3ML0A

Thermostable penicillin g acylase from alcaligenes faecalis in tetragonal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin G acylase, alpha subunit
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
molecule tags Hydrolase
total genus 40
structure length 195
sequence length 195
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ml0A02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3ml0A01
4HSRA 1GKFA 2WYBA 4BTHA 1AI4A 1GM9A 1FXVA 1PNLA 4PELA 4K2FA 3S8RA 4E55A 1E3AA 1GHDA 3K3WA 1GM7A 1OR0A 1AI6A 1K7DA 3JTRA 1GK9A 1CP9A 1K5SA 1PNKA 2WYCA 4HSTA 1PNMA 4WKTA 4YF9A 2WYEA 3L94A 4WKSA 3SRBA 4PEMA 1JVZA 1FM2A 1GK1A 1KEHA 4WKUA 3ML0A 3JTQA 4E57A 4YFBA 1GM8A 1K5QA 1JX9A 4E56A 4K2GA 4YFAA 1AJQA 1H2GA 1GK0A 3SRCA 3SRAA 1AJNA 2ADVA 4M1JA 4WKVA 2AE3A 2WYDA 1AJPA 1FXHA 1AI5A 2AE5A 2AE4A 3L91A 1JW0A 1KECA 1AI7A
chains in the Genus database with same CATH superfamily
3SJQC 1Y67A 4C7UA 5EK0A 4QIWF 4DV4O 3CEIA 4JI5O 5BY1A 4UFZA 1THZA 2XTAA 1JJOA 3JATA 3JAMN 5JVDA 4J7KA 2OWOA 1BSMA 3RYHA 5BR8O 4LF7B 3G71V 1RM1C 3FB6C 3LDDA 4WKVA 3PJSK 1FXHA 2CDYA 3OMNB 4KXRA 2GV9A 1MSWD 3ZRXA 4X64O 5LA6A 2IJJA 1QQCA 1N32O 1HR0B 2P7TC 1OCOC 3G6EV 4K0KO 1E3AA 4EB6A 1VF6C 1N0JA 2LFSA 4NTYA 4FZ0A 2HHHO 5IYBO 3B4SA 2WLIB 2YI9A 3BY6A 4UV9A 2AW9A 3GWKC 2EINC 4JGSA 4H13B 3ETEA 3HPLC 2UUBB 2WYBA 3ABUA 2NLJC 2ZINA 3ZEDA 4CH3A 3B8NA 4J11A 2ZNIA 3SPHA 1JVZA 3KCYA 4O4JA 3APQA 5BMVB 2GTAA 5B1NA 2HLDG 1HNZO 1OCZC 3ABTA 1E1RG 2RQ6A 3KKYA 1OCRB 4K35A 4JV5B 3ZBHA 2QM7A 2F4VB 5JCOA 1BS3A 1HNWO 1ORQC 2KSDA 4FMTA 3JTRA 4JF3A 4O2AB 1WB7A 2LGQA 3AG2C 1DF5A 4NKGB 4LF6O 5B3SB 4DR6O 3HR0A 1HP8A 2DMXA 4NXNO 3W7TA 3OD4A 2JDIG 5IY5C 2CE4A 1AJPA 3BA8A 5IYZB 1AP5A 4PI0A 4XDJA 4KP4A 3SYCA 4BIUA 2DYSC 3FX7A 2WYEA 3FB7C 3H1HH 4LR3A 1VQLV 1VIBA 3HKEA 1QVFU 4FLZA 1R3JC 4DW1A 5B1AC 2CTQA 3IGAC 4R8CA 3HKBB 4U3JA 4LF4B 4EEQA 1XREA 2X7RB 1ZUQA 4DR7O 4IL6Z 1W0JG 1EN5A 1Y6XA 1N34O 2QKSA 3G4SV 2ZDIC 1WP8A 1E1QG 4JI3O 3ZMZA 4QE9A 3WG7C 3K5MA 5L3GA 3R65A 4I4TB 2Z0AA 5LGTA 3K0DA 4BIZA 4FLTA 4O4HA 1UFIA 5L3EA 4FPPA 4O4IB 4TWKA 4HSTA 3W7UA 3L73H 1V54C 5CA1A 4OGQB 4G28B 4HYOA 1K92A 4GT1A 4GX0A 4IYHA 4K8ZA 1JFFB 2FKXA 3IC7A 1YDXA 3LSSA 5BXZA 2ZR3A 4KHPO 2ZCEA 1SC5B 4KFMA 2F95B 1GM9A 2A9HA 2PF4E 5B1BB 5LL6Y 3DXRA 3CYOA 2K9PA 1WA8A 4TQFA 3RBZA 3NR7A 4Q20A 2A3QA 3C3SA 3QO7A 1TVKA 1ZX3A 1GRJA 4LF8O 2FYUH 3LNMB 4AILC 2BTOA 3CCUV 1BCCH 1VF5B 5LP6C 5IYDO 2F43G 2A7WA 3OAAG 1WPBA 3ZRWA 1N33O 4LFAO 4LC1A 4X1IB 3K04A 1ZSPA 1XEQA 3F5WC 5CB4A 1T5EA 4CH4A 3KCXA 4XDLA 1XILA 4IT5A 4X65O 3F7YC 1I0HA 1GKFA 2ZNJA 3BABA 3BFRA 1OCCB 4PDRA 2ZDIA 5KMGB 2QSAA 3OW2U 5JQGA 1LNQA 3N2KA 1DGSA 2UXCO 4ICGA 2XOKG 1V55B 1QNMA 3E89A 1Q8IA 4K2GA 2Y0PA 3RYFA 4TV9B 4FZ1A 4LF9O 4U7OA 4JI1B 4A5UB 1F51A 3VBBA 3QO8A 1HNWB 1MOFA 4YJ2A 2QA4V 4B3TO 1GK9A 4DUZO 1S5HC 1KUQA 3I5DA 2HVKC 5A9GA 1QU7A 1AR1B 3BAAA 3FGTA 1H2LA 3SRCA 4JI4O 4J42A 1XMQB 3ABKB 3IC9A 2R72A 4UCVA 1XOUA 4GX1A 4CS3A 3ETQA 5GTHZ 1CPYA 2YIBD 3UT5A 1PD3A 4YHHO 1QLNA 3ZCCA 2DYRB 4N23A 2RDCA 2Q6AA 1P49A 1YHQV 5LP6A 2E3CA 5JJNB 3P3PA 4WFEA 4H33A 1JW0A 2QWNB 4P30A 2VQEB 4MVUA 4JI2B 4DR7B 4X1YB 1GMGA 2LQTA 4ZI7A 3H1KH 1PNMA 3T1YB 2N05A 2UU9O 2PGGA 2G38A 4JI3B 2Q0AA 3A0BZ 1XL4A 2ARHA 4GX2A 1DTOA 1NQTA 4QPJA 1HDJA 3OEEG 3BA9A 1PNLA 3CCVV 2VRZA 5LGUA 4QJFB 2ZXWC 3UM7A 4FM1A 5KX5A 4NXMB 1W0KG 2ZE8A 2LFRA 5EIBD 4DV6B 1JX9A 4I0XA 3E8GA 1RFYA 3ASOB 4R7CA 2A0LA 2HJFC 1QR9A 1W2BU 2LJ2A 2PTMA 4X9QA 3JAWB 4XBFA 3ZHTA 4YY3O 2FMLA 4PHZA 3M8AA 4UCSA 3VQVA 4UCTA 3ZX6A 2GUZB 1VQ6V 3RYIB 3D36C 1FJGB 2OTJV 2XAQA 3B2EE 3K9SA 3H01A 4J80A 2YUAA 3CC2V 4LF7O 4N21A 1ROPA 1V9PA 3ZN0A 3KZIZ 4E55A 3CC7V 3SR2C 5IDJA 3Q4HB 1YF2A 1GN2A 2EX3A 4GKJB 2LW7A 1N33B 3T4ZA 4IYIA 1K4CC 4DRXB 1AVMA 2AHZA 1VQOV 2PYLA 4YXWG 2R9IA 4B3MB 1QLEC 3OTFA 3J80N 4X65B 2X6BA 1NH2B 1QHTA 1FPOA 3SYPA 1QBZA 2Q67A 2ETNA 2AZ2A 5CBFA 4LH7A 1VQ8V 3JARB 4LWSA 2FTKA 3TXSA 5A2QN 4RO2A 1IDSA 5KHHA 1QCEA 2HR3A 1S0VA 1R6TA 2ZM6B 3N27A 4JASA 2JJ2G 1JVMA 4UVBA 1DF4A 3L74H 3S3WA 2YEVB 3EHBB 1KYOF 2Q7HA 3ZIAG 4DV0B 3ABLB 2CH7A 3LNNA 4PV1B 4OPHA 4ZBMA 2OCCC 5KA5A 4H0LB 4DUZB 2F4VO 1GTOA 1XQ8A 4L87A 1RSOA 3ZMVA 2Q5ZA 5LOVB 1K8AW 2OIEA 2EULA 2QR4A 3CRCA 4JI4B 2EJRA 1M9NA 2QE7G 5D5PA 4JI8B 2L35A 2WYDA 2DW4A 1YCIA 3D36A 5DECA 3CXCU 3OT7A 2BSKA 1MA1A 3A0RA 2JS5A 4TV8A 2WLLA 2XASA 4JYAO 2KG7A 3MHSC 3JAKA 2XUMA 1KEHA 1SQQH 4FVMA 2YXLA 2P5OA 3MAQA 4AI8A 2YXYA 4RQEA 2N74A 1BHBA 1SA0B 1X59A 5LXTA 1YIJV 3FGRA 3ZMUA 1FXKC 1B6QA 1K4DC 2VWKA 2M6YA 2DOSA 1P7BA 1WP7A 3OEHG 2V4DA 5CA0A 2CK3G 3WFVA 3ZHSA 1IVSA 5L3CA 3JYCA 1VQ4V 3AG7A 4U3FH 1NT2B 3I56V 2W6IG 4HNAB 2C2AA 1U97A 3K08A 1AI6A 1LUVA 3SYQA 4X66B 1GN4A 1S5LZ 3SRBA 4B3RO 3CRRA 2PI4A 1TGOA 4YIPA 3M99B 2BTQB 5IJ9A 1Q90D 3JD0A 3OE7G 3WB0A 1AR4A 1KBHA 4J7ZA 4BW9A 2QM4A 2CGOA 1GN3A 1AB3A 1CXZB 2WPDG 2F23A 1VEWA 4O2BA 5IJ0B 1NH2D 1NZ6A 5LHIA 3CJHA 4DV5B 3N2GA 2YC0A 5C8YB 3A2FA 5H6QA 2ZR2A 2B1GA 4UV8A 1F4MA 2E76B 1TUBB 4EFBA 4WFGA 3SJBC 1YXBA 3FAVA 1US6A 2X6AA 4PELA 1SQBH 2ZD9A 4BIOA 3OTOB 4ZOLA 4WKSA 4BWAA 5L3FA 3E2EA 5GONA 3MDSA 2YI8A 1FXKA 1JOYA 5JWPA 1ZL8A 2IBZH 3FKSG 4MVOA 2JGDA 3BRCA 3AG1B 1SQGA 3WB2A 2CAZC 2EIKC 3VQYA 1XL6A 4WKTA 2F1MA 1RSOB 1Q81W 5EYPA 1CEZA 5EBWC 3ZHUA 1KKDA 4JAUA 1M56B 1Q6IA 3F7VC 3OGIB 2DE0X 3GVMA 4PJ0Z 4MT8A 2AZ0A 1R6KA 5DEDA 4ZHQA 1KC8W 4CH6A 4TQDA 1O9GA 4JI1O 3QO5A 2Q0OC 3E83A 3C3TA 5E79Z 2F66C 1VQ7V 2EIJC 3FFQA 1VMGA 5F2VO 2P67A 2MW2B 1F4NA 2B1IA 3CMAV 1Y76A 1XMQO 1BGYH 1NS1A 1PV0A 4J41A 3DSQA 3K3WA 1J95A 2HKOA 4JYAB 3TK1A 3CCEV 1OV9A 3CD6V 4PA4A 1Y74B 5D5QA 1AJQA 3G67A 4YJ3B 1DLBA 3K5OA 5J2UA 4TUYB 1X4TA 3OMAB 1NBMG 1WJZA 5J2TA 1VF6A 1M57B 2GSMB 1YJNV 1GAXA 1FFXB 5EZYB 1M90W 4WBNA 2PI5A 2VQEO 4JI2O 4JI7B 2V7QG 4PA6A 4HBNA 3T1YO 3RYCB 3VQWA 2Y69C 4ABMA 4G27B 3AK2A 1JCHA 4JTCB 3ABMB 2ODMA 1K97A 1NTKH 4DR3O 2ADVA 2JEUA 2E5LB 3CB2A 4CBCA 3QG5A 4X20A 2EIMC 4P9OA 2F93B 5IWAB 4I55A 2MK3A 1XI1A 1YEWA 3JATB 1NR7A 4GX5A 5JVDB 4B3RB 1R3IC 3L70H 4P2ZA 3VOUA 4NXMO 3WU2Z 3RYHB 4DV6O 2WSSG 3H1JH 3K0GA 3CX5F 4GCZA 1Y4MA 3P3NA 3ASNB 2OTLV 1R3KC 5LA6B 1XNQO 3OUSA 1S5JA 1MMMA 4EB6B 2XNDG 4JI0B 5FL7G 5LMUB 3X2QC 3FB8C 5FPOA 1FJGO 5AG2A 4XDKA 2ADQB 1WB8A 3K9AA 1XMOB 5ITZA 2CUGA 4PI2A 4H37A 2GHYA 3APOA 3AG4B 4O4LA 2R70A 1JMKC 2YIDA 1JR9A 1L8DA 3STLC 3W7XA 4I9WA 4LF5B 5KHIA 3ML0A 4GKJO 4JYCA 4LH6A 4O4JB 3CCMV 3SRAA 5JH7A 3TJTA 1KU9A 4B3MO 2AE5A 4WCEV 3AK3A 2Z3YA 4LBEC 3S8RA 3CCSV 3AG3B 1K34A 2NN4A 4GKKO 4UVCA 5JJJB 3ZHVA 5DN6G 3SJAC 1GN6A 4KUMA 3LDEA 2ZM6O 1I94B 2Q7EA 4B7EA 1KMIZ 4D6TH 5LBQA 3CCJV 2QKAA 2HP8A 4X88A 2B9ZA 3ZHQA 4HSRA 4DR2B 4DV0O 1L0NH 5LYJA 3E8FA 3E8HA 2VS0A 2A79B 3HKCA 1Z2GA 1H38A 4RUFA 1RM1B 4X62B 2Y48A 3JTQA 1EBOA 2WA3A 2UUAB 3HKEB 4E56A 2DQ0A 1H2GA 3EXAA 2OT5A 3B77A 2EILC 1VQNV 1D5AA 1OCOB 3AEIA 1S3JA 4UUJC 4JI8O 2UXBB 1KECA 4U3JB 4U7NA 5H5NA 2EZOA 1Y66A 2YDEA 1K5SA 1Q6HA 3P32A 2EINB 3TCUA 4I50A 2QKCA 3ZJZA 4ZKIA 4GLXA 3RT3C 2JIZG 1NVPD 1L1FA 3SPGA 2QWRB 3BCCH 4O4HB 2ZE5A 2HFEC 3BPZA 3UQ8A 3CWBH 2P4VA 4W4KA 1XHXA 5CA1B 4IIJA 1YJWV 4DR3B 4DV7B 1BMFG 2YICA 2XT9A 2RNBA 3JD2A 3JASA 3AG2B 1JJ2U 1AI4A 1VQ9V 3RVZA 5KAFZ 3ZN1A 4FJCC 4Z1MG 3DXRB 2IH3C 4LNUA 3RGBA 2VWJA 5KUKA 1WA8B 5IY5B 4X66O 4GYCB 2KB1A 4MTFA 2QM8A 2DYSB 1TVKB 2JRIA 2QWOB 4MTOA 3QF7A 3JALA 1XNQB 1N4CA 5B1AB 4JZGA 4IHJA 4W4LA 3ZRWB 4BR6A 5KHJA 4X1KA 4DV5O 2ITDC 2BE3A 4OPAA 5CB4B 2UUCB 2HEPA 2WA4A 1EFRG 5FNVA 4BW5A 1G4YB 3HKDA 3DC5A 4DUYB 4AHCA 1F23A 2IJKA 4DV3B 4NTWA 3T1HO 5JQGB 3WG7B 3N2KB 3OTOO 4FM2A 3ZMTA 1OCRC 2RJZA 3R66A 3E22A 5TISZ 4DV2O 1SQFA 1WNSA 3RYFB 1FS0G 1B06A 1B3QA 1IX9A 5B3SC 4AQYO 4WFAV 1BHAA 1V54B 1KB9F 4JI6B 5E1AC 1K7DA 4YJ2B 4GKKB 2YXHA 1J5EO 2UXDO 4OXSA 1K5QA 4QE7A 3QNEA 1E79G 3OM3B 3OFNG 1GH6A 1I5YA 4FFBA 1ENVA 1O9HA 1IZ3A 2XHBA 3UT5B 1SF9A 4YF9A 3QVNA 2GBOA 3JSLA 2WLIA 5B1OA 3ZHRA 2P6JA 5LMNB 5LP6B 4CZZA 3HB3B 2WLNA 4MSWC 4X8AA 4MTXA 1WAZA 4DR4B 2JJ1G 5K1XA 4Z2WA 1D2DA 1YI2V 3DGEA 1IBLB 1NI8A 4WFFA 2GDSA 1K9MW 4ZI7B 4DO2A 3K5NA 1N8RW 3FYEB 3FYIB 5BMVA 5CBHA 5JJEB 2ZQMA 2YSUB 3RW0A 3CSXA 3VQXA 3RFRA 4DK1A 5EC1C 3ICXA 2WAMA 3K58A 2E74B 2O57A 1YJ9V 3STZC 4JYBA 1YTFB 2H94A 4O2AA 5KX5B 4JI7O 3THOA 1VF7A 2DWEC 2Z5UA 5B1BC 4I0XB 3H1IH 4QGPA 3UO3A 3SPJA 3JD4A 4K8XA 4FFKA 3G80A 2E5LO 5K1PA 5IYZA 4MTGA 3T1CA 4B7KA 1XUQA 5HFMA 4F6EA 3UCSC 1TA8A 5IWAO 1P7GA 1PKXA 1Z5VA 2DJVA 5CN0A 1UPGA 5EIBC 2KKWA 4DR1O 3OGCC 1SRYA 4JTDB 3SPCA 2Q68A 3ZRVA 1NU1H 4M1JA 1FYJA 1VQMV 1AILA 1K3EA 3HKBA 2HVJC 3CS5A 1Q6UA 5GW7A 4Z1VA 3A0HZ 1IBKO 1GO3F 1MG1A 4JI0O 1OCCC 4UB6Z 2PYJA 5LMUO 2NR5A 4FLVA 1PM9A 3L9DA 3D3IA 2W0FC 2QGNA 1W59A 2YIBA 4I4TA 4X89A 1NTMH 1XMOO 1V55C 1H2NA 1HW7A 1VARA 3T1HB 4O4IA 1IBMB 1SZTA 4QNHB 4LWSB 5KUMA 2Q7GA 2WLKA 4LF5O 4DV2B 1MZEA 1I08A 1ZWIC 1JFFA 1COWG 1LR1A 1R6NA 2WWWA 3CMEV 2ZXWB 4E2LA 4AQYB 4DR5O 4FFBB 2D2CB 2BCCH 2Q4PA 4Q6GA 2CH7B 2Q69A 4E4EA 2QJ1A 5LHHA 5KHGA 3ABKC 3O9OA 1J5EB 2UXDB 3U11A 3E35A 2B5UA 2CGNA 2XAFA 4LFBO 2P06A 2R9AA 1I94O 2BOCC 2EBOA 2DYRC 1I7FA 3W7SA 4MVRA 1FXVA 2CTPA 2H8PC 4B08A 4DR2O 2RCVA 1H2SB 2BSKB 1NTZH 1RP3B 4TV8B 4DV1B 4DW0A 3FB5C 2WLLB 1FFTB 2KG7B 3JAKB 4X62O 4L8JA 2KQXA 4X1IA 3QTCA 3D8CA 4LP8A 2JK5C 2UUAO 5H6RA 1YTFD 3L71H 3K59A 2R9RB 5B5EZ 5LXTB 1B04A 2UXBO 5KMGA 2QWPB 1MSDA 1ZLZA 2YIAA 2JEXA 3S3XA 2WLHA 1N36B 1QLEB 2ZIMA 2M7WA 4RUEA 5EC2C 1GM8A 1F7YA 1IURA 2AXTZ 4R6ZA 5CA0B 4TV9A 4F6RA 4PA7A 5C93A 1M93A 1YSCA 1AI5A 4I7ZB 2QEXV 4HAMA 4JYYA 3E86A 1PP9H 2IM9A 4HZ3A 3ASOC 4NR1A 1NKDA 4B3SB 2IU3A 1SS3A 2RMKB 5IJ9B 1QVGU 1DK1A 2OCCB 3LSQA 4DV7O 4FLUA 3CXHF 2YS8A 2P90A 1FAFA 1D5NA 4MW8A 2X0LA 4CC5A 5FPRA 1Q86W 3CRAA 4O2BB 3BHPA 1XDCA 3UO2A 2XAHA 3CJHB 4DR1B 3N2GB 1NVPB 4FK5C 2CTWA 1NR1A 1G8MA 2N04A 4DK0A 1H8HG 3EVKA 5BZBA 3MD0A 4PDVA 4F4LA 3CE2A 3FAVB 1JPXA 1SESA 2HJDA 4X1YA 1BL8A 3BVOA 1IBKB 4OX9B 4H44B 3FD9A 1OJHA 2Q9LA 4ZOLB 4UCUA 1EN4A 3K03A 4QPKA 1GK1A 3D3QA 3ETGA 4NTXA 5GONB 4J10A 1GK0A 4RWUA 1EN6A 3K5LA 1FXKB 4TT3G 2UUCO 5B66Z 2AE4A 4CH5A 1ZL8B 4DV4B 2ILMA 4JI5B 2JGDB 3U0ZA 3AK1A 4K2FA 3CHXA 1SQPH 4DUYO 1BZKA 4K3AA 2PZSA 1EZVH 2EZPA 4I9QA 2QTSA 4DV3O 5LGNA 4WF9V 5EYPB 3ABLC 1A32A 5BR8B 4ZIBA 3CCQV 1VQKV 1K73W 3H1LH 4YFAA 3O65A 5HFLA 1URFA 5FLXN 2IJHA 4FLYA 4DR5B 4ZHQB 3SDLA 4X64B 4IGGA 3JAWA 1G6UA 1MABG 4NB5A 1N32B 5H2FZ 4K0KB 4UCRA 1WN7A 2LW1A 4JI6O 2HHHB 2HG5C 2GUZA 5L3DA 1M1KW 3G6BA 1FD9A 3RYIA 4E57A 1XBLA 2K1EA 2Q73A 4BWCA 1PPJH 3CC4V 2ADPA 4LFBB 1OHHG 3JCUZ 5CBGA 2ITCC 1JA8A 3ETDA 3LDCA 3SYAA 1Y76B 3M7MX 4YFBA 1YZBA 2DWDC 4BTHA 4WFHA 3E8BA 4J9YB 2LGWA 3Q4HA 3UKMA 1HNXO 2CTRA 1CP9A 2PUSA 1N0NA 2ZT9B 4DRXA 1UJWB 5GTIZ 1XNRO 2IU0A 1YVWA 1IXMA 3ZS8C 4F6RB 5J2UB 5LMNO 1SQVH 1HNZB 3IJ4A 1QR8A 5J2TB 1NJIW 1U96A 3L75H 3B09A 4DR4O 4WBNB 2Y4TA 4CS4A 3JARA 4MVMA 1FKAO 5DM6V 1IBLO 1PNKA 4LF6B 2OIGA 4DR6B 4NXNB 3BEHA 1AP6A 2VQFO 3TXQA 1G1XB 1AROP 2EIKB 4UCOA 2YEVA 3ZRSA 4GZRB 3L91A 2UXNA 1ZTEA 3SYOA 1MZFA 4X20B 1H2KA 5IE9A 1MNGA 1KP3A 2ZE6A 4I55B 3JD1A 3SJCC 1M4UA 3RWRD 1TUEB 3SPIA 5CMUA 3RVYA 5LOVA 2QDOA 1OCZB 1RPRA 4P9PA 3IFXA 5LHGA 5KHKA 2LP7A 1Q3EA 3PN1A 3CRMA 3LSUA 4UB8Z 2E75B 4LFCO 4GUNA 2X6CA 2EIJB 1PL0A 4PA9A 3RN4A 3T2MA 1N34B 1PL4A 2Y4UA 3K79A 2RN9A 4NYKA 1SETA 3K06A 1VP7A 4TOIA 1SA0A 4MVQA 5H9CA 4D7TA 5ITZB 2OYQA 1AR5A 2UXXA 4UVAA 2W0XA 1K33A 4O4LB 1I5XA 4J9ZB 3JSNA 4PDMA 4JPRA 3DC6A 1FM2A 4MS2A 2JGUA 3AG1C 4D7SA 1IXBA 1SKVA 3EFFK 5IT9N 5JH7B 4NVPA 1R73A 3NXSA 4KHPB 3F5TA 2OCHA 4YIOA 1M56C 1BQZA 4JTAB 4HNAA 4UXNA 2Y69B 4RAIA 2Q8VA 4LCUC 3B40A 2GTSA 3C90A 1IBMO 3CCLV 4DXWA 1LUWA 2BTQA 2EIMB 2FL4A 4R50A 4CC6A 4LF8B 1SZXA 2NNUA 2AE3A 2LO1A 2FB5A 5IYCO 4PD4F 4WKUA 4MW3A 5KLVH 5LYJB 3HKCB 1HR0O 4MVSA 3A8TA 5IJ0A 4LFAB 3MHHC 2DQ3A 5C8YA 3T4DA 2ZKOA 2L6LA 2W6JG 1S72V 2XAJA 4DYLA 2V1DA 1TUBA 2P4KA 3B8MA 4FM0A 2XAGA 4I5SA 3TETA 1R3LC 3JCZA 1S77D 2AHYA 3KG2A 2UUBO 1H8EG 3CRQA 5EBLC 3X2QB 4BAYA 1KD1W 1GM7A 1HNXB 1KP2A 1M5IA 2BOBC 2DN9A 1M57C 3J81N 4RQFA 2UXCB 3GWOA 3L94A 3JD3A 4DV1O 4FLWA 2WLJA 1XNRB 4I50B 2QTOA 3OR6C 5CA3A 2ZE7A 3ZMSA 3CPWU 2IH1C 4LF9B 3P30A 3W7WA 4JAAA 3ABMC 4JV5O 4B3TB 1EZJA 1GHDA 1OR0A 1OZ0A 1Q82W 2WYCA 1TAEA 3CCRV 1N36O 2ZIOA 3TGUH 3U10A 1Z5WA 3K57A 2IW5A 2EJ7A 4IIJB 2VQFB 2AGAA 4J7JA 1WPXA 1WLEA 1AJNA 4JZ2A 1KKCA 3IAYA 1SERA 3SGIA 1AI7A 3JASB 3CP1A 1YITV 5KAIZ 4PDLA 3WB1A 4KL1A 4YHHB 1Q7YW 2H3OA 3H9VA 4LNUB 5EBMC 3ASNC 1XHZA 5L3BA 2ATKC 1EM1A 1RPOA 4B3SO 1S76D 1BQ0A 1H2MA 1JQ0A 4G2KA 2Y0IA 4LFCB 1P4RA 3OUFA 2QWQB 3JALB 4LF4O 2WLMA 3L72H 1HWYA 2EILB 1Q43A 3OR7C 4IHJB 4EFEA 4MVZA 1VQPV 2UU9B 4PEMA 3I55V 3AG4C 1SQXH 4X1KB 4ASUG 1Y74A 2A06H 4YJ3A 1VQ5V 2IJIA 5KA6A 4TUYA 2JVDA 4FLXA 4WFBV 3LUTB 1FFXA 5FNVB 3HKDB 5EZYA 5J9PC 1Q5OA 4JAVA 4FIPC 1KQSU 1BE3H 2JS3A 4EKWA 2D3OW 4OX9O 2PY5A 3DTUB 4CS2A 1R1BA 3RYCA 3J7AU 4TSFG 1P84F 3E22B 3AG3C 5JCOC 2P22C 3OMIB 1ZAUA 3GB7C 4PA3A 1BT8A 4YY3B 1L0LH
chains in the Genus database with same CATH topology
3SJQC 3SYPA 1QBZA 2Q67A 4MW8A 4QIWF 2X0LA 5EK0A 5CBFA 1THZA 1Q86W 1VQ8V 2EZOA 1Y66A 1K5SA 3P32A 2FTKA 2EINB 4RO2A 3TCUA 2XAHA 1NVPB 1QCEA 3ZJZA 4FK5C 2HR3A 1NR1A 1G8MA 1S0VA 3G71V 1RM1C 4ZKIA 3FB6C 4JASA 1H8HG 3LDDA 2JJ2G 1JVMA 2JIZG 3PJSK 4UVBA 1DF4A 1FXHA 4WKVA 1NVPD 5BZBA 3MD0A 3OMNB 4PDVA 2YEVB 1L1FA 3SPGA 3EHBB 4F4LA 1MSWD 3ZIAG 1JPXA 3ABLB 3ZRXA 1SESA 2IJJA 1BL8A 1E3AA 2P7TC 1OCOC 3G6EV 4ZBMA 2OCCC 5KA5A 1GTOA 2HFEC 2LFSA 4L87A 3ZMVA 5IYBO 3K03A 4QPKA 1GK1A 2WLIB 3ETGA 1K8AW 1YJWV 1GK0A 2EJRA 3BY6A 4UV9A 1M9NA 1BMFG 2QE7G 1FXKB 2EINC 4JGSA 4TT3G 2WYDA 2DW4A 2AE4A 3ETEA 3JD2A 3HPLC 3AG2B 1JJ2U 2WYBA 1AI4A 3D36A 1VQ9V 4K2FA 3RVZA 3ZN1A 3CXCU 3ABUA 4FJCC 2NLJC 4Z1MG 3A0RA 2IH3C 2EZPA 5KUKA 2WLLA 5LGNA 2XASA 3B8NA 3MHSC 5IY5B 4WF9V 3SPHA 3ABLC 1JVZA 1KEHA 3CCQV 1VQKV 1K73W 2KB1A 4YFAA 4MTFA 2QM8A 5HFLA 4RQEA 2DYSB 5B1NA 2HLDG 2IJHA 1BHBA 4MTOA 1OCZC 3ABTA 1E1RG 1MABG 1OCRB 1YIJV 3ZMUA 2QM7A 1FXKC 1B6QA 1ORQC 1K4DC 4FMTA 3JTRA 5B1AB 2HG5C 4JF3A 5L3DA 1M1KW 3ZRWB 3AG2C 1DF5A 1P7BA 5B3SB 4E57A 2K1EA 3OEHG 2ITDC 3W7TA 2CK3G 3CC4V 3WFVA 1OHHG 2JDIG 5IY5C 1AJPA 5CBGA 1EFRG 2ITCC 4BW5A 3ETDA 3LDCA 1G4YB 5L3CA 3JYCA 3SYAA 4YFBA 1VQ4V 2DWDC 4XDJA 2W6IG 4KP4A 3SYCA 4WFHA 3E8BA 2C2AA 4J9YB 3I56V 4BTHA 4BIUA 2DYSC 3K08A 1F23A 3UKMA 1AI6A 2IJKA 3SYQA 1CP9A 3WG7B 2WYEA 3SRBA 3FB7C 3ZMTA 1OCRC 1UJWB 2PI4A 1VQLV 3M99B 2IU0A 1QVFU 1IXMA 1R3JC 5B1AC 1FS0G 3JD0A 5B3SC 3IGAC 3OE7G 1QR8A 4WFAV 1NJIW 4R8CA 1BHAA 1V54B 2X7RB 5E1AC 2WPDG 1W0JG 1K7DA 4MVMA 5DM6V 1PNKA 1NH2D 5LHIA 2QKSA 4OXSA 1K5QA 3BEHA 4QE7A 5H6QA 3G4SV 2ZDIC 3QNEA 2ZR2A 1E1QG 3ZMZA 1E79G 2B1GA 4UV8A 4QE9A 3OM3B 1F4MA 3WG7C 3OFNG 1AROP 2EIKB 4WFGA 5L3GA 2YEVA 3R65A 3ZRSA 3L91A 1I5YA 2UXNA 3SYOA 1ENVA 5LGTA 2X6AA 3K0DA 4PELA 4BIZA 2ZD9A 1KP3A 5L3EA 3JD1A 4FPPA 4TWKA 4HSTA 4YF9A 3W7UA 4WKSA 1TUEB 1V54C 2WLIA 5CMUA 3RVYA 3SPIA 4G28B 5L3FA 3E2EA 4HYOA 5B1OA 1K92A 1OCZB 1RPRA 2P6JA 4GT1A 4GX0A 4P9PA 3IFXA 5LHGA 2LP7A 4CZZA 3HB3B 3IC7A 2WLNA 1FXKA 3LSSA 4MSWC 2ZR3A 1JOYA 3FKSG 4MTXA 4X8AA 4MVOA 2JJ1G 4KFMA 2X6CA 1GM9A 2EIJB 1PL0A 2A9HA 4PA9A 1YI2V 3AG1B 5B1BB 3DGEA 3T2MA 3CYOA 2EIKC 4WFFA 1XL6A 4WKTA 1K9MW 1Q81W 1CEZA 4DO2A 5EBWC 1KKDA 4JAUA 1M56B 3F7VC 1N8RW 3FYEB 3FYIB 3K79A 5CBHA 3RBZA 4MT8A 4Q20A 3QO7A 1SETA 3K06A 2ZQMA 1R6KA 5H9CA 2YSUB 4MVQA 3RW0A 1KC8W 3LNMB 5EC1C 2UXXA 4UVAA 3QO5A 2WAMA 3CCUV 1K33A 3E83A 5IYDO 2F43G 3OAAG 1YJ9V 1NH2B 3STZC 1I5XA 4JYBA 4J9ZB 1YTFB 4PDMA 2H94A 4JPRA 3ZRWA 1FM2A 4MS2A 1VQ7V 2EIJC 4LC1A 2DWEC 2Z5UA 3AG1C 5B1BC 3K04A 3EFFK 2P67A 3F5WC 3SPJA 3JD4A 1R73A 3NXSA 4XDLA 1F4NA 2B1IA 1M56C 3CMAV 3F7YC 4MTGA 3T1CA 4JTAB 1GKFA 4UXNA 5HFMA 2Y69B 1OCCB 4PDRA 2ZDIA 3K3WA 1J95A 4RAIA 2HKOA 3OW2U 1PKXA 4LCUC 1LNQA 3TK1A 4DXWA 3CCLV 5CN0A 3CCEV 3CD6V 4PA4A 3OGCC 2XOKG 1SRYA 1V55B 2EIMB 3E89A 4JTDB 3SPCA 1AJQA 2Q68A 3ZRVA 4K2GA 1DLBA 4R50A 3OMAB 1NBMG 4M1JA 2NNUA 2AE3A 4U7OA 1VQMV 5IYCO 1M57B 1K3EA 2GSMB 4MW3A 2HVJC 1YJNV 4WKUA 1M90W 1F51A 2PI5A 5GW7A 3QO8A 3VBBA 1MOFA 4MVSA 2QA4V 2V7QG 1GK9A 1GO3F 1S5HC 4PA6A 1MG1A 3MHHC 2HVKC 2DQ3A 1AR1B 2Y69C 3T4DA 4G27B 1OCCC 2W6JG 1JCHA 4JTCB 3ABMB 2XAJA 1S72V 1K97A 3SRCA 2V1DA 3D3IA 2W0FC 2ADVA 2JEUA 3B8MA 4CBCA 4X89A 2XAGA 3ABKB 4I5SA 1R3LC 3TETA 3JCZA 1V55C 2EIMC 4P9OA 1S77D 2AHYA 4GX1A 3KG2A 1H8EG 5EBLC 3X2QB 4BAYA 1KD1W 1GM7A 1CPYA 1KP2A 2MK3A 2BOBC 1SZTA 1M57C 1NR7A 1PD3A 4GX5A 4RQFA 4QNHB 3GWOA 1QLNA 3JD3A 1R3IC 3L94A 5KUMA 3ZCCA 2WLKA 2WLJA 4P2ZA 3VOUA 2QTOA 2DYRB 3OR6C 4N23A 5CA3A 2Q6AA 3CPWU 3ZMSA 1ZWIC 2IH1C 2WSSG 1YHQV 3K0GA 1COWG 1R6NA 2WWWA 3CMEV 2ZXWB 4GCZA 4E2LA 3P30A 3W7WA 1Y4MA 4WFEA 4H33A 1JW0A 3ASNB 2OTLV 4P30A 3ABMC 1R3KC 4MVUA 2Q69A 5LHHA 3OUSA 1EZJA 1GHDA 1GMGA 1OR0A 1OZ0A 1Q82W 2XNDG 2WYCA 1PNMA 3ABKC 3CCRV 5FL7G 2IW5A 3E35A 3X2QC 3FB8C 2B5UA 4XDKA 1WPXA 1WLEA 2XAFA 1AJNA 1XL4A 3K9AA 4GX2A 1DTOA 2BOCC 2EBOA 1NQTA 2DYRC 4H37A 1SERA 1AI7A 2GHYA 4QPJA 3OEEG 3W7SA 3CP1A 4MVRA 3AG4B 1FXVA 1PNLA 1YITV 2H8PC 3CCVV 5LGUA 4PDLA 4QJFB 2ZXWC 3UM7A 1Q7YW 3STLC 3W7XA 5EBMC 4I9WA 3FB5C 3ASNC 2WLLB 5L3BA 1FFTB 1W0KG 2ATKC 1RPOA 3ML0A 2LFRA 4JYCA 1JX9A 1S76D 3E8GA 4LP8A 2JK5C 3CCMV 5H6RA 3SRAA 3ASOB 4R7CA 2A0LA 1YTFD 2HJFC 1QR9A 1W2BU 1JQ0A 4G2KA 2AE5A 4WCEV 2R9RB 1P4RA 2Z3YA 4LBEC 4XBFA 3OUFA 3S8RA 3CCSV 2WLMA 3AG3B 2JEXA 1HWYA 1K34A 2EILB 2WLHA 3OR7C 1QLEB 4MVZA 4UVCA 1VQPV 3I55V 5DN6G 1VQ6V 3AG4C 4PEMA 2M7WA 4RUEA 5EC2C 1GM8A 4ASUG 2OTJV 1VQ5V 2XAQA 4R6ZA 4KUMA 2IJIA 3H01A 5KA6A 3LDEA 3CC2V 4PA7A 4N21A 1ROPA 3ZN0A 5C93A 5LBQA 3CCJV 1YSCA 1AI5A 4WFBV 3LUTB 2QEXV 4HAMA 4X88A 3E86A 4HSRA 5J9PC 4E55A 3CC7V 4JAVA 4FIPC 3ASOC 4HZ3A 1KQSU 5IDJA 3E8FA 3E8HA 2A79B 1H38A 4RUFA 4EKWA 1RM1B 1NKDA 2D3OW 3DTUB 2Y48A 3T4ZA 2IU3A 1K4CC 3JTQA 1EBOA 4TSFG 4E56A 2DQ0A 3AG3C 1H2GA 2OT5A 2AHZA 3B77A 2EILC 1VQOV 1QVGU 1VQNV 4YXWG 2R9IA 1OCOB 2OCCB 1QLEC 3LSQA 3OMIB 3AEIA 2X6BA 1S3JA 3GB7C 4PA3A 4UUJC 2P90A 1KECA 4U7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSR A;  1GKF A;  2WYB A;  4BTH A;  1AI4 A;  1GM9 A;  1FXV A;  1PNL A;  4PEL A;  4K2F A;  3S8R A;  4E55 A;  1E3A A;  1GHD A;  3K3W A;  1GM7 A;  1OR0 A;  1AI6 A;  1K7D A;  3JTR A;  1GK9 A;  1CP9 A;  1K5S A;  1PNK A;  2WYC A;  4HST A;  1PNM A;  4WKT A;  4YF9 A;  2WYE A;  3L94 A;  4WKS A;  3SRB A;  4PEM A;  1JVZ A;  1FM2 A;  1GK1 A;  1KEH A;  4WKU A;  3ML0 A;  3JTQ A;  4E57 A;  4YFB A;  1GM8 A;  1K5Q A;  1JX9 A;  4E56 A;  4K2G A;  4YFA A;  1AJQ A;  1H2G A;  1GK0 A;  3SRC A;  3SRA A;  1AJN A;  2ADV A;  4M1J A;  4WKV A;  2AE3 A;  2WYD A;  1AJP A;  1FXH A;  1AI5 A;  2AE5 A;  2AE4 A;  3L91 A;  1JW0 A;  1KEC A;  1AI7 A; 
#chains in the Genus database with same CATH topology
 3SJQ C;  1Y67 A;  4C7U A;  5EK0 A;  4QIW F;  4DV4 O;  3CEI A;  4JI5 O;  5BY1 A;  4UFZ A;  1THZ A;  2XTA A;  1JJO A;  3JAT A;  3JAM N;  5JVD A;  4J7K A;  2OWO A;  1BSM A;  3RYH A;  5BR8 O;  4LF7 B;  3G71 V;  1RM1 C;  3FB6 C;  3LDD A;  4WKV A;  3PJS K;  1FXH A;  2CDY A;  3OMN B;  4KXR A;  2GV9 A;  1MSW D;  3ZRX A;  4X64 O;  5LA6 A;  2IJJ A;  1QQC A;  1N32 O;  1HR0 B;  2P7T C;  1OCO C;  3G6E V;  4K0K O;  1E3A A;  4EB6 A;  1VF6 C;  1N0J A;  2LFS A;  4NTY A;  4FZ0 A;  2HHH O;  5IYB O;  3B4S A;  2WLI B;  2YI9 A;  3BY6 A;  4UV9 A;  2AW9 A;  3GWK C;  2EIN C;  4JGS A;  4H13 B;  3ETE A;  3HPL C;  2UUB B;  2WYB A;  3ABU A;  2NLJ C;  2ZIN A;  3ZED A;  4CH3 A;  3B8N A;  4J11 A;  2ZNI A;  3SPH A;  1JVZ A;  3KCY A;  4O4J A;  3APQ A;  5BMV B;  2GTA A;  5B1N A;  2HLD G;  1HNZ O;  1OCZ C;  3ABT A;  1E1R G;  2RQ6 A;  3KKY A;  1OCR B;  4K35 A;  4JV5 B;  3ZBH A;  2QM7 A;  2F4V B;  5JCO A;  1BS3 A;  1HNW O;  1ORQ C;  2KSD A;  4FMT A;  3JTR A;  4JF3 A;  4O2A B;  1WB7 A;  2LGQ A;  3AG2 C;  1DF5 A;  4NKG B;  4LF6 O;  5B3S B;  4DR6 O;  3HR0 A;  1HP8 A;  2DMX A;  4NXN O;  3W7T A;  3OD4 A;  2JDI G;  5IY5 C;  2CE4 A;  1AJP A;  3BA8 A;  5IYZ B;  1AP5 A;  4PI0 A;  4XDJ A;  4KP4 A;  3SYC A;  4BIU A;  2DYS C;  3FX7 A;  2WYE A;  3FB7 C;  3H1H H;  4LR3 A;  1VQL V;  1VIB A;  3HKE A;  1QVF U;  4FLZ A;  1R3J C;  4DW1 A;  5B1A C;  2CTQ A;  3IGA C;  4R8C A;  3HKB B;  4U3J A;  4LF4 B;  4EEQ A;  1XRE A;  2X7R B;  1ZUQ A;  4DR7 O;  4IL6 Z;  1W0J G;  1EN5 A;  1Y6X A;  1N34 O;  2QKS A;  3G4S V;  2ZDI C;  1WP8 A;  1E1Q G;  4JI3 O;  3ZMZ A;  4QE9 A;  3WG7 C;  3K5M A;  5L3G A;  3R65 A;  4I4T B;  2Z0A A;  5LGT A;  3K0D A;  4BIZ A;  4FLT A;  4O4H A;  1UFI A;  5L3E A;  4FPP A;  4O4I B;  4TWK A;  4HST A;  3W7U A;  3L73 H;  1V54 C;  5CA1 A;  4OGQ B;  4G28 B;  4HYO A;  1K92 A;  4GT1 A;  4GX0 A;  4IYH A;  4K8Z A;  1JFF B;  2FKX A;  3IC7 A;  1YDX A;  3LSS A;  5BXZ A;  2ZR3 A;  4KHP O;  2ZCE A;  1SC5 B;  4KFM A;  2F95 B;  1GM9 A;  2A9H A;  2PF4 E;  5B1B B;  5LL6 Y;  3DXR A;  3CYO A;  2K9P A;  1WA8 A;  4TQF A;  3RBZ A;  3NR7 A;  4Q20 A;  2A3Q A;  3C3S A;  3QO7 A;  1TVK A;  1ZX3 A;  1GRJ A;  4LF8 O;  2FYU H;  3LNM B;  4AIL C;  2BTO A;  3CCU V;  1BCC H;  1VF5 B;  5LP6 C;  5IYD O;  2F43 G;  2A7W A;  3OAA G;  1WPB A;  3ZRW A;  1N33 O;  4LFA O;  4LC1 A;  4X1I B;  3K04 A;  1ZSP A;  1XEQ A;  3F5W C;  5CB4 A;  1T5E A;  4CH4 A;  3KCX A;  4XDL A;  1XIL A;  4IT5 A;  4X65 O;  3F7Y C;  1I0H A;  1GKF A;  2ZNJ A;  3BAB A;  3BFR A;  1OCC B;  4PDR A;  2ZDI A;  5KMG B;  2QSA A;  3OW2 U;  5JQG A;  1LNQ A;  3N2K A;  1DGS A;  2UXC O;  4ICG A;  2XOK G;  1V55 B;  1QNM A;  3E89 A;  1Q8I A;  4K2G A;  2Y0P A;  3RYF A;  4TV9 B;  4FZ1 A;  4LF9 O;  4U7O A;  4JI1 B;  4A5U B;  1F51 A;  3VBB A;  3QO8 A;  1HNW B;  1MOF A;  4YJ2 A;  2QA4 V;  4B3T O;  1GK9 A;  4DUZ O;  1S5H C;  1KUQ A;  3I5D A;  2HVK C;  5A9G A;  1QU7 A;  1AR1 B;  3BAA A;  3FGT A;  1H2L A;  3SRC A;  4JI4 O;  4J42 A;  1XMQ B;  3ABK B;  3IC9 A;  2R72 A;  4UCV A;  1XOU A;  4GX1 A;  4CS3 A;  3ETQ A;  5GTH Z;  1CPY A;  2YIB D;  3UT5 A;  1PD3 A;  4YHH O;  1QLN A;  3ZCC A;  2DYR B;  4N23 A;  2RDC A;  2Q6A A;  1P49 A;  1YHQ V;  5LP6 A;  2E3C A;  5JJN B;  3P3P A;  4WFE A;  4H33 A;  1JW0 A;  2QWN B;  4P30 A;  2VQE B;  4MVU A;  4JI2 B;  4DR7 B;  4X1Y B;  1GMG A;  2LQT A;  4ZI7 A;  3H1K H;  1PNM A;  3T1Y B;  2N05 A;  2UU9 O;  2PGG A;  2G38 A;  4JI3 B;  2Q0A A;  3A0B Z;  1XL4 A;  2ARH A;  4GX2 A;  1DTO A;  1NQT A;  4QPJ A;  1HDJ A;  3OEE G;  3BA9 A;  1PNL A;  3CCV V;  2VRZ A;  5LGU A;  4QJF B;  2ZXW C;  3UM7 A;  4FM1 A;  5KX5 A;  4NXM B;  1W0K G;  2ZE8 A;  2LFR A;  5EIB D;  4DV6 B;  1JX9 A;  4I0X A;  3E8G A;  1RFY A;  3ASO B;  4R7C A;  2A0L A;  2HJF C;  1QR9 A;  1W2B U;  2LJ2 A;  2PTM A;  4X9Q A;  3JAW B;  4XBF A;  3ZHT A;  4YY3 O;  2FML A;  4PHZ A;  3M8A A;  4UCS A;  3VQV A;  4UCT A;  3ZX6 A;  2GUZ B;  1VQ6 V;  3RYI B;  3D36 C;  1FJG B;  2OTJ V;  2XAQ A;  3B2E E;  3K9S A;  3H01 A;  4J80 A;  2YUA A;  3CC2 V;  4LF7 O;  4N21 A;  1ROP A;  1V9P A;  3ZN0 A;  3KZI Z;  4E55 A;  3CC7 V;  3SR2 C;  5IDJ A;  3Q4H B;  1YF2 A;  1GN2 A;  2EX3 A;  4GKJ B;  2LW7 A;  1N33 B;  3T4Z A;  4IYI A;  1K4C C;  4DRX B;  1AVM A;  2AHZ A;  1VQO V;  2PYL A;  4YXW G;  2R9I A;  4B3M B;  1QLE C;  3OTF A;  3J80 N;  4X65 B;  2X6B A;  1NH2 B;  1QHT A;  1FPO A;  3SYP A;  1QBZ A;  2Q67 A;  2ETN A;  2AZ2 A;  5CBF A;  4LH7 A;  1VQ8 V;  3JAR B;  4LWS A;  2FTK A;  3TXS A;  5A2Q N;  4RO2 A;  1IDS A;  5KHH A;  1QCE A;  2HR3 A;  1S0V A;  1R6T A;  2ZM6 B;  3N27 A;  4JAS A;  2JJ2 G;  1JVM A;  4UVB A;  1DF4 A;  3L74 H;  3S3W A;  2YEV B;  3EHB B;  1KYO F;  2Q7H A;  3ZIA G;  4DV0 B;  3ABL B;  2CH7 A;  3LNN A;  4PV1 B;  4OPH A;  4ZBM A;  2OCC C;  5KA5 A;  4H0L B;  4DUZ B;  2F4V O;  1GTO A;  1XQ8 A;  4L87 A;  1RSO A;  3ZMV A;  2Q5Z A;  5LOV B;  1K8A W;  2OIE A;  2EUL A;  2QR4 A;  3CRC A;  4JI4 B;  2EJR A;  1M9N A;  2QE7 G;  5D5P A;  4JI8 B;  2L35 A;  2WYD A;  2DW4 A;  1YCI A;  3D36 A;  5DEC A;  3CXC U;  3OT7 A;  2BSK A;  1MA1 A;  3A0R A;  2JS5 A;  4TV8 A;  2WLL A;  2XAS A;  4JYA O;  2KG7 A;  3MHS C;  3JAK A;  2XUM A;  1KEH A;  1SQQ H;  4FVM A;  2YXL A;  2P5O A;  3MAQ A;  4AI8 A;  2YXY A;  4RQE A;  2N74 A;  1BHB A;  1SA0 B;  1X59 A;  5LXT A;  1YIJ V;  3FGR A;  3ZMU A;  1FXK C;  1B6Q A;  1K4D C;  2VWK A;  2M6Y A;  2DOS A;  1P7B A;  1WP7 A;  3OEH G;  2V4D A;  5CA0 A;  2CK3 G;  3WFV A;  3ZHS A;  1IVS A;  5L3C A;  3JYC A;  1VQ4 V;  3AG7 A;  4U3F H;  1NT2 B;  3I56 V;  2W6I G;  4HNA B;  2C2A A;  1U97 A;  3K08 A;  1AI6 A;  1LUV A;  3SYQ A;  4X66 B;  1GN4 A;  1S5L Z;  3SRB A;  4B3R O;  3CRR A;  2PI4 A;  1TGO A;  4YIP A;  3M99 B;  2BTQ B;  5IJ9 A;  1Q90 D;  3JD0 A;  3OE7 G;  3WB0 A;  1AR4 A;  1KBH A;  4J7Z A;  4BW9 A;  2QM4 A;  2CGO A;  1GN3 A;  1AB3 A;  1CXZ B;  2WPD G;  2F23 A;  1VEW A;  4O2B A;  5IJ0 B;  1NH2 D;  1NZ6 A;  5LHI A;  3CJH A;  4DV5 B;  3N2G A;  2YC0 A;  5C8Y B;  3A2F A;  5H6Q A;  2ZR2 A;  2B1G A;  4UV8 A;  1F4M A;  2E76 B;  1TUB B;  4EFB A;  4WFG A;  3SJB C;  1YXB A;  3FAV A;  1US6 A;  2X6A A;  4PEL A;  1SQB H;  2ZD9 A;  4BIO A;  3OTO B;  4ZOL A;  4WKS A;  4BWA A;  5L3F A;  3E2E A;  5GON A;  3MDS A;  2YI8 A;  1FXK A;  1JOY A;  5JWP A;  1ZL8 A;  2IBZ H;  3FKS G;  4MVO A;  2JGD A;  3BRC A;  3AG1 B;  1SQG A;  3WB2 A;  2CAZ C;  2EIK C;  3VQY A;  1XL6 A;  4WKT A;  2F1M A;  1RSO B;  1Q81 W;  5EYP A;  1CEZ A;  5EBW C;  3ZHU A;  1KKD A;  4JAU A;  1M56 B;  1Q6I A;  3F7V C;  3OGI B;  2DE0 X;  3GVM A;  4PJ0 Z;  4MT8 A;  2AZ0 A;  1R6K A;  5DED A;  4ZHQ A;  1KC8 W;  4CH6 A;  4TQD A;  1O9G A;  4JI1 O;  3QO5 A;  2Q0O C;  3E83 A;  3C3T A;  5E79 Z;  2F66 C;  1VQ7 V;  2EIJ C;  3FFQ A;  1VMG A;  5F2V O;  2P67 A;  2MW2 B;  1F4N A;  2B1I A;  3CMA V;  1Y76 A;  1XMQ O;  1BGY H;  1NS1 A;  1PV0 A;  4J41 A;  3DSQ A;  3K3W A;  1J95 A;  2HKO A;  4JYA B;  3TK1 A;  3CCE V;  1OV9 A;  3CD6 V;  4PA4 A;  1Y74 B;  5D5Q A;  1AJQ A;  3G67 A;  4YJ3 B;  1DLB A;  3K5O A;  5J2U A;  4TUY B;  1X4T A;  3OMA B;  1NBM G;  1WJZ A;  5J2T A;  1VF6 A;  1M57 B;  2GSM B;  1YJN V;  1GAX A;  1FFX B;  5EZY B;  1M90 W;  4WBN A;  2PI5 A;  2VQE O;  4JI2 O;  4JI7 B;  2V7Q G;  4PA6 A;  4HBN A;  3T1Y O;  3RYC B;  3VQW A;  2Y69 C;  4ABM A;  4G27 B;  3AK2 A;  1JCH A;  4JTC B;  3ABM B;  2ODM A;  1K97 A;  1NTK H;  4DR3 O;  2ADV A;  2JEU A;  2E5L B;  3CB2 A;  4CBC A;  3QG5 A;  4X20 A;  2EIM C;  4P9O A;  2F93 B;  5IWA B;  4I55 A;  2MK3 A;  1XI1 A;  1YEW A;  3JAT B;  1NR7 A;  4GX5 A;  5JVD B;  4B3R B;  1R3I C;  3L70 H;  4P2Z A;  3VOU A;  4NXM O;  3WU2 Z;  3RYH B;  4DV6 O;  2WSS G;  3H1J H;  3K0G A;  3CX5 F;  4GCZ A;  1Y4M A;  3P3N A;  3ASN B;  2OTL V;  1R3K C;  5LA6 B;  1XNQ O;  3OUS A;  1S5J A;  1MMM A;  4EB6 B;  2XND G;  4JI0 B;  5FL7 G;  5LMU B;  3X2Q C;  3FB8 C;  5FPO A;  1FJG O;  5AG2 A;  4XDK A;  2ADQ B;  1WB8 A;  3K9A A;  1XMO B;  5ITZ A;  2CUG A;  4PI2 A;  4H37 A;  2GHY A;  3APO A;  3AG4 B;  4O4L A;  2R70 A;  1JMK C;  2YID A;  1JR9 A;  1L8D A;  3STL C;  3W7X A;  4I9W A;  4LF5 B;  5KHI A;  3ML0 A;  4GKJ O;  4JYC A;  4LH6 A;  4O4J B;  3CCM V;  3SRA A;  5JH7 A;  3TJT A;  1KU9 A;  4B3M O;  2AE5 A;  4WCE V;  3AK3 A;  2Z3Y A;  4LBE C;  3S8R A;  3CCS V;  3AG3 B;  1K34 A;  2NN4 A;  4GKK O;  4UVC A;  5JJJ B;  3ZHV A;  5DN6 G;  3SJA C;  1GN6 A;  4KUM A;  3LDE A;  2ZM6 O;  1I94 B;  2Q7E A;  4B7E A;  1KMI Z;  4D6T H;  5LBQ A;  3CCJ V;  2QKA A;  2HP8 A;  4X88 A;  2B9Z A;  3ZHQ A;  4HSR A;  4DR2 B;  4DV0 O;  1L0N H;  5LYJ A;  3E8F A;  3E8H A;  2VS0 A;  2A79 B;  3HKC A;  1Z2G A;  1H38 A;  4RUF A;  1RM1 B;  4X62 B;  2Y48 A;  3JTQ A;  1EBO A;  2WA3 A;  2UUA B;  3HKE B;  4E56 A;  2DQ0 A;  1H2G A;  3EXA A;  2OT5 A;  3B77 A;  2EIL C;  1VQN V;  1D5A A;  1OCO B;  3AEI A;  1S3J A;  4UUJ C;  4JI8 O;  2UXB B;  1KEC A;  4U3J B;  4U7N A;  5H5N A;  2EZO A;  1Y66 A;  2YDE A;  1K5S A;  1Q6H A;  3P32 A;  2EIN B;  3TCU A;  4I50 A;  2QKC A;  3ZJZ A;  4ZKI A;  4GLX A;  3RT3 C;  2JIZ G;  1NVP D;  1L1F A;  3SPG A;  2QWR B;  3BCC H;  4O4H B;  2ZE5 A;  2HFE C;  3BPZ A;  3UQ8 A;  3CWB H;  2P4V A;  4W4K A;  1XHX A;  5CA1 B;  4IIJ A;  1YJW V;  4DR3 B;  4DV7 B;  1BMF G;  2YIC A;  2XT9 A;  2RNB A;  3JD2 A;  3JAS A;  3AG2 B;  1JJ2 U;  1AI4 A;  1VQ9 V;  3RVZ A;  5KAF Z;  3ZN1 A;  4FJC C;  4Z1M G;  3DXR B;  2IH3 C;  4LNU A;  3RGB A;  2VWJ A;  5KUK A;  1WA8 B;  5IY5 B;  4X66 O;  4GYC B;  2KB1 A;  4MTF A;  2QM8 A;  2DYS B;  1TVK B;  2JRI A;  2QWO B;  4MTO A;  3QF7 A;  3JAL A;  1XNQ B;  1N4C A;  5B1A B;  4JZG A;  4IHJ A;  4W4L A;  3ZRW B;  4BR6 A;  5KHJ A;  4X1K A;  4DV5 O;  2ITD C;  2BE3 A;  4OPA A;  5CB4 B;  2UUC B;  2HEP A;  2WA4 A;  1EFR G;  5FNV A;  4BW5 A;  1G4Y B;  3HKD A;  3DC5 A;  4DUY B;  4AHC A;  1F23 A;  2IJK A;  4DV3 B;  4NTW A;  3T1H O;  5JQG B;  3WG7 B;  3N2K B;  3OTO O;  4FM2 A;  3ZMT A;  1OCR C;  2RJZ A;  3R66 A;  3E22 A;  5TIS Z;  4DV2 O;  1SQF A;  1WNS A;  3RYF B;  1FS0 G;  1B06 A;  1B3Q A;  1IX9 A;  5B3S C;  4AQY O;  4WFA V;  1BHA A;  1V54 B;  1KB9 F;  4JI6 B;  5E1A C;  1K7D A;  4YJ2 B;  4GKK B;  2YXH A;  1J5E O;  2UXD O;  4OXS A;  1K5Q A;  4QE7 A;  3QNE A;  1E79 G;  3OM3 B;  3OFN G;  1GH6 A;  1I5Y A;  4FFB A;  1ENV A;  1O9H A;  1IZ3 A;  2XHB A;  3UT5 B;  1SF9 A;  4YF9 A;  3QVN A;  2GBO A;  3JSL A;  2WLI A;  5B1O A;  3ZHR A;  2P6J A;  5LMN B;  5LP6 B;  4CZZ A;  3HB3 B;  2WLN A;  4MSW C;  4X8A A;  4MTX A;  1WAZ A;  4DR4 B;  2JJ1 G;  5K1X A;  4Z2W A;  1D2D A;  1YI2 V;  3DGE A;  1IBL B;  1NI8 A;  4WFF A;  2GDS A;  1K9M W;  4ZI7 B;  4DO2 A;  3K5N A;  1N8R W;  3FYE B;  3FYI B;  5BMV A;  5CBH A;  5JJE B;  2ZQM A;  2YSU B;  3RW0 A;  3CSX A;  3VQX A;  3RFR A;  4DK1 A;  5EC1 C;  3ICX A;  2WAM A;  3K58 A;  2E74 B;  2O57 A;  1YJ9 V;  3STZ C;  4JYB A;  1YTF B;  2H94 A;  4O2A A;  5KX5 B;  4JI7 O;  3THO A;  1VF7 A;  2DWE C;  2Z5U A;  5B1B C;  4I0X B;  3H1I H;  4QGP A;  3UO3 A;  3SPJ A;  3JD4 A;  4K8X A;  4FFK A;  3G80 A;  2E5L O;  5K1P A;  5IYZ A;  4MTG A;  3T1C A;  4B7K A;  1XUQ A;  5HFM A;  4F6E A;  3UCS C;  1TA8 A;  5IWA O;  1P7G A;  1PKX A;  1Z5V A;  2DJV A;  5CN0 A;  1UPG A;  5EIB C;  2KKW A;  4DR1 O;  3OGC C;  1SRY A;  4JTD B;  3SPC A;  2Q68 A;  3ZRV A;  1NU1 H;  4M1J A;  1FYJ A;  1VQM V;  1AIL A;  1K3E A;  3HKB A;  2HVJ C;  3CS5 A;  1Q6U A;  5GW7 A;  4Z1V A;  3A0H Z;  1IBK O;  1GO3 F;  1MG1 A;  4JI0 O;  1OCC C;  4UB6 Z;  2PYJ A;  5LMU O;  2NR5 A;  4FLV A;  1PM9 A;  3L9D A;  3D3I A;  2W0F C;  2QGN A;  1W59 A;  2YIB A;  4I4T A;  4X89 A;  1NTM H;  1XMO O;  1V55 C;  1H2N A;  1HW7 A;  1VAR A;  3T1H B;  4O4I A;  1IBM B;  1SZT A;  4QNH B;  4LWS B;  5KUM A;  2Q7G A;  2WLK A;  4LF5 O;  4DV2 B;  1MZE A;  1I08 A;  1ZWI C;  1JFF A;  1COW G;  1LR1 A;  1R6N A;  2WWW A;  3CME V;  2ZXW B;  4E2L A;  4AQY B;  4DR5 O;  4FFB B;  2D2C B;  2BCC H;  2Q4P A;  4Q6G A;  2CH7 B;  2Q69 A;  4E4E A;  2QJ1 A;  5LHH A;  5KHG A;  3ABK C;  3O9O A;  1J5E B;  2UXD B;  3U11 A;  3E35 A;  2B5U A;  2CGN A;  2XAF A;  4LFB O;  2P06 A;  2R9A A;  1I94 O;  2BOC C;  2EBO A;  2DYR C;  1I7F A;  3W7S A;  4MVR A;  1FXV A;  2CTP A;  2H8P C;  4B08 A;  4DR2 O;  2RCV A;  1H2S B;  2BSK B;  1NTZ H;  1RP3 B;  4TV8 B;  4DV1 B;  4DW0 A;  3FB5 C;  2WLL B;  1FFT B;  2KG7 B;  3JAK B;  4X62 O;  4L8J A;  2KQX A;  4X1I A;  3QTC A;  3D8C A;  4LP8 A;  2JK5 C;  2UUA O;  5H6R A;  1YTF D;  3L71 H;  3K59 A;  2R9R B;  5B5E Z;  5LXT B;  1B04 A;  2UXB O;  5KMG A;  2QWP B;  1MSD A;  1ZLZ A;  2YIA A;  2JEX A;  3S3X A;  2WLH A;  1N36 B;  1QLE B;  2ZIM A;  2M7W A;  4RUE A;  5EC2 C;  1GM8 A;  1F7Y A;  1IUR A;  2AXT Z;  4R6Z A;  5CA0 B;  4TV9 A;  4F6R A;  4PA7 A;  5C93 A;  1M93 A;  1YSC A;  1AI5 A;  4I7Z B;  2QEX V;  4HAM A;  4JYY A;  3E86 A;  1PP9 H;  2IM9 A;  4HZ3 A;  3ASO C;  4NR1 A;  1NKD A;  4B3S B;  2IU3 A;  1SS3 A;  2RMK B;  5IJ9 B;  1QVG U;  1DK1 A;  2OCC B;  3LSQ A;  4DV7 O;  4FLU A;  3CXH F;  2YS8 A;  2P90 A;  1FAF A;  1D5N A;  4MW8 A;  2X0L A;  4CC5 A;  5FPR A;  1Q86 W;  3CRA A;  4O2B B;  3BHP A;  1XDC A;  3UO2 A;  2XAH A;  3CJH B;  4DR1 B;  3N2G B;  1NVP B;  4FK5 C;  2CTW A;  1NR1 A;  1G8M A;  2N04 A;  4DK0 A;  1H8H G;  3EVK A;  5BZB A;  3MD0 A;  4PDV A;  4F4L A;  3CE2 A;  3FAV B;  1JPX A;  1SES A;  2HJD A;  4X1Y A;  1BL8 A;  3BVO A;  1IBK B;  4OX9 B;  4H44 B;  3FD9 A;  1OJH A;  2Q9L A;  4ZOL B;  4UCU A;  1EN4 A;  3K03 A;  4QPK A;  1GK1 A;  3D3Q A;  3ETG A;  4NTX A;  5GON B;  4J10 A;  1GK0 A;  4RWU A;  1EN6 A;  3K5L A;  1FXK B;  4TT3 G;  2UUC O;  5B66 Z;  2AE4 A;  4CH5 A;  1ZL8 B;  4DV4 B;  2ILM A;  4JI5 B;  2JGD B;  3U0Z A;  3AK1 A;  4K2F A;  3CHX A;  1SQP H;  4DUY O;  1BZK A;  4K3A A;  2PZS A;  1EZV H;  2EZP A;  4I9Q A;  2QTS A;  4DV3 O;  5LGN A;  4WF9 V;  5EYP B;  3ABL C;  1A32 A;  5BR8 B;  4ZIB A;  3CCQ V;  1VQK V;  1K73 W;  3H1L H;  4YFA A;  3O65 A;  5HFL A;  1URF A;  5FLX N;  2IJH A;  4FLY A;  4DR5 B;  4ZHQ B;  3SDL A;  4X64 B;  4IGG A;  3JAW A;  1G6U A;  1MAB G;  4NB5 A;  1N32 B;  5H2F Z;  4K0K B;  4UCR A;  1WN7 A;  2LW1 A;  4JI6 O;  2HHH B;  2HG5 C;  2GUZ A;  5L3D A;  1M1K W;  3G6B A;  1FD9 A;  3RYI A;  4E57 A;  1XBL A;  2K1E A;  2Q73 A;  4BWC A;  1PPJ H;  3CC4 V;  2ADP A;  4LFB B;  1OHH G;  3JCU Z;  5CBG A;  2ITC C;  1JA8 A;  3ETD A;  3LDC A;  3SYA A;  1Y76 B;  3M7M X;  4YFB A;  1YZB A;  2DWD C;  4BTH A;  4WFH A;  3E8B A;  4J9Y B;  2LGW A;  3Q4H A;  3UKM A;  1HNX O;  2CTR A;  1CP9 A;  2PUS A;  1N0N A;  2ZT9 B;  4DRX A;  1UJW B;  5GTI Z;  1XNR O;  2IU0 A;  1YVW A;  1IXM A;  3ZS8 C;  4F6R B;  5J2U B;  5LMN O;  1SQV H;  1HNZ B;  3IJ4 A;  1QR8 A;  5J2T B;  1NJI W;  1U96 A;  3L75 H;  3B09 A;  4DR4 O;  4WBN B;  2Y4T A;  4CS4 A;  3JAR A;  4MVM A;  1FKA O;  5DM6 V;  1IBL O;  1PNK A;  4LF6 B;  2OIG A;  4DR6 B;  4NXN B;  3BEH A;  1AP6 A;  2VQF O;  3TXQ A;  1G1X B;  1ARO P;  2EIK B;  4UCO A;  2YEV A;  3ZRS A;  4GZR B;  3L91 A;  2UXN A;  1ZTE A;  3SYO A;  1MZF A;  4X20 B;  1H2K A;  5IE9 A;  1MNG A;  1KP3 A;  2ZE6 A;  4I55 B;  3JD1 A;  3SJC C;  1M4U A;  3RWR D;  1TUE B;  3SPI A;  5CMU A;  3RVY A;  5LOV A;  2QDO A;  1OCZ B;  1RPR A;  4P9P A;  3IFX A;  5LHG A;  5KHK A;  2LP7 A;  1Q3E A;  3PN1 A;  3CRM A;  3LSU A;  4UB8 Z;  2E75 B;  4LFC O;  4GUN A;  2X6C A;  2EIJ B;  1PL0 A;  4PA9 A;  3RN4 A;  3T2M A;  1N34 B;  1PL4 A;  2Y4U A;  3K79 A;  2RN9 A;  4NYK A;  1SET A;  3K06 A;  1VP7 A;  4TOI A;  1SA0 A;  4MVQ A;  5H9C A;  4D7T A;  5ITZ B;  2OYQ A;  1AR5 A;  2UXX A;  4UVA A;  2W0X A;  1K33 A;  4O4L B;  1I5X A;  4J9Z B;  3JSN A;  4PDM A;  4JPR A;  3DC6 A;  1FM2 A;  4MS2 A;  2JGU A;  3AG1 C;  4D7S A;  1IXB A;  1SKV A;  3EFF K;  5IT9 N;  5JH7 B;  4NVP A;  1R73 A;  3NXS A;  4KHP B;  3F5T A;  2OCH A;  4YIO A;  1M56 C;  1BQZ A;  4JTA B;  4HNA A;  4UXN A;  2Y69 B;  4RAI A;  2Q8V A;  4LCU C;  3B40 A;  2GTS A;  3C90 A;  1IBM O;  3CCL V;  4DXW A;  1LUW A;  2BTQ A;  2EIM B;  2FL4 A;  4R50 A;  4CC6 A;  4LF8 B;  1SZX A;  2NNU A;  2AE3 A;  2LO1 A;  2FB5 A;  5IYC O;  4PD4 F;  4WKU A;  4MW3 A;  5KLV H;  5LYJ B;  3HKC B;  1HR0 O;  4MVS A;  3A8T A;  5IJ0 A;  4LFA B;  3MHH C;  2DQ3 A;  5C8Y A;  3T4D A;  2ZKO A;  2L6L A;  2W6J G;  1S72 V;  2XAJ A;  4DYL A;  2V1D A;  1TUB A;  2P4K A;  3B8M A;  4FM0 A;  2XAG A;  4I5S A;  3TET A;  1R3L C;  3JCZ A;  1S77 D;  2AHY A;  3KG2 A;  2UUB O;  1H8E G;  3CRQ A;  5EBL C;  3X2Q B;  4BAY A;  1KD1 W;  1GM7 A;  1HNX B;  1KP2 A;  1M5I A;  2BOB C;  2DN9 A;  1M57 C;  3J81 N;  4RQF A;  2UXC B;  3GWO A;  3L94 A;  3JD3 A;  4DV1 O;  4FLW A;  2WLJ A;  1XNR B;  4I50 B;  2QTO A;  3OR6 C;  5CA3 A;  2ZE7 A;  3ZMS A;  3CPW U;  2IH1 C;  4LF9 B;  3P30 A;  3W7W A;  4JAA A;  3ABM C;  4JV5 O;  4B3T B;  1EZJ A;  1GHD A;  1OR0 A;  1OZ0 A;  1Q82 W;  2WYC A;  1TAE A;  3CCR V;  1N36 O;  2ZIO A;  3TGU H;  3U10 A;  1Z5W A;  3K57 A;  2IW5 A;  2EJ7 A;  4IIJ B;  2VQF B;  2AGA A;  4J7J A;  1WPX A;  1WLE A;  1AJN A;  4JZ2 A;  1KKC A;  3IAY A;  1SER A;  3SGI A;  1AI7 A;  3JAS B;  3CP1 A;  1YIT V;  5KAI Z;  4PDL A;  3WB1 A;  4KL1 A;  4YHH B;  1Q7Y W;  2H3O A;  3H9V A;  4LNU B;  5EBM C;  3ASN C;  1XHZ A;  5L3B A;  2ATK C;  1EM1 A;  1RPO A;  4B3S O;  1S76 D;  1BQ0 A;  1H2M A;  1JQ0 A;  4G2K A;  2Y0I A;  4LFC B;  1P4R A;  3OUF A;  2QWQ B;  3JAL B;  4LF4 O;  2WLM A;  3L72 H;  1HWY A;  2EIL B;  1Q43 A;  3OR7 C;  4IHJ B;  4EFE A;  4MVZ A;  1VQP V;  2UU9 B;  4PEM A;  3I55 V;  3AG4 C;  1SQX H;  4X1K B;  4ASU G;  1Y74 A;  2A06 H;  4YJ3 A;  1VQ5 V;  2IJI A;  5KA6 A;  4TUY A;  2JVD A;  4FLX A;  4WFB V;  3LUT B;  1FFX A;  5FNV B;  3HKD B;  5EZY A;  5J9P C;  1Q5O A;  4JAV A;  4FIP C;  1KQS U;  1BE3 H;  2JS3 A;  4EKW A;  2D3O W;  4OX9 O;  2PY5 A;  3DTU B;  4CS2 A;  1R1B A;  3RYC A;  3J7A U;  4TSF G;  1P84 F;  3E22 B;  3AG3 C;  5JCO C;  2P22 C;  3OMI B;  1ZAU A;  3GB7 C;  4PA3 A;  1BT8 A;  4YY3 B;  1L0L H; 
#chains in the Genus database with same CATH homology
 3SJQ C;  3SYP A;  1QBZ A;  2Q67 A;  4MW8 A;  4QIW F;  2X0L A;  5EK0 A;  5CBF A;  1THZ A;  1Q86 W;  1VQ8 V;  2EZO A;  1Y66 A;  1K5S A;  3P32 A;  2FTK A;  2EIN B;  4RO2 A;  3TCU A;  2XAH A;  1NVP B;  1QCE A;  3ZJZ A;  4FK5 C;  2HR3 A;  1NR1 A;  1G8M A;  1S0V A;  3G71 V;  1RM1 C;  4ZKI A;  3FB6 C;  4JAS A;  1H8H G;  3LDD A;  2JJ2 G;  1JVM A;  2JIZ G;  3PJS K;  4UVB A;  1DF4 A;  1FXH A;  4WKV A;  1NVP D;  5BZB A;  3MD0 A;  3OMN B;  4PDV A;  2YEV B;  1L1F A;  3SPG A;  3EHB B;  4F4L A;  1MSW D;  3ZIA G;  1JPX A;  3ABL B;  3ZRX A;  1SES A;  2IJJ A;  1BL8 A;  1E3A A;  2P7T C;  1OCO C;  3G6E V;  4ZBM A;  2OCC C;  5KA5 A;  1GTO A;  2HFE C;  2LFS A;  4L87 A;  3ZMV A;  5IYB O;  3K03 A;  4QPK A;  1GK1 A;  2WLI B;  3ETG A;  1K8A W;  1YJW V;  1GK0 A;  2EJR A;  3BY6 A;  4UV9 A;  1M9N A;  1BMF G;  2QE7 G;  1FXK B;  2EIN C;  4JGS A;  4TT3 G;  2WYD A;  2DW4 A;  2AE4 A;  3ETE A;  3JD2 A;  3HPL C;  3AG2 B;  1JJ2 U;  2WYB A;  1AI4 A;  3D36 A;  1VQ9 V;  4K2F A;  3RVZ A;  3ZN1 A;  3CXC U;  3ABU A;  4FJC C;  2NLJ C;  4Z1M G;  3A0R A;  2IH3 C;  2EZP A;  5KUK A;  2WLL A;  5LGN A;  2XAS A;  3B8N A;  3MHS C;  5IY5 B;  4WF9 V;  3SPH A;  3ABL C;  1JVZ A;  1KEH A;  3CCQ V;  1VQK V;  1K73 W;  2KB1 A;  4YFA A;  4MTF A;  2QM8 A;  5HFL A;  4RQE A;  2DYS B;  5B1N A;  2HLD G;  2IJH A;  1BHB A;  4MTO A;  1OCZ C;  3ABT A;  1E1R G;  1MAB G;  1OCR B;  1YIJ V;  3ZMU A;  2QM7 A;  1FXK C;  1B6Q A;  1ORQ C;  1K4D C;  4FMT A;  3JTR A;  5B1A B;  2HG5 C;  4JF3 A;  5L3D A;  1M1K W;  3ZRW B;  3AG2 C;  1DF5 A;  1P7B A;  5B3S B;  4E57 A;  2K1E A;  3OEH G;  2ITD C;  3W7T A;  2CK3 G;  3CC4 V;  3WFV A;  1OHH G;  2JDI G;  5IY5 C;  1AJP A;  5CBG A;  1EFR G;  2ITC C;  4BW5 A;  3ETD A;  3LDC A;  1G4Y B;  5L3C A;  3JYC A;  3SYA A;  4YFB A;  1VQ4 V;  2DWD C;  4XDJ A;  2W6I G;  4KP4 A;  3SYC A;  4WFH A;  3E8B A;  2C2A A;  4J9Y B;  3I56 V;  4BTH A;  4BIU A;  2DYS C;  3K08 A;  1F23 A;  3UKM A;  1AI6 A;  2IJK A;  3SYQ A;  1CP9 A;  3WG7 B;  2WYE A;  3SRB A;  3FB7 C;  3ZMT A;  1OCR C;  1UJW B;  2PI4 A;  1VQL V;  3M99 B;  2IU0 A;  1QVF U;  1IXM A;  1R3J C;  5B1A C;  1FS0 G;  3JD0 A;  5B3S C;  3IGA C;  3OE7 G;  1QR8 A;  4WFA V;  1NJI W;  4R8C A;  1BHA A;  1V54 B;  2X7R B;  5E1A C;  2WPD G;  1W0J G;  1K7D A;  4MVM A;  5DM6 V;  1PNK A;  1NH2 D;  5LHI A;  2QKS A;  4OXS A;  1K5Q A;  3BEH A;  4QE7 A;  5H6Q A;  3G4S V;  2ZDI C;  3QNE A;  2ZR2 A;  1E1Q G;  3ZMZ A;  1E79 G;  2B1G A;  4UV8 A;  4QE9 A;  3OM3 B;  1F4M A;  3WG7 C;  3OFN G;  1ARO P;  2EIK B;  4WFG A;  5L3G A;  2YEV A;  3R65 A;  3ZRS A;  3L91 A;  1I5Y A;  2UXN A;  3SYO A;  1ENV A;  5LGT A;  2X6A A;  3K0D A;  4PEL A;  4BIZ A;  2ZD9 A;  1KP3 A;  5L3E A;  3JD1 A;  4FPP A;  4TWK A;  4HST A;  4YF9 A;  3W7U A;  4WKS A;  1TUE B;  1V54 C;  2WLI A;  5CMU A;  3RVY A;  3SPI A;  4G28 B;  5L3F A;  3E2E A;  4HYO A;  5B1O A;  1K92 A;  1OCZ B;  1RPR A;  2P6J A;  4GT1 A;  4GX0 A;  4P9P A;  3IFX A;  5LHG A;  2LP7 A;  4CZZ A;  3HB3 B;  3IC7 A;  2WLN A;  1FXK A;  3LSS A;  4MSW C;  2ZR3 A;  1JOY A;  3FKS G;  4MTX A;  4X8A A;  4MVO A;  2JJ1 G;  4KFM A;  2X6C A;  1GM9 A;  2EIJ B;  1PL0 A;  2A9H A;  4PA9 A;  1YI2 V;  3AG1 B;  5B1B B;  3DGE A;  3T2M A;  3CYO A;  2EIK C;  4WFF A;  1XL6 A;  4WKT A;  1K9M W;  1Q81 W;  1CEZ A;  4DO2 A;  5EBW C;  1KKD A;  4JAU A;  1M56 B;  3F7V C;  1N8R W;  3FYE B;  3FYI B;  3K79 A;  5CBH A;  3RBZ A;  4MT8 A;  4Q20 A;  3QO7 A;  1SET A;  3K06 A;  2ZQM A;  1R6K A;  5H9C A;  2YSU B;  4MVQ A;  3RW0 A;  1KC8 W;  3LNM B;  5EC1 C;  2UXX A;  4UVA A;  3QO5 A;  2WAM A;  3CCU V;  1K33 A;  3E83 A;  5IYD O;  2F43 G;  3OAA G;  1YJ9 V;  1NH2 B;  3STZ C;  1I5X A;  4JYB A;  4J9Z B;  1YTF B;  4PDM A;  2H94 A;  4JPR A;  3ZRW A;  1FM2 A;  4MS2 A;  1VQ7 V;  2EIJ C;  4LC1 A;  2DWE C;  2Z5U A;  3AG1 C;  5B1B C;  3K04 A;  3EFF K;  2P67 A;  3F5W C;  3SPJ A;  3JD4 A;  1R73 A;  3NXS A;  4XDL A;  1F4N A;  2B1I A;  1M56 C;  3CMA V;  3F7Y C;  4MTG A;  3T1C A;  4JTA B;  1GKF A;  4UXN A;  5HFM A;  2Y69 B;  1OCC B;  4PDR A;  2ZDI A;  3K3W A;  1J95 A;  4RAI A;  2HKO A;  3OW2 U;  1PKX A;  4LCU C;  1LNQ A;  3TK1 A;  4DXW A;  3CCL V;  5CN0 A;  3CCE V;  3CD6 V;  4PA4 A;  3OGC C;  2XOK G;  1SRY A;  1V55 B;  2EIM B;  3E89 A;  4JTD B;  3SPC A;  1AJQ A;  2Q68 A;  3ZRV A;  4K2G A;  1DLB A;  4R50 A;  3OMA B;  1NBM G;  4M1J A;  2NNU A;  2AE3 A;  4U7O A;  1VQM V;  5IYC O;  1M57 B;  1K3E A;  2GSM B;  4MW3 A;  2HVJ C;  1YJN V;  4WKU A;  1M90 W;  1F51 A;  2PI5 A;  5GW7 A;  3QO8 A;  3VBB A;  1MOF A;  4MVS A;  2QA4 V;  2V7Q G;  1GK9 A;  1GO3 F;  1S5H C;  4PA6 A;  1MG1 A;  3MHH C;  2HVK C;  2DQ3 A;  1AR1 B;  2Y69 C;  3T4D A;  4G27 B;  1OCC C;  2W6J G;  1JCH A;  4JTC B;  3ABM B;  2XAJ A;  1S72 V;  1K97 A;  3SRC A;  2V1D A;  3D3I A;  2W0F C;  2ADV A;  2JEU A;  3B8M A;  4CBC A;  4X89 A;  2XAG A;  3ABK B;  4I5S A;  1R3L C;  3TET A;  3JCZ A;  1V55 C;  2EIM C;  4P9O A;  1S77 D;  2AHY A;  4GX1 A;  3KG2 A;  1H8E G;  5EBL C;  3X2Q B;  4BAY A;  1KD1 W;  1GM7 A;  1CPY A;  1KP2 A;  2MK3 A;  2BOB C;  1SZT A;  1M57 C;  1NR7 A;  1PD3 A;  4GX5 A;  4RQF A;  4QNH B;  3GWO A;  1QLN A;  3JD3 A;  1R3I C;  3L94 A;  5KUM A;  3ZCC A;  2WLK A;  2WLJ A;  4P2Z A;  3VOU A;  2QTO A;  2DYR B;  3OR6 C;  4N23 A;  5CA3 A;  2Q6A A;  3CPW U;  3ZMS A;  1ZWI C;  2IH1 C;  2WSS G;  1YHQ V;  3K0G A;  1COW G;  1R6N A;  2WWW A;  3CME V;  2ZXW B;  4GCZ A;  4E2L A;  3P30 A;  3W7W A;  1Y4M A;  4WFE A;  4H33 A;  1JW0 A;  3ASN B;  2OTL V;  4P30 A;  3ABM C;  1R3K C;  4MVU A;  2Q69 A;  5LHH A;  3OUS A;  1EZJ A;  1GHD A;  1GMG A;  1OR0 A;  1OZ0 A;  1Q82 W;  2XND G;  2WYC A;  1PNM A;  3ABK C;  3CCR V;  5FL7 G;  2IW5 A;  3E35 A;  3X2Q C;  3FB8 C;  2B5U A;  4XDK A;  1WPX A;  1WLE A;  2XAF A;  1AJN A;  1XL4 A;  3K9A A;  4GX2 A;  1DTO A;  2BOC C;  2EBO A;  1NQT A;  2DYR C;  4H37 A;  1SER A;  1AI7 A;  2GHY A;  4QPJ A;  3OEE G;  3W7S A;  3CP1 A;  4MVR A;  3AG4 B;  1FXV A;  1PNL A;  1YIT V;  2H8P C;  3CCV V;  5LGU A;  4PDL A;  4QJF B;  2ZXW C;  3UM7 A;  1Q7Y W;  3STL C;  3W7X A;  5EBM C;  4I9W A;  3FB5 C;  3ASN C;  2WLL B;  5L3B A;  1FFT B;  1W0K G;  2ATK C;  1RPO A;  3ML0 A;  2LFR A;  4JYC A;  1JX9 A;  1S76 D;  3E8G A;  4LP8 A;  2JK5 C;  3CCM V;  5H6R A;  3SRA A;  3ASO B;  4R7C A;  2A0L A;  1YTF D;  2HJF C;  1QR9 A;  1W2B U;  1JQ0 A;  4G2K A;  2AE5 A;  4WCE V;  2R9R B;  1P4R A;  2Z3Y A;  4LBE C;  4XBF A;  3OUF A;  3S8R A;  3CCS V;  2WLM A;  3AG3 B;  2JEX A;  1HWY A;  1K34 A;  2EIL B;  2WLH A;  3OR7 C;  1QLE B;  4MVZ A;  4UVC A;  1VQP V;  3I55 V;  5DN6 G;  1VQ6 V;  3AG4 C;  4PEM A;  2M7W A;  4RUE A;  5EC2 C;  1GM8 A;  4ASU G;  2OTJ V;  1VQ5 V;  2XAQ A;  4R6Z A;  4KUM A;  2IJI A;  3H01 A;  5KA6 A;  3LDE A;  3CC2 V;  4PA7 A;  4N21 A;  1ROP A;  3ZN0 A;  5C93 A;  5LBQ A;  3CCJ V;  1YSC A;  1AI5 A;  4WFB V;  3LUT B;  2QEX V;  4HAM A;  4X88 A;  3E86 A;  4HSR A;  5J9P C;  4E55 A;  3CC7 V;  4JAV A;  4FIP C;  3ASO C;  4HZ3 A;  1KQS U;  5IDJ A;  3E8F A;  3E8H A;  2A79 B;  1H38 A;  4RUF A;  4EKW A;  1RM1 B;  1NKD A;  2D3O W;  3DTU B;  2Y48 A;  3T4Z A;  2IU3 A;  1K4C C;  3JTQ A;  1EBO A;  4TSF G;  4E56 A;  2DQ0 A;  3AG3 C;  1H2G A;  2OT5 A;  2AHZ A;  3B77 A;  2EIL C;  1VQO V;  1QVG U;  1VQN V;  4YXW G;  2R9I A;  1OCO B;  2OCC B;  1QLE C;  3LSQ A;  3OMI B;  3AEI A;  2X6B A;  1S3J A;  3GB7 C;  4PA3 A;  4UUJ C;  2P90 A;  1KEC A;  4U7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...