1JW0A

Structure of cephalosporin acylase in complex with glutarate
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
QAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPEVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cephalosporin acylase alpha chain
publication title Structure of cephalosporin acylase in complex with glutaryl-7-aminocephalosporanic acid and glutarate: insight into the basis of its substrate specificity
pubmed doi rcsb
source organism Brevundimonas diminuta
molecule tags Hydrolase
total genus 50
structure length 152
sequence length 152
ec nomenclature ec 3.5.1.93: Glutaryl-7-aminocephalosporanic-acid acylase.
pdb deposition date 2001-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 1jw0A00
4WKUA 1AJPA 1CP9A 1GK1A 1JW0A 2WYBA 3L94A 4HSTA 3SRBA 1KEHA 4E55A 4YFBA 3SRCA 1AI6A 1GM8A 4BTHA 4YFAA 1FM2A 1AI4A 1GM7A 4K2GA 4M1JA 4PELA 2AE5A 1PNLA 1AI5A 2WYEA 4WKSA 1PNKA 1GK0A 1H2GA 1K7DA 1JX9A 1GHDA 1E3AA 4PEMA 4WKTA 2WYCA 1AI7A 2ADVA 1K5SA 2AE4A 1JVZA 4HSRA 1K5QA 1AJQA 4K2FA 3JTRA 3JTQA 1FXHA 2WYDA 3L91A 1AJNA 4WKVA 1KECA 2AE3A 1GKFA 1GK9A 3K3WA 4YF9A 3S8RA 1GM9A 1OR0A 1PNMA 3ML0A 4E56A 1FXVA 3SRAA 4E57A
chains in the Genus database with same CATH superfamily
4WKUA 1AJPA 1CP9A 1GK1A 1JW0A 2WYBA 3L94A 4HSTA 3SRBA 1KEHA 4E55A 4YFBA 3SRCA 1AI6A 1GM8A 4BTHA 4YFAA 1FM2A 1AI4A 1GM7A 4K2GA 4M1JA 4PELA 2AE5A 1PNLA 1AI5A 2WYEA 4WKSA 1PNKA 1GK0A 1H2GA 1K7DA 1JX9A 1GHDA 1E3AA 4PEMA 4WKTA 2WYCA 3FGRA 1AI7A 2ADVA 1K5SA 2AE4A 1JVZA 4HSRA 1K5QA 1AJQA 4K2FA 3JTRA 3JTQA 1FXHA 2WYDA 3L91A 1AJNA 4WKVA 1KECA 2AE3A 3FGTA 1GKFA 1GK9A 3K3WA 4YF9A 3S8RA 1GM9A 4BWCA 1OR0A 1PNMA 3ML0A 4E56A 1FXVA 3SRAA 4E57A
chains in the Genus database with same CATH topology
4WKUA 1AJPA 1CP9A 1GK1A 1JW0A 2WYBA 3L94A 4HSTA 3SRBA 1KEHA 4E55A 4YFBA 3SRCA 1AI6A 1GM8A 4BTHA 4YFAA 1FM2A 1AI4A 1GM7A 4K2GA 4M1JA 4PELA 2AE5A 1PNLA 1AI5A 2WYEA 4WKSA 1PNKA 1GK0A 1H2GA 1K7DA 1JX9A 1GHDA 1E3AA 4PEMA 4WKTA 2WYCA 1AI7A 2ADVA 1K5SA 2AE4A 1JVZA 4HSRA 1K5QA 1AJQA 4K2FA 3JTRA 3JTQA 1FXHA 2WYDA 3L91A 1AJNA 4WKVA 1KECA 2AE3A 1GKFA 1GK9A 3K3WA 4YF9A 3S8RA 1GM9A 1OR0A 1PNMA 3ML0A 4E56A 1FXVA 3SRAA 4E57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WKU A;  1AJP A;  1CP9 A;  1GK1 A;  1JW0 A;  2WYB A;  3L94 A;  4HST A;  3SRB A;  1KEH A;  4E55 A;  4YFB A;  3SRC A;  1AI6 A;  1GM8 A;  4BTH A;  4YFA A;  1FM2 A;  1AI4 A;  1GM7 A;  4K2G A;  4M1J A;  4PEL A;  2AE5 A;  1PNL A;  1AI5 A;  2WYE A;  4WKS A;  1PNK A;  1GK0 A;  1H2G A;  1K7D A;  1JX9 A;  1GHD A;  1E3A A;  4PEM A;  4WKT A;  2WYC A;  1AI7 A;  2ADV A;  1K5S A;  2AE4 A;  1JVZ A;  4HSR A;  1K5Q A;  1AJQ A;  4K2F A;  3JTR A;  3JTQ A;  1FXH A;  2WYD A;  3L91 A;  1AJN A;  4WKV A;  1KEC A;  2AE3 A;  1GKF A;  1GK9 A;  3K3W A;  4YF9 A;  3S8R A;  1GM9 A;  1OR0 A;  1PNM A;  3ML0 A;  4E56 A;  1FXV A;  3SRA A;  4E57 A; 
#chains in the Genus database with same CATH topology
 4WKU A;  1AJP A;  1CP9 A;  1GK1 A;  1JW0 A;  2WYB A;  3L94 A;  4HST A;  3SRB A;  1KEH A;  4E55 A;  4YFB A;  3SRC A;  1AI6 A;  1GM8 A;  4BTH A;  4YFA A;  1FM2 A;  1AI4 A;  1GM7 A;  4K2G A;  4M1J A;  4PEL A;  2AE5 A;  1PNL A;  1AI5 A;  2WYE A;  4WKS A;  1PNK A;  1GK0 A;  1H2G A;  1K7D A;  1JX9 A;  1GHD A;  1E3A A;  4PEM A;  4WKT A;  2WYC A;  3FGR A;  1AI7 A;  2ADV A;  1K5S A;  2AE4 A;  1JVZ A;  4HSR A;  1K5Q A;  1AJQ A;  4K2F A;  3JTR A;  3JTQ A;  1FXH A;  2WYD A;  3L91 A;  1AJN A;  4WKV A;  1KEC A;  2AE3 A;  3FGT A;  1GKF A;  1GK9 A;  3K3W A;  4YF9 A;  3S8R A;  1GM9 A;  4BWC A;  1OR0 A;  1PNM A;  3ML0 A;  4E56 A;  1FXV A;  3SRA A;  4E57 A; 
#chains in the Genus database with same CATH homology
 4WKU A;  1AJP A;  1CP9 A;  1GK1 A;  1JW0 A;  2WYB A;  3L94 A;  4HST A;  3SRB A;  1KEH A;  4E55 A;  4YFB A;  3SRC A;  1AI6 A;  1GM8 A;  4BTH A;  4YFA A;  1FM2 A;  1AI4 A;  1GM7 A;  4K2G A;  4M1J A;  4PEL A;  2AE5 A;  1PNL A;  1AI5 A;  2WYE A;  4WKS A;  1PNK A;  1GK0 A;  1H2G A;  1K7D A;  1JX9 A;  1GHD A;  1E3A A;  4PEM A;  4WKT A;  2WYC A;  1AI7 A;  2ADV A;  1K5S A;  2AE4 A;  1JVZ A;  4HSR A;  1K5Q A;  1AJQ A;  4K2F A;  3JTR A;  3JTQ A;  1FXH A;  2WYD A;  3L91 A;  1AJN A;  4WKV A;  1KEC A;  2AE3 A;  1GKF A;  1GK9 A;  3K3W A;  4YF9 A;  3S8R A;  1GM9 A;  1OR0 A;  1PNM A;  3ML0 A;  4E56 A;  1FXV A;  3SRA A;  4E57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...