3ML0A

Thermostable penicillin g acylase from alcaligenes faecalis in tetragonal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Penicillin G acylase, alpha subunit
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
total genus 40
structure length 195
sequence length 195
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ml0A02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3ml0A01
3L94A 1FXVA 1AJNA 4WKVA 3SRCA 1H2GA 1GM8A 2AE3A 2WYBA 4YF9A 4WKSA 1K5SA 2WYEA 1K7DA 4PEMA 4WKTA 1GHDA 1JVZA 4E55A 1GKFA 4E57A 1AJPA 1GK9A 4PELA 1AI6A 1JX9A 3K3WA 1AI5A 1KECA 2WYCA 3L91A 1PNMA 4E56A 1GM9A 1AI7A 3JTRA 1FXHA 4HSTA 4YFBA 3SRAA 4BTHA 3ML0A 4YFAA 1JW0A 1FM2A 1K5QA 2ADVA 1AJQA 4M1JA 1AI4A 1CP9A 1E3AA 2WYDA 1GM7A 1PNKA 1GK0A 1KEHA 3JTQA 4HSRA 4K2GA 1GK1A 2AE4A 4K2FA 4WKUA 3S8RA 3SRBA 1PNLA 2AE5A 1OR0A
chains in the Genus database with same CATH superfamily
3HKEA 5BR8O 1O9HA 1QBZA 4E57A 3RYCA 3FYEB 2ZR3A 4PELA 3BAAA 5DEDA 2OTLV 2K1EA 5IYZA 4LF5B 1FM2A 1K73W 3D8CA 3OEEG 1W0KG 2X0LA 4EEQA 3AEIA 1FFTB 1SF9A 3WFVA 1Q43A 1XI1A 4YF9A 2E76B 1KD1W 3FAVA 5JJJB 3S3XA 3KKYA 1DF5A 3SYOA 4RAIA 4CBCA 4DR4O 3X2QC 1H2KA 1NR7A 4WCEV 3E8BA 2CGNA 5KHGA 5IT9N 1Y74B 1YDXA 1EBOA 4JI6B 1SC5B 5IYCO 1OCRB 1PD3A 4FVMA 2EIMC 1BHAA 1HNXB 5KX5B 2EILB 1I5YA 4UV8A 4B3MB 4O2AA 3ASNC 4NXMB 4CS4A 2XUMA 4FLZA 2YIAA 1QNMA 1GN3A 4G28B 4K3AA 3CC7V 3I55V 1XNRB 4DV0B 4FLWA 2ZIOA 1TVKB 4BTHA 3F5TA 4DRXA 1BT8A 2ADVA 1GH6A 3IJ4A 3GB7C 1SERA 3SYPA 4B7EA 1SS3A 2P06A 2ZD9A 2QSAA 3GWKC 1XQ8A 3HKCA 4JPRA 3IAYA 3RT3C 2EBOA 1VQ5V 3H1LH 3AK2A 2HVJC 3KZIZ 3E2EA 3RVYA 5CN0A 4MW3A 4H0LB 2N74A 2ZXWC 4MVUA 4DR6B 1M57C 3ZS8C 4X1IA 5E1AC 5JCOA 3LNNA 4UB6Z 1Q5OA 4JI7B 1EZJA 2IBZH 3K9AA 1KYOF 2YXHA 4X64B 1NQTA 1WN7A 4LNUB 1EN4A 5IWAB 2Q9LA 1O9GA 4U3JB 1AR4A 3RFRA 4DV3O 4GKJB 3CCEV 2OIGA 1HNWO 4B3SB 2RDCA 4ZIBA 2Q69A 2V7QG 2F95B 1ZTEA 2FB5A 1Q6IA 3SPCA 4BIUA 3RYFB 5LHIA 1NJIW 1AVMA 5K1PA 1ZL8A 3N2KA 5CB4B 4I55B 1VMGA 1TUBB 3K08A 1M56B 3QO7A 4X20A 4UFZA 5JH7A 1GMGA 2C2AA 2EZOA 2AHZA 1OCZB 4DR1O 2QDOA 5L3GA 1GK9A 2W6JG 1Y4MA 1Q8IA 3K79A 3CWBH 3ML0A 4LF4B 4DUYO 3L9DA 1OV9A 2WLMA 2EINC 4X89A 2FMLA 4JYCA 1WB8A 1PV0A 2A79B 1A32A 2YSUB 4FMTA 1XNQB 4AHCA 5LMNO 3PJSK 2QR4A 2R9IA 1JA8A 5LA6A 4QIWF 3LDCA 3ZHRA 3W7UA 2V1DA 4FPPA 2DYSB 1S72V 4X8AA 4F4LA 4ZKIA 4DV4O 4YJ3A 2ZDIC 3APOA 1PP9H 5LBQA 4FLTA 3IC9A 4J11A 1MSDA 2M6YA 2BTQA 2P7TC 4J9ZB 5LOVA 5LP6A 4PA6A 3RN4A 1ZSPA 2WSSG 4J7ZA 4RUFA 4NVPA 4QE7A 1N4CA 3SJQC 3FX7A 1N0NA 2CTRA 2VS0A 4CS2A 2P22C 3CS5A 1Q90D 3VQVA 1F4MA 2GDSA 3E89A 4DV1O 3FYIB 3SPGA 4J10A 1N33B 4PD4F 5J2TA 1OCRC 2IW5A 3AG7A 3CMEV 2RJZA 2ZDIA 3TJTA 3DXRB 4LWSA 4HNAB 2FYUH 3HKBB 2EILC 2K9PA 5BY1A 4DV2O 1AP5A 2IJJA 3CPWU 3JALA 5CA0B 2JS3A 3CP1A 1VQ9V 4UCTA 4ZI7A 4AQYO 4QPJA 1KC8W 3RW0A 1GRJA 3CCUV 1X59A 2Q7HA 3OR7C 2XTAA 4CH4A 3ASOC 5KAIZ 1NT2B 2XNDG 2O57A 1BHBA 4DK1A 3B4SA 5CA1A 1IBLB 3ETDA 2QWPB 1TGOA 1AB3A 4I50A 4BIZA 2ZM6B 2BOBC 5LXTA 2RCVA 3JAKA 4PJ0Z 2F4VO 5JQGB 4TQDA 1AROP 4DR3O 4JI0O 2RQ6A 1MZFA 1U97A 2P5OA 1F4NA 1ZLZA 2XOKG 2P90A 4CZZA 4G2KA 2ETNA 4TV8A 2VRZA 3MDSA 3UKMA 3OTOO 1HP8A 2A9HA 1HNZO 1HDJA 3E83A 3RYCB 3VBBA 4YHHB 4PDRA 3S3WA 3TXSA 5IYZB 3G4SV 1YHQV 1YF2A 4J42A 2WA4A 2MK3A 5LGUA 1VP7A 1WPBA 2JVDA 1IURA 1THZA 1S5JA 1SQPH 1N32O 2XAJA 3D3QA 3WG7C 5FPRA 4JGSA 4LFCO 3RYIA 2XAQA 4NR1A 3L94A 2Y4UA 5IY5B 2GUZA 3OMIB 3JARA 2YI9A 2RN9A 4U3FH 1K4CC 3W7XA 2DWDC 4A5UB 1Q6HA 1KU9A 3FB6C 2FL4A 4GCZA 1GM7A 2IJIA 2IU3A 3CCMV 2MW2B 1JCHA 4Z1VA 3NR7A 1OCZC 4WFEA 4YY3B 2Q73A 4AI8A 3E22B 2JS5A 1VEWA 1FJGB 3JATA 1Q3EA 3I5DA 3SYAA 4UCVA 1S5LZ 1Q6UA 3CE2A 1K9MW 2Z0AA 4O4IA 1L0NH 1K33A 2F1MA 4JAAA 1R3IC 2LQTA 3AG3C 3U0ZA 1JVMA 3SRBA 4MTFA 2R72A 1N34O 1Z2GA 1NH2D 2XAGA 2BTOA 4IHJA 5J2UB 3LSSA 2VQEB 2NR5A 1AP6A 1QLEB 5IYBO 4OPHA 1BQ0A 5CMUA 2ZR2A 2KB1A 4FZ0A 4JI0B 4FFKA 3SPHA 2DW4A 2N05A 3HKCB 2Q0OC 2Q68A 3SJAC 1WAZA 2D2CB 4I9QA 5KAFZ 4FLXA 4UVCA 4LF5O 5KMGB 3UO3A 2PZSA 2E5LB 2RNBA 3EHBB 1WA8B 1IXBA 2L35A 3AG2B 3FGTA 1AI7A 4UV9A 3SDLA 3OAAG 1K5QA 1YSCA 3A0BZ 3LSQA 1VQPV 1XBLA 4WBNB 5ITZA 5EBMC 1K92A 1I08A 1XOUA 3ZHUA 2Q67A 1XMOB 3OMAB 1YTFB 3K5NA 5F2VO 4DR2B 5EBLC 2ODMA 2EJ7A 4OX9O 3BRCA 5CBGA 4EKWA 1L1FA 5C8YB 1SQQH 5B1BB 1MNGA 4MVZA 1IVSA 2Y69B 4JI6O 1HR0O 4DUZB 4DV7B 2H8PC 3LUTB 2UU9B 4B3TB 3BY6A 3ETGA 5LL6Y 2GV9A 1R3KC 2F66C 3G67A 4ZOLB 3ETQA 4W4LA 4K0KB 1HNXO 4U7NA 1OCCC 4X20B 3EFFK 4LP8A 1IBMB 4B3MO 4PDLA 2UXNA 3H9VA 2DE0X 1OCOB 4LC1A 2UUBB 2CH7A 1QR9A 2Q7GA 4WKUA 4DV0O 4K2FA 2LFSA 4JTDB 1IBKB 1PNLA 3EVKA 3HKDB 4KFMA 5J9PC 1CXZB 2AZ2A 2YEVA 1NBMG 4PEMA 5CBHA 1CPYA 2YXYA 4NTXA 1VQ6V 1WJZA 2Y0IA 1S3JA 4WF9V 3OM3B 5B1NA 3TK1A 3STZC 3K5MA 2L6LA 4UB8Z 3FB7C 1JR9A 3JD4A 1VF5B 4O4LB 4IYHA 3SRCA 3THOA 4GX5A 3NXSA 1XDCA 3ZHTA 2IM9A 4YJ3B 2CE4A 3BABA 3MAQA 2CK3G 2X6BA 4DR6O 4ICGA 2PI4A 1W0JG 2NN4A 1FXKA 1J5EB 1WB7A 1AJQA 1RFYA 1KMIZ 3E8HA 4PDMA 2IU0A 2QJ1A 1SETA 1OZ0A 4JI7O 3DC6A 5KUKA 3CMAV 3K5OA 1E1RG 4X64O 3AG1B 5IY5C 5IWAO 2EX3A 2EIKB 2ZKOA 1DF4A 5GONA 2UXDO 2YC0A 3K0DA 4GKJO 2E3CA 1Q82W 1AR1B 4G27B 2GTSA 2JIZG 4I5SA 4B3SO 1VARA 4OGQB 3T1YB 4XDLA 4CH5A 3TXQA 4B3RB 4J7JA 4NXNB 5J2TB 4OX9B 4HAMA 3K04A 2EJRA 3G80A 3CRCA 4GLXA 1BZKA 2FTKA 3JD3A 2FKXA 2WLLA 4IIJA 1V54B 4C7UA 1ORQC 5BMVB 2QTSA 1K5SA 1JQ0A 2Q7EA 1K7DA 1HR0B 2CDYA 3JALB 4O4HA 3ZBHA 4E55A 1NU1H 2LGWA 4LF7O 3ZN1A 5IJ9B 4BW9A 1M1KW 4LF6B 1DK1A 2PGGA 4ZI7B 3D36C 3OTFA 5BXZA 3G6BA 4RO2A 4UVAA 2OTJV 2QWQB 4LR3A 1FXVA 3ZRWA 4LF4O 1GM8A 4L8JA 1RSOA 3DSQA 3CB2A 5LXTB 1AILA 3K03A 5KUMA 4TUYB 4UVBA 1XNQO 2PI5A 4NB5A 2JK5C 4GZRB 1BMFG 5L3EA 5JVDA 1KBHA 3FFQA 3UT5A 1I5XA 4DW1A 2JGDB 4MTXA 3AG2C 3N2GB 2IH1C 4GKKB 1P4RA 2B1IA 2KQXA 2RMKB 4FLVA 4EB6A 2ILMA 4JYAO 4NYKA 1Y76B 1B3QA 1R3LC 2QM4A 3RYHA 2DJVA 2KG7A 2EULA 4CH6A 1AJPA 2Y69C 5FPOA 5AG2A 4I0XA 1N33O 2B9ZA 3E8FA 2GUZB 4HYOA 5EYPA 5K1XA 3B40A 2UXDB 2XASA 1QQCA 1IDSA 3JAWB 2ZCEA 3JTQA 4D7SA 5B3SB 4E4EA 3QO5A 5LMUB 3E8GA 1YCIA 5H6RA 4K35A 3UCSC 1BCCH 1JX9A 4O2BA 5L3BA 1H8EG 2HFEC 4WFBV 2NNUA 4Q6GA 3TGUH 4MVMA 1V9PA 2PUSA 4CC5A 1MZEA 4LF7B 2EIJB 1SQFA 3B8NA 1EN5A 1IBLO 3OR6C 4HZ3A 2DQ0A 2WLIA 1MA1A 4O4IB 4FK5C 4L87A 2ZM6O 1JJOA 3AG4B 4QPKA 2IJKA 3O65A 1FYJA 3RWRD 4DW0A 1L8DA 3IFXA 4IT5A 4IHJB 1G8MA 1ROPA 4WFAV 3TCUA 4F6RB 3SJBC 2LGQA 3ABMB 4JI1B 4FLUA 4NTWA 1FFXB 3OFNG 3J7AU 1W2BU 2DOSA 3CRQA 3QTCA 1YVWA 1VQLV 1E79G 3JCZA 3CC4V 2AW9A 3SYCA 4YHHO 4EFBA 2W0XA 1VIBA 2GHYA 3P30A 3ABKB 3AG1C 1QR8A 2YUAA 2EIKC 3HPLC 1UPGA 4CC6A 4LH6A 4X1YB 4UCSA 1XUQA 3F7VC 3OW2U 1GTOA 3ZHVA 1VF6C 1N0JA 4JYAB 3B77A 1GHDA 3A8TA 4JI5O 1D5NA 2IH3C 1B04A 3L74H 2A06H 2KKWA 1OHHG 4WFHA 1DGSA 1GAXA 3CCLV 1J95A 3AK3A 2R70A 2XAFA 1EM1A 3ZMSA 4ASUG 3APQA 1Q86W 4DXWA 1IX9A 1SA0B 1I0HA 1KB9F 1H2LA 4E56A 3LDEA 4MSWC 1VQ4V 4YY3O 1H8HG 3T1HB 4O4JB 4LBEC 1VF6A 4K2GA 1FJGO 4QNHB 1MABG 3CSXA 3OUFA 1YJNV 5B1AB 2HR3A 5DECA 3SGIA 4GX1A 4W4KA 1NI8A 1JOYA 1Y74A 2KSDA 4TV9B 2YEVB 4JZGA 2VQEO 4BR6A 1SESA 1WP8A 5LGTA 4FLYA 5B1OA 1NZ6A 4RQFA 1AR5A 5KX5A 2WLJA 1TA8A 2CTPA 1YITV 3ABLB 5FNVB 5GTHZ 1XHXA 1Y6XA 2NLJC 3HKEB 4JI2B 1K97A 1SRYA 4JAUA 2E5LO 3JASA 3F7YC 2E74B 3CCRV 1GK1A 4ZBMA 5KHKA 1YTFD 5L3DA 1AJNA 4K8ZA 2AE3A 2LO1A 4X66B 1XMOO 4X88A 3L75H 3WU2Z 4FFBA 4DR2O 3MD0A 1PKXA 3WB0A 2ZE5A 1FD9A 3ZRVA 3N27A 4MVOA 5LHHA 3BPZA 2Q5ZA 3FAVB 4JI5B 3W7SA 1T5EA 1X4TA 4RQEA 3SJCC 4X1KA 4DUZO 4DV7O 2UU9O 4GX0A 2E75B 4B3TO 1PNMA 2WLLB 1R1BA 1XL4A 3M99B 2ARHA 5E79Z 4PDVA 4K0KO 1M56C 5HFLA 2EIJC 4LNUA 1IBMO 2Z5UA 3ABUA 3VQYA 3OT7A 2DWEC 4U3JA 2B5UA 1VQ8V 4JF3A 2HLDG 1VQMV 4U7OA 2UXBB 4DV6B 2UUBO 3CX5F 1IXMA 3K3WA 4O2AB 1KECA 1IBKO 1YI2V 3CXHF 3SRAA 1S5HC 1JW0A 3X2QB 2ZINA 2OCCB 2F93B 3ABMC 1L0LH 1PNKA 3RYFA 3ZRXA 1QU7A 2F23A 1WNSA 3QVNA 4Q20A 3G6EV 5CB4A 4DRXB 3BVOA 2AGAA 3J81N 1GM9A 1I94B 4K8XA 1G6UA 3UT5B 2DYSC 2JEUA 3ABKC 3ICXA 2OWOA 4BIOA 5GW7A 1KUQA 3P3NA 3J80N 4FIPC 4MTGA 5H6QA 2W6IG 4X62B 1H2GA 1J5EO 3QO8A 1LNQA 4KHPB 4X1IB 4MVRA 1KP2A 3FB8C 2KG7B 1FS0G 2UUAB 4LF8B 4LFAB 2BOCC 1GK0A 1Q81W 3T1YO 4LFBB 4I0XB 4XDKA 4B3RO 4NXNO 3JSNA 1S76D 2LJ2A 4I4TA 2LW7A 2H94A 4JTCB 3OUSA 5DN6G 3L91A 4JYYA 5D5PA 2UXCB 3LSUA 1CEZA 4J7KA 2WYDA 2A0LA 1UJWB 1SZXA 3L71H 5LGNA 2ZXWB 1U96A 1LUWA 5FLXN 4LF6O 4DK0A 1BSMA 2P67A 4DV5O 1ZL8B 1F7YA 3N2KB 1KKDA 1VQOV 5H5NA 1TUEB 2HHHB 1Q7YW 2WPDG 5JH7B 3JAMN 4GT1A 3H1IH 4PA9A 3CCQV 1KP3A 4TOIA 3W7TA 1DTOA 2VWKA 4OXSA 5LYJA 4HNAA 3VQXA 3I56V 1ZWIC 3WB1A 1OR0A 1XHZA 5GTIZ 3SYQA 1EZVH 5CA0A 2VQFB 2CTQA 3GVMA 1YXBA 2BE3A 4R8CA 1ZAUA 3FGRA 1Z5WA 2N04A 2H3OA 3KCYA 3H01A 4NTYA 2W0FC 1K34A 3OGCC 3E35A 2AE5A 3AK1A 4JI4B 5LA6B 1SZTA 1TAEA 5IE9A 4GKKO 5KHJA 3B8MA 3T4DA 4RUEA 2GSMB 4I7ZB 1HWYA 1NS1A 5KA5A 4D7TA 2BTQB 1XMQB 4DR5B 1QVFU 1K4DC 3IC7A 5LOVB 5LP6B 1YZBA 3MHSC 4QGPA 1BL8A 2QKCA 4H13B 3RGBA 1FPOA 2HJDA 2UUCB 4QE9A 2R9RB 4TT3G 1SQBH 4IL6Z 2CTWA 4JAVA 5DM6V 2Y4TA 5LMUO 1YJ9V 1E3AA 1YIJV 2BSKA 2AE4A 4LWSB 2YS8A 4ABMA 2WLHA 3ZX6A 2CUGA 3ZHSA 4I9WA 2YIBD 1M90W 4N21A 4H44B 2QM8A 4WKTA 4BWCA 1IZ3A 4YIOA 3H1JH 2HJFC 3TETA 3ZMZA 3OE7G 3CXCU 1R6NA 2OCCC 5EIBD 3ZN0A 3QNEA 4DV5B 2LP7A 2PF4E 2Y0PA 2HP8A 3L73H 4QJFB 4MS2A 1F51A 4WFFA 4NKGB 2AXTZ 1GN6A 5CA1B 1QLEC 3F5WC 2DN9A 1QHTA 3BEHA 3CJHA 4I50B 5IYDO 3A2FA 1NVPB 4TSFG 1AI6A 2P6JA 2M7WA 3JAKB 4PA7A 2JJ2G 3UO2A 4JTAB 4JI1O 3SPJA 2YXLA 2ZNJA 3E22A 1KKCA 3SPIA 2ZE6A 2D3OW 4X65O 3K58A 3K5LA 4UCRA 4TV8B 4FM1A 3RVZA 3D36A 3KG2A 3FKSG 2QE7G 3JASB 4DR7O 1ZUQA 2EZPA 2X6AA 2WYCA 5JCOC 3ASOB 4HSTA 2WLKA 3QG5A 4F6EA 5J2UA 4LH7A 4HBNA 3T1CA 5CBFA 4MT8A 4FFBB 3MHHC 5IDJA 5HFMA 1JMKC 2X7RB 5EBWC 1OJHA 3T4ZA 4JI8O 5B1BC 1AI5A 4JASA 1FAFA 3FD9A 3RYIB 4YJ2A 3DTUB 5BR8B 1US6A 5KMGA 3ZEDA 4P9OA 3JARB 4X1KB 4YIPA 1WA8A 4JYBA 1H2SB 5B5EZ 4UCUA 1N36O 1EN6A 2P4VA 4WKVA 4WBNA 1W59A 3T1HO 3JYCA 3WB2A 4R50A 1B6QA 1OCOC 4KL1A 3ETEA 5EC2C 5EZYA 1BE3H 5C8YA 3OEHG 4UXNA 2V4DA 3HB3B 3JATB 4GUNA 4KUMA 3WG7B 3B2EE 4J80A 4DR4B 3L72H 5IJ0A 3HR0A 3BA8A 3VQWA 4B7KA 3JD0A 4B08A 4ZOLA 1EFRG 1ENVA 2JDIG 2QM7A 1KQSU 1SQVH 3W7WA 4P30A 3U11A 1V55B 1R73A 3M8AA 1XL6A 1JFFA 4HSRA 2HEPA 5H9CA 3Q4HA 2PY5A 1NTMH 1UFIA 2WYBA 1QVGU 4MVQA 3K06A 4JI2O 4ZHQA 3P3PA 3E86A 4X65B 3HKDA 3R66A 4UUJC 1HW7A 4X9QA 3ZMVA 2DYRB 2Z3YA 3K0GA 3BHPA 3CCJV 5LP6C 3K9SA 3ZHQA 4X66O 4DR7B 4LF9O 3JCUZ 4Z2WA 1MSWD 3CD6V 2A3QA 3AG3B 1ZX3A 2WYEA 2HVKC 5ITZB 1NTKH 1WPXA 3P32A 4PI0A 5A9GA 3C3TA 4O4LA 4PHZA 1JJ2U 3JD1A 3H1HH 3CEIA 4M1JA 2Y48A 3BCCH 4I4TB 4JI8B 2GTAA 1V54C 4H37A 3K59A 4MTOA 2OT5A 2B1GA 2P4KA 2QWNB 2ITCC 2HKOA 3ZCCA 1GKFA 3SR2C 4XBFA 1N36B 3GWOA 1BGYH 3KCXA 3A0HZ 1M4UA 2DQ3A 3DGEA 5JJEB 3CCVV 4RWUA 5KLVH 2JGUA 2OYQA 2QA4V 1CP9A 2UXBO 4DV6O 3PN1A 3H1KH 1P7GA 5L3CA 3UM7A 4DV3B 1DLBA 1H2MA 3LNMB 1HNWB 1RM1B 1WP7A 5LYJB 1BQZA 3L70H 2CH7B 1K3EA 3JTRA 4YFAA 1P49A 1VQNV 5BMVA 1PL4A 1MOFA 1P7BA 5IJ9A 1I94O 2OIEA 3ZMTA 1YEWA 4WFGA 4BWAA 1GO3F 1QCEA 1OCCB 2WLNA 1COWG 4UCOA 4X62O 4DR1B 2PYJA 3ZIAG 4PV1B 1NR1A 2OCHA 2Q0AA 1Z5VA 4KHPO 1TVKA 3VOUA 4TUYA 4DUYB 3ZRSA 2YIDA 1FXKB 3C90A 2ZT9B 2Q6AA 2A7WA 2UUAO 4LF8O 5EK0A 4LF9B 4LFAO 4R6ZA 5LHGA 4MVSA 1BS3A 4FM2A 4Z1MG 2ZQMA 2WAMA 4LFBO 2X6CA 2LW1A 1Y66A 5GONB 5LMNB 2JGDA 4FM0A 3N2GA 4P9PA 1R6TA 4GX2A 4DO2A 3S8RA 1LR1A 4GYCB 2LFRA 3BFRA 5B3SC 1G1XB 1GN4A 2PYLA 3C3SA 2PTMA 3BA9A 4KP4A 2UXCO 3CHXA 4PA3A 4DV4B 1H2NA 1R3JC 2BSKB 1Y76A 3LDDA 2XAHA 1RPOA 4LCUC 2Q8VA 4IIJB 4J41A 2HG5C 4O4HB 2HHHO 1MMMA 4PA4A 3DC5A 4JV5O 2CGOA 1N8RW 4J9YB 1Y67A 3JAWA 3AG4C 4JI3O 1JVZA 2BCCH 5EIBC 2QTOA 4DV1B 1XILA 4D6TH 4KXRA 4YFBA 2YI8A 4AILC 3ZRWB 1M93A 2GBOA 1V55C 1I7FA 3CJHB 2JRIA 1RSOB 2YDEA 2VQFO 1MG1A 2JEXA 3T2MA 1PL0A 1S77D 4BW5A 3CRAA 4DV2B 4I55A 1TUBA 3CRMA 5FL7G 2QWOB 1XEQA 3G71V 1P84F 5H2FZ 2DYRC 4YXWG 2YIBA 4P2ZA 5JVDB 4AQYB 4JI4O 2XT9A 5C93A 2ZNIA 1M5IA 2G38A 2YICA 1NTZH 3ZMUA 2EIMB 3IGAC 2JJ1G 4MW8A 1KEHA 4CH3A 1E1QG 3EXAA 3ASNB 4IGGA 4TQFA 1XMQO 1G4YB 2UXXA 4DR5O 3ABTA 4EB6B 3CC2V 4F6RA 3OMNB 4H33A 3O9OA 2F4VB 2ZIMA 5A2QN 1NKDA 2R9AA 4DR3B 1S0VA 1FFXA 4FJCC 3RYHB 2AHYA 1VQKV 3OD4A 2QKSA 2ADQB 2UUCO 5JJNB 4YJ2B 1RPRA 2F43G 5EYPB 4WKSA 3OTOB 1PM9A 1F23A 1JPXA 5JWPA 1HNZB 3CCSV 4FZ1A 2QWRB 4X1YA 4JZ2A 4BAYA 2ZE8A 3JD2A 3UQ8A 3D3IA 2Q4PA 5TISZ 1D5AA 5B1AC 4O2BB 1B06A 4XDJA 3OGIB 1N32B 2QEXV 1M57B 2DMXA 2WA3A 1RM1C 5EZYB 1QLNA 1LUVA 4CS3A 3STLC 2ATKC 1SQXH 1H38A 3M7MX 3R65A 5BZBA 4LFCB 1VF7A 2QKAA 1XREA 1NVPD 4JV5B 3CYOA 5IJ0B 1M9NA 2WLIB 1SA0A 3U10A 3FB5C 4JI3B 4EFEA 5KHHA 1RP3B 3DXRA 3HKBA 5D5QA 2AZ0A 2VWJA 1D2DA 2ITDC 4E2LA 3RBZA 3ABLC 4O4JA 1JFFB 4NXMO 2ZE7A 4DYLA 3K57A 3QF7A 3Q4HB 2IJHA 1FXHA 1K8AW 1YJWV 1AI4A 4ZHQB 1SQGA 2CAZC 1XNRO 3ZJZA 3B09A 4TV9A 1FXKC 1FKAO 4OPAA 3A0RA 5B66Z 5KHIA 5KA6A 4TWKA 1SKVA 3CRRA 2XHBA 1N34B 5EC1C 4R7CA 1PPJH 1WLEA 2WWWA 4PI2A 5JQGA 3JSLA 1VQ7V 1R6KA 1GN2A 5L3FA 4IYIA 1URFA 2QGNA 5CA3A 2EINB 4N23A 1NH2B 5FNVA 2ADPA
chains in the Genus database with same CATH topology
5B1AB 1NH2D 4WKVA 2XAGA 3LSSA 2HR3A 3JYCA 1QLEB 5IYBO 1QBZA 4E57A 3FYEB 2ZR3A 4PELA 4GX1A 5CMUA 2ZR2A 4R50A 1B6QA 2KB1A 2OTLV 1OCOC 1JOYA 3ETEA 2K1EA 1FM2A 3SPHA 1K73W 5EC2C 2DW4A 2YEVB 3OEEG 1W0KG 3OEHG 4UXNA 3HB3B 2X0LA 3AEIA 1FFTB 1SESA 2Q68A 4KUMA 3WG7B 5LGTA 3WFVA 4UVCA 5B1OA 4YF9A 4RQFA 2WLJA 1KD1W 3EHBB 1YITV 3ABLB 1DF5A 3AG2B 3JD0A 3SYOA 4RAIA 1AI7A 4UV9A 1EFRG 1ENVA 4CBCA 2JDIG 2QM7A 3X2QC 2NLJC 1KQSU 3OAAG 3W7WA 1K5QA 1YSCA 3LSQA 1VQPV 1K97A 1SRYA 4JAUA 4P30A 1NR7A 1K92A 5EBMC 1V55B 1R73A 2Q67A 1XL6A 3F7YC 3CCRV 3OMAB 4WCEV 3E8BA 1YTFB 4HSRA 1GK1A 4ZBMA 5H9CA 1YTFD 5L3DA 5EBLC 1AJNA 2AE3A 1QVGU 2WYBA 4MVQA 1EBOA 4EKWA 3K06A 5CBGA 1L1FA 5IYCO 5B1BB 3E86A 1OCRB 4MVZA 4X88A 4UUJC 1PD3A 3MD0A 1PKXA 2Y69B 3ZMVA 2DYRB 2EIMC 2Z3YA 3K0GA 1BHAA 3CCJV 3ZRVA 4MVOA 2EILB 1I5YA 5LHHA 4UV8A 2H8PC 3LUTB 3ASNC 3W7SA 3BY6A 3ETGA 1MSWD 3CD6V 3AG3B 1R3KC 4RQEA 2WYEA 4G28B 4U7NA 2HVKC 1OCCC 3CC7V 3EFFK 4LP8A 3I55V 1WPXA 4PDLA 4GX0A 3P32A 1PNMA 2UXNA 2WLLB 4BTHA 1JJ2U 1XL4A 3JD1A 3M99B 1OCOB 4LC1A 4PDVA 2ADVA 1M56C 4M1JA 2Y48A 5HFLA 2EIJC 1QR9A 3GB7C 1SERA 3SYPA 4WKUA 4K2FA 2Z5UA 3ABUA 2LFSA 4JTDB 1PNLA 4KFMA 2DWEC 1V54C 5J9PC 2B5UA 4H37A 1VQ8V 4JF3A 2ZD9A 2HLDG 4MTOA 2YEVA 1VQMV 1NBMG 4U7OA 2OT5A 2B1GA 4PEMA 5CBHA 1CPYA 2ITCC 2HKOA 3ZCCA 1IXMA 1GKFA 4XBFA 3K3WA 1KECA 4JPRA 1YI2V 2EBOA 3GWOA 1VQ5V 1VQ6V 3SRAA 1S5HC 2DQ3A 3DGEA 1JW0A 1S3JA 2HVJC 4WF9V 3OM3B 3CCVV 3E2EA 3RVYA 5CN0A 3X2QB 4MW3A 5B1NA 2QA4V 1CP9A 3TK1A 2OCCB 2ZXWC 3ABMC 3STZC 1PNKA 3FB7C 4MVUA 3ZRXA 5L3CA 3UM7A 3JD4A 1M57C 4Q20A 3SRCA 5E1AC 4GX5A 3G6EV 3NXSA 1DLBA 3LNMB 1EZJA 1RM1B 3K9AA 1NQTA 1K3EA 2CK3G 2X6BA 1GM9A 3JTRA 2PI4A 4YFAA 1VQNV 1W0JG 2DYSC 3ABKC 2JEUA 1FXKA 5GW7A 1AJQA 3E8HA 2IU0A 4PDMA 3CCEV 1SETA 1OZ0A 1MOFA 5KUKA 3CMAV 1P7BA 1E1RG 3AG1B 5IY5C 4FIPC 4MTGA 5H6QA 2W6IG 2EIKB 1DF4A 2Q69A 1H2GA 2V7QG 3K0DA 3ZMTA 3QO8A 1Q82W 4WFGA 1AR1B 1LNQA 4G27B 1GO3F 2JIZG 4I5SA 1QCEA 1OCCB 3SPCA 2WLNA 4BIUA 1COWG 5LHIA 4XDLA 1NJIW 4MVRA 1KP2A 4HAMA 3FB8C 2EJRA 3K04A 3ZIAG 3K08A 1FS0G 1NR1A 1M56B 3QO7A 2FTKA 3JD3A 2BOCC 1GK0A 1Q81W 1GMGA 2C2AA 2EZOA 2AHZA 2WLLA 4XDKA 3VOUA 1V54B 3ZRSA 1OCZB 1ORQC 1FXKB 1K5SA 1JQ0A 1S76D 1K7DA 2H94A 4JTCB 4E55A 2Q6AA 3OUSA 5L3GA 5EK0A 1GK9A 5DN6G 4R6ZA 2W6JG 3L91A 5LHGA 3ZN1A 1Y4MA 4MVSA 1M1KW 3K79A 2ZQMA 4Z1MG 2WAMA 2X6CA 3ML0A 1Y66A 2WLMA 2EINC 1CEZA 4X89A 2WYDA 2A0LA 1UJWB 4P9PA 4RO2A 4JYCA 4GX2A 4UVAA 4DO2A 2OTJV 3S8RA 5LGNA 2ZXWB 2LFRA 5B3SC 1FXVA 2A79B 3ZRWA 4KP4A 2YSUB 4FMTA 1GM8A 2P67A 4PA3A 1R3JC 3PJSK 1KKDA 1VQOV 2R9IA 1TUEB 3LDDA 1Q7YW 2WPDG 2XAHA 1RPOA 4LCUC 4QIWF 3K03A 3LDCA 4GT1A 3W7UA 5KUMA 4PA9A 3CCQV 4UVBA 1KP3A 3W7TA 2V1DA 4FPPA 2PI5A 2DYSB 1S72V 1DTOA 4X8AA 4F4LA 4ZKIA 2JK5C 2ZDIC 4OXSA 2HG5C 1BMFG 3I56V 5LBQA 1ZWIC 5L3EA 1OR0A 4PA4A 3SYQA 1N8RW 1I5XA 4J9YB 2P7TC 4J9ZB 4PA6A 4MTXA 3AG4C 3AG2C 1JVZA 2WSSG 2QTOA 4RUFA 4QE7A 3SJQC 2IH1C 4R8CA 4YFBA 1P4RA 2B1IA 3ZRWB 1V55C 3H01A 1F4MA 1MG1A 3E89A 2JEXA 2W0FC 1K34A 3FYIB 3SPGA 3T2MA 3OGCC 3E35A 2AE5A 1SZTA 1PL0A 1S77D 1R3LC 4BW5A 3B8MA 3T4DA 4RUEA 1OCRC 5FL7G 2IW5A 3CMEV 2GSMB 2ZDIA 3G71V 1AJPA 2Y69C 1HWYA 2DYRC 4YXWG 4P2ZA 5C93A 3E8FA 2EILC 5KA5A 4HYOA 2XASA 2IJJA 3ZMUA 2EIMB 1QVFU 3CPWU 1K4DC 3IC7A 3IGAC 2JJ1G 3CP1A 4MW8A 1VQ9V 1KEHA 3JTQA 3MHSC 1BL8A 1E1QG 3ASNB 5B3SB 4QPJA 1KC8W 3RW0A 3QO5A 3CCUV 3E8GA 1G4YB 2UXXA 3ABTA 3OR7C 4QE9A 3CC2V 2R9RB 5H6RA 4TT3G 3OMNB 4H33A 1JX9A 3ASOC 2XNDG 5L3BA 1H8EG 1NKDA 1BHBA 1S0VA 4JAVA 5DM6V 4FJCC 3ETDA 2HFEC 4WFBV 1YJ9V 2NNUA 2AHYA 1VQKV 4BIZA 1E3AA 2BOBC 2QKSA 4MVMA 1YIJV 2AE4A 2EIJB 3B8NA 1AROP 1RPRA 2WLHA 3OR6C 2F43G 4HZ3A 2DQ0A 2WLIA 4I9WA 4WKSA 4FK5C 4L87A 1M90W 4N21A 1F23A 1JPXA 2QM8A 1F4NA 4WKTA 3CCSV 2XOKG 2P90A 3AG4B 4CZZA 4G2KA 4QPKA 2HJFC 2IJKA 3TETA 3ZMZA 4BAYA 3OE7G 3JD2A 3CXCU 3IFXA 1R6NA 2OCCC 3ZN0A 3QNEA 3UKMA 3D3IA 1G8MA 1ROPA 2LP7A 4WFAV 2A9HA 3E83A 3TCUA 4QJFB 4MS2A 3VBBA 1F51A 3ABMB 4WFFA 5B1AC 4PDRA 4XDJA 3OFNG 2QEXV 3G4SV 1M57B 1RM1C 1W2BU 1YHQV 1QLEC 1QLNA 3F5WC 3STLC 2ATKC 3BEHA 1H38A 3R65A 5BZBA 5IYDO 1VQLV 1E79G 3JCZA 1NVPB 3CC4V 4TSFG 1AI6A 2MK3A 5LGUA 3SYCA 2P6JA 2M7WA 4PA7A 2JJ2G 4JTAB 1NVPD 1THZA 3SPJA 3CYOA 1M9NA 2XAJA 2GHYA 2WLIB 3P30A 3SPIA 3FB5C 3ABKB 3AG1C 2D3OW 1QR8A 3WG7C 4JGSA 2EIKC 3HPLC 2XAQA 3L94A 5IY5B 3RVZA 3OMIB 3D36A 2ITDC 3KG2A 4E2LA 3F7VC 3FKSG 3RBZA 2QE7G 1GTOA 3ABLC 3OW2U 1GHDA 3B77A 2EZPA 2X6AA 2WYCA 2IH3C 2IJHA 3ASOB 1K4CC 1FXHA 4HSTA 3W7XA 2WLKA 1OHHG 4WFHA 1K8AW 2DWDC 1YJWV 1AI4A 3FB6C 3CCLV 4GCZA 3T1CA 1GM7A 2IJIA 2IU3A 3ZJZA 3CCMV 5CBFA 1JCHA 4MT8A 1J95A 1OCZC 3MHHC 4WFEA 2XAFA 1FXKC 3ZMSA 4ASUG 5IDJA 5HFMA 1Q86W 2X7RB 4DXWA 5EBWC 3T4ZA 5B1BC 3A0RA 5KA6A 4TWKA 4E56A 1AI5A 4JASA 3SYAA 3LDEA 5EC1C 4R7CA 2WWWA 1WLEA 4MSWC 1VQ7V 1R6KA 1K9MW 1VQ4V 3DTUB 5L3FA 4P9OA 1H8HG 1K33A 5CA3A 4JYBA 2EINB 4N23A 4LBEC 1R3IC 4K2GA 4QNHB 1NH2B 1MABG 3AG3C 1JVMA 3OUFA 3SRBA 4MTFA 1YJNV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L94 A;  1FXV A;  1AJN A;  4WKV A;  3SRC A;  1H2G A;  1GM8 A;  2AE3 A;  2WYB A;  4YF9 A;  4WKS A;  1K5S A;  2WYE A;  1K7D A;  4PEM A;  4WKT A;  1GHD A;  1JVZ A;  4E55 A;  1GKF A;  4E57 A;  1AJP A;  1GK9 A;  4PEL A;  1AI6 A;  1JX9 A;  3K3W A;  1AI5 A;  1KEC A;  2WYC A;  3L91 A;  1PNM A;  4E56 A;  1GM9 A;  1AI7 A;  3JTR A;  1FXH A;  4HST A;  4YFB A;  3SRA A;  4BTH A;  3ML0 A;  4YFA A;  1JW0 A;  1FM2 A;  1K5Q A;  2ADV A;  1AJQ A;  4M1J A;  1AI4 A;  1CP9 A;  1E3A A;  2WYD A;  1GM7 A;  1PNK A;  1GK0 A;  1KEH A;  3JTQ A;  4HSR A;  4K2G A;  1GK1 A;  2AE4 A;  4K2F A;  4WKU A;  3S8R A;  3SRB A;  1PNL A;  2AE5 A;  1OR0 A; 
#chains in the Genus database with same CATH topology
 3HKE A;  5BR8 O;  1O9H A;  1QBZ A;  4E57 A;  3RYC A;  3FYE B;  2ZR3 A;  4PEL A;  3BAA A;  5DED A;  2OTL V;  2K1E A;  5IYZ A;  4LF5 B;  1FM2 A;  1K73 W;  3D8C A;  3OEE G;  1W0K G;  2X0L A;  4EEQ A;  3AEI A;  1FFT B;  1SF9 A;  3WFV A;  1Q43 A;  1XI1 A;  4YF9 A;  2E76 B;  1KD1 W;  3FAV A;  5JJJ B;  3S3X A;  3KKY A;  1DF5 A;  3SYO A;  4RAI A;  4CBC A;  4DR4 O;  3X2Q C;  1H2K A;  1NR7 A;  4WCE V;  3E8B A;  2CGN A;  5KHG A;  5IT9 N;  1Y74 B;  1YDX A;  1EBO A;  4JI6 B;  1SC5 B;  5IYC O;  1OCR B;  1PD3 A;  4FVM A;  2EIM C;  1BHA A;  1HNX B;  5KX5 B;  2EIL B;  1I5Y A;  4UV8 A;  4B3M B;  4O2A A;  3ASN C;  4NXM B;  4CS4 A;  2XUM A;  4FLZ A;  2YIA A;  1QNM A;  1GN3 A;  4G28 B;  4K3A A;  3CC7 V;  3I55 V;  1XNR B;  4DV0 B;  4FLW A;  2ZIO A;  1TVK B;  4BTH A;  3F5T A;  4DRX A;  1BT8 A;  2ADV A;  1GH6 A;  3IJ4 A;  3GB7 C;  1SER A;  3SYP A;  4B7E A;  1SS3 A;  2P06 A;  2ZD9 A;  2QSA A;  3GWK C;  1XQ8 A;  3HKC A;  4JPR A;  3IAY A;  3RT3 C;  2EBO A;  1VQ5 V;  3H1L H;  3AK2 A;  2HVJ C;  3KZI Z;  3E2E A;  3RVY A;  5CN0 A;  4MW3 A;  4H0L B;  2N74 A;  2ZXW C;  4MVU A;  4DR6 B;  1M57 C;  3ZS8 C;  4X1I A;  5E1A C;  5JCO A;  3LNN A;  4UB6 Z;  1Q5O A;  4JI7 B;  1EZJ A;  2IBZ H;  3K9A A;  1KYO F;  2YXH A;  4X64 B;  1NQT A;  1WN7 A;  4LNU B;  1EN4 A;  5IWA B;  2Q9L A;  1O9G A;  4U3J B;  1AR4 A;  3RFR A;  4DV3 O;  4GKJ B;  3CCE V;  2OIG A;  1HNW O;  4B3S B;  2RDC A;  4ZIB A;  2Q69 A;  2V7Q G;  2F95 B;  1ZTE A;  2FB5 A;  1Q6I A;  3SPC A;  4BIU A;  3RYF B;  5LHI A;  1NJI W;  1AVM A;  5K1P A;  1ZL8 A;  3N2K A;  5CB4 B;  4I55 B;  1VMG A;  1TUB B;  3K08 A;  1M56 B;  3QO7 A;  4X20 A;  4UFZ A;  5JH7 A;  1GMG A;  2C2A A;  2EZO A;  2AHZ A;  1OCZ B;  4DR1 O;  2QDO A;  5L3G A;  1GK9 A;  2W6J G;  1Y4M A;  1Q8I A;  3K79 A;  3CWB H;  3ML0 A;  4LF4 B;  4DUY O;  3L9D A;  1OV9 A;  2WLM A;  2EIN C;  4X89 A;  2FML A;  4JYC A;  1WB8 A;  1PV0 A;  2A79 B;  1A32 A;  2YSU B;  4FMT A;  1XNQ B;  4AHC A;  5LMN O;  3PJS K;  2QR4 A;  2R9I A;  1JA8 A;  5LA6 A;  4QIW F;  3LDC A;  3ZHR A;  3W7U A;  2V1D A;  4FPP A;  2DYS B;  1S72 V;  4X8A A;  4F4L A;  4ZKI A;  4DV4 O;  4YJ3 A;  2ZDI C;  3APO A;  1PP9 H;  5LBQ A;  4FLT A;  3IC9 A;  4J11 A;  1MSD A;  2M6Y A;  2BTQ A;  2P7T C;  4J9Z B;  5LOV A;  5LP6 A;  4PA6 A;  3RN4 A;  1ZSP A;  2WSS G;  4J7Z A;  4RUF A;  4NVP A;  4QE7 A;  1N4C A;  3SJQ C;  3FX7 A;  1N0N A;  2CTR A;  2VS0 A;  4CS2 A;  2P22 C;  3CS5 A;  1Q90 D;  3VQV A;  1F4M A;  2GDS A;  3E89 A;  4DV1 O;  3FYI B;  3SPG A;  4J10 A;  1N33 B;  4PD4 F;  5J2T A;  1OCR C;  2IW5 A;  3AG7 A;  3CME V;  2RJZ A;  2ZDI A;  3TJT A;  3DXR B;  4LWS A;  4HNA B;  2FYU H;  3HKB B;  2EIL C;  2K9P A;  5BY1 A;  4DV2 O;  1AP5 A;  2IJJ A;  3CPW U;  3JAL A;  5CA0 B;  2JS3 A;  3CP1 A;  1VQ9 V;  4UCT A;  4ZI7 A;  4AQY O;  4QPJ A;  1KC8 W;  3RW0 A;  1GRJ A;  3CCU V;  1X59 A;  2Q7H A;  3OR7 C;  2XTA A;  4CH4 A;  3ASO C;  5KAI Z;  1NT2 B;  2XND G;  2O57 A;  1BHB A;  4DK1 A;  3B4S A;  5CA1 A;  1IBL B;  3ETD A;  2QWP B;  1TGO A;  1AB3 A;  4I50 A;  4BIZ A;  2ZM6 B;  2BOB C;  5LXT A;  2RCV A;  3JAK A;  4PJ0 Z;  2F4V O;  5JQG B;  4TQD A;  1ARO P;  4DR3 O;  4JI0 O;  2RQ6 A;  1MZF A;  1U97 A;  2P5O A;  1F4N A;  1ZLZ A;  2XOK G;  2P90 A;  4CZZ A;  4G2K A;  2ETN A;  4TV8 A;  2VRZ A;  3MDS A;  3UKM A;  3OTO O;  1HP8 A;  2A9H A;  1HNZ O;  1HDJ A;  3E83 A;  3RYC B;  3VBB A;  4YHH B;  4PDR A;  3S3W A;  3TXS A;  5IYZ B;  3G4S V;  1YHQ V;  1YF2 A;  4J42 A;  2WA4 A;  2MK3 A;  5LGU A;  1VP7 A;  1WPB A;  2JVD A;  1IUR A;  1THZ A;  1S5J A;  1SQP H;  1N32 O;  2XAJ A;  3D3Q A;  3WG7 C;  5FPR A;  4JGS A;  4LFC O;  3RYI A;  2XAQ A;  4NR1 A;  3L94 A;  2Y4U A;  5IY5 B;  2GUZ A;  3OMI B;  3JAR A;  2YI9 A;  2RN9 A;  4U3F H;  1K4C C;  3W7X A;  2DWD C;  4A5U B;  1Q6H A;  1KU9 A;  3FB6 C;  2FL4 A;  4GCZ A;  1GM7 A;  2IJI A;  2IU3 A;  3CCM V;  2MW2 B;  1JCH A;  4Z1V A;  3NR7 A;  1OCZ C;  4WFE A;  4YY3 B;  2Q73 A;  4AI8 A;  3E22 B;  2JS5 A;  1VEW A;  1FJG B;  3JAT A;  1Q3E A;  3I5D A;  3SYA A;  4UCV A;  1S5L Z;  1Q6U A;  3CE2 A;  1K9M W;  2Z0A A;  4O4I A;  1L0N H;  1K33 A;  2F1M A;  4JAA A;  1R3I C;  2LQT A;  3AG3 C;  3U0Z A;  1JVM A;  3SRB A;  4MTF A;  2R72 A;  1N34 O;  1Z2G A;  1NH2 D;  2XAG A;  2BTO A;  4IHJ A;  5J2U B;  3LSS A;  2VQE B;  2NR5 A;  1AP6 A;  1QLE B;  5IYB O;  4OPH A;  1BQ0 A;  5CMU A;  2ZR2 A;  2KB1 A;  4FZ0 A;  4JI0 B;  4FFK A;  3SPH A;  2DW4 A;  2N05 A;  3HKC B;  2Q0O C;  2Q68 A;  3SJA C;  1WAZ A;  2D2C B;  4I9Q A;  5KAF Z;  4FLX A;  4UVC A;  4LF5 O;  5KMG B;  3UO3 A;  2PZS A;  2E5L B;  2RNB A;  3EHB B;  1WA8 B;  1IXB A;  2L35 A;  3AG2 B;  3FGT A;  1AI7 A;  4UV9 A;  3SDL A;  3OAA G;  1K5Q A;  1YSC A;  3A0B Z;  3LSQ A;  1VQP V;  1XBL A;  4WBN B;  5ITZ A;  5EBM C;  1K92 A;  1I08 A;  1XOU A;  3ZHU A;  2Q67 A;  1XMO B;  3OMA B;  1YTF B;  3K5N A;  5F2V O;  4DR2 B;  5EBL C;  2ODM A;  2EJ7 A;  4OX9 O;  3BRC A;  5CBG A;  4EKW A;  1L1F A;  5C8Y B;  1SQQ H;  5B1B B;  1MNG A;  4MVZ A;  1IVS A;  2Y69 B;  4JI6 O;  1HR0 O;  4DUZ B;  4DV7 B;  2H8P C;  3LUT B;  2UU9 B;  4B3T B;  3BY6 A;  3ETG A;  5LL6 Y;  2GV9 A;  1R3K C;  2F66 C;  3G67 A;  4ZOL B;  3ETQ A;  4W4L A;  4K0K B;  1HNX O;  4U7N A;  1OCC C;  4X20 B;  3EFF K;  4LP8 A;  1IBM B;  4B3M O;  4PDL A;  2UXN A;  3H9V A;  2DE0 X;  1OCO B;  4LC1 A;  2UUB B;  2CH7 A;  1QR9 A;  2Q7G A;  4WKU A;  4DV0 O;  4K2F A;  2LFS A;  4JTD B;  1IBK B;  1PNL A;  3EVK A;  3HKD B;  4KFM A;  5J9P C;  1CXZ B;  2AZ2 A;  2YEV A;  1NBM G;  4PEM A;  5CBH A;  1CPY A;  2YXY A;  4NTX A;  1VQ6 V;  1WJZ A;  2Y0I A;  1S3J A;  4WF9 V;  3OM3 B;  5B1N A;  3TK1 A;  3STZ C;  3K5M A;  2L6L A;  4UB8 Z;  3FB7 C;  1JR9 A;  3JD4 A;  1VF5 B;  4O4L B;  4IYH A;  3SRC A;  3THO A;  4GX5 A;  3NXS A;  1XDC A;  3ZHT A;  2IM9 A;  4YJ3 B;  2CE4 A;  3BAB A;  3MAQ A;  2CK3 G;  2X6B A;  4DR6 O;  4ICG A;  2PI4 A;  1W0J G;  2NN4 A;  1FXK A;  1J5E B;  1WB7 A;  1AJQ A;  1RFY A;  1KMI Z;  3E8H A;  4PDM A;  2IU0 A;  2QJ1 A;  1SET A;  1OZ0 A;  4JI7 O;  3DC6 A;  5KUK A;  3CMA V;  3K5O A;  1E1R G;  4X64 O;  3AG1 B;  5IY5 C;  5IWA O;  2EX3 A;  2EIK B;  2ZKO A;  1DF4 A;  5GON A;  2UXD O;  2YC0 A;  3K0D A;  4GKJ O;  2E3C A;  1Q82 W;  1AR1 B;  4G27 B;  2GTS A;  2JIZ G;  4I5S A;  4B3S O;  1VAR A;  4OGQ B;  3T1Y B;  4XDL A;  4CH5 A;  3TXQ A;  4B3R B;  4J7J A;  4NXN B;  5J2T B;  4OX9 B;  4HAM A;  3K04 A;  2EJR A;  3G80 A;  3CRC A;  4GLX A;  1BZK A;  2FTK A;  3JD3 A;  2FKX A;  2WLL A;  4IIJ A;  1V54 B;  4C7U A;  1ORQ C;  5BMV B;  2QTS A;  1K5S A;  1JQ0 A;  2Q7E A;  1K7D A;  1HR0 B;  2CDY A;  3JAL B;  4O4H A;  3ZBH A;  4E55 A;  1NU1 H;  2LGW A;  4LF7 O;  3ZN1 A;  5IJ9 B;  4BW9 A;  1M1K W;  4LF6 B;  1DK1 A;  2PGG A;  4ZI7 B;  3D36 C;  3OTF A;  5BXZ A;  3G6B A;  4RO2 A;  4UVA A;  2OTJ V;  2QWQ B;  4LR3 A;  1FXV A;  3ZRW A;  4LF4 O;  1GM8 A;  4L8J A;  1RSO A;  3DSQ A;  3CB2 A;  5LXT B;  1AIL A;  3K03 A;  5KUM A;  4TUY B;  4UVB A;  1XNQ O;  2PI5 A;  4NB5 A;  2JK5 C;  4GZR B;  1BMF G;  5L3E A;  5JVD A;  1KBH A;  3FFQ A;  3UT5 A;  1I5X A;  4DW1 A;  2JGD B;  4MTX A;  3AG2 C;  3N2G B;  2IH1 C;  4GKK B;  1P4R A;  2B1I A;  2KQX A;  2RMK B;  4FLV A;  4EB6 A;  2ILM A;  4JYA O;  4NYK A;  1Y76 B;  1B3Q A;  1R3L C;  2QM4 A;  3RYH A;  2DJV A;  2KG7 A;  2EUL A;  4CH6 A;  1AJP A;  2Y69 C;  5FPO A;  5AG2 A;  4I0X A;  1N33 O;  2B9Z A;  3E8F A;  2GUZ B;  4HYO A;  5EYP A;  5K1X A;  3B40 A;  2UXD B;  2XAS A;  1QQC A;  1IDS A;  3JAW B;  2ZCE A;  3JTQ A;  4D7S A;  5B3S B;  4E4E A;  3QO5 A;  5LMU B;  3E8G A;  1YCI A;  5H6R A;  4K35 A;  3UCS C;  1BCC H;  1JX9 A;  4O2B A;  5L3B A;  1H8E G;  2HFE C;  4WFB V;  2NNU A;  4Q6G A;  3TGU H;  4MVM A;  1V9P A;  2PUS A;  4CC5 A;  1MZE A;  4LF7 B;  2EIJ B;  1SQF A;  3B8N A;  1EN5 A;  1IBL O;  3OR6 C;  4HZ3 A;  2DQ0 A;  2WLI A;  1MA1 A;  4O4I B;  4FK5 C;  4L87 A;  2ZM6 O;  1JJO A;  3AG4 B;  4QPK A;  2IJK A;  3O65 A;  1FYJ A;  3RWR D;  4DW0 A;  1L8D A;  3IFX A;  4IT5 A;  4IHJ B;  1G8M A;  1ROP A;  4WFA V;  3TCU A;  4F6R B;  3SJB C;  2LGQ A;  3ABM B;  4JI1 B;  4FLU A;  4NTW A;  1FFX B;  3OFN G;  3J7A U;  1W2B U;  2DOS A;  3CRQ A;  3QTC A;  1YVW A;  1VQL V;  1E79 G;  3JCZ A;  3CC4 V;  2AW9 A;  3SYC A;  4YHH O;  4EFB A;  2W0X A;  1VIB A;  2GHY A;  3P30 A;  3ABK B;  3AG1 C;  1QR8 A;  2YUA A;  2EIK C;  3HPL C;  1UPG A;  4CC6 A;  4LH6 A;  4X1Y B;  4UCS A;  1XUQ A;  3F7V C;  3OW2 U;  1GTO A;  3ZHV A;  1VF6 C;  1N0J A;  4JYA B;  3B77 A;  1GHD A;  3A8T A;  4JI5 O;  1D5N A;  2IH3 C;  1B04 A;  3L74 H;  2A06 H;  2KKW A;  1OHH G;  4WFH A;  1DGS A;  1GAX A;  3CCL V;  1J95 A;  3AK3 A;  2R70 A;  2XAF A;  1EM1 A;  3ZMS A;  4ASU G;  3APQ A;  1Q86 W;  4DXW A;  1IX9 A;  1SA0 B;  1I0H A;  1KB9 F;  1H2L A;  4E56 A;  3LDE A;  4MSW C;  1VQ4 V;  4YY3 O;  1H8H G;  3T1H B;  4O4J B;  4LBE C;  1VF6 A;  4K2G A;  1FJG O;  4QNH B;  1MAB G;  3CSX A;  3OUF A;  1YJN V;  5B1A B;  2HR3 A;  5DEC A;  3SGI A;  4GX1 A;  4W4K A;  1NI8 A;  1JOY A;  1Y74 A;  2KSD A;  4TV9 B;  2YEV B;  4JZG A;  2VQE O;  4BR6 A;  1SES A;  1WP8 A;  5LGT A;  4FLY A;  5B1O A;  1NZ6 A;  4RQF A;  1AR5 A;  5KX5 A;  2WLJ A;  1TA8 A;  2CTP A;  1YIT V;  3ABL B;  5FNV B;  5GTH Z;  1XHX A;  1Y6X A;  2NLJ C;  3HKE B;  4JI2 B;  1K97 A;  1SRY A;  4JAU A;  2E5L O;  3JAS A;  3F7Y C;  2E74 B;  3CCR V;  1GK1 A;  4ZBM A;  5KHK A;  1YTF D;  5L3D A;  1AJN A;  4K8Z A;  2AE3 A;  2LO1 A;  4X66 B;  1XMO O;  4X88 A;  3L75 H;  3WU2 Z;  4FFB A;  4DR2 O;  3MD0 A;  1PKX A;  3WB0 A;  2ZE5 A;  1FD9 A;  3ZRV A;  3N27 A;  4MVO A;  5LHH A;  3BPZ A;  2Q5Z A;  3FAV B;  4JI5 B;  3W7S A;  1T5E A;  1X4T A;  4RQE A;  3SJC C;  4X1K A;  4DUZ O;  4DV7 O;  2UU9 O;  4GX0 A;  2E75 B;  4B3T O;  1PNM A;  2WLL B;  1R1B A;  1XL4 A;  3M99 B;  2ARH A;  5E79 Z;  4PDV A;  4K0K O;  1M56 C;  5HFL A;  2EIJ C;  4LNU A;  1IBM O;  2Z5U A;  3ABU A;  3VQY A;  3OT7 A;  2DWE C;  4U3J A;  2B5U A;  1VQ8 V;  4JF3 A;  2HLD G;  1VQM V;  4U7O A;  2UXB B;  4DV6 B;  2UUB O;  3CX5 F;  1IXM A;  3K3W A;  4O2A B;  1KEC A;  1IBK O;  1YI2 V;  3CXH F;  3SRA A;  1S5H C;  1JW0 A;  3X2Q B;  2ZIN A;  2OCC B;  2F93 B;  3ABM C;  1L0L H;  1PNK A;  3RYF A;  3ZRX A;  1QU7 A;  2F23 A;  1WNS A;  3QVN A;  4Q20 A;  3G6E V;  5CB4 A;  4DRX B;  3BVO A;  2AGA A;  3J81 N;  1GM9 A;  1I94 B;  4K8X A;  1G6U A;  3UT5 B;  2DYS C;  2JEU A;  3ABK C;  3ICX A;  2OWO A;  4BIO A;  5GW7 A;  1KUQ A;  3P3N A;  3J80 N;  4FIP C;  4MTG A;  5H6Q A;  2W6I G;  4X62 B;  1H2G A;  1J5E O;  3QO8 A;  1LNQ A;  4KHP B;  4X1I B;  4MVR A;  1KP2 A;  3FB8 C;  2KG7 B;  1FS0 G;  2UUA B;  4LF8 B;  4LFA B;  2BOC C;  1GK0 A;  1Q81 W;  3T1Y O;  4LFB B;  4I0X B;  4XDK A;  4B3R O;  4NXN O;  3JSN A;  1S76 D;  2LJ2 A;  4I4T A;  2LW7 A;  2H94 A;  4JTC B;  3OUS A;  5DN6 G;  3L91 A;  4JYY A;  5D5P A;  2UXC B;  3LSU A;  1CEZ A;  4J7K A;  2WYD A;  2A0L A;  1UJW B;  1SZX A;  3L71 H;  5LGN A;  2ZXW B;  1U96 A;  1LUW A;  5FLX N;  4LF6 O;  4DK0 A;  1BSM A;  2P67 A;  4DV5 O;  1ZL8 B;  1F7Y A;  3N2K B;  1KKD A;  1VQO V;  5H5N A;  1TUE B;  2HHH B;  1Q7Y W;  2WPD G;  5JH7 B;  3JAM N;  4GT1 A;  3H1I H;  4PA9 A;  3CCQ V;  1KP3 A;  4TOI A;  3W7T A;  1DTO A;  2VWK A;  4OXS A;  5LYJ A;  4HNA A;  3VQX A;  3I56 V;  1ZWI C;  3WB1 A;  1OR0 A;  1XHZ A;  5GTI Z;  3SYQ A;  1EZV H;  5CA0 A;  2VQF B;  2CTQ A;  3GVM A;  1YXB A;  2BE3 A;  4R8C A;  1ZAU A;  3FGR A;  1Z5W A;  2N04 A;  2H3O A;  3KCY A;  3H01 A;  4NTY A;  2W0F C;  1K34 A;  3OGC C;  3E35 A;  2AE5 A;  3AK1 A;  4JI4 B;  5LA6 B;  1SZT A;  1TAE A;  5IE9 A;  4GKK O;  5KHJ A;  3B8M A;  3T4D A;  4RUE A;  2GSM B;  4I7Z B;  1HWY A;  1NS1 A;  5KA5 A;  4D7T A;  2BTQ B;  1XMQ B;  4DR5 B;  1QVF U;  1K4D C;  3IC7 A;  5LOV B;  5LP6 B;  1YZB A;  3MHS C;  4QGP A;  1BL8 A;  2QKC A;  4H13 B;  3RGB A;  1FPO A;  2HJD A;  2UUC B;  4QE9 A;  2R9R B;  4TT3 G;  1SQB H;  4IL6 Z;  2CTW A;  4JAV A;  5DM6 V;  2Y4T A;  5LMU O;  1YJ9 V;  1E3A A;  1YIJ V;  2BSK A;  2AE4 A;  4LWS B;  2YS8 A;  4ABM A;  2WLH A;  3ZX6 A;  2CUG A;  3ZHS A;  4I9W A;  2YIB D;  1M90 W;  4N21 A;  4H44 B;  2QM8 A;  4WKT A;  4BWC A;  1IZ3 A;  4YIO A;  3H1J H;  2HJF C;  3TET A;  3ZMZ A;  3OE7 G;  3CXC U;  1R6N A;  2OCC C;  5EIB D;  3ZN0 A;  3QNE A;  4DV5 B;  2LP7 A;  2PF4 E;  2Y0P A;  2HP8 A;  3L73 H;  4QJF B;  4MS2 A;  1F51 A;  4WFF A;  4NKG B;  2AXT Z;  1GN6 A;  5CA1 B;  1QLE C;  3F5W C;  2DN9 A;  1QHT A;  3BEH A;  3CJH A;  4I50 B;  5IYD O;  3A2F A;  1NVP B;  4TSF G;  1AI6 A;  2P6J A;  2M7W A;  3JAK B;  4PA7 A;  2JJ2 G;  3UO2 A;  4JTA B;  4JI1 O;  3SPJ A;  2YXL A;  2ZNJ A;  3E22 A;  1KKC A;  3SPI A;  2ZE6 A;  2D3O W;  4X65 O;  3K58 A;  3K5L A;  4UCR A;  4TV8 B;  4FM1 A;  3RVZ A;  3D36 A;  3KG2 A;  3FKS G;  2QE7 G;  3JAS B;  4DR7 O;  1ZUQ A;  2EZP A;  2X6A A;  2WYC A;  5JCO C;  3ASO B;  4HST A;  2WLK A;  3QG5 A;  4F6E A;  5J2U A;  4LH7 A;  4HBN A;  3T1C A;  5CBF A;  4MT8 A;  4FFB B;  3MHH C;  5IDJ A;  5HFM A;  1JMK C;  2X7R B;  5EBW C;  1OJH A;  3T4Z A;  4JI8 O;  5B1B C;  1AI5 A;  4JAS A;  1FAF A;  3FD9 A;  3RYI B;  4YJ2 A;  3DTU B;  5BR8 B;  1US6 A;  5KMG A;  3ZED A;  4P9O A;  3JAR B;  4X1K B;  4YIP A;  1WA8 A;  4JYB A;  1H2S B;  5B5E Z;  4UCU A;  1N36 O;  1EN6 A;  2P4V A;  4WKV A;  4WBN A;  1W59 A;  3T1H O;  3JYC A;  3WB2 A;  4R50 A;  1B6Q A;  1OCO C;  4KL1 A;  3ETE A;  5EC2 C;  5EZY A;  1BE3 H;  5C8Y A;  3OEH G;  4UXN A;  2V4D A;  3HB3 B;  3JAT B;  4GUN A;  4KUM A;  3WG7 B;  3B2E E;  4J80 A;  4DR4 B;  3L72 H;  5IJ0 A;  3HR0 A;  3BA8 A;  3VQW A;  4B7K A;  3JD0 A;  4B08 A;  4ZOL A;  1EFR G;  1ENV A;  2JDI G;  2QM7 A;  1KQS U;  1SQV H;  3W7W A;  4P30 A;  3U11 A;  1V55 B;  1R73 A;  3M8A A;  1XL6 A;  1JFF A;  4HSR A;  2HEP A;  5H9C A;  3Q4H A;  2PY5 A;  1NTM H;  1UFI A;  2WYB A;  1QVG U;  4MVQ A;  3K06 A;  4JI2 O;  4ZHQ A;  3P3P A;  3E86 A;  4X65 B;  3HKD A;  3R66 A;  4UUJ C;  1HW7 A;  4X9Q A;  3ZMV A;  2DYR B;  2Z3Y A;  3K0G A;  3BHP A;  3CCJ V;  5LP6 C;  3K9S A;  3ZHQ A;  4X66 O;  4DR7 B;  4LF9 O;  3JCU Z;  4Z2W A;  1MSW D;  3CD6 V;  2A3Q A;  3AG3 B;  1ZX3 A;  2WYE A;  2HVK C;  5ITZ B;  1NTK H;  1WPX A;  3P32 A;  4PI0 A;  5A9G A;  3C3T A;  4O4L A;  4PHZ A;  1JJ2 U;  3JD1 A;  3H1H H;  3CEI A;  4M1J A;  2Y48 A;  3BCC H;  4I4T B;  4JI8 B;  2GTA A;  1V54 C;  4H37 A;  3K59 A;  4MTO A;  2OT5 A;  2B1G A;  2P4K A;  2QWN B;  2ITC C;  2HKO A;  3ZCC A;  1GKF A;  3SR2 C;  4XBF A;  1N36 B;  3GWO A;  1BGY H;  3KCX A;  3A0H Z;  1M4U A;  2DQ3 A;  3DGE A;  5JJE B;  3CCV V;  4RWU A;  5KLV H;  2JGU A;  2OYQ A;  2QA4 V;  1CP9 A;  2UXB O;  4DV6 O;  3PN1 A;  3H1K H;  1P7G A;  5L3C A;  3UM7 A;  4DV3 B;  1DLB A;  1H2M A;  3LNM B;  1HNW B;  1RM1 B;  1WP7 A;  5LYJ B;  1BQZ A;  3L70 H;  2CH7 B;  1K3E A;  3JTR A;  4YFA A;  1P49 A;  1VQN V;  5BMV A;  1PL4 A;  1MOF A;  1P7B A;  5IJ9 A;  1I94 O;  2OIE A;  3ZMT A;  1YEW A;  4WFG A;  4BWA A;  1GO3 F;  1QCE A;  1OCC B;  2WLN A;  1COW G;  4UCO A;  4X62 O;  4DR1 B;  2PYJ A;  3ZIA G;  4PV1 B;  1NR1 A;  2OCH A;  2Q0A A;  1Z5V A;  4KHP O;  1TVK A;  3VOU A;  4TUY A;  4DUY B;  3ZRS A;  2YID A;  1FXK B;  3C90 A;  2ZT9 B;  2Q6A A;  2A7W A;  2UUA O;  4LF8 O;  5EK0 A;  4LF9 B;  4LFA O;  4R6Z A;  5LHG A;  4MVS A;  1BS3 A;  4FM2 A;  4Z1M G;  2ZQM A;  2WAM A;  4LFB O;  2X6C A;  2LW1 A;  1Y66 A;  5GON B;  5LMN B;  2JGD A;  4FM0 A;  3N2G A;  4P9P A;  1R6T A;  4GX2 A;  4DO2 A;  3S8R A;  1LR1 A;  4GYC B;  2LFR A;  3BFR A;  5B3S C;  1G1X B;  1GN4 A;  2PYL A;  3C3S A;  2PTM A;  3BA9 A;  4KP4 A;  2UXC O;  3CHX A;  4PA3 A;  4DV4 B;  1H2N A;  1R3J C;  2BSK B;  1Y76 A;  3LDD A;  2XAH A;  1RPO A;  4LCU C;  2Q8V A;  4IIJ B;  4J41 A;  2HG5 C;  4O4H B;  2HHH O;  1MMM A;  4PA4 A;  3DC5 A;  4JV5 O;  2CGO A;  1N8R W;  4J9Y B;  1Y67 A;  3JAW A;  3AG4 C;  4JI3 O;  1JVZ A;  2BCC H;  5EIB C;  2QTO A;  4DV1 B;  1XIL A;  4D6T H;  4KXR A;  4YFB A;  2YI8 A;  4AIL C;  3ZRW B;  1M93 A;  2GBO A;  1V55 C;  1I7F A;  3CJH B;  2JRI A;  1RSO B;  2YDE A;  2VQF O;  1MG1 A;  2JEX A;  3T2M A;  1PL0 A;  1S77 D;  4BW5 A;  3CRA A;  4DV2 B;  4I55 A;  1TUB A;  3CRM A;  5FL7 G;  2QWO B;  1XEQ A;  3G71 V;  1P84 F;  5H2F Z;  2DYR C;  4YXW G;  2YIB A;  4P2Z A;  5JVD B;  4AQY B;  4JI4 O;  2XT9 A;  5C93 A;  2ZNI A;  1M5I A;  2G38 A;  2YIC A;  1NTZ H;  3ZMU A;  2EIM B;  3IGA C;  2JJ1 G;  4MW8 A;  1KEH A;  4CH3 A;  1E1Q G;  3EXA A;  3ASN B;  4IGG A;  4TQF A;  1XMQ O;  1G4Y B;  2UXX A;  4DR5 O;  3ABT A;  4EB6 B;  3CC2 V;  4F6R A;  3OMN B;  4H33 A;  3O9O A;  2F4V B;  2ZIM A;  5A2Q N;  1NKD A;  2R9A A;  4DR3 B;  1S0V A;  1FFX A;  4FJC C;  3RYH B;  2AHY A;  1VQK V;  3OD4 A;  2QKS A;  2ADQ B;  2UUC O;  5JJN B;  4YJ2 B;  1RPR A;  2F43 G;  5EYP B;  4WKS A;  3OTO B;  1PM9 A;  1F23 A;  1JPX A;  5JWP A;  1HNZ B;  3CCS V;  4FZ1 A;  2QWR B;  4X1Y A;  4JZ2 A;  4BAY A;  2ZE8 A;  3JD2 A;  3UQ8 A;  3D3I A;  2Q4P A;  5TIS Z;  1D5A A;  5B1A C;  4O2B B;  1B06 A;  4XDJ A;  3OGI B;  1N32 B;  2QEX V;  1M57 B;  2DMX A;  2WA3 A;  1RM1 C;  5EZY B;  1QLN A;  1LUV A;  4CS3 A;  3STL C;  2ATK C;  1SQX H;  1H38 A;  3M7M X;  3R65 A;  5BZB A;  4LFC B;  1VF7 A;  2QKA A;  1XRE A;  1NVP D;  4JV5 B;  3CYO A;  5IJ0 B;  1M9N A;  2WLI B;  1SA0 A;  3U10 A;  3FB5 C;  4JI3 B;  4EFE A;  5KHH A;  1RP3 B;  3DXR A;  3HKB A;  5D5Q A;  2AZ0 A;  2VWJ A;  1D2D A;  2ITD C;  4E2L A;  3RBZ A;  3ABL C;  4O4J A;  1JFF B;  4NXM O;  2ZE7 A;  4DYL A;  3K57 A;  3QF7 A;  3Q4H B;  2IJH A;  1FXH A;  1K8A W;  1YJW V;  1AI4 A;  4ZHQ B;  1SQG A;  2CAZ C;  1XNR O;  3ZJZ A;  3B09 A;  4TV9 A;  1FXK C;  1FKA O;  4OPA A;  3A0R A;  5B66 Z;  5KHI A;  5KA6 A;  4TWK A;  1SKV A;  3CRR A;  2XHB A;  1N34 B;  5EC1 C;  4R7C A;  1PPJ H;  1WLE A;  2WWW A;  4PI2 A;  5JQG A;  3JSL A;  1VQ7 V;  1R6K A;  1GN2 A;  5L3F A;  4IYI A;  1URF A;  2QGN A;  5CA3 A;  2EIN B;  4N23 A;  1NH2 B;  5FNV A;  2ADP A; 
#chains in the Genus database with same CATH homology
 5B1A B;  1NH2 D;  4WKV A;  2XAG A;  3LSS A;  2HR3 A;  3JYC A;  1QLE B;  5IYB O;  1QBZ A;  4E57 A;  3FYE B;  2ZR3 A;  4PEL A;  4GX1 A;  5CMU A;  2ZR2 A;  4R50 A;  1B6Q A;  2KB1 A;  2OTL V;  1OCO C;  1JOY A;  3ETE A;  2K1E A;  1FM2 A;  3SPH A;  1K73 W;  5EC2 C;  2DW4 A;  2YEV B;  3OEE G;  1W0K G;  3OEH G;  4UXN A;  3HB3 B;  2X0L A;  3AEI A;  1FFT B;  1SES A;  2Q68 A;  4KUM A;  3WG7 B;  5LGT A;  3WFV A;  4UVC A;  5B1O A;  4YF9 A;  4RQF A;  2WLJ A;  1KD1 W;  3EHB B;  1YIT V;  3ABL B;  1DF5 A;  3AG2 B;  3JD0 A;  3SYO A;  4RAI A;  1AI7 A;  4UV9 A;  1EFR G;  1ENV A;  4CBC A;  2JDI G;  2QM7 A;  3X2Q C;  2NLJ C;  1KQS U;  3OAA G;  3W7W A;  1K5Q A;  1YSC A;  3LSQ A;  1VQP V;  1K97 A;  1SRY A;  4JAU A;  4P30 A;  1NR7 A;  1K92 A;  5EBM C;  1V55 B;  1R73 A;  2Q67 A;  1XL6 A;  3F7Y C;  3CCR V;  3OMA B;  4WCE V;  3E8B A;  1YTF B;  4HSR A;  1GK1 A;  4ZBM A;  5H9C A;  1YTF D;  5L3D A;  5EBL C;  1AJN A;  2AE3 A;  1QVG U;  2WYB A;  4MVQ A;  1EBO A;  4EKW A;  3K06 A;  5CBG A;  1L1F A;  5IYC O;  5B1B B;  3E86 A;  1OCR B;  4MVZ A;  4X88 A;  4UUJ C;  1PD3 A;  3MD0 A;  1PKX A;  2Y69 B;  3ZMV A;  2DYR B;  2EIM C;  2Z3Y A;  3K0G A;  1BHA A;  3CCJ V;  3ZRV A;  4MVO A;  2EIL B;  1I5Y A;  5LHH A;  4UV8 A;  2H8P C;  3LUT B;  3ASN C;  3W7S A;  3BY6 A;  3ETG A;  1MSW D;  3CD6 V;  3AG3 B;  1R3K C;  4RQE A;  2WYE A;  4G28 B;  4U7N A;  2HVK C;  1OCC C;  3CC7 V;  3EFF K;  4LP8 A;  3I55 V;  1WPX A;  4PDL A;  4GX0 A;  3P32 A;  1PNM A;  2UXN A;  2WLL B;  4BTH A;  1JJ2 U;  1XL4 A;  3JD1 A;  3M99 B;  1OCO B;  4LC1 A;  4PDV A;  2ADV A;  1M56 C;  4M1J A;  2Y48 A;  5HFL A;  2EIJ C;  1QR9 A;  3GB7 C;  1SER A;  3SYP A;  4WKU A;  4K2F A;  2Z5U A;  3ABU A;  2LFS A;  4JTD B;  1PNL A;  4KFM A;  2DWE C;  1V54 C;  5J9P C;  2B5U A;  4H37 A;  1VQ8 V;  4JF3 A;  2ZD9 A;  2HLD G;  4MTO A;  2YEV A;  1VQM V;  1NBM G;  4U7O A;  2OT5 A;  2B1G A;  4PEM A;  5CBH A;  1CPY A;  2ITC C;  2HKO A;  3ZCC A;  1IXM A;  1GKF A;  4XBF A;  3K3W A;  1KEC A;  4JPR A;  1YI2 V;  2EBO A;  3GWO A;  1VQ5 V;  1VQ6 V;  3SRA A;  1S5H C;  2DQ3 A;  3DGE A;  1JW0 A;  1S3J A;  2HVJ C;  4WF9 V;  3OM3 B;  3CCV V;  3E2E A;  3RVY A;  5CN0 A;  3X2Q B;  4MW3 A;  5B1N A;  2QA4 V;  1CP9 A;  3TK1 A;  2OCC B;  2ZXW C;  3ABM C;  3STZ C;  1PNK A;  3FB7 C;  4MVU A;  3ZRX A;  5L3C A;  3UM7 A;  3JD4 A;  1M57 C;  4Q20 A;  3SRC A;  5E1A C;  4GX5 A;  3G6E V;  3NXS A;  1DLB A;  3LNM B;  1EZJ A;  1RM1 B;  3K9A A;  1NQT A;  1K3E A;  2CK3 G;  2X6B A;  1GM9 A;  3JTR A;  2PI4 A;  4YFA A;  1VQN V;  1W0J G;  2DYS C;  3ABK C;  2JEU A;  1FXK A;  5GW7 A;  1AJQ A;  3E8H A;  2IU0 A;  4PDM A;  3CCE V;  1SET A;  1OZ0 A;  1MOF A;  5KUK A;  3CMA V;  1P7B A;  1E1R G;  3AG1 B;  5IY5 C;  4FIP C;  4MTG A;  5H6Q A;  2W6I G;  2EIK B;  1DF4 A;  2Q69 A;  1H2G A;  2V7Q G;  3K0D A;  3ZMT A;  3QO8 A;  1Q82 W;  4WFG A;  1AR1 B;  1LNQ A;  4G27 B;  1GO3 F;  2JIZ G;  4I5S A;  1QCE A;  1OCC B;  3SPC A;  2WLN A;  4BIU A;  1COW G;  5LHI A;  4XDL A;  1NJI W;  4MVR A;  1KP2 A;  4HAM A;  3FB8 C;  2EJR A;  3K04 A;  3ZIA G;  3K08 A;  1FS0 G;  1NR1 A;  1M56 B;  3QO7 A;  2FTK A;  3JD3 A;  2BOC C;  1GK0 A;  1Q81 W;  1GMG A;  2C2A A;  2EZO A;  2AHZ A;  2WLL A;  4XDK A;  3VOU A;  1V54 B;  3ZRS A;  1OCZ B;  1ORQ C;  1FXK B;  1K5S A;  1JQ0 A;  1S76 D;  1K7D A;  2H94 A;  4JTC B;  4E55 A;  2Q6A A;  3OUS A;  5L3G A;  5EK0 A;  1GK9 A;  5DN6 G;  4R6Z A;  2W6J G;  3L91 A;  5LHG A;  3ZN1 A;  1Y4M A;  4MVS A;  1M1K W;  3K79 A;  2ZQM A;  4Z1M G;  2WAM A;  2X6C A;  3ML0 A;  1Y66 A;  2WLM A;  2EIN C;  1CEZ A;  4X89 A;  2WYD A;  2A0L A;  1UJW B;  4P9P A;  4RO2 A;  4JYC A;  4GX2 A;  4UVA A;  4DO2 A;  2OTJ V;  3S8R A;  5LGN A;  2ZXW B;  2LFR A;  5B3S C;  1FXV A;  2A79 B;  3ZRW A;  4KP4 A;  2YSU B;  4FMT A;  1GM8 A;  2P67 A;  4PA3 A;  1R3J C;  3PJS K;  1KKD A;  1VQO V;  2R9I A;  1TUE B;  3LDD A;  1Q7Y W;  2WPD G;  2XAH A;  1RPO A;  4LCU C;  4QIW F;  3K03 A;  3LDC A;  4GT1 A;  3W7U A;  5KUM A;  4PA9 A;  3CCQ V;  4UVB A;  1KP3 A;  3W7T A;  2V1D A;  4FPP A;  2PI5 A;  2DYS B;  1S72 V;  1DTO A;  4X8A A;  4F4L A;  4ZKI A;  2JK5 C;  2ZDI C;  4OXS A;  2HG5 C;  1BMF G;  3I56 V;  5LBQ A;  1ZWI C;  5L3E A;  1OR0 A;  4PA4 A;  3SYQ A;  1N8R W;  1I5X A;  4J9Y B;  2P7T C;  4J9Z B;  4PA6 A;  4MTX A;  3AG4 C;  3AG2 C;  1JVZ A;  2WSS G;  2QTO A;  4RUF A;  4QE7 A;  3SJQ C;  2IH1 C;  4R8C A;  4YFB A;  1P4R A;  2B1I A;  3ZRW B;  1V55 C;  3H01 A;  1F4M A;  1MG1 A;  3E89 A;  2JEX A;  2W0F C;  1K34 A;  3FYI B;  3SPG A;  3T2M A;  3OGC C;  3E35 A;  2AE5 A;  1SZT A;  1PL0 A;  1S77 D;  1R3L C;  4BW5 A;  3B8M A;  3T4D A;  4RUE A;  1OCR C;  5FL7 G;  2IW5 A;  3CME V;  2GSM B;  2ZDI A;  3G71 V;  1AJP A;  2Y69 C;  1HWY A;  2DYR C;  4YXW G;  4P2Z A;  5C93 A;  3E8F A;  2EIL C;  5KA5 A;  4HYO A;  2XAS A;  2IJJ A;  3ZMU A;  2EIM B;  1QVF U;  3CPW U;  1K4D C;  3IC7 A;  3IGA C;  2JJ1 G;  3CP1 A;  4MW8 A;  1VQ9 V;  1KEH A;  3JTQ A;  3MHS C;  1BL8 A;  1E1Q G;  3ASN B;  5B3S B;  4QPJ A;  1KC8 W;  3RW0 A;  3QO5 A;  3CCU V;  3E8G A;  1G4Y B;  2UXX A;  3ABT A;  3OR7 C;  4QE9 A;  3CC2 V;  2R9R B;  5H6R A;  4TT3 G;  3OMN B;  4H33 A;  1JX9 A;  3ASO C;  2XND G;  5L3B A;  1H8E G;  1NKD A;  1BHB A;  1S0V A;  4JAV A;  5DM6 V;  4FJC C;  3ETD A;  2HFE C;  4WFB V;  1YJ9 V;  2NNU A;  2AHY A;  1VQK V;  4BIZ A;  1E3A A;  2BOB C;  2QKS A;  4MVM A;  1YIJ V;  2AE4 A;  2EIJ B;  3B8N A;  1ARO P;  1RPR A;  2WLH A;  3OR6 C;  2F43 G;  4HZ3 A;  2DQ0 A;  2WLI A;  4I9W A;  4WKS A;  4FK5 C;  4L87 A;  1M90 W;  4N21 A;  1F23 A;  1JPX A;  2QM8 A;  1F4N A;  4WKT A;  3CCS V;  2XOK G;  2P90 A;  3AG4 B;  4CZZ A;  4G2K A;  4QPK A;  2HJF C;  2IJK A;  3TET A;  3ZMZ A;  4BAY A;  3OE7 G;  3JD2 A;  3CXC U;  3IFX A;  1R6N A;  2OCC C;  3ZN0 A;  3QNE A;  3UKM A;  3D3I A;  1G8M A;  1ROP A;  2LP7 A;  4WFA V;  2A9H A;  3E83 A;  3TCU A;  4QJF B;  4MS2 A;  3VBB A;  1F51 A;  3ABM B;  4WFF A;  5B1A C;  4PDR A;  4XDJ A;  3OFN G;  2QEX V;  3G4S V;  1M57 B;  1RM1 C;  1W2B U;  1YHQ V;  1QLE C;  1QLN A;  3F5W C;  3STL C;  2ATK C;  3BEH A;  1H38 A;  3R65 A;  5BZB A;  5IYD O;  1VQL V;  1E79 G;  3JCZ A;  1NVP B;  3CC4 V;  4TSF G;  1AI6 A;  2MK3 A;  5LGU A;  3SYC A;  2P6J A;  2M7W A;  4PA7 A;  2JJ2 G;  4JTA B;  1NVP D;  1THZ A;  3SPJ A;  3CYO A;  1M9N A;  2XAJ A;  2GHY A;  2WLI B;  3P30 A;  3SPI A;  3FB5 C;  3ABK B;  3AG1 C;  2D3O W;  1QR8 A;  3WG7 C;  4JGS A;  2EIK C;  3HPL C;  2XAQ A;  3L94 A;  5IY5 B;  3RVZ A;  3OMI B;  3D36 A;  2ITD C;  3KG2 A;  4E2L A;  3F7V C;  3FKS G;  3RBZ A;  2QE7 G;  1GTO A;  3ABL C;  3OW2 U;  1GHD A;  3B77 A;  2EZP A;  2X6A A;  2WYC A;  2IH3 C;  2IJH A;  3ASO B;  1K4C C;  1FXH A;  4HST A;  3W7X A;  2WLK A;  1OHH G;  4WFH A;  1K8A W;  2DWD C;  1YJW V;  1AI4 A;  3FB6 C;  3CCL V;  4GCZ A;  3T1C A;  1GM7 A;  2IJI A;  2IU3 A;  3ZJZ A;  3CCM V;  5CBF A;  1JCH A;  4MT8 A;  1J95 A;  1OCZ C;  3MHH C;  4WFE A;  2XAF A;  1FXK C;  3ZMS A;  4ASU G;  5IDJ A;  5HFM A;  1Q86 W;  2X7R B;  4DXW A;  5EBW C;  3T4Z A;  5B1B C;  3A0R A;  5KA6 A;  4TWK A;  4E56 A;  1AI5 A;  4JAS A;  3SYA A;  3LDE A;  5EC1 C;  4R7C A;  2WWW A;  1WLE A;  4MSW C;  1VQ7 V;  1R6K A;  1K9M W;  1VQ4 V;  3DTU B;  5L3F A;  4P9O A;  1H8H G;  1K33 A;  5CA3 A;  4JYB A;  2EIN B;  4N23 A;  4LBE C;  1R3I C;  4K2G A;  4QNH B;  1NH2 B;  1MAB G;  3AG3 C;  1JVM A;  3OUF A;  3SRB A;  4MTF A;  1YJN V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...