3ML0A

Thermostable penicillin g acylase from alcaligenes faecalis in tetragonal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
molecule tags Hydrolase
molecule keywords Penicillin G acylase, alpha subunit
total genus 40
structure length 195
sequence length 195
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ml0A02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3ml0A01
3L94A 1GM7A 1E3AA 1JW0A 1AI6A 3K3WA 3S8RA 1GM9A 4YFAA 4E55A 4PELA 1PNKA 1AI4A 1KECA 1KEHA 2WYCA 1AI5A 1FXVA 4HSTA 4YFBA 3SRBA 1AJNA 4PEMA 1AJQA 3ML0A 2ADVA 3SRAA 1GHDA 1JX9A 1OR0A 4HSRA 4E56A 1PNMA 1CP9A 2AE5A 1PNLA 3L91A 2AE4A 4WKSA 4E57A 4WKTA 1JVZA 1K7DA 1FM2A 1AJPA 1AI7A 1FXHA 1GKFA 2WYBA 4YF9A 4M1JA 4K2GA 1GM8A 2AE3A 2WYDA 1GK0A 1H2GA 1GK1A 1K5SA 2WYEA 3JTRA 4K2FA 4WKVA 1GK9A 3JTQA 4WKUA 1K5QA 4BTHA 3SRCA
chains in the Genus database with same CATH superfamily
3ZRWA 1TUBA 3K08A 4DUZB 1YTFB 4FZ0A 3LSUA 4IYIA 2IW5A 1BSMA 1QVGU 3D8CA 3E86A 1OR0A 2QWNB 3UT5B 5K1PA 1FXKA 4CH6A 1B3QA 1WB7A 1FM2A 3BRCA 1G1XB 1I7FA 2FL4A 2EULA 2E5LO 3SPCA 1EZJA 3UM7A 3ZMZA 1GM7A 1AI6A 1MOFA 2R9RB 4UV8A 5AG2A 4AHCA 3ZRVA 4CS2A 4ZHQB 3L71H 1NJIW 3JD4A 1SS3A 1I5YA 2LO1A 2NNUA 1BHBA 4TT3G 3VOUA 1WPXA 5JQGB 3GWOA 4RUFA 2ZKOA 3ZRSA 2YI8A 4FLYA 3CX5F 1IBKO 2VWJA 3RYIA 1JPXA 4X64B 1Y76B 4JI0B 4AI8A 2XASA 4QJFB 5GW7A 1RPRA 5KA6A 4BW5A 4X1YB 2OCCC 4NTWA 1EFRG 3ZN1A 1VQLV 1FPOA 2YUAA 1S77D 3P32A 1N0JA 1YEWA 4LWSA 3I56V 1B06A 4KP4A 5B1BB 1XI1A 1NTZH 1ENVA 3RWRD 4AILC 4HSTA 2BTOA 1Z2GA 2XAHA 1D5AA 2VQFO 5HFLA 2EILB 5HFMA 5BR8B 1NTMH 4UFZA 4B3MO 1QBZA 2YXYA 1V54C 4LH7A 1BHAA 2RCVA 4J10A 4J11A 2AE3A 3Q4HA 4WFGA 2ITCC 4J7JA 4TUYB 3RYHB 1HR0O 3ZJZA 2A06H 3JAMN 1WB8A 1MSWD 2WYCA 1YIJV 4X65B 1VF6A 5IY5B 3AG4B 3EXAA 4DRXB 2E5LB 1VQ7V 5B1AB 1PD3A 4O4JA 3VBBA 3D36A 5JH7A 4KFMA 1EBOA 2AW9A 3CCUV 2YDEA 3ABMC 3CHXA 3CC7V 1YJWV 4MVUA 4O4IB 1CPYA 2ZQMA 1YSCA 2CTPA 3RYFA 3QO8A 4GX0A 1IXBA 5C93A 2LJ2A 1AR1B 2HP8A 3FAVB 1HNZO 3CWBH 5CA0B 2YIBD 3W7UA 2CGNA 2KSDA 1KYOF 1F51A 1K5SA 3MD0A 3M8AA 4QE9A 4UCTA 3HKEA 5KMGB 3CCSV 2R9IA 3GWKC 4GT1A 1K97A 3C3SA 2YS8A 3UQ8A 1QNMA 1XNQO 5KX5B 5IJ9A 4YF9A 2JDIG 1BQ0A 1KB9F 1BQZA 3A8TA 1JCHA 4LFBO 3JALA 1ZUQA 3KZIZ 2BTQB 4B3RO 1RM1C 2AGAA 1WA8B 4K0KB 4YFAA 1KECA 4FLXA 4HYOA 3ZMUA 2JK5C 1XBLA 1FFXA 2V1DA 5CBHA 3BY6A 1P84F 1M56B 3CCLV 2JIZG 3CS5A 3OTOB 5EZYA 2WLLA 4HBNA 3K0DA 2HHHB 2ZIMA 4DW1A 3OGCC 4LF4B 3WB2A 3ASOC 4B3RB 5GONA 1Q86W 4QPJA 5DN6G 4RWUA 1XMOO 3CCRV 5EBWC 1H2LA 2Q4PA 2JGDA 2Q6AA 5B5EZ 3FGRA 3CP1A 2E76B 3QO5A 4B3SB 2OWOA 3TXSA 4FM2A 1QVFU 5CA1B 1Q5OA 2UXNA 1PL0A 2ZDIA 2VQEB 4JYCA 4JYYA 2OCCB 3CMAV 1KMIZ 4YJ3A 2ZM6O 1KP2A 1AROP 5KMGA 1QQCA 1Q7YW 5CBGA 1M1KW 4P30A 4O2AA 1IBMO 2VRZA 2PYJA 4J41A 1OZ0A 3X2QC 2UUCO 4TOIA 1OJHA 1SQFA 3ZS8C 1PV0A 5BY1A 2BCCH 4DR7B 5EIBC 3L9DA 3JAKB 3S3WA 3AK3A 2M6YA 4WCEV 4PJ0Z 4NTYA 4FM0A 1PKXA 4LCUC 4W4KA 2Z3YA 3O65A 1H2SB 4WFFA 4O4JB 1SQVH 4XDLA 3ASOB 1X59A 4YJ2A 3ZHTA 1UFIA 3TETA 4MTFA 1H38A 2JGDB 2NN4A 1WLEA 2F4VB 5GTHZ 1IXMA 4WFEA 3OMIB 2QTSA 4YHHO 1E1QG 1OCCC 1PPJH 4FLUA 3OTFA 2HKOA 5E1AC 4R8CA 5LA6B 1CXZB 1MG1A 4U7OA 2DOSA 1FS0G 4AQYO 3D3QA 4FLVA 2PZSA 4MVOA 2JS5A 1M5IA 4JTCB 3I55V 4DUYO 3KG2A 1VQ9V 2ZE5A 2G38A 4J7ZA 1AJNA 2UXCB 3SJBC 4U3JB 5L3FA 1JVMA 1E79G 2Q0AA 1GRJA 4I0XA 4LF8O 1H8EG 2LFRA 3CC2V 4CZZA 2NLJC 4A5UB 3SGIA 3SPJA 1R6KA 1IBKB 2X7RB 4N21A 4KXRA 1R1BA 2EIJC 3DC6A 4X62B 1HNWB 5IJ0B 1UPGA 4QIWF 3ZHRA 1DF5A 5LA6A 3EFFK 4FLZA 4JI3B 1W0KG 5LP6C 4B3TO 2PF4E 3CRAA 2BOBC 2QSAA 1XQ8A 3OFNG 3AG3C 2OTLV 4UCRA 2F43G 2JJ1G 5K1XA 5IWAB 2LW1A 5KAFZ 1M57C 4X66O 1QLNA 4FLWA 1VEWA 3A2FA 4ZI7B 2Y69B 1XL6A 3AG7A 3BPZA 1HW7A 1K8AW 2XAFA 5H6QA 4X62O 1HDJA 2DYSB 3BHPA 4RAIA 1JMKC 5KHGA 1Q81W 4UCOA 3FYEB 3ABKC 4PA6A 4O4HB 4X20A 4WFBV 4JV5O 1BMFG 2DJVA 4CS4A 2QDOA 3O9OA 3RBZA 4CBCA 1Y74B 4EFBA 1VARA 3K57A 4WKSA 3LDEA 1AJPA 1JFFA 2IH3C 1FXKC 2GHYA 4MTOA 2WYEA 3HKEB 2GV9A 4EB6A 1VF5B 2PYLA 3K3WA 1DLBA 1ZLZA 2UUCB 2UXDO 4J80A 2Q7GA 5EIBD 4DR6O 1FXKB 5B1NA 1OCRB 4WFAV 4DR1O 1ZL8B 4PDRA 3AG1C 2ZXWC 3LNNA 1HNZB 4JI5O 2GUZB 4LF6B 1AILA 5H2FZ 4U7NA 4MT8A 4BIOA 4UUJC 1N36B 4GCZA 3E2EA 2LQTA 1YTFD 1XDCA 5LP6B 2IJHA 3K58A 3ABMB 4BR6A 1VF7A 1XHXA 4QE7A 2E74B 3T1HB 4YY3O 3G71V 1QR8A 3B8NA 3S3XA 3B2EE 4I55B 4LNUA 2E3CA 3KKYA 3E22A 1YF2A 2DW4A 3IFXA 2Y48A 3JASB 2RN9A 1N32O 1R3JC 1N34O 5B1BC 2CH7A 3AG2B 1IX9A 4MTGA 3SYQA 5ITZB 4BWCA 4D7SA 1WPBA 4LFCO 5DEDA 3QTCA 5BXZA 3CB2A 4LWSB 2EJRA 5LL6Y 2OTJV 3SJAC 2Q0OC 2XUMA 2ATKC 4JPRA 1L1FA 1PP9H 5L3DA 1VQMV 2V7QG 3ETGA 3LDCA 1Q90D 2ADPA 1P49A 4MVZA 1W0JG 1MZEA 3AG1B 3SYAA 1KKDA 3JCZA 1SZTA 3JD0A 2ETNA 4DYLA 4JAUA 4Z1VA 3Q4HB 1QLEB 4LF9B 1MZFA 1KUQA 3JTQA 3TK1A 3OUFA 2BOCC 1E3AA 4JI1O 5JH7B 4EFEA 3RYFB 1UJWB 2RDCA 3N2KB 1TAEA 5IWAO 4DV6B 2IU3A 3CPWU 3F7YC 2QKAA 2RNBA 3JD3A 1D5NA 4PA9A 1R6TA 2A7WA 4X9QA 4NXNB 1BZKA 1RSOA 3QNEA 4DRXA 4BTHA 2QWPB 3OMNB 3J80N 3FKSG 4MVMA 5JVDA 2WLHA 4DV4O 4MW3A 3X2QB 4DV0O 3ABTA 1I94B 3RGBA 3A0HZ 2WYBA 3WB0A 2WLIA 5C8YA 4X1IB 3JD2A 1VQ5V 1GK9A 4J7KA 3CE2A 4UV9A 4O4LB 4I9WA 3S8RA 3OE7G 4X88A 2PUSA 4X1KA 3CC4V 5LP6A 4H33A 3A0RA 4YXWG 3OM3B 1GHDA 2EINB 4X1KB 1LR1A 3E8HA 2ZXWB 5B1AC 4RO2A 3APOA 3ZHQA 4LFBB 3CCMV 4K2FA 1SZXA 5CA0A 1XMQO 2KG7B 2QGNA 5H9CA 3BFRA 4NVPA 1N36O 2IJJA 2VS0A 3ZX6A 3F7VC 4TV9B 3P30A 4DV1B 3MHSC 3BAAA 1DGSA 3K5NA 3OMAB 1JA8A 2Y0IA 2WPDG 1I08A 3HB3B 1AP5A 3HKBB 4XBFA 2EIKC 5CA1A 4MVQA 3HPLC 3ZHUA 2FMLA 5JJJB 1Q3EA 1U97A 1A32A 1Y74A 4K35A 2GUZA 5D5QA 2QKSA 3OR7C 3SRBA 5IYZA 1AVMA 1EN4A 5BMVB 2Q8VA 3SR2C 5CN0A 4JI6B 4JGSA 1OCCB 3QF7A 3LSQA 2PTMA 5DECA 5JVDB 4DR2O 4I50A 1R6NA 2LFSA 1NR7A 2QKCA 4G28B 3D36C 3FYIB 2DN9A 1R3LC 1OCOC 1BE3H 1IBLO 4Q6GA 4EB6B 3BVOA 2IM9A 4ZOLA 1F4MA 4PA7A 1GKFA 3ETQA 2Y4TA 5IT9N 4JTAB 3FB6C 4DR3B 1IBMB 1ZX3A 2KB1A 3E8FA 1HP8A 4FK5C 2ZIOA 2Q69A 1BGYH 4GYCB 2QR4A 2HVJC 1VQOV 4PEMA 2AHYA 1IURA 1FD9A 2AZ0A 2XNDG 5EC2C 2QWRB 2OCHA 2LP7A 3OEEG 4NYKA 3RVYA 4I4TB 4DV7O 1NH2B 4LR3A 2L35A 2DE0X 3IAYA 3G80A 4F4LA 3RVZA 2IJIA 1VQPV 1I5XA 3TGUH 4PHZA 4UCSA 4PELA 1VIBA 3LSSA 4JASA 4LH6A 1VP7A 2EIKB 2X6AA 2YXLA 4DV0B 4E56A 1Q6IA 1OCRC 1ORQC 5JCOA 3UO3A 2YXHA 1YVWA 1GK0A 4N23A 1WP7A 5LYJA 1XHZA 3SJCC 4JYAO 4FVMA 3A0BZ 3ABUA 1FAFA 5EBMC 2RJZA 3H1LH 3STZC 1MNGA 5L3CA 1WN7A 1Q43A 3WG7B 4U3JA 3L91A 4B7EA 4D6TH 2NR5A 2DYRB 2K1EA 4UCVA 3OW2U 3K04A 1O9HA 1H2GA 3LNMB 5D5PA 3E8BA 4WKUA 3OR6C 3SJQC 2ILMA 2UXBB 2WA3A 1U96A 4CH5A 1H8HG 1NT2B 1Y6XA 3VQXA 1M9NA 1GN4A 2EX3A 1GO3F 4K3AA 1FXHA 3CJHB 1DTOA 4OX9B 2Y4UA 5JWPA 1I0HA 3WG7C 5KX5A 4W4LA 1KP3A 2P90A 4NKGB 3HKDA 3ZMSA 4UVCA 2P22C 2CTRA 2GDSA 4HNAB 1SETA 1XOUA 1KEHA 4O2BA 1QR9A 1LNQA 4NXMB 1XILA 3ZMVA 5KUMA 5FLXN 4P9PA 2PI4A 2LW7A 1KU9A 3MHHC 2ZNJA 4JI6O 4RQFA 3RYCA 1BT8A 4CC5A 3CXCU 4YIPA 1R3IC 4FZ1A 3MDSA 3C90A 1MA1A 2EINC 4IIJB 4GUNA 1THZA 1OHHG 3H9VA 2ZD9A 2Q9LA 5LMNB 1VQ8V 4I0XB 3H01A 2Q5ZA 5CMUA 1H2NA 2Z5UA 2Q68A 3SDLA 2FB5A 4KUMA 4TV8A 3CCVV 2WLLB 4DV3B 4M1JA 3AG4C 1J5EB 2QWQB 3AK2A 1GM8A 1RSOB 3ZCCA 1KD1W 4L8JA 1LUVA 3JSLA 1GN2A 1SQPH 1K9MW 4XDJA 2VWKA 1SA0A 2DQ0A 5EK0A 4DV5O 1GMGA 1I94O 1V55B 4JTDB 1BS3A 1GN6A 5E79Z 3B4SA 5IYZB 2KQXA 1TGOA 2WYDA 5H6RA 4OGQB 2QTOA 2YEVB 1OV9A 5IE9A 5IJ9B 4UXNA 1KKCA 3FB7C 4DV3O 2EJ7A 4LC1A 1QCEA 3J7AU 3CRCA 3RN4A 4DV2O 4FFBB 1PNMA 4UB8Z 4YJ2B 1WP8A 4FJCC 4J42A 3SPGA 3T1HO 2Q67A 2ZDIC 1NBMG 3WFVA 4GX5A 1NU1H 1YITV 2YIAA 1YCIA 5L3GA 4CS3A 5ITZA 5B3SB 3T2MA 3VQWA 2IBZH 1JJOA 3ABLC 4GKJO 3B8MA 1QHTA 1RM1B 3L74H 3ZHSA 1L8DA 3BEHA 4IYHA 4IIJA 2H8PC 3K0GA 3ZRXA 3CYOA 1Y4MA 2QM4A 2DWDC 2WLNA 1AR5A 4B3TB 3SPHA 2BE3A 1R73A 4E4EA 2XHBA 2N04A 4GX1A 1GTOA 1PNKA 2WLIB 3F5TA 4ICGA 4ZKIA 5C8YB 1AI5A 1BL8A 2P4KA 4CH4A 2P4VA 4HNAA 2HJFC 4F6RB 1V54B 4K0KO 3PJSK 1V55C 3RYHA 3UO2A 1NR1A 3ZIAG 3C3TA 3E8GA 4O4IA 4LF9O 4ZIBA 1ROPA 2F1MA 1JW0A 4O2AB 3UT5A 3FB8C 4WBNA 2QM8A 2A9HA 5LXTA 4I9QA 2A3QA 3EHBB 2R70A 4MTXA 3JD1A 2DMXA 1M4UA 4HZ3A 1HNXB 3SPIA 5DM6V 2XAGA 2JS3A 4K2GA 1S5HC 3BABA 3P3PA 4JZ2A 3CEIA 4TUYA 1ZTEA 3FX7A 4I50B 5LMNO 1SQQH 3EVKA 2A0LA 1FFXB 1EZVH 3I5DA 3L70H 2EBOA 4YHHB 1VMGA 1VQ6V 2JEXA 3J81N 3TCUA 2UXDB 4PD4F 2UUAB 4H37A 4DW0A 3N27A 4MSWC 3CCQV 3ZBHA 3G6BA 3JAWA 5JJEB 4JZGA 2F23A 4O4LA 2M7WA 4CH3A 3L94A 4BIUA 5A2QN 1VF6C 3QO7A 1FYJA 2CGOA 5LGTA 4J9YB 4JAAA 2OIGA 2DWEC 5FPRA 3JYCA 5FNVA 4MW8A 1YHQV 2YIBA 3JARA 2F66C 1Z5WA 2WA4A 3GB7C 4PI2A 4I4TA 4DR4B 1O9GA 1L0NH 1MSDA 1RP3B 4JYBA 4IHJB 2W0FC 1W2BU 3CCEV 2PY5A 2Z0AA 2YIDA 4JAVA 4P2ZA 2AXTZ 4DV4B 4LP8A 2OT5A 3OD4A 4KHPB 5H5NA 1BCCH 2AHZA 2HEPA 3K9SA 1NQTA 2OYQA 4PI0A 3E83A 3N2KA 4LF5B 1M90W 2YC0A 4R6ZA 3ZHVA 3OGIB 4TSFG 3W7TA 3DSQA 2ADQB 2VQEO 2XAJA 3HKCB 1PNLA 1P7BA 3K06A 1GH6A 1TUBB 1TVKB 1EM1A 3K5MA 2CTWA 3JATA 3SRCA 4DK1A 5FNVB 4JI1B 3OT7A 5KHJA 2Y0PA 4YIOA 2DYSC 3DGEA 3SRAA 1AR4A 4HAMA 1WAZA 4B3MB 1XNRO 2GSMB 3JASA 4KL1A 4DV2B 5LGNA 2CE4A 1FFTB 1DF4A 5J2TA 3JAKA 1Y76A 5JCOC 4B3SO 2B1IA 1YDXA 2FKXA 3B77A 3SYPA 4LFAB 2ZE8A 4UCUA 2DQ3A 2UXBO 4LF6O 1V9PA 4GKKB 4NB5A 4DR1B 3L75H 4O2BB 5A9GA 2WSSG 1Q82W 4GX2A 4X64O 3W7XA 4Z1MG 5KA5A 4CC6A 4YJ3B 4WF9V 2QEXV 1TVKA 3TXQA 3DXRB 3FAVA 1PL4A 1RPOA 2C2AA 4GKKO 5IYBO 3RYIB 5J2UA 1EN6A 4NXNO 4F6EA 4ASUG 4LNUB 4I5SA 5TISZ 3RFRA 4DR5O 1NVPB 4YFBA 2CK3G 3DXRA 2E75B 2ITDC 2LGWA 2W0XA 2B5UA 2KKWA 1E1RG 2ARHA 3H1IH 3RT3C 3T1CA 2P6JA 2DYRC 5IYCO 4BW9A 1HR0B 4DR6B 1X4TA 3N2GA 3QG5A 2KG7A 1H2MA 4B7KA 2XTAA 4DUYB 2QA4V 3U11A 5CA3A 3LUTB 4K8ZA 4JI2O 1P7GA 4JI8B 1WA8A 4BIZA 4F6RA 3UCSC 4GKJB 2WLJA 3OUSA 2QWOB 3IC9A 2WWWA 4QPKA 1S0VA 5KAIZ 1KBHA 3RYCB 4I55A 2HVKC 4LF8B 3STLC 4JV5B 3MAQA 4MS2A 5CB4A 1P4RA 4JYAB 2HLDG 5CBFA 1XREA 4LFAO 3ABKB 2BSKB 5CB4B 3G67A 5IYDO 2N05A 1XMOB 1K33A 4GLXA 1B6QA 2QE7G 1TA8A 3UKMA 2UU9O 4IHJA 3B40A 2WLMA 4DO2A 1T5EA 4QNHB 1MMMA 2W6IG 3H1JH 4C7UA 1NVPD 3D3IA 1MABG 3KCXA 4UB6Z 1AI7A 4DK0A 2ZT9B 1G8MA 1HNXO 1SQXH 4TQFA 4L87A 3K79A 3VQYA 1OCZC 3SYOA 3CXHF 4TV8B 1OCOB 4ZBMA 4BAYA 4H0LB 2PGGA 1G4YB 2UUBB 3DC5A 2B9ZA 4DR7O 3RW0A 4E2LA 1B04A 2X6CA 3CRMA 2H94A 3JATB 5EBLC 4KHPO 5BMVA 4LF5O 1SKVA 4TWKA 3FGTA 4JI2B 4JI8O 3T1YO 2IU0A 5B66Z 1F4NA 1SA0B 2K9PA 3ML0A 5KHIA 4DR3O 1JOYA 4G27B 3M7MX 2HJDA 1XEQA 1WJZA 4WFHA 4PDLA 3CMEV 3F5WC 3BCCH 4DR4O 5FL7G 4PDVA 1WNSA 3B09A 2X0LA 2CUGA 4U3FH 4J9ZB 1Y66A 2A79B 1H2KA 1CEZA 3ZN0A 3T1YB 2ODMA 4NTXA 4JI4O 2Q7EA 3QVNA 4PA4A 2P67A 4FLTA 3WU2Z 4YY3B 1URFA 1Z5VA 4X8AA 4EKWA 2JJ2G 4K8XA 2ZR2A 3IGAC 2XAQA 3TJTA 4RQEA 3FB5C 1K3EA 1SESA 3HKDB 1DK1A 2OIEA 2LGQA 2Q73A 4DXWA 4LF4O 2YI9A 1ZAUA 3JAWB 4X1IA 4GZRB 4HSRA 1VQKV 1IVSA 2ZE7A 1K7DA 2UXXA 5LYJB 1Q8IA 2Y69C 4H13B 4IT5A 3E89A 5IJ0A 2F95B 1M57B 1K5QA 2H3OA 3E22B 4JI3O 5LMUB 3SYCA 1SF9A 1S72V 5EYPA 3K5OA 1K92A 1Y67A 1F7YA 2RMKB 3R65A 1ZSPA 1JR9A 4UVAA 2Q7HA 2XOKG 4DV7B 4JI5B 3H1KH 3VQVA 5LXTB 3K5LA 3APQA 3JSNA 2CAZC 4PA3A 2UU9B 1NTKH 5KHKA 3ZMTA 5J9PC 4PV1B 3P3NA 3ETEA 1N4CA 4MVSA 5LMUO 2O57A 4WBNB 2R72A 4O4HA 3OTOO 2ZNIA 4OPAA 4G2KA 1K4CC 3ICXA 3PN1A 5BR8O 4DV6O 1GN3A 2MK3A 2YICA 4OXSA 4JI4B 5BZBA 3AK1A 3OAAG 1AP6A 4FFBA 2FYUH 1JQ0A 4Z2WA 2P06A 1K73W 5LOVB 5LHIA 2X6BA 4X65O 2EZOA 2L6LA 4X20B 3K9AA 1FKAO 5LHHA 2EIJB 1XUQA 1GK1A 2HFEC 3L73H 1IZ3A 3JALB 1L0LH 1J95A 3NR7A 4DR5B 1QU7A 5JJNB 3ZEDA 4FPPA 4ZOLB 1OCZB 5GONB 4I7ZB 2EIMB 1CP9A 1JJ2U 5LOVA 3ETDA 1M56C 4OX9O 4P9OA 2W6JG 1NS1A 2CDYA 4DUZO 4LF7O 4MVRA 2EILC 1S5JA 2CTQA 4R7CA 1TUEB 3FD9A 4DV5B 1W59A 1GM9A 1Q6HA 4E55A 3IJ4A 4X89A 1QLEC 1US6A 3CSXA 4TV9A 2GTSA 2VQFB 4PDMA 4DV1O 1ZL8A 1SERA 2D3OW 1K4DC 3HKCA 1RFYA 3E35A 1N33O 5LHGA 2YEVA 4FFKA 1K34A 1HNWO 2ZCEA 3AEIA 2JEUA 3JTRA 2WAMA 1FJGO 5GTIZ 2F4VO 3ABLB 4LFCB 1SRYA 2UUBO 5EC1C 1D2DA 2MW2B 4AQYB 1SC5B 1JFFB 2QJ1A 4X66B 3LDDA 1M93A 4B08A 3FFQA 3G6EV 1YI2V 3U0ZA 1XNRB 3L72H 2IJKA 1NH2D 3CD6V 3ASNC 1PM9A 1XL4A 1SQBH 2JGUA 4X1YA 2D2CB 3CRQA 5JQGA 2N74A 2CH7B 4FIPC 3JARB 1HWYA 2WLKA 1FJGB 2AZ2A 1Q6UA 1JX9A 4NXMO 2AE5A 5J2TB 2BTQA 1JVZA 2BSKA 4R50A 4Q20A 1F23A 3N2GB 5L3BA 2GTAA 1R3KC 2EZPA 3JCUZ 1AB3A 2FTKA 2YSUB 4XDKA 3K03A 1N8RW 1GAXA 1S3JA 3AG3B 2HG5C 4FM1A 1AJQA 3CJHA 2P7TC 3DTUB 4WKTA 2V4DA 4BWAA 4LF7B 1KC8W 2GBOA 4UVBA 1YJNV 1NZ6A 1SQGA 5IY5C 2EIMC 5J2UB 3AG2C 3H1HH 3T4ZA 5LGUA 4QGPA 5IDJA 4ABMA 3M99B 2ZM6B 2HR3A 1FXVA 3W7SA 3U10A 1NKDA 4ZHQA 5KLVH 4DR2B 1S5LZ 2ZR3A 3ZRWB 2AE4A 2JRIA 3T4DA 1YXBA 3ASNB 3BA9A 3G4SV 4JI7O 1IDSA 2UUAO 3BA8A 2IH1C 5EYPB 1ZWIC 1N0NA 1N32B 3W7WA 2HHHO 1XMQB 4IGGA 5KUKA 4FMTA 1N34B 5FPOA 5B1OA 1YJ9V 2R9AA 2JVDA 3IC7A 5F2VO 4OPHA 1VQNV 3KCYA 3HR0A 1XNQB 4WKVA 3OEHG 5EZYB 2ZINA 5B3SC 2F93B 4ZI7A 4JI7B 5L3EA 3WB1A 3HKBA 1AI4A 2ZE6A 2ADVA 4RUEA 1NI8A 1LUWA 4LBEC 1J5EO 3CRRA 1VQ4V 1G6UA 2XT9A 1N33B 3K59A 1KQSU 4JI0O 4D7TA 2UXCO 4EEQA 2PI5A 2QM7A 4TQDA 3GVMA 3CCJV 2P5OA 1COWG 5KHHA 1IBLB 1S76D 3NXSA 3R66A 4H44B 4E57A 5LBQA 1EN5A 3THOA 4JF3A 2RQ6A 1YZBA 4IL6Z 2B1GA 4NR1A
chains in the Genus database with same CATH topology
3ZRWA 3K3WA 1OCOB 1DLBA 3K08A 4ZBMA 1YTFB 4BAYA 1K9MW 1G4YB 4XDJA 2IW5A 1QVGU 2DQ0A 5EK0A 3E86A 1GMGA 1OR0A 3RW0A 4E2LA 1FXKA 1FXKB 2X6CA 5B1NA 1V55B 4JTDB 2H94A 1OCRB 4WFAV 5EBLC 1FM2A 4PDRA 3AG1C 2ZXWC 4TWKA 3SPCA 1EZJA 2WYDA 4U7NA 4MT8A 5H6RA 2QTOA 2YEVB 3UM7A 4UXNA 3ZMZA 1GM7A 3FB7C 1AI6A 1MOFA 2R9RB 4GCZA 4UUJC 4LC1A 4UV8A 2IU0A 1F4NA 3E2EA 1YTFD 1QCEA 3ML0A 2IJHA 3ABMB 3ZRVA 1PNMA 4G27B 1JOYA 4FJCC 4QE7A 4WFHA 4PDLA 3SPGA 3B8NA 1QR8A 3JD4A 3G71V 1NJIW 3CMEV 1I5YA 3F5WC 2Q67A 2ZDIC 1NBMG 2NNUA 1BHBA 4TT3G 3WFVA 4GX5A 3VOUA 1WPXA 5FL7G 3GWOA 1YITV 4PDVA 4RUFA 2DW4A 2X0LA 5L3GA 3IFXA 3ZRSA 5B3SB 3T2MA 2Y48A 4J9ZB 1Y66A 2A79B 3ABLC 1R3JC 1CEZA 3ZN0A 1JPXA 3B8MA 5B1BC 1RM1B 3AG2B 2XASA 4PA4A 4QJFB 4MTGA 2P67A 3BEHA 3SYQA 2H8PC 5GW7A 1RPRA 3K0GA 3ZRXA 4BW5A 5KA6A 4X8AA 2OCCC 4EKWA 2JJ2G 3CYOA 1Y4MA 1EFRG 3ZN1A 2ZR2A 3IGAC 1VQLV 1S77D 2DWDC 2WLNA 2XAQA 3SPHA 3P32A 4RQEA 1R73A 1K3EA 3FB5C 2EJRA 1SESA 3I56V 4KP4A 2OTJV 5B1BB 4GX1A 4DXWA 1ENVA 1GTOA 1PNKA 2WLIB 4ZKIA 2ATKC 4JPRA 5L3DA 1AI5A 1L1FA 1BL8A 4HSTA 2XAHA 1VQMV 2V7QG 3ETGA 3LDCA 4HSRA 4MVZA 5HFLA 2EILB 1W0JG 2HJFC 5HFMA 3AG1B 3SYAA 1VQKV 1V54B 1KKDA 1K7DA 2UXXA 3JCZA 1SZTA 3PJSK 3JD0A 1V55C 1QBZA 1V54C 1BHAA 4JAUA 1NR1A 3ZIAG 2AE3A 2Y69C 3E8GA 1QLEB 3E89A 2ITCC 4WFGA 3JTQA 1M57B 1K5QA 3ZJZA 3TK1A 3OUFA 2BOCC 3SYCA 1ROPA 1E3AA 1JW0A 1S72V 3FB8C 2QM8A 1MSWD 2WYCA 1YIJV 1K92A 2A9HA 1UJWB 3EHBB 5IY5B 3AG4B 3R65A 2IU3A 4MTXA 3JD1A 4UVAA 3CPWU 3F7YC 4HZ3A 2XOKG 3SPIA 3JD3A 5DM6V 2XAGA 1VQ7V 4PA9A 5B1AB 1PD3A 3VBBA 3D36A 4K2GA 1S5HC 4KFMA 1EBOA 3CCUV 4PA3A 3ABMC 3CC7V 1YJWV 3QNEA 4MVUA 4BTHA 1CPYA 3OMNB 3ZMTA 2ZQMA 3FKSG 4MVMA 1YSCA 5J9PC 2A0LA 2WLHA 2EBOA 3QO8A 4MW3A 3X2QB 4GX0A 3ETEA 3ABTA 4MVSA 5C93A 1VQ6V 2JEXA 3TCUA 4H37A 1AR1B 4MSWC 3CCQV 2WYBA 2WLIA 4G2KA 3JD2A 3W7UA 1VQ5V 1K4CC 1F51A 1K5SA 2MK3A 3MD0A 4OXSA 1GK9A 4QE9A 4UV9A 3CCSV 2R9IA 2M7WA 5BZBA 3L94A 4I9WA 4BIUA 4GT1A 1K97A 3S8RA 3OE7G 3OAAG 4X88A 3QO7A 5LGTA 3CC4V 1JQ0A 4J9YB 4H33A 1K73W 3A0RA 4YXWG 3OM3B 1GHDA 2EINB 5LHIA 2DWEC 2X6BA 3E8HA 2ZXWB 3JYCA 5B1AC 4MW8A 1YHQV 2EZOA 4RO2A 4YF9A 2JDIG 3K9AA 5LHHA 1JCHA 2EIJB 3GB7C 3CCMV 1GK1A 4K2FA 2HFEC 1J95A 1RM1C 4JYBA 2W0FC 5H9CA 1W2BU 3CCEV 4YFAA 2IJJA 1KECA 4FPPA 4HYOA 3F7VC 1OCZB 3ZMUA 2JK5C 3P30A 4JAVA 3MHSC 4P2ZA 2EIMB 1CP9A 2V1DA 1JJ2U 5CBHA 3BY6A 3ETDA 1M56C 3OMAB 4LP8A 4P9OA 2OT5A 2W6JG 1M56B 4MVRA 3CCLV 2JIZG 2WPDG 2EILC 3HB3B 4XBFA 4R7CA 2EIKC 1TUEB 4MVQA 2AHZA 3HPLC 2WLLA 3K0DA 1NQTA 3E83A 1GM9A 3OGCC 4E55A 1M90W 3ASOC 4R6ZA 2QKSA 3OR7C 4X89A 1QLEC 3SRBA 1Q86W 3W7TA 4TSFG 4QPJA 5DN6G 4PDMA 1SERA 2XAJA 2D3OW 1K4DC 1PNLA 3E35A 3CCRV 1P7BA 5EBWC 5CN0A 4JGSA 5LHGA 1OCCB 2YEVA 3K06A 1K34A 3LSQA 3AEIA 2JEUA 2Q6AA 3JTRA 1R6NA 3CP1A 2WAMA 2LFSA 3QO5A 1NR7A 3ABLB 3SRCA 1SRYA 4G28B 1QVFU 3FYIB 5EC1C 1R3LC 2DYSC 3DGEA 1OCOC 2UXNA 1PL0A 2ZDIA 3SRAA 4JYCA 2OCCB 3LDDA 3CMAV 1KP2A 3G6EV 1YI2V 1F4MA 2IJKA 1AROP 4HAMA 1GKFA 4PA7A 1NH2D 1Q7YW 2GSMB 3CD6V 3ASNC 5CBGA 1M1KW 4P30A 1XL4A 4JTAB 3FB6C 5LGNA 1FFTB 1OZ0A 2KB1A 3X2QC 3E8FA 1DF4A 4FK5C 4FIPC 2Q69A 2B1IA 2HVJC 1HWYA 1VQOV 2WLKA 2AHYA 3B77A 4PEMA 3SYPA 1JX9A 2XNDG 5EC2C 2AE5A 1JVZA 4WCEV 2DQ3A 2LP7A 4R50A 3OEEG 3RVYA 1PKXA 4LCUC 1NH2B 4Q20A 1F23A 2Z3YA 2WSSG 5L3BA 4WFFA 1R3KC 4GX2A 1Q82W 2EZPA 3W7XA 4F4LA 3RVZA 2IJIA 4XDLA 1I5XA 2FTKA 2YSUB 3ASOB 4XDKA 4Z1MG 3K03A 5KA5A 1VQPV 4WF9V 2QEXV 3TETA 4MTFA 4PELA 1N8RW 1H38A 1S3JA 3LSSA 4JASA 1WLEA 3AG3B 2HG5C 1IXMA 4WFEA 1AJQA 2EIKB 3OMIB 2X6AA 4E56A 2P7TC 1E1QG 3DTUB 1RPOA 1OCCC 4WKTA 1OCRC 1ORQC 2C2AA 2HKOA 1KC8W 5IYBO 4UVBA 1YJNV 5E1AC 4R8CA 5IY5C 2EIMC 1MG1A 4U7OA 1GK0A 1FS0G 3AG2C 4N23A 3T4ZA 5LGUA 5IDJA 4MVOA 4ASUG 3M99B 3ABUA 4I5SA 4JTCB 3I55V 5EBMC 3KG2A 2HR3A 1VQ9V 1FXVA 3W7SA 1NVPB 4YFBA 1AJNA 3STZC 2CK3G 1NKDA 2ITDC 5L3CA 2B5UA 3WG7B 3L91A 2ZR3A 3ZRWB 5L3FA 2AE4A 1E1RG 1JVMA 3T4DA 1E79G 3ASNB 2DYRB 3G4SV 2K1EA 3T1CA 3OW2U 2P6JA 3K04A 2DYRC 5IYCO 1H8EG 2IH1C 2LFRA 1H2GA 3LNMB 1ZWIC 4CZZA 3CC2V 3E8BA 4WKUA 3OR6C 2NLJC 3SJQC 3SPJA 1R6KA 2QA4V 3W7WA 2X7RB 5CA3A 3LUTB 4N21A 2EIJC 1H8HG 5KUKA 4FMTA 1M9NA 4BIZA 2WLJA 1GO3F 3OUSA 5B1OA 1YJ9V 3IC7A 2WWWA 1FXHA 4QPKA 1S0VA 1DTOA 4QIWF 1DF5A 1VQNV 3EFFK 3WG7C 1W0KG 4WKVA 1KP3A 2P90A 3ZMSA 3OEHG 2HVKC 4UVCA 2BOBC 3STLC 5B3SC 5L3EA 3OFNG 3AG3C 4MS2A 1SETA 2OTLV 1P4RA 1AI4A 2F43G 1KEHA 2JJ1G 1QR9A 2HLDG 1LNQA 5CBFA 2ADVA 3ABKB 1M57C 3ZMVA 5KUMA 1QLNA 4RUEA 4P9PA 5IYDO 2PI4A 2Y69B 4LBEC 1XL6A 3MHHC 4RQFA 1K8AW 1VQ4V 2XAFA 5H6QA 3CXCU 1K33A 1B6QA 2QE7G 3UKMA 1R3IC 2DYSB 4RAIA 1KQSU 1Q81W 2QM7A 2EINC 2WLMA 4DO2A 2PI5A 3FYEB 3ABKC 1THZA 4PA6A 4QNHB 1OHHG 2ZD9A 3CCJV 1COWG 2W6IG 4WFBV 1VQ8V 1BMFG 3H01A 1NVPD 1S76D 3RBZA 3NXSA 4CBCA 5CMUA 3D3IA 1MABG 2Z5UA 4WKSA 2Q68A 4E57A 5LBQA 4KUMA 3LDEA 1AJPA 1AI7A 3CCVV 2IH3C 2WLLB 1FXKC 4JF3A 2GHYA 1G8MA 4MTOA 4M1JA 3AG4C 1GM8A 3ZCCA 1KD1W 4L87A 3K79A 2WYEA 2B1GA 1OCZC 3SYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L94 A;  1GM7 A;  1E3A A;  1JW0 A;  1AI6 A;  3K3W A;  3S8R A;  1GM9 A;  4YFA A;  4E55 A;  4PEL A;  1PNK A;  1AI4 A;  1KEC A;  1KEH A;  2WYC A;  1AI5 A;  1FXV A;  4HST A;  4YFB A;  3SRB A;  1AJN A;  4PEM A;  1AJQ A;  3ML0 A;  2ADV A;  3SRA A;  1GHD A;  1JX9 A;  1OR0 A;  4HSR A;  4E56 A;  1PNM A;  1CP9 A;  2AE5 A;  1PNL A;  3L91 A;  2AE4 A;  4WKS A;  4E57 A;  4WKT A;  1JVZ A;  1K7D A;  1FM2 A;  1AJP A;  1AI7 A;  1FXH A;  1GKF A;  2WYB A;  4YF9 A;  4M1J A;  4K2G A;  1GM8 A;  2AE3 A;  2WYD A;  1GK0 A;  1H2G A;  1GK1 A;  1K5S A;  2WYE A;  3JTR A;  4K2F A;  4WKV A;  1GK9 A;  3JTQ A;  4WKU A;  1K5Q A;  4BTH A;  3SRC A; 
#chains in the Genus database with same CATH topology
 3ZRW A;  1TUB A;  3K08 A;  4DUZ B;  1YTF B;  4FZ0 A;  3LSU A;  4IYI A;  2IW5 A;  1BSM A;  1QVG U;  3D8C A;  3E86 A;  1OR0 A;  2QWN B;  3UT5 B;  5K1P A;  1FXK A;  4CH6 A;  1B3Q A;  1WB7 A;  1FM2 A;  3BRC A;  1G1X B;  1I7F A;  2FL4 A;  2EUL A;  2E5L O;  3SPC A;  1EZJ A;  3UM7 A;  3ZMZ A;  1GM7 A;  1AI6 A;  1MOF A;  2R9R B;  4UV8 A;  5AG2 A;  4AHC A;  3ZRV A;  4CS2 A;  4ZHQ B;  3L71 H;  1NJI W;  3JD4 A;  1SS3 A;  1I5Y A;  2LO1 A;  2NNU A;  1BHB A;  4TT3 G;  3VOU A;  1WPX A;  5JQG B;  3GWO A;  4RUF A;  2ZKO A;  3ZRS A;  2YI8 A;  4FLY A;  3CX5 F;  1IBK O;  2VWJ A;  3RYI A;  1JPX A;  4X64 B;  1Y76 B;  4JI0 B;  4AI8 A;  2XAS A;  4QJF B;  5GW7 A;  1RPR A;  5KA6 A;  4BW5 A;  4X1Y B;  2OCC C;  4NTW A;  1EFR G;  3ZN1 A;  1VQL V;  1FPO A;  2YUA A;  1S77 D;  3P32 A;  1N0J A;  1YEW A;  4LWS A;  3I56 V;  1B06 A;  4KP4 A;  5B1B B;  1XI1 A;  1NTZ H;  1ENV A;  3RWR D;  4AIL C;  4HST A;  2BTO A;  1Z2G A;  2XAH A;  1D5A A;  2VQF O;  5HFL A;  2EIL B;  5HFM A;  5BR8 B;  1NTM H;  4UFZ A;  4B3M O;  1QBZ A;  2YXY A;  1V54 C;  4LH7 A;  1BHA A;  2RCV A;  4J10 A;  4J11 A;  2AE3 A;  3Q4H A;  4WFG A;  2ITC C;  4J7J A;  4TUY B;  3RYH B;  1HR0 O;  3ZJZ A;  2A06 H;  3JAM N;  1WB8 A;  1MSW D;  2WYC A;  1YIJ V;  4X65 B;  1VF6 A;  5IY5 B;  3AG4 B;  3EXA A;  4DRX B;  2E5L B;  1VQ7 V;  5B1A B;  1PD3 A;  4O4J A;  3VBB A;  3D36 A;  5JH7 A;  4KFM A;  1EBO A;  2AW9 A;  3CCU V;  2YDE A;  3ABM C;  3CHX A;  3CC7 V;  1YJW V;  4MVU A;  4O4I B;  1CPY A;  2ZQM A;  1YSC A;  2CTP A;  3RYF A;  3QO8 A;  4GX0 A;  1IXB A;  5C93 A;  2LJ2 A;  1AR1 B;  2HP8 A;  3FAV B;  1HNZ O;  3CWB H;  5CA0 B;  2YIB D;  3W7U A;  2CGN A;  2KSD A;  1KYO F;  1F51 A;  1K5S A;  3MD0 A;  3M8A A;  4QE9 A;  4UCT A;  3HKE A;  5KMG B;  3CCS V;  2R9I A;  3GWK C;  4GT1 A;  1K97 A;  3C3S A;  2YS8 A;  3UQ8 A;  1QNM A;  1XNQ O;  5KX5 B;  5IJ9 A;  4YF9 A;  2JDI G;  1BQ0 A;  1KB9 F;  1BQZ A;  3A8T A;  1JCH A;  4LFB O;  3JAL A;  1ZUQ A;  3KZI Z;  2BTQ B;  4B3R O;  1RM1 C;  2AGA A;  1WA8 B;  4K0K B;  4YFA A;  1KEC A;  4FLX A;  4HYO A;  3ZMU A;  2JK5 C;  1XBL A;  1FFX A;  2V1D A;  5CBH A;  3BY6 A;  1P84 F;  1M56 B;  3CCL V;  2JIZ G;  3CS5 A;  3OTO B;  5EZY A;  2WLL A;  4HBN A;  3K0D A;  2HHH B;  2ZIM A;  4DW1 A;  3OGC C;  4LF4 B;  3WB2 A;  3ASO C;  4B3R B;  5GON A;  1Q86 W;  4QPJ A;  5DN6 G;  4RWU A;  1XMO O;  3CCR V;  5EBW C;  1H2L A;  2Q4P A;  2JGD A;  2Q6A A;  5B5E Z;  3FGR A;  3CP1 A;  2E76 B;  3QO5 A;  4B3S B;  2OWO A;  3TXS A;  4FM2 A;  1QVF U;  5CA1 B;  1Q5O A;  2UXN A;  1PL0 A;  2ZDI A;  2VQE B;  4JYC A;  4JYY A;  2OCC B;  3CMA V;  1KMI Z;  4YJ3 A;  2ZM6 O;  1KP2 A;  1ARO P;  5KMG A;  1QQC A;  1Q7Y W;  5CBG A;  1M1K W;  4P30 A;  4O2A A;  1IBM O;  2VRZ A;  2PYJ A;  4J41 A;  1OZ0 A;  3X2Q C;  2UUC O;  4TOI A;  1OJH A;  1SQF A;  3ZS8 C;  1PV0 A;  5BY1 A;  2BCC H;  4DR7 B;  5EIB C;  3L9D A;  3JAK B;  3S3W A;  3AK3 A;  2M6Y A;  4WCE V;  4PJ0 Z;  4NTY A;  4FM0 A;  1PKX A;  4LCU C;  4W4K A;  2Z3Y A;  3O65 A;  1H2S B;  4WFF A;  4O4J B;  1SQV H;  4XDL A;  3ASO B;  1X59 A;  4YJ2 A;  3ZHT A;  1UFI A;  3TET A;  4MTF A;  1H38 A;  2JGD B;  2NN4 A;  1WLE A;  2F4V B;  5GTH Z;  1IXM A;  4WFE A;  3OMI B;  2QTS A;  4YHH O;  1E1Q G;  1OCC C;  1PPJ H;  4FLU A;  3OTF A;  2HKO A;  5E1A C;  4R8C A;  5LA6 B;  1CXZ B;  1MG1 A;  4U7O A;  2DOS A;  1FS0 G;  4AQY O;  3D3Q A;  4FLV A;  2PZS A;  4MVO A;  2JS5 A;  1M5I A;  4JTC B;  3I55 V;  4DUY O;  3KG2 A;  1VQ9 V;  2ZE5 A;  2G38 A;  4J7Z A;  1AJN A;  2UXC B;  3SJB C;  4U3J B;  5L3F A;  1JVM A;  1E79 G;  2Q0A A;  1GRJ A;  4I0X A;  4LF8 O;  1H8E G;  2LFR A;  3CC2 V;  4CZZ A;  2NLJ C;  4A5U B;  3SGI A;  3SPJ A;  1R6K A;  1IBK B;  2X7R B;  4N21 A;  4KXR A;  1R1B A;  2EIJ C;  3DC6 A;  4X62 B;  1HNW B;  5IJ0 B;  1UPG A;  4QIW F;  3ZHR A;  1DF5 A;  5LA6 A;  3EFF K;  4FLZ A;  4JI3 B;  1W0K G;  5LP6 C;  4B3T O;  2PF4 E;  3CRA A;  2BOB C;  2QSA A;  1XQ8 A;  3OFN G;  3AG3 C;  2OTL V;  4UCR A;  2F43 G;  2JJ1 G;  5K1X A;  5IWA B;  2LW1 A;  5KAF Z;  1M57 C;  4X66 O;  1QLN A;  4FLW A;  1VEW A;  3A2F A;  4ZI7 B;  2Y69 B;  1XL6 A;  3AG7 A;  3BPZ A;  1HW7 A;  1K8A W;  2XAF A;  5H6Q A;  4X62 O;  1HDJ A;  2DYS B;  3BHP A;  4RAI A;  1JMK C;  5KHG A;  1Q81 W;  4UCO A;  3FYE B;  3ABK C;  4PA6 A;  4O4H B;  4X20 A;  4WFB V;  4JV5 O;  1BMF G;  2DJV A;  4CS4 A;  2QDO A;  3O9O A;  3RBZ A;  4CBC A;  1Y74 B;  4EFB A;  1VAR A;  3K57 A;  4WKS A;  3LDE A;  1AJP A;  1JFF A;  2IH3 C;  1FXK C;  2GHY A;  4MTO A;  2WYE A;  3HKE B;  2GV9 A;  4EB6 A;  1VF5 B;  2PYL A;  3K3W A;  1DLB A;  1ZLZ A;  2UUC B;  2UXD O;  4J80 A;  2Q7G A;  5EIB D;  4DR6 O;  1FXK B;  5B1N A;  1OCR B;  4WFA V;  4DR1 O;  1ZL8 B;  4PDR A;  3AG1 C;  2ZXW C;  3LNN A;  1HNZ B;  4JI5 O;  2GUZ B;  4LF6 B;  1AIL A;  5H2F Z;  4U7N A;  4MT8 A;  4BIO A;  4UUJ C;  1N36 B;  4GCZ A;  3E2E A;  2LQT A;  1YTF D;  1XDC A;  5LP6 B;  2IJH A;  3K58 A;  3ABM B;  4BR6 A;  1VF7 A;  1XHX A;  4QE7 A;  2E74 B;  3T1H B;  4YY3 O;  3G71 V;  1QR8 A;  3B8N A;  3S3X A;  3B2E E;  4I55 B;  4LNU A;  2E3C A;  3KKY A;  3E22 A;  1YF2 A;  2DW4 A;  3IFX A;  2Y48 A;  3JAS B;  2RN9 A;  1N32 O;  1R3J C;  1N34 O;  5B1B C;  2CH7 A;  3AG2 B;  1IX9 A;  4MTG A;  3SYQ A;  5ITZ B;  4BWC A;  4D7S A;  1WPB A;  4LFC O;  5DED A;  3QTC A;  5BXZ A;  3CB2 A;  4LWS B;  2EJR A;  5LL6 Y;  2OTJ V;  3SJA C;  2Q0O C;  2XUM A;  2ATK C;  4JPR A;  1L1F A;  1PP9 H;  5L3D A;  1VQM V;  2V7Q G;  3ETG A;  3LDC A;  1Q90 D;  2ADP A;  1P49 A;  4MVZ A;  1W0J G;  1MZE A;  3AG1 B;  3SYA A;  1KKD A;  3JCZ A;  1SZT A;  3JD0 A;  2ETN A;  4DYL A;  4JAU A;  4Z1V A;  3Q4H B;  1QLE B;  4LF9 B;  1MZF A;  1KUQ A;  3JTQ A;  3TK1 A;  3OUF A;  2BOC C;  1E3A A;  4JI1 O;  5JH7 B;  4EFE A;  3RYF B;  1UJW B;  2RDC A;  3N2K B;  1TAE A;  5IWA O;  4DV6 B;  2IU3 A;  3CPW U;  3F7Y C;  2QKA A;  2RNB A;  3JD3 A;  1D5N A;  4PA9 A;  1R6T A;  2A7W A;  4X9Q A;  4NXN B;  1BZK A;  1RSO A;  3QNE A;  4DRX A;  4BTH A;  2QWP B;  3OMN B;  3J80 N;  3FKS G;  4MVM A;  5JVD A;  2WLH A;  4DV4 O;  4MW3 A;  3X2Q B;  4DV0 O;  3ABT A;  1I94 B;  3RGB A;  3A0H Z;  2WYB A;  3WB0 A;  2WLI A;  5C8Y A;  4X1I B;  3JD2 A;  1VQ5 V;  1GK9 A;  4J7K A;  3CE2 A;  4UV9 A;  4O4L B;  4I9W A;  3S8R A;  3OE7 G;  4X88 A;  2PUS A;  4X1K A;  3CC4 V;  5LP6 A;  4H33 A;  3A0R A;  4YXW G;  3OM3 B;  1GHD A;  2EIN B;  4X1K B;  1LR1 A;  3E8H A;  2ZXW B;  5B1A C;  4RO2 A;  3APO A;  3ZHQ A;  4LFB B;  3CCM V;  4K2F A;  1SZX A;  5CA0 A;  1XMQ O;  2KG7 B;  2QGN A;  5H9C A;  3BFR A;  4NVP A;  1N36 O;  2IJJ A;  2VS0 A;  3ZX6 A;  3F7V C;  4TV9 B;  3P30 A;  4DV1 B;  3MHS C;  3BAA A;  1DGS A;  3K5N A;  3OMA B;  1JA8 A;  2Y0I A;  2WPD G;  1I08 A;  3HB3 B;  1AP5 A;  3HKB B;  4XBF A;  2EIK C;  5CA1 A;  4MVQ A;  3HPL C;  3ZHU A;  2FML A;  5JJJ B;  1Q3E A;  1U97 A;  1A32 A;  1Y74 A;  4K35 A;  2GUZ A;  5D5Q A;  2QKS A;  3OR7 C;  3SRB A;  5IYZ A;  1AVM A;  1EN4 A;  5BMV B;  2Q8V A;  3SR2 C;  5CN0 A;  4JI6 B;  4JGS A;  1OCC B;  3QF7 A;  3LSQ A;  2PTM A;  5DEC A;  5JVD B;  4DR2 O;  4I50 A;  1R6N A;  2LFS A;  1NR7 A;  2QKC A;  4G28 B;  3D36 C;  3FYI B;  2DN9 A;  1R3L C;  1OCO C;  1BE3 H;  1IBL O;  4Q6G A;  4EB6 B;  3BVO A;  2IM9 A;  4ZOL A;  1F4M A;  4PA7 A;  1GKF A;  3ETQ A;  2Y4T A;  5IT9 N;  4JTA B;  3FB6 C;  4DR3 B;  1IBM B;  1ZX3 A;  2KB1 A;  3E8F A;  1HP8 A;  4FK5 C;  2ZIO A;  2Q69 A;  1BGY H;  4GYC B;  2QR4 A;  2HVJ C;  1VQO V;  4PEM A;  2AHY A;  1IUR A;  1FD9 A;  2AZ0 A;  2XND G;  5EC2 C;  2QWR B;  2OCH A;  2LP7 A;  3OEE G;  4NYK A;  3RVY A;  4I4T B;  4DV7 O;  1NH2 B;  4LR3 A;  2L35 A;  2DE0 X;  3IAY A;  3G80 A;  4F4L A;  3RVZ A;  2IJI A;  1VQP V;  1I5X A;  3TGU H;  4PHZ A;  4UCS A;  4PEL A;  1VIB A;  3LSS A;  4JAS A;  4LH6 A;  1VP7 A;  2EIK B;  2X6A A;  2YXL A;  4DV0 B;  4E56 A;  1Q6I A;  1OCR C;  1ORQ C;  5JCO A;  3UO3 A;  2YXH A;  1YVW A;  1GK0 A;  4N23 A;  1WP7 A;  5LYJ A;  1XHZ A;  3SJC C;  4JYA O;  4FVM A;  3A0B Z;  3ABU A;  1FAF A;  5EBM C;  2RJZ A;  3H1L H;  3STZ C;  1MNG A;  5L3C A;  1WN7 A;  1Q43 A;  3WG7 B;  4U3J A;  3L91 A;  4B7E A;  4D6T H;  2NR5 A;  2DYR B;  2K1E A;  4UCV A;  3OW2 U;  3K04 A;  1O9H A;  1H2G A;  3LNM B;  5D5P A;  3E8B A;  4WKU A;  3OR6 C;  3SJQ C;  2ILM A;  2UXB B;  2WA3 A;  1U96 A;  4CH5 A;  1H8H G;  1NT2 B;  1Y6X A;  3VQX A;  1M9N A;  1GN4 A;  2EX3 A;  1GO3 F;  4K3A A;  1FXH A;  3CJH B;  1DTO A;  4OX9 B;  2Y4U A;  5JWP A;  1I0H A;  3WG7 C;  5KX5 A;  4W4L A;  1KP3 A;  2P90 A;  4NKG B;  3HKD A;  3ZMS A;  4UVC A;  2P22 C;  2CTR A;  2GDS A;  4HNA B;  1SET A;  1XOU A;  1KEH A;  4O2B A;  1QR9 A;  1LNQ A;  4NXM B;  1XIL A;  3ZMV A;  5KUM A;  5FLX N;  4P9P A;  2PI4 A;  2LW7 A;  1KU9 A;  3MHH C;  2ZNJ A;  4JI6 O;  4RQF A;  3RYC A;  1BT8 A;  4CC5 A;  3CXC U;  4YIP A;  1R3I C;  4FZ1 A;  3MDS A;  3C90 A;  1MA1 A;  2EIN C;  4IIJ B;  4GUN A;  1THZ A;  1OHH G;  3H9V A;  2ZD9 A;  2Q9L A;  5LMN B;  1VQ8 V;  4I0X B;  3H01 A;  2Q5Z A;  5CMU A;  1H2N A;  2Z5U A;  2Q68 A;  3SDL A;  2FB5 A;  4KUM A;  4TV8 A;  3CCV V;  2WLL B;  4DV3 B;  4M1J A;  3AG4 C;  1J5E B;  2QWQ B;  3AK2 A;  1GM8 A;  1RSO B;  3ZCC A;  1KD1 W;  4L8J A;  1LUV A;  3JSL A;  1GN2 A;  1SQP H;  1K9M W;  4XDJ A;  2VWK A;  1SA0 A;  2DQ0 A;  5EK0 A;  4DV5 O;  1GMG A;  1I94 O;  1V55 B;  4JTD B;  1BS3 A;  1GN6 A;  5E79 Z;  3B4S A;  5IYZ B;  2KQX A;  1TGO A;  2WYD A;  5H6R A;  4OGQ B;  2QTO A;  2YEV B;  1OV9 A;  5IE9 A;  5IJ9 B;  4UXN A;  1KKC A;  3FB7 C;  4DV3 O;  2EJ7 A;  4LC1 A;  1QCE A;  3J7A U;  3CRC A;  3RN4 A;  4DV2 O;  4FFB B;  1PNM A;  4UB8 Z;  4YJ2 B;  1WP8 A;  4FJC C;  4J42 A;  3SPG A;  3T1H O;  2Q67 A;  2ZDI C;  1NBM G;  3WFV A;  4GX5 A;  1NU1 H;  1YIT V;  2YIA A;  1YCI A;  5L3G A;  4CS3 A;  5ITZ A;  5B3S B;  3T2M A;  3VQW A;  2IBZ H;  1JJO A;  3ABL C;  4GKJ O;  3B8M A;  1QHT A;  1RM1 B;  3L74 H;  3ZHS A;  1L8D A;  3BEH A;  4IYH A;  4IIJ A;  2H8P C;  3K0G A;  3ZRX A;  3CYO A;  1Y4M A;  2QM4 A;  2DWD C;  2WLN A;  1AR5 A;  4B3T B;  3SPH A;  2BE3 A;  1R73 A;  4E4E A;  2XHB A;  2N04 A;  4GX1 A;  1GTO A;  1PNK A;  2WLI B;  3F5T A;  4ICG A;  4ZKI A;  5C8Y B;  1AI5 A;  1BL8 A;  2P4K A;  4CH4 A;  2P4V A;  4HNA A;  2HJF C;  4F6R B;  1V54 B;  4K0K O;  3PJS K;  1V55 C;  3RYH A;  3UO2 A;  1NR1 A;  3ZIA G;  3C3T A;  3E8G A;  4O4I A;  4LF9 O;  4ZIB A;  1ROP A;  2F1M A;  1JW0 A;  4O2A B;  3UT5 A;  3FB8 C;  4WBN A;  2QM8 A;  2A9H A;  5LXT A;  4I9Q A;  2A3Q A;  3EHB B;  2R70 A;  4MTX A;  3JD1 A;  2DMX A;  1M4U A;  4HZ3 A;  1HNX B;  3SPI A;  5DM6 V;  2XAG A;  2JS3 A;  4K2G A;  1S5H C;  3BAB A;  3P3P A;  4JZ2 A;  3CEI A;  4TUY A;  1ZTE A;  3FX7 A;  4I50 B;  5LMN O;  1SQQ H;  3EVK A;  2A0L A;  1FFX B;  1EZV H;  3I5D A;  3L70 H;  2EBO A;  4YHH B;  1VMG A;  1VQ6 V;  2JEX A;  3J81 N;  3TCU A;  2UXD B;  4PD4 F;  2UUA B;  4H37 A;  4DW0 A;  3N27 A;  4MSW C;  3CCQ V;  3ZBH A;  3G6B A;  3JAW A;  5JJE B;  4JZG A;  2F23 A;  4O4L A;  2M7W A;  4CH3 A;  3L94 A;  4BIU A;  5A2Q N;  1VF6 C;  3QO7 A;  1FYJ A;  2CGO A;  5LGT A;  4J9Y B;  4JAA A;  2OIG A;  2DWE C;  5FPR A;  3JYC A;  5FNV A;  4MW8 A;  1YHQ V;  2YIB A;  3JAR A;  2F66 C;  1Z5W A;  2WA4 A;  3GB7 C;  4PI2 A;  4I4T A;  4DR4 B;  1O9G A;  1L0N H;  1MSD A;  1RP3 B;  4JYB A;  4IHJ B;  2W0F C;  1W2B U;  3CCE V;  2PY5 A;  2Z0A A;  2YID A;  4JAV A;  4P2Z A;  2AXT Z;  4DV4 B;  4LP8 A;  2OT5 A;  3OD4 A;  4KHP B;  5H5N A;  1BCC H;  2AHZ A;  2HEP A;  3K9S A;  1NQT A;  2OYQ A;  4PI0 A;  3E83 A;  3N2K A;  4LF5 B;  1M90 W;  2YC0 A;  4R6Z A;  3ZHV A;  3OGI B;  4TSF G;  3W7T A;  3DSQ A;  2ADQ B;  2VQE O;  2XAJ A;  3HKC B;  1PNL A;  1P7B A;  3K06 A;  1GH6 A;  1TUB B;  1TVK B;  1EM1 A;  3K5M A;  2CTW A;  3JAT A;  3SRC A;  4DK1 A;  5FNV B;  4JI1 B;  3OT7 A;  5KHJ A;  2Y0P A;  4YIO A;  2DYS C;  3DGE A;  3SRA A;  1AR4 A;  4HAM A;  1WAZ A;  4B3M B;  1XNR O;  2GSM B;  3JAS A;  4KL1 A;  4DV2 B;  5LGN A;  2CE4 A;  1FFT B;  1DF4 A;  5J2T A;  3JAK A;  1Y76 A;  5JCO C;  4B3S O;  2B1I A;  1YDX A;  2FKX A;  3B77 A;  3SYP A;  4LFA B;  2ZE8 A;  4UCU A;  2DQ3 A;  2UXB O;  4LF6 O;  1V9P A;  4GKK B;  4NB5 A;  4DR1 B;  3L75 H;  4O2B B;  5A9G A;  2WSS G;  1Q82 W;  4GX2 A;  4X64 O;  3W7X A;  4Z1M G;  5KA5 A;  4CC6 A;  4YJ3 B;  4WF9 V;  2QEX V;  1TVK A;  3TXQ A;  3DXR B;  3FAV A;  1PL4 A;  1RPO A;  2C2A A;  4GKK O;  5IYB O;  3RYI B;  5J2U A;  1EN6 A;  4NXN O;  4F6E A;  4ASU G;  4LNU B;  4I5S A;  5TIS Z;  3RFR A;  4DR5 O;  1NVP B;  4YFB A;  2CK3 G;  3DXR A;  2E75 B;  2ITD C;  2LGW A;  2W0X A;  2B5U A;  2KKW A;  1E1R G;  2ARH A;  3H1I H;  3RT3 C;  3T1C A;  2P6J A;  2DYR C;  5IYC O;  4BW9 A;  1HR0 B;  4DR6 B;  1X4T A;  3N2G A;  3QG5 A;  2KG7 A;  1H2M A;  4B7K A;  2XTA A;  4DUY B;  2QA4 V;  3U11 A;  5CA3 A;  3LUT B;  4K8Z A;  4JI2 O;  1P7G A;  4JI8 B;  1WA8 A;  4BIZ A;  4F6R A;  3UCS C;  4GKJ B;  2WLJ A;  3OUS A;  2QWO B;  3IC9 A;  2WWW A;  4QPK A;  1S0V A;  5KAI Z;  1KBH A;  3RYC B;  4I55 A;  2HVK C;  4LF8 B;  3STL C;  4JV5 B;  3MAQ A;  4MS2 A;  5CB4 A;  1P4R A;  4JYA B;  2HLD G;  5CBF A;  1XRE A;  4LFA O;  3ABK B;  2BSK B;  5CB4 B;  3G67 A;  5IYD O;  2N05 A;  1XMO B;  1K33 A;  4GLX A;  1B6Q A;  2QE7 G;  1TA8 A;  3UKM A;  2UU9 O;  4IHJ A;  3B40 A;  2WLM A;  4DO2 A;  1T5E A;  4QNH B;  1MMM A;  2W6I G;  3H1J H;  4C7U A;  1NVP D;  3D3I A;  1MAB G;  3KCX A;  4UB6 Z;  1AI7 A;  4DK0 A;  2ZT9 B;  1G8M A;  1HNX O;  1SQX H;  4TQF A;  4L87 A;  3K79 A;  3VQY A;  1OCZ C;  3SYO A;  3CXH F;  4TV8 B;  1OCO B;  4ZBM A;  4BAY A;  4H0L B;  2PGG A;  1G4Y B;  2UUB B;  3DC5 A;  2B9Z A;  4DR7 O;  3RW0 A;  4E2L A;  1B04 A;  2X6C A;  3CRM A;  2H94 A;  3JAT B;  5EBL C;  4KHP O;  5BMV A;  4LF5 O;  1SKV A;  4TWK A;  3FGT A;  4JI2 B;  4JI8 O;  3T1Y O;  2IU0 A;  5B66 Z;  1F4N A;  1SA0 B;  2K9P A;  3ML0 A;  5KHI A;  4DR3 O;  1JOY A;  4G27 B;  3M7M X;  2HJD A;  1XEQ A;  1WJZ A;  4WFH A;  4PDL A;  3CME V;  3F5W C;  3BCC H;  4DR4 O;  5FL7 G;  4PDV A;  1WNS A;  3B09 A;  2X0L A;  2CUG A;  4U3F H;  4J9Z B;  1Y66 A;  2A79 B;  1H2K A;  1CEZ A;  3ZN0 A;  3T1Y B;  2ODM A;  4NTX A;  4JI4 O;  2Q7E A;  3QVN A;  4PA4 A;  2P67 A;  4FLT A;  3WU2 Z;  4YY3 B;  1URF A;  1Z5V A;  4X8A A;  4EKW A;  2JJ2 G;  4K8X A;  2ZR2 A;  3IGA C;  2XAQ A;  3TJT A;  4RQE A;  3FB5 C;  1K3E A;  1SES A;  3HKD B;  1DK1 A;  2OIE A;  2LGQ A;  2Q73 A;  4DXW A;  4LF4 O;  2YI9 A;  1ZAU A;  3JAW B;  4X1I A;  4GZR B;  4HSR A;  1VQK V;  1IVS A;  2ZE7 A;  1K7D A;  2UXX A;  5LYJ B;  1Q8I A;  2Y69 C;  4H13 B;  4IT5 A;  3E89 A;  5IJ0 A;  2F95 B;  1M57 B;  1K5Q A;  2H3O A;  3E22 B;  4JI3 O;  5LMU B;  3SYC A;  1SF9 A;  1S72 V;  5EYP A;  3K5O A;  1K92 A;  1Y67 A;  1F7Y A;  2RMK B;  3R65 A;  1ZSP A;  1JR9 A;  4UVA A;  2Q7H A;  2XOK G;  4DV7 B;  4JI5 B;  3H1K H;  3VQV A;  5LXT B;  3K5L A;  3APQ A;  3JSN A;  2CAZ C;  4PA3 A;  2UU9 B;  1NTK H;  5KHK A;  3ZMT A;  5J9P C;  4PV1 B;  3P3N A;  3ETE A;  1N4C A;  4MVS A;  5LMU O;  2O57 A;  4WBN B;  2R72 A;  4O4H A;  3OTO O;  2ZNI A;  4OPA A;  4G2K A;  1K4C C;  3ICX A;  3PN1 A;  5BR8 O;  4DV6 O;  1GN3 A;  2MK3 A;  2YIC A;  4OXS A;  4JI4 B;  5BZB A;  3AK1 A;  3OAA G;  1AP6 A;  4FFB A;  2FYU H;  1JQ0 A;  4Z2W A;  2P06 A;  1K73 W;  5LOV B;  5LHI A;  2X6B A;  4X65 O;  2EZO A;  2L6L A;  4X20 B;  3K9A A;  1FKA O;  5LHH A;  2EIJ B;  1XUQ A;  1GK1 A;  2HFE C;  3L73 H;  1IZ3 A;  3JAL B;  1L0L H;  1J95 A;  3NR7 A;  4DR5 B;  1QU7 A;  5JJN B;  3ZED A;  4FPP A;  4ZOL B;  1OCZ B;  5GON B;  4I7Z B;  2EIM B;  1CP9 A;  1JJ2 U;  5LOV A;  3ETD A;  1M56 C;  4OX9 O;  4P9O A;  2W6J G;  1NS1 A;  2CDY A;  4DUZ O;  4LF7 O;  4MVR A;  2EIL C;  1S5J A;  2CTQ A;  4R7C A;  1TUE B;  3FD9 A;  4DV5 B;  1W59 A;  1GM9 A;  1Q6H A;  4E55 A;  3IJ4 A;  4X89 A;  1QLE C;  1US6 A;  3CSX A;  4TV9 A;  2GTS A;  2VQF B;  4PDM A;  4DV1 O;  1ZL8 A;  1SER A;  2D3O W;  1K4D C;  3HKC A;  1RFY A;  3E35 A;  1N33 O;  5LHG A;  2YEV A;  4FFK A;  1K34 A;  1HNW O;  2ZCE A;  3AEI A;  2JEU A;  3JTR A;  2WAM A;  1FJG O;  5GTI Z;  2F4V O;  3ABL B;  4LFC B;  1SRY A;  2UUB O;  5EC1 C;  1D2D A;  2MW2 B;  4AQY B;  1SC5 B;  1JFF B;  2QJ1 A;  4X66 B;  3LDD A;  1M93 A;  4B08 A;  3FFQ A;  3G6E V;  1YI2 V;  3U0Z A;  1XNR B;  3L72 H;  2IJK A;  1NH2 D;  3CD6 V;  3ASN C;  1PM9 A;  1XL4 A;  1SQB H;  2JGU A;  4X1Y A;  2D2C B;  3CRQ A;  5JQG A;  2N74 A;  2CH7 B;  4FIP C;  3JAR B;  1HWY A;  2WLK A;  1FJG B;  2AZ2 A;  1Q6U A;  1JX9 A;  4NXM O;  2AE5 A;  5J2T B;  2BTQ A;  1JVZ A;  2BSK A;  4R50 A;  4Q20 A;  1F23 A;  3N2G B;  5L3B A;  2GTA A;  1R3K C;  2EZP A;  3JCU Z;  1AB3 A;  2FTK A;  2YSU B;  4XDK A;  3K03 A;  1N8R W;  1GAX A;  1S3J A;  3AG3 B;  2HG5 C;  4FM1 A;  1AJQ A;  3CJH A;  2P7T C;  3DTU B;  4WKT A;  2V4D A;  4BWA A;  4LF7 B;  1KC8 W;  2GBO A;  4UVB A;  1YJN V;  1NZ6 A;  1SQG A;  5IY5 C;  2EIM C;  5J2U B;  3AG2 C;  3H1H H;  3T4Z A;  5LGU A;  4QGP A;  5IDJ A;  4ABM A;  3M99 B;  2ZM6 B;  2HR3 A;  1FXV A;  3W7S A;  3U10 A;  1NKD A;  4ZHQ A;  5KLV H;  4DR2 B;  1S5L Z;  2ZR3 A;  3ZRW B;  2AE4 A;  2JRI A;  3T4D A;  1YXB A;  3ASN B;  3BA9 A;  3G4S V;  4JI7 O;  1IDS A;  2UUA O;  3BA8 A;  2IH1 C;  5EYP B;  1ZWI C;  1N0N A;  1N32 B;  3W7W A;  2HHH O;  1XMQ B;  4IGG A;  5KUK A;  4FMT A;  1N34 B;  5FPO A;  5B1O A;  1YJ9 V;  2R9A A;  2JVD A;  3IC7 A;  5F2V O;  4OPH A;  1VQN V;  3KCY A;  3HR0 A;  1XNQ B;  4WKV A;  3OEH G;  5EZY B;  2ZIN A;  5B3S C;  2F93 B;  4ZI7 A;  4JI7 B;  5L3E A;  3WB1 A;  3HKB A;  1AI4 A;  2ZE6 A;  2ADV A;  4RUE A;  1NI8 A;  1LUW A;  4LBE C;  1J5E O;  3CRR A;  1VQ4 V;  1G6U A;  2XT9 A;  1N33 B;  3K59 A;  1KQS U;  4JI0 O;  4D7T A;  2UXC O;  4EEQ A;  2PI5 A;  2QM7 A;  4TQD A;  3GVM A;  3CCJ V;  2P5O A;  1COW G;  5KHH A;  1IBL B;  1S76 D;  3NXS A;  3R66 A;  4H44 B;  4E57 A;  5LBQ A;  1EN5 A;  3THO A;  4JF3 A;  2RQ6 A;  1YZB A;  4IL6 Z;  2B1G A;  4NR1 A; 
#chains in the Genus database with same CATH homology
 3ZRW A;  3K3W A;  1OCO B;  1DLB A;  3K08 A;  4ZBM A;  1YTF B;  4BAY A;  1K9M W;  1G4Y B;  4XDJ A;  2IW5 A;  1QVG U;  2DQ0 A;  5EK0 A;  3E86 A;  1GMG A;  1OR0 A;  3RW0 A;  4E2L A;  1FXK A;  1FXK B;  2X6C A;  5B1N A;  1V55 B;  4JTD B;  2H94 A;  1OCR B;  4WFA V;  5EBL C;  1FM2 A;  4PDR A;  3AG1 C;  2ZXW C;  4TWK A;  3SPC A;  1EZJ A;  2WYD A;  4U7N A;  4MT8 A;  5H6R A;  2QTO A;  2YEV B;  3UM7 A;  4UXN A;  3ZMZ A;  1GM7 A;  3FB7 C;  1AI6 A;  1MOF A;  2R9R B;  4GCZ A;  4UUJ C;  4LC1 A;  4UV8 A;  2IU0 A;  1F4N A;  3E2E A;  1YTF D;  1QCE A;  3ML0 A;  2IJH A;  3ABM B;  3ZRV A;  1PNM A;  4G27 B;  1JOY A;  4FJC C;  4QE7 A;  4WFH A;  4PDL A;  3SPG A;  3B8N A;  1QR8 A;  3JD4 A;  3G71 V;  1NJI W;  3CME V;  1I5Y A;  3F5W C;  2Q67 A;  2ZDI C;  1NBM G;  2NNU A;  1BHB A;  4TT3 G;  3WFV A;  4GX5 A;  3VOU A;  1WPX A;  5FL7 G;  3GWO A;  1YIT V;  4PDV A;  4RUF A;  2DW4 A;  2X0L A;  5L3G A;  3IFX A;  3ZRS A;  5B3S B;  3T2M A;  2Y48 A;  4J9Z B;  1Y66 A;  2A79 B;  3ABL C;  1R3J C;  1CEZ A;  3ZN0 A;  1JPX A;  3B8M A;  5B1B C;  1RM1 B;  3AG2 B;  2XAS A;  4PA4 A;  4QJF B;  4MTG A;  2P67 A;  3BEH A;  3SYQ A;  2H8P C;  5GW7 A;  1RPR A;  3K0G A;  3ZRX A;  4BW5 A;  5KA6 A;  4X8A A;  2OCC C;  4EKW A;  2JJ2 G;  3CYO A;  1Y4M A;  1EFR G;  3ZN1 A;  2ZR2 A;  3IGA C;  1VQL V;  1S77 D;  2DWD C;  2WLN A;  2XAQ A;  3SPH A;  3P32 A;  4RQE A;  1R73 A;  1K3E A;  3FB5 C;  2EJR A;  1SES A;  3I56 V;  4KP4 A;  2OTJ V;  5B1B B;  4GX1 A;  4DXW A;  1ENV A;  1GTO A;  1PNK A;  2WLI B;  4ZKI A;  2ATK C;  4JPR A;  5L3D A;  1AI5 A;  1L1F A;  1BL8 A;  4HST A;  2XAH A;  1VQM V;  2V7Q G;  3ETG A;  3LDC A;  4HSR A;  4MVZ A;  5HFL A;  2EIL B;  1W0J G;  2HJF C;  5HFM A;  3AG1 B;  3SYA A;  1VQK V;  1V54 B;  1KKD A;  1K7D A;  2UXX A;  3JCZ A;  1SZT A;  3PJS K;  3JD0 A;  1V55 C;  1QBZ A;  1V54 C;  1BHA A;  4JAU A;  1NR1 A;  3ZIA G;  2AE3 A;  2Y69 C;  3E8G A;  1QLE B;  3E89 A;  2ITC C;  4WFG A;  3JTQ A;  1M57 B;  1K5Q A;  3ZJZ A;  3TK1 A;  3OUF A;  2BOC C;  3SYC A;  1ROP A;  1E3A A;  1JW0 A;  1S72 V;  3FB8 C;  2QM8 A;  1MSW D;  2WYC A;  1YIJ V;  1K92 A;  2A9H A;  1UJW B;  3EHB B;  5IY5 B;  3AG4 B;  3R65 A;  2IU3 A;  4MTX A;  3JD1 A;  4UVA A;  3CPW U;  3F7Y C;  4HZ3 A;  2XOK G;  3SPI A;  3JD3 A;  5DM6 V;  2XAG A;  1VQ7 V;  4PA9 A;  5B1A B;  1PD3 A;  3VBB A;  3D36 A;  4K2G A;  1S5H C;  4KFM A;  1EBO A;  3CCU V;  4PA3 A;  3ABM C;  3CC7 V;  1YJW V;  3QNE A;  4MVU A;  4BTH A;  1CPY A;  3OMN B;  3ZMT A;  2ZQM A;  3FKS G;  4MVM A;  1YSC A;  5J9P C;  2A0L A;  2WLH A;  2EBO A;  3QO8 A;  4MW3 A;  3X2Q B;  4GX0 A;  3ETE A;  3ABT A;  4MVS A;  5C93 A;  1VQ6 V;  2JEX A;  3TCU A;  4H37 A;  1AR1 B;  4MSW C;  3CCQ V;  2WYB A;  2WLI A;  4G2K A;  3JD2 A;  3W7U A;  1VQ5 V;  1K4C C;  1F51 A;  1K5S A;  2MK3 A;  3MD0 A;  4OXS A;  1GK9 A;  4QE9 A;  4UV9 A;  3CCS V;  2R9I A;  2M7W A;  5BZB A;  3L94 A;  4I9W A;  4BIU A;  4GT1 A;  1K97 A;  3S8R A;  3OE7 G;  3OAA G;  4X88 A;  3QO7 A;  5LGT A;  3CC4 V;  1JQ0 A;  4J9Y B;  4H33 A;  1K73 W;  3A0R A;  4YXW G;  3OM3 B;  1GHD A;  2EIN B;  5LHI A;  2DWE C;  2X6B A;  3E8H A;  2ZXW B;  3JYC A;  5B1A C;  4MW8 A;  1YHQ V;  2EZO A;  4RO2 A;  4YF9 A;  2JDI G;  3K9A A;  5LHH A;  1JCH A;  2EIJ B;  3GB7 C;  3CCM V;  1GK1 A;  4K2F A;  2HFE C;  1J95 A;  1RM1 C;  4JYB A;  2W0F C;  5H9C A;  1W2B U;  3CCE V;  4YFA A;  2IJJ A;  1KEC A;  4FPP A;  4HYO A;  3F7V C;  1OCZ B;  3ZMU A;  2JK5 C;  3P30 A;  4JAV A;  3MHS C;  4P2Z A;  2EIM B;  1CP9 A;  2V1D A;  1JJ2 U;  5CBH A;  3BY6 A;  3ETD A;  1M56 C;  3OMA B;  4LP8 A;  4P9O A;  2OT5 A;  2W6J G;  1M56 B;  4MVR A;  3CCL V;  2JIZ G;  2WPD G;  2EIL C;  3HB3 B;  4XBF A;  4R7C A;  2EIK C;  1TUE B;  4MVQ A;  2AHZ A;  3HPL C;  2WLL A;  3K0D A;  1NQT A;  3E83 A;  1GM9 A;  3OGC C;  4E55 A;  1M90 W;  3ASO C;  4R6Z A;  2QKS A;  3OR7 C;  4X89 A;  1QLE C;  3SRB A;  1Q86 W;  3W7T A;  4TSF G;  4QPJ A;  5DN6 G;  4PDM A;  1SER A;  2XAJ A;  2D3O W;  1K4D C;  1PNL A;  3E35 A;  3CCR V;  1P7B A;  5EBW C;  5CN0 A;  4JGS A;  5LHG A;  1OCC B;  2YEV A;  3K06 A;  1K34 A;  3LSQ A;  3AEI A;  2JEU A;  2Q6A A;  3JTR A;  1R6N A;  3CP1 A;  2WAM A;  2LFS A;  3QO5 A;  1NR7 A;  3ABL B;  3SRC A;  1SRY A;  4G28 B;  1QVF U;  3FYI B;  5EC1 C;  1R3L C;  2DYS C;  3DGE A;  1OCO C;  2UXN A;  1PL0 A;  2ZDI A;  3SRA A;  4JYC A;  2OCC B;  3LDD A;  3CMA V;  1KP2 A;  3G6E V;  1YI2 V;  1F4M A;  2IJK A;  1ARO P;  4HAM A;  1GKF A;  4PA7 A;  1NH2 D;  1Q7Y W;  2GSM B;  3CD6 V;  3ASN C;  5CBG A;  1M1K W;  4P30 A;  1XL4 A;  4JTA B;  3FB6 C;  5LGN A;  1FFT B;  1OZ0 A;  2KB1 A;  3X2Q C;  3E8F A;  1DF4 A;  4FK5 C;  4FIP C;  2Q69 A;  2B1I A;  2HVJ C;  1HWY A;  1VQO V;  2WLK A;  2AHY A;  3B77 A;  4PEM A;  3SYP A;  1JX9 A;  2XND G;  5EC2 C;  2AE5 A;  1JVZ A;  4WCE V;  2DQ3 A;  2LP7 A;  4R50 A;  3OEE G;  3RVY A;  1PKX A;  4LCU C;  1NH2 B;  4Q20 A;  1F23 A;  2Z3Y A;  2WSS G;  5L3B A;  4WFF A;  1R3K C;  4GX2 A;  1Q82 W;  2EZP A;  3W7X A;  4F4L A;  3RVZ A;  2IJI A;  4XDL A;  1I5X A;  2FTK A;  2YSU B;  3ASO B;  4XDK A;  4Z1M G;  3K03 A;  5KA5 A;  1VQP V;  4WF9 V;  2QEX V;  3TET A;  4MTF A;  4PEL A;  1N8R W;  1H38 A;  1S3J A;  3LSS A;  4JAS A;  1WLE A;  3AG3 B;  2HG5 C;  1IXM A;  4WFE A;  1AJQ A;  2EIK B;  3OMI B;  2X6A A;  4E56 A;  2P7T C;  1E1Q G;  3DTU B;  1RPO A;  1OCC C;  4WKT A;  1OCR C;  1ORQ C;  2C2A A;  2HKO A;  1KC8 W;  5IYB O;  4UVB A;  1YJN V;  5E1A C;  4R8C A;  5IY5 C;  2EIM C;  1MG1 A;  4U7O A;  1GK0 A;  1FS0 G;  3AG2 C;  4N23 A;  3T4Z A;  5LGU A;  5IDJ A;  4MVO A;  4ASU G;  3M99 B;  3ABU A;  4I5S A;  4JTC B;  3I55 V;  5EBM C;  3KG2 A;  2HR3 A;  1VQ9 V;  1FXV A;  3W7S A;  1NVP B;  4YFB A;  1AJN A;  3STZ C;  2CK3 G;  1NKD A;  2ITD C;  5L3C A;  2B5U A;  3WG7 B;  3L91 A;  2ZR3 A;  3ZRW B;  5L3F A;  2AE4 A;  1E1R G;  1JVM A;  3T4D A;  1E79 G;  3ASN B;  2DYR B;  3G4S V;  2K1E A;  3T1C A;  3OW2 U;  2P6J A;  3K04 A;  2DYR C;  5IYC O;  1H8E G;  2IH1 C;  2LFR A;  1H2G A;  3LNM B;  1ZWI C;  4CZZ A;  3CC2 V;  3E8B A;  4WKU A;  3OR6 C;  2NLJ C;  3SJQ C;  3SPJ A;  1R6K A;  2QA4 V;  3W7W A;  2X7R B;  5CA3 A;  3LUT B;  4N21 A;  2EIJ C;  1H8H G;  5KUK A;  4FMT A;  1M9N A;  4BIZ A;  2WLJ A;  1GO3 F;  3OUS A;  5B1O A;  1YJ9 V;  3IC7 A;  2WWW A;  1FXH A;  4QPK A;  1S0V A;  1DTO A;  4QIW F;  1DF5 A;  1VQN V;  3EFF K;  3WG7 C;  1W0K G;  4WKV A;  1KP3 A;  2P90 A;  3ZMS A;  3OEH G;  2HVK C;  4UVC A;  2BOB C;  3STL C;  5B3S C;  5L3E A;  3OFN G;  3AG3 C;  4MS2 A;  1SET A;  2OTL V;  1P4R A;  1AI4 A;  2F43 G;  1KEH A;  2JJ1 G;  1QR9 A;  2HLD G;  1LNQ A;  5CBF A;  2ADV A;  3ABK B;  1M57 C;  3ZMV A;  5KUM A;  1QLN A;  4RUE A;  4P9P A;  5IYD O;  2PI4 A;  2Y69 B;  4LBE C;  1XL6 A;  3MHH C;  4RQF A;  1K8A W;  1VQ4 V;  2XAF A;  5H6Q A;  3CXC U;  1K33 A;  1B6Q A;  2QE7 G;  3UKM A;  1R3I C;  2DYS B;  4RAI A;  1KQS U;  1Q81 W;  2QM7 A;  2EIN C;  2WLM A;  4DO2 A;  2PI5 A;  3FYE B;  3ABK C;  1THZ A;  4PA6 A;  4QNH B;  1OHH G;  2ZD9 A;  3CCJ V;  1COW G;  2W6I G;  4WFB V;  1VQ8 V;  1BMF G;  3H01 A;  1NVP D;  1S76 D;  3RBZ A;  3NXS A;  4CBC A;  5CMU A;  3D3I A;  1MAB G;  2Z5U A;  4WKS A;  2Q68 A;  4E57 A;  5LBQ A;  4KUM A;  3LDE A;  1AJP A;  1AI7 A;  3CCV V;  2IH3 C;  2WLL B;  1FXK C;  4JF3 A;  2GHY A;  1G8M A;  4MTO A;  4M1J A;  3AG4 C;  1GM8 A;  3ZCC A;  1KD1 W;  4L87 A;  3K79 A;  2WYE A;  2B1G A;  1OCZ C;  3SYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...