4WKVA

N-alkylboronic acid inhibitors reveal determinants of ligand specificity in the quorum-quenching and siderophore biosynthetic enzyme pvdq
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-homoserine lactone acylase PvdQ
publication title n-Alkylboronic Acid Inhibitors Reveal Determinants of Ligand Specificity in the Quorum-Quenching and Siderophore Biosynthetic Enzyme PvdQ.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 164
sequence length 164
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2014-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4wkvA00
1GKFA 1FXHA 4YF9A 1AJPA 1KEHA 2WYBA 4K2GA 4BTHA 2ADVA 2WYEA 2AE5A 3JTRA 1PNLA 1JW0A 1JX9A 3L94A 4E57A 3SRAA 1AI7A 1FXVA 1E3AA 1GM7A 3ML0A 4K2FA 1GM8A 1AJNA 1AJQA 4E56A 1AI5A 3L91A 1GHDA 4WKVA 4WKUA 4YFAA 4E55A 1PNMA 4HSRA 1GK1A 1K7DA 1GK9A 1GK0A 1OR0A 1AI6A 3SRCA 1CP9A 2AE4A 2WYDA 3K3WA 4HSTA 1GM9A 1AI4A 4PEMA 4WKTA 2AE3A 1KECA 2WYCA 4PELA 1PNKA 3JTQA 1JVZA 3SRBA 4YFBA 1FM2A 4WKSA 3S8RA 1K5QA 4M1JA 1K5SA 1H2GA
chains in the Genus database with same CATH superfamily
1GKFA 1FXHA 4YF9A 1AJPA 1KEHA 2WYBA 4K2GA 4BTHA 2ADVA 2WYEA 2AE5A 3JTRA 1PNLA 1JW0A 1JX9A 3L94A 4E57A 3SRAA 1AI7A 1FXVA 1E3AA 1GM7A 3ML0A 4K2FA 1GM8A 1AJNA 1AJQA 4E56A 1AI5A 3L91A 1GHDA 4WKVA 4WKUA 4YFAA 4E55A 1PNMA 4HSRA 1GK1A 3FGTA 1K7DA 1GK9A 1GK0A 1OR0A 1AI6A 3SRCA 1CP9A 2AE4A 2WYDA 3K3WA 4HSTA 1GM9A 1AI4A 4PEMA 4WKTA 2AE3A 3FGRA 1KECA 2WYCA 4PELA 1PNKA 3JTQA 1JVZA 3SRBA 4YFBA 1FM2A 4WKSA 3S8RA 1K5QA 4BWCA 4M1JA 1K5SA 1H2GA
chains in the Genus database with same CATH topology
1GKFA 1FXHA 4YF9A 1AJPA 1KEHA 2WYBA 4K2GA 4BTHA 2ADVA 2WYEA 2AE5A 3JTRA 1PNLA 1JW0A 1JX9A 3L94A 4E57A 3SRAA 1AI7A 1FXVA 1E3AA 1GM7A 3ML0A 4K2FA 1GM8A 1AJNA 1AJQA 4E56A 1AI5A 3L91A 1GHDA 4WKVA 4WKUA 4YFAA 4E55A 1PNMA 4HSRA 1GK1A 1K7DA 1GK9A 1GK0A 1OR0A 1AI6A 3SRCA 1CP9A 2AE4A 2WYDA 3K3WA 4HSTA 1GM9A 1AI4A 4PEMA 4WKTA 2AE3A 1KECA 2WYCA 4PELA 1PNKA 3JTQA 1JVZA 3SRBA 4YFBA 1FM2A 4WKSA 3S8RA 1K5QA 4M1JA 1K5SA 1H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKF A;  1FXH A;  4YF9 A;  1AJP A;  1KEH A;  2WYB A;  4K2G A;  4BTH A;  2ADV A;  2WYE A;  2AE5 A;  3JTR A;  1PNL A;  1JW0 A;  1JX9 A;  3L94 A;  4E57 A;  3SRA A;  1AI7 A;  1FXV A;  1E3A A;  1GM7 A;  3ML0 A;  4K2F A;  1GM8 A;  1AJN A;  1AJQ A;  4E56 A;  1AI5 A;  3L91 A;  1GHD A;  4WKV A;  4WKU A;  4YFA A;  4E55 A;  1PNM A;  4HSR A;  1GK1 A;  1K7D A;  1GK9 A;  1GK0 A;  1OR0 A;  1AI6 A;  3SRC A;  1CP9 A;  2AE4 A;  2WYD A;  3K3W A;  4HST A;  1GM9 A;  1AI4 A;  4PEM A;  4WKT A;  2AE3 A;  1KEC A;  2WYC A;  4PEL A;  1PNK A;  3JTQ A;  1JVZ A;  3SRB A;  4YFB A;  1FM2 A;  4WKS A;  3S8R A;  1K5Q A;  4M1J A;  1K5S A;  1H2G A; 
#chains in the Genus database with same CATH topology
 1GKF A;  1FXH A;  4YF9 A;  1AJP A;  1KEH A;  2WYB A;  4K2G A;  4BTH A;  2ADV A;  2WYE A;  2AE5 A;  3JTR A;  1PNL A;  1JW0 A;  1JX9 A;  3L94 A;  4E57 A;  3SRA A;  1AI7 A;  1FXV A;  1E3A A;  1GM7 A;  3ML0 A;  4K2F A;  1GM8 A;  1AJN A;  1AJQ A;  4E56 A;  1AI5 A;  3L91 A;  1GHD A;  4WKV A;  4WKU A;  4YFA A;  4E55 A;  1PNM A;  4HSR A;  1GK1 A;  3FGT A;  1K7D A;  1GK9 A;  1GK0 A;  1OR0 A;  1AI6 A;  3SRC A;  1CP9 A;  2AE4 A;  2WYD A;  3K3W A;  4HST A;  1GM9 A;  1AI4 A;  4PEM A;  4WKT A;  2AE3 A;  3FGR A;  1KEC A;  2WYC A;  4PEL A;  1PNK A;  3JTQ A;  1JVZ A;  3SRB A;  4YFB A;  1FM2 A;  4WKS A;  3S8R A;  1K5Q A;  4BWC A;  4M1J A;  1K5S A;  1H2G A; 
#chains in the Genus database with same CATH homology
 1GKF A;  1FXH A;  4YF9 A;  1AJP A;  1KEH A;  2WYB A;  4K2G A;  4BTH A;  2ADV A;  2WYE A;  2AE5 A;  3JTR A;  1PNL A;  1JW0 A;  1JX9 A;  3L94 A;  4E57 A;  3SRA A;  1AI7 A;  1FXV A;  1E3A A;  1GM7 A;  3ML0 A;  4K2F A;  1GM8 A;  1AJN A;  1AJQ A;  4E56 A;  1AI5 A;  3L91 A;  1GHD A;  4WKV A;  4WKU A;  4YFA A;  4E55 A;  1PNM A;  4HSR A;  1GK1 A;  1K7D A;  1GK9 A;  1GK0 A;  1OR0 A;  1AI6 A;  3SRC A;  1CP9 A;  2AE4 A;  2WYD A;  3K3W A;  4HST A;  1GM9 A;  1AI4 A;  4PEM A;  4WKT A;  2AE3 A;  1KEC A;  2WYC A;  4PEL A;  1PNK A;  3JTQ A;  1JVZ A;  3SRB A;  4YFB A;  1FM2 A;  4WKS A;  3S8R A;  1K5Q A;  4M1J A;  1K5S A;  1H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...