3ML0A

Thermostable penicillin g acylase from alcaligenes faecalis in tetragonal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
molecule tags Hydrolase
molecule keywords Penicillin G acylase, alpha subunit
total genus 40
structure length 195
sequence length 195
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ml0A02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3ml0A01
1GK1A 1PNMA 3SRBA 1AI4A 4BTHA 2WYEA 3SRCA 1AJPA 1GM7A 1K7DA 1CP9A 2AE4A 1KEHA 3L94A 4E55A 1GK0A 1GM8A 1PNLA 1AI5A 4HSTA 4M1JA 4YFBA 1AI6A 1GKFA 1JVZA 1OR0A 3ML0A 1FXVA 4PEMA 1K5SA 1KECA 1K5QA 1PNKA 3K3WA 1JW0A 4WKTA 2WYDA 3JTQA 1JX9A 4E56A 3JTRA 4WKVA 1GM9A 3L91A 2AE5A 4WKSA 4E57A 2WYBA 1FM2A 3SRAA 3S8RA 1E3AA 2ADVA 4HSRA 1AJQA 1GK9A 1GHDA 1AI7A 1FXHA 4PELA 2AE3A 4K2GA 4WKUA 2WYCA 4YFAA 1AJNA 4YF9A 1H2GA 4K2FA
chains in the Genus database with same CATH superfamily
1PNMA 5CA1A 1K7DA 2ZDIA 4LF7B 1AILA 2QSAA 2ZNJA 1KU9A 1XEQA 3DXRA 3CE2A 1FYJA 4LWSB 4ZBMA 3OTFA 3A0BZ 3RYIB 2PYLA 1GM9A 1JVMA 3FB7C 3T2MA 3K0GA 2X6BA 4DV0O 3TK1A 2UUBB 4J42A 2ILMA 4JI0O 4EKWA 4CH5A 2DW4A 2YIBA 3IGAC 1AROP 3ZMTA 2LQTA 3HKDB 2Q7HA 3N2GA 5JJEB 2PI5A 4GKKB 3IAYA 4X9QA 4WBNA 4YY3B 1BQZA 4PI0A 2UUCB 4RQEA 1R73A 4LCUC 2GHYA 4OGQB 1NKDA 2EIKB 3P30A 2UXCO 1OV9A 5IYZA 3UM7A 1H8EG 4I9WA 1R3KC 1PPJH 2PI4A 4XDJA 4AHCA 4PHZA 5AG2A 4EFEA 2ZT9B 3IC7A 4CS3A 3TETA 4FLXA 2EZOA 1NBMG 1Q86W 1FJGO 1V9PA 3LNNA 4JI2O 3S3WA 3WB1A 2XAHA 1XUQA 2OCCC 5B1BC 4GKKO 1XI1A 1LR1A 2ZNIA 2YIDA 1OR0A 2ZQMA 4Q6GA 3BA9A 2DQ3A 2ZXWB 3ABMB 1KP2A 4JI7B 4Z2WA 1KQSU 2ZE8A 4YJ2A 3FB5C 4UV8A 1Q8IA 5FLXN 3OMAB 2IJKA 3LSUA 2Q5ZA 3FAVA 5CA3A 2QA4V 5CBFA 2CTPA 1US6A 3EVKA 4DV7O 1MOFA 1EBOA 3T1YO 2YI8A 3K3WA 3AK3A 1MABG 1KKDA 4FM2A 3AG7A 2Y4UA 2F95B 1H8HG 1SRYA 2A7WA 4GUNA 2DWEC 4W4LA 4MS2A 1BQ0A 1I94O 3RT3C 4CBCA 4H13B 4F6RA 5KHGA 2QM7A 5IJ9B 3JTRA 5H6RA 4GZRB 3M99B 1F4MA 3AG4B 3RW0A 1SF9A 3L74H 1YXBA 2JS3A 2WYCA 1K34A 1XNRB 4LFCB 2UUCO 4UVCA 2B1IA 3AK2A 2BOCC 5DN6G 4E55A 1XL6A 3A0HZ 3JATB 2IH3C 4JI3O 3LDEA 1DF5A 2JGDA 4GCZA 3OD4A 2BTQA 3C90A 1VF5B 1XDCA 1VF6A 2GUZA 4H44B 3AG1C 3OMNB 4J11A 5LA6A 2KG7A 3VQXA 2HKOA 3LUTB 4PDMA 3LDCA 1BHAA 2R9IA 3C3SA 3O9OA 2WLIB 3ML0A 4RUFA 1VARA 4UCOA 4QE7A 1EN6A 4PDLA 2XUMA 1FFTB 3CPWU 1E3AA 4TSFG 4JI5B 2W6JG 5FPOA 4DR1O 3OTOB 1XHZA 4J7ZA 5GW7A 3L72H 4QPJA 1THZA 1KEHA 4HZ3A 1N0NA 3F5TA 1ZWIC 2EJRA 3H1KH 4HNAA 4MTXA 3KCXA 3CCMV 1W0JG 4LF6B 4KFMA 2EZPA 3OTOO 1JJ2U 5KHJA 1XNQB 3ETGA 5IYCO 4DR7O 3CHXA 3H01A 2WLMA 2HEPA 4MTFA 2VWJA 3DGEA 5LMUO 1RP3B 1XNRO 1T5EA 4B3TB 3D36C 3BA8A 3CEIA 3SYPA 3RYCA 3ETQA 3CX5F 3HKEA 2E3CA 3ABKB 1VQ4V 2X0LA 4I55A 4UCTA 4ZOLA 4TV9A 3P32A 4C7UA 4U3JB 1BT8A 1Z2GA 4U3JA 1WA8B 3TXSA 3AEIA 4MW8A 3CCEV 4K2FA 4U3FH 3CB2A 4DRXA 3ZMUA 4J7KA 4JI3B 3CRRA 3L75H 3U11A 3ZIAG 3CRCA 4IL6Z 4GLXA 4LFCO 2EULA 1OCZB 1MSWD 4NVPA 3JD1A 2OIGA 4X89A 2WLNA 4LF5O 1FS0G 3OEEG 1N34O 4CC6A 1M56B 2CH7A 3K5LA 4JZGA 3HKCB 3E8GA 4E56A 1JOYA 3BRCA 3H9VA 1IVSA 3CRQA 1R1BA 4HSRA 1FAFA 5JVDB 2F1MA 1TUBB 3SYAA 4B3RO 2HR3A 3SGIA 3AG3C 1S3JA 3OUFA 2UXDO 3ICXA 4B3SO 3G67A 2WLIA 2JGUA 4X1KA 4EB6B 3OR6C 2UUBO 4DV7B 3H1HH 1S5HC 1O9HA 2YEVA 3I5DA 1Q81W 1MG1A 1VP7A 4HBNA 3ABTA 1Y6XA 2VS0A 2LP7A 5IJ0A 1U96A 2WYBA 3HKCA 2MK3A 3N2KB 2CDYA 5LMNB 3CC4V 3G4SV 5LHGA 2XAGA 1PKXA 1NTZH 3A8TA 3WG7C 4JI1O 2BOBC 4UFZA 2JVDA 3L9DA 3QVNA 5L3CA 5A2QN 1XOUA 2AW9A 4Z1VA 3TCUA 5IYBO 4K35A 4UUJC 1Y4MA 1N36O 3ETDA 4JYBA 4B3SB 1R6NA 4TUYA 3K57A 3L91A 4IYHA 3FB6C 1HP8A 3APQA 2VWKA 3HKBA 1BSMA 1ZX3A 3OM3B 4D7TA 5JJNB 1Q90D 2AZ2A 2CTRA 4F6RB 1Y74B 2ADQB 3I55V 1XMOO 4LP8A 1SZXA 1QVFU 4WFHA 2L35A 4JTCB 3SPGA 2N04A 3ZHQA 2YC0A 2E75B 3JD0A 1SQXH 4X64B 1M4UA 1S72V 4JYAO 1GK9A 2JEXA 1FXHA 2DE0X 3QG5A 4TUYB 5BY1A 2CGOA 4O4LA 2Q9LA 2ZE6A 2IBZH 2Q7EA 5KX5B 5LGNA 1IURA 2QWNB 3K5MA 4DK1A 2CUGA 1B06A 3BABA 1YCIA 2F4VB 2E76B 2R9AA 1P49A 2H94A 4IIJA 4YFAA 1HNZO 1WA8A 2XTAA 3ZX6A 4ZHQA 3ASOB 3E8FA 4X88A 4QGPA 1NU1H 1NH2B 4TWKA 5GTHZ 4I9QA 4JI6B 4DV5O 2YEVB 1GN6A 5CA1B 3L94A 1GN3A 5KUKA 5A9GA 2DYSC 2KQXA 3FFQA 2YXHA 5B3SB 1OCCB 3FAVB 2V4DA 5IJ9A 3JARA 3AG3B 1BMFG 3SRAA 3D3IA 2UUAO 3CXHF 3E89A 4TV8A 1Y66A 1WP8A 4FLUA 1R3JC 1F7YA 4W4KA 1FD9A 5JJJB 1R3IC 2YDEA 2ZR3A 3AK1A 4DUYB 2D3OW 4F6EA 1PP9H 5DEDA 4X65O 2WYDA 1K33A 1MSDA 4GX2A 5F2VO 4O4HB 2QGNA 3KZIZ 1AR5A 4JASA 5EYPA 5EYPB 1VF7A 2KSDA 2Y4TA 3SPHA 1QLEB 1GAXA 3N27A 3LSSA 2GSMB 5C8YB 1GN4A 4NKGB 4LF4B 4ZHQB 1N36B 1FPOA 4QNHB 2ZM6B 2HHHO 1SERA 5KAIZ 4DW1A 1H38A 1M57C 1H2LA 1DF4A 1WPXA 4BIOA 5EC1C 1AJQA 2V7QG 3UT5A 3CCUV 2H8PC 2LGQA 1AP5A 1BCCH 2QR4A 5KHIA 2HFEC 1FXKA 4UXNA 2ZKOA 4L8JA 3JAKB 2WAMA 3W7UA 4HAMA 3D3QA 4X62B 1OJHA 3BCCH 3F7YC 4H33A 3U10A 1HR0B 1DGSA 1SZTA 2IM9A 4DV3B 1YJ9V 2WLLB 1B6QA 2JK5C 2RCVA 1F23A 1N8RW 3U0ZA 2NNUA 2JRIA 3B2EE 3KCYA 3ZRWA 5KLVH 4JI1B 1XREA 3BEHA 3ASOC 2A79B 3BY6A 4JV5B 3TXQA 5K1PA 2YUAA 3JD3A 4LFAB 3ZRVA 3ZJZA 5DM6V 3UCSC 3SRCA 1IBLO 4X66O 4UCUA 3K9AA 1Q43A 1Q6IA 3SJCC 2DMXA 5BMVB 4JI2B 2LGWA 2DN9A 3F5WC 4DR7B 2ARHA 3KKYA 1QHTA 1V54B 1XHXA 4JF3A 3RYFA 2ODMA 5LGTA 2QM8A 3CCQV 5B1OA 2OTJV 4JAVA 2L6LA 2FL4A 5LHIA 3JATA 4F4LA 1A32A 2Z0AA 1EZJA 4FFBB 2WLLA 1UFIA 1AVMA 4FM0A 1NJIW 3I56V 1QLEC 3P3NA 3NXSA 4NXNO 1ROPA 2NLJC 4CH3A 5H9CA 3T4ZA 1YZBA 3DC6A 4RQFA 3OMIB 4L87A 2QKAA 4NTYA 3VQWA 3RYFB 3LNMB 1NZ6A 2Y0PA 1WNSA 2EJ7A 1I08A 3H1LH 1RSOB 1O9GA 5GONB 4J9ZB 2B9ZA 5IJ0B 4AILC 3P3PA 2UU9B 1L0LH 3EHBB 4FMTA 3L70H 3S8RA 1AR4A 3UT5B 2EIMC 4DR1B 4O4JA 1TVKA 3B4SA 1NS1A 4GT1A 3JSNA 2VQFB 3JALB 4G27B 1JFFB 2NR5A 4DR5B 5FL7G 1IBKB 4RO2A 2JEUA 2DYRB 5B5EZ 1K4CC 3OGIB 3BVOA 3SDLA 5KMGA 2JIZG 4MSWC 4WKVA 2XNDG 2QM4A 1X59A 4LF9O 3CMAV 1FKAO 4FLTA 4PD4F 5JCOA 2MW2B 4B7KA 4DR6B 4O4HA 4G28B 4PA4A 2LJ2A 5KX5A 1MZFA 3N2KA 1GRJA 4HSTA 1HNZB 4DR3O 3MAQA 1SS3A 1Q6UA 1QU7A 2XHBA 2P4VA 4ZOLB 2YIAA 1K3EA 2EILC 2GV9A 3K04A 3JASA 1BE3H 2IJJA 3OUSA 5BR8O 3OEHG 2KB1A 2JGDB 1IX9A 1YEWA 2JS5A 1KBHA 5H2FZ 3RVYA 1I5YA 4YHHO 1OCRB 4FLZA 1ZL8B 3SPJA 3UQ8A 4PA7A 1QQCA 4MW3A 4FPPA 5LBQA 3QTCA 2FB5A 1ZSPA 1S5JA 4YHHB 3X2QB 2E74B 1NI8A 2PZSA 2C2AA 4WFFA 3WB0A 3Q4HA 2ZINA 1NVPD 2XT9A 4JYAB 5BMVA 1W0KG 5CBGA 3EFFK 4FFBA 4MVZA 2IJHA 4TOIA 2Q67A 4I4TB 4WCEV 2K1EA 3GWKC 4X1YB 4DV4O 1K4DC 2W6IG 2P4KA 1YITV 4QJFB 2YS8A 2BSKA 4DUZB 4JI4O 3L73H 2BCCH 4UB8Z 2ATKC 1SC5B 4X1KB 4EB6A 1I5XA 2AHYA 2QEXV 1JVZA 3THOA 1W59A 4JI5O 2EIMB 1G1XB 3CCSV 1L8DA 3L71H 4I50B 3HKBB 4XBFA 2HVJC 1PD3A 3CC7V 1KUQA 3K5OA 4LNUB 1GN2A 4X66B 1GM7A 2B1GA 4RWUA 2DYRC 5E79Z 4PJ0Z 4P30A 1Q5OA 3JCUZ 1RM1B 4JI8O 3TJTA 1RPRA 2IJIA 3E86A 2F66C 2Y69C 5EC2C 4DV2O 1VQLV 4WKSA 3Q4HB 1M90W 4O4JB 3CJHB 3MDSA 1NTKH 2O57A 1VQ9V 4GKJB 2CGNA 3AG4C 4PI2A 2IU0A 4FZ1A 2PGGA 2XASA 2Z3YA 3JAKA 4B3RB 4K0KB 2WLKA 2P06A 3VBBA 2AGAA 2ZR2A 1W2BU 2R72A 1I0HA 4DV0B 1VQKV 1YI2V 1WLEA 4IHJB 4NXNB 2P7TC 1KD1W 1K8AW 4NXMO 5DECA 5LHHA 3CCRV 1XBLA 2HP8A 1OCRC 2AZ0A 2UXNA 3AG1B 1AI5A 1JA8A 4R8CA 1ORQC 1TUEB 1RPOA 5H6QA 2QKCA 1GO3F 1XILA 1MMMA 1YIJV 4BIUA 3CXCU 4DV4B 4B3TO 3RYHB 1YTFD 3X2QC 3SJBC 3RN4A 1AJNA 4GX1A 1GK1A 4LF4O 3ABLB 4XDKA 4B7EA 1QR9A 1MNGA 5CN0A 2PYJA 4K8XA 2Q6AA 4Z1MG 2QE7G 4FK5C 3O65A 4UCVA 2HJFC 1QR8A 4Q20A 1SETA 1SQBH 5J9PC 2RDCA 3FYIB 1YDXA 3UKMA 1NH2D 3ZBHA 1SKVA 5L3EA 2GDSA 3QNEA 1JFFA 3ZMVA 1AP6A 1H2GA 1TUBA 5KA6A 3W7SA 2BSKB 3JYCA 3E8BA 4PA9A 4DO2A 4YIOA 5J2UB 1XMQB 1TGOA 5IE9A 3H1JH 4WFBV 2AE5A 1NQTA 1AI7A 1B3QA 3ABKC 4O2BA 5LP6C 4O4IA 4ASUG 1V55C 4PV1B 4X65B 1WJZA 4J80A 2Y69B 5TISZ 1N4CA 4RAIA 4JPRA 1J95A 4I50A 2K9PA 2CAZC 1DTOA 2F93B 4DR2B 2HG5C 1KC8W 4K2GA 3SYQA 5JQGA 4H0LB 4DRXB 4LF9B 3RYIA 5LMUB 3DTUB 4O2AA 1OCZC 3FYEB 4BAYA 3ETEA 2BTOA 1K5SA 1QBZA 1P84F 2W0XA 1TA8A 2FTKA 1ZTEA 4WFAV 5B1AB 1M56C 2KKWA 5FNVA 3KG2A 5GONA 3OE7G 2XAQA 3CJHA 2OTLV 3CSXA 1Q82W 5LOVA 1H2MA 3ZMSA 4DR4O 2OYQA 2F4VO 4WBNB 4LR3A 3FX7A 1YSCA 1U97A 4FLVA 1KYOF 1KECA 4JTAB 2PTMA 2QTSA 4I55B 3S3XA 4LF8O 3ZRSA 2R9RB 4BWCA 3ABLC 1VQ8V 5C93A 4IIJB 1XQ8A 1B04A 3MHSC 3SYCA 4NR1A 2Q68A 3QO7A 4U7NA 4D6TH 3NR7A 1N32B 2RNBA 5IDJA 4DV5B 4MT8A 3J7AU 3G80A 4TV8B 5KHHA 3T1YB 1GH6A 2PUSA 3QF7A 3GVMA 1IXBA 5FNVB 5L3FA 2ZCEA 3RWRD 1FJGB 1YJWV 1IDSA 5IY5C 4AQYB 3PJSK 4JGSA 5EIBD 3OT7A 2DOSA 5LP6B 4O2AB 2NN4A 4WF9V 1V55B 4X1YA 1WPBA 2FMLA 3WFVA 1EZVH 2RJZA 3G6BA 4A5UB 2HVKC 3SR2C 4P9PA 1QLNA 4JI8B 4YXWG 1EFRG 3K5NA 1J5EO 4ZI7A 1R6TA 2CTQA 3CD6V 1HNXO 2YSUB 5BZBA 5J2TA 3HR0A 5K1XA 3VQVA 3BHPA 1ZAUA 5EIBC 3B8MA 1D5NA 4BR6A 2YXLA 3JAWA 1EN4A 3K06A 3F7VC 1YHQV 1TAEA 2ITCC 4YJ3B 5EBLC 3VQYA 4R6ZA 4JAUA 3JALA 4K8ZA 1G8MA 2OCHA 4DXWA 4LFBB 1VQMV 5B1AC 4OXSA 4WFGA 4QPKA 4GX5A 3ABUA 4WKTA 4LH7A 4X20A 2RN9A 3M8AA 4UCRA 1VQ6V 3RVZA 1M93A 1OCCC 4YJ2B 4CZZA 2XAJA 1R6KA 3T1CA 3CWBH 1H2SB 2LW1A 5KA5A 3CRAA 4FM1A 1Y76A 1WAZA 5CB4A 2M6YA 2H3OA 4GX0A 1XNQO 3A2FA 1BL8A 3E35A 3D8CA 2GTAA 5JH7A 4CH4A 1GMGA 4OPAA 4LFAO 4E57A 3ASNC 2X6CA 3K0DA 3DC5A 2WWWA 1M9NA 4DR4B 2Q7GA 3ZMZA 3K58A 1M5IA 2EINC 5J2UA 4GKJO 2Q73A 1E79G 3C3TA 4NXMB 3FGRA 2BTQB 4BWAA 2ZM6O 3K9SA 4BIZA 2HHHB 2IU3A 2XOKG 2UXBO 1Y74A 4ABMA 1WP7A 2D2CB 3K08A 1VQPV 4BW9A 1M1KW 2ZIMA 2IH1C 3CCJV 2AHZA 5EBMC 2A9HA 2OT5A 2JJ1G 2A3QA 1M57B 2OCCB 4J10A 4TV9B 2A0LA 5KAFZ 5IY5B 4IGGA 1X4TA 3CRMA 1VQOV 1I7FA 1SQFA 2B5UA 1GKFA 4LH6A 3ABMC 2YICA 3RGBA 4UVAA 1DLBA 3IFXA 4DUYO 3JTQA 5IT9N 1OCOC 4CS2A 4U7OA 2Q0OC 3SJAC 2WA4A 1FXKB 5HFMA 4JI4B 1SA0A 4B08A 3RFRA 3TGUH 4N21A 4CS4A 2F23A 3WB2A 1PV0A 4D7SA 2VQEO 4J41A 1KP3A 3MD0A 4OX9O 4B3MB 4R50A 3QO5A 4QE9A 4E4EA 4PA3A 2W0FC 1FFXB 3E22B 4JI6O 4WFEA 4ZIBA 3SJQC 1ZL8A 2ZD9A 1AR1B 3WU2Z 1Q3EA 2ETNA 3GWOA 3R65A 3HKEB 1GK0A 4OX9B 4DV1B 4RUEA 4N23A 4HNAB 3ZN1A 1VMGA 4MTOA 2WLJA 3CMEV 1SQPH 4K0KO 4FLWA 2CH7B 4DR5O 2N05A 1G4YB 5BR8B 4X64O 1N33B 2PY5A 4I4TA 2E5LB 1V54C 2QJ1A 4XDLA 4YFBA 4UVBA 2Y0IA 1FXVA 4DR6O 1Z5WA 3OGCC 3ASNB 4LFBO 4ICGA 1N34B 3STZC 1OZ0A 5HFLA 1ZUQA 1LUVA 1JJOA 2EINB 5J2TB 1HW7A 5LOVB 5B1NA 1JPXA 1IXMA 4EFBA 1BHBA 2HLDG 3BFRA 1BZKA 1NT2B 3OW2U 1UJWB 2WPDG 4I5SA 4FJCC 1HNXB 3RYCB 2WLHA 3CYOA 5JVDA 1CEZA 1JX9A 3SPCA 2P6JA 1JCHA 2EBOA 3D36A 2ADVA 1GHDA 4WKUA 1WN7A 2ADPA 1E1QG 4JV5O 2VRZA 2UXCB 2RQ6A 2V1DA 3W7WA 3CC2V 3RBZA 3W7TA 3EXAA 1OCOB 1YJNV 5EBWC 4LF5B 1N33O 4MVOA 3OR7C 4FZ0A 4JYYA 1FXKC 4O4IB 2UXDB 2CK3G 2CTWA 1IBLB 5D5PA 3QO8A 4JI0B 4R7CA 4OPHA 1VIBA 2QKSA 1N32O 4I7ZB 1WB8A 4TT3G 4KHPO 4FFKA 4DYLA 3UO2A 1LUWA 1VEWA 4H37A 5IYDO 1D5AA 4I0XB 4CH6A 1SQGA 2EILB 1AI4A 4FVMA 5C8YA 4UB6Z 4KUMA 1PNLA 5IYZB 1S5LZ 3J80N 3FD9A 4TQFA 3JAWB 3MHHC 1MZEA 3SYOA 4IYIA 2QWRB 1HNWB 3BAAA 2QWOB 1PL0A 4O4LB 1NR7A 5EZYA 3E83A 5JQGB 1VQ7V 2Z5UA 3A0RA 3DSQA 5CBHA 4BTHA 4DV6O 5EK0A 4KP4A 3ZRWB 5B66Z 3UO3A 3E8HA 5FPRA 4M1JA 1F4NA 2ZE7A 4AI8A 4UCSA 3HB3B 5IWAB 2Y48A 1F51A 1H2NA 1P7GA 4YY3O 1IBKO 1FM2A 1L0NH 2FYUH 2A06H 1RSOA 2XAFA 3B8NA 3B40A 1BS3A 4G2KA 4IHJA 2UXBB 2ZIOA 4J7JA 1E1RG 4I0XA 2Q69A 2WA3A 5LYJB 5LYJA 3ZCCA 1N0JA 3T1HB 1JR9A 2LFSA 5L3BA 1MA1A 1S76D 1CXZB 5L3DA 3FB8C 5BXZA 1VQNV 2AXTZ 2PF4E 1K9MW 4JZ2A 2HJDA 2EIJC 3WG7B 2YXYA 1GTOA 1R3LC 3RYHA 4QIWF 3T4DA 1BGYH 4FLYA 4IT5A 2DJVA 2CE4A 2F43G 2AE4A 1K92A 2LW7A 4NYKA 4LWSA 1XMQO 1D2DA 4MVQA 1K5QA 4X8AA 1HR0O 3JSLA 4UV9A 4LBEC 4LNUA 1RM1C 4PELA 1EN5A 2VQFO 4PDVA 3ZHSA 1SA0B 3LDDA 4X20B 1HWYA 1IBMO 3BPZA 4GYCB 1SQQH 1L1FA 1Q7YW 4MTGA 1LNQA 4J9YB 4LC1A 1KKCA 2UUAB 1HNWO 4X1IB 3T1HO 3IC9A 2VQEB 1JQ0A 2X6AA 4MVUA 2GUZB 4DV1O 1HDJA 1K97A 2P22C 4K3AA 5JH7B 1OHHG 2JDIG 4ZI7B 1J5EB 3B77A 1YVWA 4DW0A 5IWAO 2UU9O 3CCLV 5CA0B 5CA0A 4JTDB 4KHPB 3E2EA 1YF2A 2DYSB 3ZHUA 1Y67A 1YTFB 1H2KA 1AJPA 1NVPB 5B3SC 4AQYO 1G6UA 3M7MX 5JCOC 1PNKA 3STLC 1JW0A 5KMGB 1JMKC 4TQDA 1CPYA 1NTMH 2YI9A 4JYCA 3CS5A 4KL1A 4DV2B 5JWPA 3SRBA 2IW5A 2WYEA 1VF6C 1S0VA 3SPIA 2JJ2G 5CMUA 4P2ZA 4CC5A 4DK0A 5ITZB 3JARB 2KG7B 3AG2B 3JCZA 2EIJB 1Z5VA 3G71V 2QTOA 5E1AC 1ENVA 2Q0AA 4P9OA 4NTXA 3ZN0A 2QWQB 1COWG 3PN1A 1QNMA 5L3GA 2GTSA 4DV3O 3H1IH 5LXTA 5LXTB 1AI6A 2X7RB 3ZS8C 3GB7C 4O2BB 5LA6B 4MVMA 1XMOB 4JI7O 2DWDC 3OAAG 2Q8VA 2RMKB 4NTWA 5LMNO 2P67A 1CP9A 3HPLC 1GM8A 5KHKA 1PL4A 2P90A 4LF7O 3ZRXA 2M7WA 2ZDIC 4EEQA 4X62O 1QCEA 5KUMA 1WB7A 5H5NA 1P4RA 2QDOA 1IBMB 3ZHVA 1QVGU 2P5OA 2OIEA 1Q6HA 2YIBD 3JASB 2QWPB 2GBOA 3HKDA 1SQVH 4PEMA 2FKXA 2WSSG 1SESA 4MVRA 4B3MO 2ITDC 2LO1A 4X1IA 3CP1A 5LGUA 2DQ0A 3DXRB 4PA6A 1VQ5V 1ZLZA 1AB3A 3JD4A 5LL6Y 1EM1A 2Q4PA 3ZHRA 1XL4A 3APOA 3JAMN 4NB5A 4DR3B 3VOUA 3CCVV 3ZHTA 5D5QA 3JD2A 4FIPC 2EIKC 4HYOA 3IJ4A 1UPGA 4DUZO 3J81N 2G38A 1TVKB 2EX3A 4YF9A 1FFXA 3E22A 3K79A 4MVSA 4YJ3A 1K73W 2E5LO 3AG2C 4BW5A 3K59A 2N74A 3G6EV 1URFA 4JAAA 3K03A 4YIPA 5B1BB 3B09A 2OWOA 4LF6O 3OFNG 2ZE5A 2AE3A 4DR2O 2ZXWC 1NR1A 4E2LA 5GTIZ 3N2GB 3W7XA 1Y76B 4DV6B 1DK1A 5EZYB 2R70A 2UXXA 5CB4B 1KB9F 1S77D 1P7BA 4KXRA 2LFRA 1KMIZ 3R66A 1IZ3A 5ITZA 5LP6A 1I94B 4PDRA 3FKSG 4ZKIA 3ZEDA 1RFYA 1PM9A 3LSQA 4LF8B 2BE3A 3FGTA
chains in the Genus database with same CATH topology
1GK1A 1PNMA 3ABLB 4XDKA 2YEVB 1K7DA 2ZDIA 1QR9A 3L94A 5CN0A 2V1DA 5KUKA 3W7WA 3RBZA 3W7TA 3CC2V 2DYSC 1OCOB 1YJNV 2Q6AA 4Z1MG 5EBWC 2QE7G 4TWKA 5B3SB 4ZBMA 1OCCB 4FK5C 2HJFC 1QR8A 4Q20A 1SETA 4MVOA 3OR7C 5J9PC 1FXKC 1GM9A 3AG3B 1BMFG 3SRAA 3FYIB 3UKMA 1JVMA 3D3IA 3FB7C 1NH2D 3E89A 2CK3G 3T2MA 3K0GA 5L3EA 3QNEA 1Y66A 2X6BA 3ZMVA 5KA6A 1H2GA 3TK1A 1R3JC 3W7SA 3JYCA 3E8BA 3QO8A 4EKWA 1R3IC 2DW4A 4PA9A 4DO2A 2ZR3A 4R7CA 3IGAC 1AROP 2QKSA 2D3OW 3ZMTA 4TT3G 2PI5A 4WFBV 2WYDA 1K33A 4GX2A 2AE5A 4JASA 1NQTA 4H37A 5IYDO 1AI7A 3ABKC 3SPHA 1QLEB 2EILB 1AI4A 4RQEA 3LSSA 2GSMB 4ASUG 1V55C 1R73A 4LCUC 2GHYA 1NKDA 2EIKB 3P30A 4KUMA 1PNLA 4QNHB 3UM7A 1H8EG 4I9WA 2Y69B 1SERA 1H38A 1R3KC 3MHHC 2PI4A 3SYOA 4XDJA 1M57C 4RAIA 4JPRA 1J95A 1DF4A 1PL0A 1WPXA 5EC1C 1DTOA 1AJQA 2HG5C 1NR7A 3IC7A 1KC8W 3TETA 3E83A 4K2GA 1VQ7V 2EZOA 3SYQA 1NBMG 2V7QG 1Q86W 2Z5UA 3A0RA 3CCUV 2H8PC 5CBHA 4BTHA 3DTUB 1OCZC 3FYEB 4BAYA 5EK0A 2XAHA 4KP4A 3ZRWB 2OCCC 5B1BC 3E8HA 2HFEC 1FXKA 3ETEA 4M1JA 4UXNA 1OR0A 2ZQMA 1F4NA 1K5SA 1QBZA 3HB3B 2FTKA 2WAMA 2DQ3A 2Y48A 2ZXWB 4HAMA 3W7UA 4WFAV 1F51A 5B1AB 1M56C 3ABMB 3F7YC 1KP2A 4H33A 1FM2A 3KG2A 2XAFA 3OE7G 2XAQA 1SZTA 3B8NA 2OTLV 1KQSU 4G2KA 1Q82W 1YJ9V 3FB5C 4UV8A 3ZMSA 1E1RG 2WLLB 3OMAB 2IJKA 1B6QA 2JK5C 5CA3A 2Q69A 2QA4V 5CBFA 1F23A 1YSCA 1N8RW 1MOFA 3ZCCA 2NNUA 1EBOA 1KECA 2LFSA 3ZRWA 4JTAB 3K3WA 3BEHA 1MABG 3ZRSA 1KKDA 5L3BA 3ASOC 1S76D 2A79B 3BY6A 2R9RB 5L3DA 3ABLC 1VQ8V 5C93A 3FB8C 1VQNV 1K9MW 1H8HG 2EIJC 3WG7B 1SRYA 1GTOA 1R3LC 3JD3A 4QIWF 3T4DA 3ZJZA 3ZRVA 5DM6V 2DWEC 3SRCA 3MHSC 3SYCA 4MS2A 2F43G 3K9AA 2AE4A 2Q68A 3QO7A 1K92A 4U7NA 4CBCA 4MVQA 1K5QA 4X8AA 5IDJA 2QM7A 4MT8A 3JTRA 5H6RA 4UV9A 3F5WC 4LBEC 1RM1C 3M99B 1F4MA 1V54B 3AG4B 3RW0A 4JF3A 4PELA 2WYCA 4PDVA 1K34A 4UVCA 5LGTA 2B1IA 5L3FA 3LDDA 2QM8A 3CCQV 5B1OA 2BOCC 5DN6G 2OTJV 1HWYA 4JAVA 1XL6A 4E55A 5LHIA 1YJWV 4F4LA 2IH3C 1L1FA 5IY5C 1Q7YW 3PJSK 4MTGA 1EZJA 3LDEA 2WLLA 1LNQA 1DF5A 4J9YB 4LC1A 4GCZA 4JGSA 1NJIW 3I56V 1QLEC 1JQ0A 3NXSA 4WF9V 2X6AA 1V55B 4MVUA 1ROPA 2NLJC 5H9CA 3T4ZA 3AG1C 3WFVA 4RQFA 3OMNB 3OMIB 4L87A 2HVKC 1K97A 2HKOA 3LUTB 4P9PA 1QLNA 4PDMA 3LDCA 1BHAA 4YXWG 2R9IA 1EFRG 1OHHG 2JDIG 3LNMB 3CD6V 2WLIB 3B77A 3ML0A 2YSUB 4RUFA 5BZBA 4J9ZB 3B8MA 4QE7A 4PDLA 3CCLV 4JTDB 1FFTB 3CPWU 3EHBB 3K06A 4FMTA 3F7VC 1YHQV 1E3AA 3S8RA 4TSFG 2EIMC 2W6JG 3E2EA 2DYSB 2ITCC 5EBLC 5GW7A 1YTFB 4GT1A 4QPJA 4R6ZA 1AJPA 4JAUA 1THZA 1NVPB 5B3SC 1G8MA 4G27B 4DXWA 1KEHA 1VQMV 4HZ3A 5B1AC 4OXSA 5FL7G 4WFGA 1ZWIC 2EJRA 4QPKA 4GX5A 3ABUA 2JEUA 4MTXA 1PNKA 2DYRB 4RO2A 3STLC 3CCMV 1W0JG 1JW0A 4WKTA 1K4CC 2JIZG 4KFMA 4MSWC 4WKVA 2XNDG 2EZPA 1VQ6V 1JJ2U 1CPYA 3CMAV 3RVZA 1OCCC 4CZZA 2XAJA 1R6KA 3ETGA 4JYCA 3T1CA 5IYCO 4G28B 3H01A 3SRBA 2WLMA 2IW5A 2WYEA 4PA4A 5KA5A 4MTFA 1S0VA 3DGEA 3SPIA 4HSTA 2JJ2G 5CMUA 3SYPA 4P2ZA 4GX0A 3AG2B 1BL8A 3E35A 3ABKB 3JCZA 2EIJB 1VQ4V 2X0LA 3G71V 2QTOA 1GMGA 5E1AC 1K3EA 4E57A 2EILC 1ENVA 3ASNC 2X6CA 3K0DA 3P32A 4P9OA 3K04A 3ZN0A 2WWWA 1M9NA 3AEIA 1COWG 4MW8A 3CCEV 3ZMZA 2IJJA 4K2FA 3OUSA 2EINC 5L3GA 3OEHG 2KB1A 1E79G 3ZMUA 1AI6A 3RVYA 4BIZA 1I5YA 2IU3A 2X7RB 2XOKG 1OCRB 3ZIAG 3GB7C 3SPJA 3K08A 1VQPV 1M1KW 3CCJV 2IH1C 1OCZB 2AHZA 4PA7A 5EBMC 1MSWD 3JD1A 4MVMA 2A9HA 2OT5A 2JJ1G 4MW3A 1M57B 2OCCB 4FPPA 2A0LA 5LBQA 4X89A 2WLNA 2DWDC 3OAAG 5IY5B 1FS0G 1VQOV 2P67A 1CP9A 3HPLC 3OEEG 3X2QB 1GM8A 2B5UA 1GKFA 2C2AA 3ABMC 1M56B 4WFFA 2P90A 1NVPD 3ZRXA 4UVAA 2M7WA 2ZDIC 1DLBA 3IFXA 3JTQA 1W0KG 5CBGA 3EFFK 3E8GA 4E56A 4MVZA 1OCOC 2IJHA 1JOYA 1QCEA 5KUMA 2Q67A 4U7OA 4WCEV 2K1EA 4HSRA 1K4DC 2W6IG 3SYAA 1YITV 4QJFB 2HR3A 1P4RA 1FXKB 1QVGU 3AG3C 1S3JA 3OUFA 5HFMA 2ATKC 4N21A 2WLIA 3OR6C 1I5XA 2AHYA 2QEXV 1JVZA 1S5HC 4PEMA 2WSSG 2YEVA 1Q81W 1MG1A 1KP3A 1SESA 2EIMB 3MD0A 4MVRA 2ITDC 3ABTA 4R50A 3QO5A 4QE9A 3CCSV 3CP1A 5LGUA 4XBFA 2LP7A 2DQ0A 4PA3A 2W0FC 2WYBA 2HVJC 1PD3A 2MK3A 3CC7V 4WFEA 4PA6A 1VQ5V 3SJQC 3G4SV 3CC4V 2ZD9A 1AR1B 3JD4A 3GWOA 5LHGA 2XAGA 1PKXA 1GM7A 2B1GA 3R65A 2DYRC 3WG7C 2BOBC 1GK0A 1XL4A 4P30A 5L3CA 4RUEA 4N23A 3TCUA 3ZN1A 3VOUA 3CCVV 5IYBO 1RM1B 3JD2A 4FIPC 4UUJC 4MTOA 1Y4MA 2WLJA 1RPRA 2EIKC 3CMEV 3ETDA 4HYOA 2IJIA 4JYBA 1R6NA 3E86A 3L91A 2Y69C 5EC2C 1VQLV 3FB6C 4WKSA 1M90W 1G4YB 4YF9A 3K79A 1VQ9V 3OM3B 4MVSA 1V54C 3AG4C 1K73W 2IU0A 3AG2C 2Z3YA 2XASA 4BW5A 4XDLA 3I55V 4YFBA 4UVBA 4LP8A 1QVFU 4WFHA 3G6EV 4JTCB 1FXVA 3OGCC 3ASNB 3K03A 2WLKA 3SPGA 3STZC 5B1BB 1OZ0A 5HFLA 3VBBA 3JD0A 2ZR2A 2EINB 1W2BU 1S72V 1VQKV 1YI2V 1WLEA 1GK9A 3OFNG 2JEXA 1FXHA 2P7TC 2ZXWC 1KD1W 2AE3A 5B1NA 1K8AW 1JPXA 1IXMA 5LHHA 1NR1A 3CCRV 4E2LA 1BHBA 3W7XA 2HLDG 5LGNA 1OCRC 1UJWB 2WPDG 3OW2U 4I5SA 2UXNA 2UXXA 3AG1B 1AI5A 4FJCC 1S77D 1ORQC 4R8CA 1P7BA 1TUEB 1RPOA 2LFRA 2WLHA 5H6QA 3CYOA 4PDRA 3FKSG 1CEZA 1JX9A 3SPCA 2P6JA 1GO3F 4ZKIA 1JCHA 2H94A 1YIJV 2EBOA 3LSQA 3D36A 4BIUA 3CXCU 1GHDA 2ADVA 4YFAA 4WKUA 1YTFD 3ASOB 3E8FA 3X2QC 1AJNA 4X88A 1NH2B 1E1QG 4GX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK1 A;  1PNM A;  3SRB A;  1AI4 A;  4BTH A;  2WYE A;  3SRC A;  1AJP A;  1GM7 A;  1K7D A;  1CP9 A;  2AE4 A;  1KEH A;  3L94 A;  4E55 A;  1GK0 A;  1GM8 A;  1PNL A;  1AI5 A;  4HST A;  4M1J A;  4YFB A;  1AI6 A;  1GKF A;  1JVZ A;  1OR0 A;  3ML0 A;  1FXV A;  4PEM A;  1K5S A;  1KEC A;  1K5Q A;  1PNK A;  3K3W A;  1JW0 A;  4WKT A;  2WYD A;  3JTQ A;  1JX9 A;  4E56 A;  3JTR A;  4WKV A;  1GM9 A;  3L91 A;  2AE5 A;  4WKS A;  4E57 A;  2WYB A;  1FM2 A;  3SRA A;  3S8R A;  1E3A A;  2ADV A;  4HSR A;  1AJQ A;  1GK9 A;  1GHD A;  1AI7 A;  1FXH A;  4PEL A;  2AE3 A;  4K2G A;  4WKU A;  2WYC A;  4YFA A;  1AJN A;  4YF9 A;  1H2G A;  4K2F A; 
#chains in the Genus database with same CATH topology
 1PNM A;  5CA1 A;  1K7D A;  2ZDI A;  4LF7 B;  1AIL A;  2QSA A;  2ZNJ A;  1KU9 A;  1XEQ A;  3DXR A;  3CE2 A;  1FYJ A;  4LWS B;  4ZBM A;  3OTF A;  3A0B Z;  3RYI B;  2PYL A;  1GM9 A;  1JVM A;  3FB7 C;  3T2M A;  3K0G A;  2X6B A;  4DV0 O;  3TK1 A;  2UUB B;  4J42 A;  2ILM A;  4JI0 O;  4EKW A;  4CH5 A;  2DW4 A;  2YIB A;  3IGA C;  1ARO P;  3ZMT A;  2LQT A;  3HKD B;  2Q7H A;  3N2G A;  5JJE B;  2PI5 A;  4GKK B;  3IAY A;  4X9Q A;  4WBN A;  4YY3 B;  1BQZ A;  4PI0 A;  2UUC B;  4RQE A;  1R73 A;  4LCU C;  2GHY A;  4OGQ B;  1NKD A;  2EIK B;  3P30 A;  2UXC O;  1OV9 A;  5IYZ A;  3UM7 A;  1H8E G;  4I9W A;  1R3K C;  1PPJ H;  2PI4 A;  4XDJ A;  4AHC A;  4PHZ A;  5AG2 A;  4EFE A;  2ZT9 B;  3IC7 A;  4CS3 A;  3TET A;  4FLX A;  2EZO A;  1NBM G;  1Q86 W;  1FJG O;  1V9P A;  3LNN A;  4JI2 O;  3S3W A;  3WB1 A;  2XAH A;  1XUQ A;  2OCC C;  5B1B C;  4GKK O;  1XI1 A;  1LR1 A;  2ZNI A;  2YID A;  1OR0 A;  2ZQM A;  4Q6G A;  3BA9 A;  2DQ3 A;  2ZXW B;  3ABM B;  1KP2 A;  4JI7 B;  4Z2W A;  1KQS U;  2ZE8 A;  4YJ2 A;  3FB5 C;  4UV8 A;  1Q8I A;  5FLX N;  3OMA B;  2IJK A;  3LSU A;  2Q5Z A;  3FAV A;  5CA3 A;  2QA4 V;  5CBF A;  2CTP A;  1US6 A;  3EVK A;  4DV7 O;  1MOF A;  1EBO A;  3T1Y O;  2YI8 A;  3K3W A;  3AK3 A;  1MAB G;  1KKD A;  4FM2 A;  3AG7 A;  2Y4U A;  2F95 B;  1H8H G;  1SRY A;  2A7W A;  4GUN A;  2DWE C;  4W4L A;  4MS2 A;  1BQ0 A;  1I94 O;  3RT3 C;  4CBC A;  4H13 B;  4F6R A;  5KHG A;  2QM7 A;  5IJ9 B;  3JTR A;  5H6R A;  4GZR B;  3M99 B;  1F4M A;  3AG4 B;  3RW0 A;  1SF9 A;  3L74 H;  1YXB A;  2JS3 A;  2WYC A;  1K34 A;  1XNR B;  4LFC B;  2UUC O;  4UVC A;  2B1I A;  3AK2 A;  2BOC C;  5DN6 G;  4E55 A;  1XL6 A;  3A0H Z;  3JAT B;  2IH3 C;  4JI3 O;  3LDE A;  1DF5 A;  2JGD A;  4GCZ A;  3OD4 A;  2BTQ A;  3C90 A;  1VF5 B;  1XDC A;  1VF6 A;  2GUZ A;  4H44 B;  3AG1 C;  3OMN B;  4J11 A;  5LA6 A;  2KG7 A;  3VQX A;  2HKO A;  3LUT B;  4PDM A;  3LDC A;  1BHA A;  2R9I A;  3C3S A;  3O9O A;  2WLI B;  3ML0 A;  4RUF A;  1VAR A;  4UCO A;  4QE7 A;  1EN6 A;  4PDL A;  2XUM A;  1FFT B;  3CPW U;  1E3A A;  4TSF G;  4JI5 B;  2W6J G;  5FPO A;  4DR1 O;  3OTO B;  1XHZ A;  4J7Z A;  5GW7 A;  3L72 H;  4QPJ A;  1THZ A;  1KEH A;  4HZ3 A;  1N0N A;  3F5T A;  1ZWI C;  2EJR A;  3H1K H;  4HNA A;  4MTX A;  3KCX A;  3CCM V;  1W0J G;  4LF6 B;  4KFM A;  2EZP A;  3OTO O;  1JJ2 U;  5KHJ A;  1XNQ B;  3ETG A;  5IYC O;  4DR7 O;  3CHX A;  3H01 A;  2WLM A;  2HEP A;  4MTF A;  2VWJ A;  3DGE A;  5LMU O;  1RP3 B;  1XNR O;  1T5E A;  4B3T B;  3D36 C;  3BA8 A;  3CEI A;  3SYP A;  3RYC A;  3ETQ A;  3CX5 F;  3HKE A;  2E3C A;  3ABK B;  1VQ4 V;  2X0L A;  4I55 A;  4UCT A;  4ZOL A;  4TV9 A;  3P32 A;  4C7U A;  4U3J B;  1BT8 A;  1Z2G A;  4U3J A;  1WA8 B;  3TXS A;  3AEI A;  4MW8 A;  3CCE V;  4K2F A;  4U3F H;  3CB2 A;  4DRX A;  3ZMU A;  4J7K A;  4JI3 B;  3CRR A;  3L75 H;  3U11 A;  3ZIA G;  3CRC A;  4IL6 Z;  4GLX A;  4LFC O;  2EUL A;  1OCZ B;  1MSW D;  4NVP A;  3JD1 A;  2OIG A;  4X89 A;  2WLN A;  4LF5 O;  1FS0 G;  3OEE G;  1N34 O;  4CC6 A;  1M56 B;  2CH7 A;  3K5L A;  4JZG A;  3HKC B;  3E8G A;  4E56 A;  1JOY A;  3BRC A;  3H9V A;  1IVS A;  3CRQ A;  1R1B A;  4HSR A;  1FAF A;  5JVD B;  2F1M A;  1TUB B;  3SYA A;  4B3R O;  2HR3 A;  3SGI A;  3AG3 C;  1S3J A;  3OUF A;  2UXD O;  3ICX A;  4B3S O;  3G67 A;  2WLI A;  2JGU A;  4X1K A;  4EB6 B;  3OR6 C;  2UUB O;  4DV7 B;  3H1H H;  1S5H C;  1O9H A;  2YEV A;  3I5D A;  1Q81 W;  1MG1 A;  1VP7 A;  4HBN A;  3ABT A;  1Y6X A;  2VS0 A;  2LP7 A;  5IJ0 A;  1U96 A;  2WYB A;  3HKC A;  2MK3 A;  3N2K B;  2CDY A;  5LMN B;  3CC4 V;  3G4S V;  5LHG A;  2XAG A;  1PKX A;  1NTZ H;  3A8T A;  3WG7 C;  4JI1 O;  2BOB C;  4UFZ A;  2JVD A;  3L9D A;  3QVN A;  5L3C A;  5A2Q N;  1XOU A;  2AW9 A;  4Z1V A;  3TCU A;  5IYB O;  4K35 A;  4UUJ C;  1Y4M A;  1N36 O;  3ETD A;  4JYB A;  4B3S B;  1R6N A;  4TUY A;  3K57 A;  3L91 A;  4IYH A;  3FB6 C;  1HP8 A;  3APQ A;  2VWK A;  3HKB A;  1BSM A;  1ZX3 A;  3OM3 B;  4D7T A;  5JJN B;  1Q90 D;  2AZ2 A;  2CTR A;  4F6R B;  1Y74 B;  2ADQ B;  3I55 V;  1XMO O;  4LP8 A;  1SZX A;  1QVF U;  4WFH A;  2L35 A;  4JTC B;  3SPG A;  2N04 A;  3ZHQ A;  2YC0 A;  2E75 B;  3JD0 A;  1SQX H;  4X64 B;  1M4U A;  1S72 V;  4JYA O;  1GK9 A;  2JEX A;  1FXH A;  2DE0 X;  3QG5 A;  4TUY B;  5BY1 A;  2CGO A;  4O4L A;  2Q9L A;  2ZE6 A;  2IBZ H;  2Q7E A;  5KX5 B;  5LGN A;  1IUR A;  2QWN B;  3K5M A;  4DK1 A;  2CUG A;  1B06 A;  3BAB A;  1YCI A;  2F4V B;  2E76 B;  2R9A A;  1P49 A;  2H94 A;  4IIJ A;  4YFA A;  1HNZ O;  1WA8 A;  2XTA A;  3ZX6 A;  4ZHQ A;  3ASO B;  3E8F A;  4X88 A;  4QGP A;  1NU1 H;  1NH2 B;  4TWK A;  5GTH Z;  4I9Q A;  4JI6 B;  4DV5 O;  2YEV B;  1GN6 A;  5CA1 B;  3L94 A;  1GN3 A;  5KUK A;  5A9G A;  2DYS C;  2KQX A;  3FFQ A;  2YXH A;  5B3S B;  1OCC B;  3FAV B;  2V4D A;  5IJ9 A;  3JAR A;  3AG3 B;  1BMF G;  3SRA A;  3D3I A;  2UUA O;  3CXH F;  3E89 A;  4TV8 A;  1Y66 A;  1WP8 A;  4FLU A;  1R3J C;  1F7Y A;  4W4K A;  1FD9 A;  5JJJ B;  1R3I C;  2YDE A;  2ZR3 A;  3AK1 A;  4DUY B;  2D3O W;  4F6E A;  1PP9 H;  5DED A;  4X65 O;  2WYD A;  1K33 A;  1MSD A;  4GX2 A;  5F2V O;  4O4H B;  2QGN A;  3KZI Z;  1AR5 A;  4JAS A;  5EYP A;  5EYP B;  1VF7 A;  2KSD A;  2Y4T A;  3SPH A;  1QLE B;  1GAX A;  3N27 A;  3LSS A;  2GSM B;  5C8Y B;  1GN4 A;  4NKG B;  4LF4 B;  4ZHQ B;  1N36 B;  1FPO A;  4QNH B;  2ZM6 B;  2HHH O;  1SER A;  5KAI Z;  4DW1 A;  1H38 A;  1M57 C;  1H2L A;  1DF4 A;  1WPX A;  4BIO A;  5EC1 C;  1AJQ A;  2V7Q G;  3UT5 A;  3CCU V;  2H8P C;  2LGQ A;  1AP5 A;  1BCC H;  2QR4 A;  5KHI A;  2HFE C;  1FXK A;  4UXN A;  2ZKO A;  4L8J A;  3JAK B;  2WAM A;  3W7U A;  4HAM A;  3D3Q A;  4X62 B;  1OJH A;  3BCC H;  3F7Y C;  4H33 A;  3U10 A;  1HR0 B;  1DGS A;  1SZT A;  2IM9 A;  4DV3 B;  1YJ9 V;  2WLL B;  1B6Q A;  2JK5 C;  2RCV A;  1F23 A;  1N8R W;  3U0Z A;  2NNU A;  2JRI A;  3B2E E;  3KCY A;  3ZRW A;  5KLV H;  4JI1 B;  1XRE A;  3BEH A;  3ASO C;  2A79 B;  3BY6 A;  4JV5 B;  3TXQ A;  5K1P A;  2YUA A;  3JD3 A;  4LFA B;  3ZRV A;  3ZJZ A;  5DM6 V;  3UCS C;  3SRC A;  1IBL O;  4X66 O;  4UCU A;  3K9A A;  1Q43 A;  1Q6I A;  3SJC C;  2DMX A;  5BMV B;  4JI2 B;  2LGW A;  2DN9 A;  3F5W C;  4DR7 B;  2ARH A;  3KKY A;  1QHT A;  1V54 B;  1XHX A;  4JF3 A;  3RYF A;  2ODM A;  5LGT A;  2QM8 A;  3CCQ V;  5B1O A;  2OTJ V;  4JAV A;  2L6L A;  2FL4 A;  5LHI A;  3JAT A;  4F4L A;  1A32 A;  2Z0A A;  1EZJ A;  4FFB B;  2WLL A;  1UFI A;  1AVM A;  4FM0 A;  1NJI W;  3I56 V;  1QLE C;  3P3N A;  3NXS A;  4NXN O;  1ROP A;  2NLJ C;  4CH3 A;  5H9C A;  3T4Z A;  1YZB A;  3DC6 A;  4RQF A;  3OMI B;  4L87 A;  2QKA A;  4NTY A;  3VQW A;  3RYF B;  3LNM B;  1NZ6 A;  2Y0P A;  1WNS A;  2EJ7 A;  1I08 A;  3H1L H;  1RSO B;  1O9G A;  5GON B;  4J9Z B;  2B9Z A;  5IJ0 B;  4AIL C;  3P3P A;  2UU9 B;  1L0L H;  3EHB B;  4FMT A;  3L70 H;  3S8R A;  1AR4 A;  3UT5 B;  2EIM C;  4DR1 B;  4O4J A;  1TVK A;  3B4S A;  1NS1 A;  4GT1 A;  3JSN A;  2VQF B;  3JAL B;  4G27 B;  1JFF B;  2NR5 A;  4DR5 B;  5FL7 G;  1IBK B;  4RO2 A;  2JEU A;  2DYR B;  5B5E Z;  1K4C C;  3OGI B;  3BVO A;  3SDL A;  5KMG A;  2JIZ G;  4MSW C;  4WKV A;  2XND G;  2QM4 A;  1X59 A;  4LF9 O;  3CMA V;  1FKA O;  4FLT A;  4PD4 F;  5JCO A;  2MW2 B;  4B7K A;  4DR6 B;  4O4H A;  4G28 B;  4PA4 A;  2LJ2 A;  5KX5 A;  1MZF A;  3N2K A;  1GRJ A;  4HST A;  1HNZ B;  4DR3 O;  3MAQ A;  1SS3 A;  1Q6U A;  1QU7 A;  2XHB A;  2P4V A;  4ZOL B;  2YIA A;  1K3E A;  2EIL C;  2GV9 A;  3K04 A;  3JAS A;  1BE3 H;  2IJJ A;  3OUS A;  5BR8 O;  3OEH G;  2KB1 A;  2JGD B;  1IX9 A;  1YEW A;  2JS5 A;  1KBH A;  5H2F Z;  3RVY A;  1I5Y A;  4YHH O;  1OCR B;  4FLZ A;  1ZL8 B;  3SPJ A;  3UQ8 A;  4PA7 A;  1QQC A;  4MW3 A;  4FPP A;  5LBQ A;  3QTC A;  2FB5 A;  1ZSP A;  1S5J A;  4YHH B;  3X2Q B;  2E74 B;  1NI8 A;  2PZS A;  2C2A A;  4WFF A;  3WB0 A;  3Q4H A;  2ZIN A;  1NVP D;  2XT9 A;  4JYA B;  5BMV A;  1W0K G;  5CBG A;  3EFF K;  4FFB A;  4MVZ A;  2IJH A;  4TOI A;  2Q67 A;  4I4T B;  4WCE V;  2K1E A;  3GWK C;  4X1Y B;  4DV4 O;  1K4D C;  2W6I G;  2P4K A;  1YIT V;  4QJF B;  2YS8 A;  2BSK A;  4DUZ B;  4JI4 O;  3L73 H;  2BCC H;  4UB8 Z;  2ATK C;  1SC5 B;  4X1K B;  4EB6 A;  1I5X A;  2AHY A;  2QEX V;  1JVZ A;  3THO A;  1W59 A;  4JI5 O;  2EIM B;  1G1X B;  3CCS V;  1L8D A;  3L71 H;  4I50 B;  3HKB B;  4XBF A;  2HVJ C;  1PD3 A;  3CC7 V;  1KUQ A;  3K5O A;  4LNU B;  1GN2 A;  4X66 B;  1GM7 A;  2B1G A;  4RWU A;  2DYR C;  5E79 Z;  4PJ0 Z;  4P30 A;  1Q5O A;  3JCU Z;  1RM1 B;  4JI8 O;  3TJT A;  1RPR A;  2IJI A;  3E86 A;  2F66 C;  2Y69 C;  5EC2 C;  4DV2 O;  1VQL V;  4WKS A;  3Q4H B;  1M90 W;  4O4J B;  3CJH B;  3MDS A;  1NTK H;  2O57 A;  1VQ9 V;  4GKJ B;  2CGN A;  3AG4 C;  4PI2 A;  2IU0 A;  4FZ1 A;  2PGG A;  2XAS A;  2Z3Y A;  3JAK A;  4B3R B;  4K0K B;  2WLK A;  2P06 A;  3VBB A;  2AGA A;  2ZR2 A;  1W2B U;  2R72 A;  1I0H A;  4DV0 B;  1VQK V;  1YI2 V;  1WLE A;  4IHJ B;  4NXN B;  2P7T C;  1KD1 W;  1K8A W;  4NXM O;  5DEC A;  5LHH A;  3CCR V;  1XBL A;  2HP8 A;  1OCR C;  2AZ0 A;  2UXN A;  3AG1 B;  1AI5 A;  1JA8 A;  4R8C A;  1ORQ C;  1TUE B;  1RPO A;  5H6Q A;  2QKC A;  1GO3 F;  1XIL A;  1MMM A;  1YIJ V;  4BIU A;  3CXC U;  4DV4 B;  4B3T O;  3RYH B;  1YTF D;  3X2Q C;  3SJB C;  3RN4 A;  1AJN A;  4GX1 A;  1GK1 A;  4LF4 O;  3ABL B;  4XDK A;  4B7E A;  1QR9 A;  1MNG A;  5CN0 A;  2PYJ A;  4K8X A;  2Q6A A;  4Z1M G;  2QE7 G;  4FK5 C;  3O65 A;  4UCV A;  2HJF C;  1QR8 A;  4Q20 A;  1SET A;  1SQB H;  5J9P C;  2RDC A;  3FYI B;  1YDX A;  3UKM A;  1NH2 D;  3ZBH A;  1SKV A;  5L3E A;  2GDS A;  3QNE A;  1JFF A;  3ZMV A;  1AP6 A;  1H2G A;  1TUB A;  5KA6 A;  3W7S A;  2BSK B;  3JYC A;  3E8B A;  4PA9 A;  4DO2 A;  4YIO A;  5J2U B;  1XMQ B;  1TGO A;  5IE9 A;  3H1J H;  4WFB V;  2AE5 A;  1NQT A;  1AI7 A;  1B3Q A;  3ABK C;  4O2B A;  5LP6 C;  4O4I A;  4ASU G;  1V55 C;  4PV1 B;  4X65 B;  1WJZ A;  4J80 A;  2Y69 B;  5TIS Z;  1N4C A;  4RAI A;  4JPR A;  1J95 A;  4I50 A;  2K9P A;  2CAZ C;  1DTO A;  2F93 B;  4DR2 B;  2HG5 C;  1KC8 W;  4K2G A;  3SYQ A;  5JQG A;  4H0L B;  4DRX B;  4LF9 B;  3RYI A;  5LMU B;  3DTU B;  4O2A A;  1OCZ C;  3FYE B;  4BAY A;  3ETE A;  2BTO A;  1K5S A;  1QBZ A;  1P84 F;  2W0X A;  1TA8 A;  2FTK A;  1ZTE A;  4WFA V;  5B1A B;  1M56 C;  2KKW A;  5FNV A;  3KG2 A;  5GON A;  3OE7 G;  2XAQ A;  3CJH A;  2OTL V;  3CSX A;  1Q82 W;  5LOV A;  1H2M A;  3ZMS A;  4DR4 O;  2OYQ A;  2F4V O;  4WBN B;  4LR3 A;  3FX7 A;  1YSC A;  1U97 A;  4FLV A;  1KYO F;  1KEC A;  4JTA B;  2PTM A;  2QTS A;  4I55 B;  3S3X A;  4LF8 O;  3ZRS A;  2R9R B;  4BWC A;  3ABL C;  1VQ8 V;  5C93 A;  4IIJ B;  1XQ8 A;  1B04 A;  3MHS C;  3SYC A;  4NR1 A;  2Q68 A;  3QO7 A;  4U7N A;  4D6T H;  3NR7 A;  1N32 B;  2RNB A;  5IDJ A;  4DV5 B;  4MT8 A;  3J7A U;  3G80 A;  4TV8 B;  5KHH A;  3T1Y B;  1GH6 A;  2PUS A;  3QF7 A;  3GVM A;  1IXB A;  5FNV B;  5L3F A;  2ZCE A;  3RWR D;  1FJG B;  1YJW V;  1IDS A;  5IY5 C;  4AQY B;  3PJS K;  4JGS A;  5EIB D;  3OT7 A;  2DOS A;  5LP6 B;  4O2A B;  2NN4 A;  4WF9 V;  1V55 B;  4X1Y A;  1WPB A;  2FML A;  3WFV A;  1EZV H;  2RJZ A;  3G6B A;  4A5U B;  2HVK C;  3SR2 C;  4P9P A;  1QLN A;  4JI8 B;  4YXW G;  1EFR G;  3K5N A;  1J5E O;  4ZI7 A;  1R6T A;  2CTQ A;  3CD6 V;  1HNX O;  2YSU B;  5BZB A;  5J2T A;  3HR0 A;  5K1X A;  3VQV A;  3BHP A;  1ZAU A;  5EIB C;  3B8M A;  1D5N A;  4BR6 A;  2YXL A;  3JAW A;  1EN4 A;  3K06 A;  3F7V C;  1YHQ V;  1TAE A;  2ITC C;  4YJ3 B;  5EBL C;  3VQY A;  4R6Z A;  4JAU A;  3JAL A;  4K8Z A;  1G8M A;  2OCH A;  4DXW A;  4LFB B;  1VQM V;  5B1A C;  4OXS A;  4WFG A;  4QPK A;  4GX5 A;  3ABU A;  4WKT A;  4LH7 A;  4X20 A;  2RN9 A;  3M8A A;  4UCR A;  1VQ6 V;  3RVZ A;  1M93 A;  1OCC C;  4YJ2 B;  4CZZ A;  2XAJ A;  1R6K A;  3T1C A;  3CWB H;  1H2S B;  2LW1 A;  5KA5 A;  3CRA A;  4FM1 A;  1Y76 A;  1WAZ A;  5CB4 A;  2M6Y A;  2H3O A;  4GX0 A;  1XNQ O;  3A2F A;  1BL8 A;  3E35 A;  3D8C A;  2GTA A;  5JH7 A;  4CH4 A;  1GMG A;  4OPA A;  4LFA O;  4E57 A;  3ASN C;  2X6C A;  3K0D A;  3DC5 A;  2WWW A;  1M9N A;  4DR4 B;  2Q7G A;  3ZMZ A;  3K58 A;  1M5I A;  2EIN C;  5J2U A;  4GKJ O;  2Q73 A;  1E79 G;  3C3T A;  4NXM B;  3FGR A;  2BTQ B;  4BWA A;  2ZM6 O;  3K9S A;  4BIZ A;  2HHH B;  2IU3 A;  2XOK G;  2UXB O;  1Y74 A;  4ABM A;  1WP7 A;  2D2C B;  3K08 A;  1VQP V;  4BW9 A;  1M1K W;  2ZIM A;  2IH1 C;  3CCJ V;  2AHZ A;  5EBM C;  2A9H A;  2OT5 A;  2JJ1 G;  2A3Q A;  1M57 B;  2OCC B;  4J10 A;  4TV9 B;  2A0L A;  5KAF Z;  5IY5 B;  4IGG A;  1X4T A;  3CRM A;  1VQO V;  1I7F A;  1SQF A;  2B5U A;  1GKF A;  4LH6 A;  3ABM C;  2YIC A;  3RGB A;  4UVA A;  1DLB A;  3IFX A;  4DUY O;  3JTQ A;  5IT9 N;  1OCO C;  4CS2 A;  4U7O A;  2Q0O C;  3SJA C;  2WA4 A;  1FXK B;  5HFM A;  4JI4 B;  1SA0 A;  4B08 A;  3RFR A;  3TGU H;  4N21 A;  4CS4 A;  2F23 A;  3WB2 A;  1PV0 A;  4D7S A;  2VQE O;  4J41 A;  1KP3 A;  3MD0 A;  4OX9 O;  4B3M B;  4R50 A;  3QO5 A;  4QE9 A;  4E4E A;  4PA3 A;  2W0F C;  1FFX B;  3E22 B;  4JI6 O;  4WFE A;  4ZIB A;  3SJQ C;  1ZL8 A;  2ZD9 A;  1AR1 B;  3WU2 Z;  1Q3E A;  2ETN A;  3GWO A;  3R65 A;  3HKE B;  1GK0 A;  4OX9 B;  4DV1 B;  4RUE A;  4N23 A;  4HNA B;  3ZN1 A;  1VMG A;  4MTO A;  2WLJ A;  3CME V;  1SQP H;  4K0K O;  4FLW A;  2CH7 B;  4DR5 O;  2N05 A;  1G4Y B;  5BR8 B;  4X64 O;  1N33 B;  2PY5 A;  4I4T A;  2E5L B;  1V54 C;  2QJ1 A;  4XDL A;  4YFB A;  4UVB A;  2Y0I A;  1FXV A;  4DR6 O;  1Z5W A;  3OGC C;  3ASN B;  4LFB O;  4ICG A;  1N34 B;  3STZ C;  1OZ0 A;  5HFL A;  1ZUQ A;  1LUV A;  1JJO A;  2EIN B;  5J2T B;  1HW7 A;  5LOV B;  5B1N A;  1JPX A;  1IXM A;  4EFB A;  1BHB A;  2HLD G;  3BFR A;  1BZK A;  1NT2 B;  3OW2 U;  1UJW B;  2WPD G;  4I5S A;  4FJC C;  1HNX B;  3RYC B;  2WLH A;  3CYO A;  5JVD A;  1CEZ A;  1JX9 A;  3SPC A;  2P6J A;  1JCH A;  2EBO A;  3D36 A;  2ADV A;  1GHD A;  4WKU A;  1WN7 A;  2ADP A;  1E1Q G;  4JV5 O;  2VRZ A;  2UXC B;  2RQ6 A;  2V1D A;  3W7W A;  3CC2 V;  3RBZ A;  3W7T A;  3EXA A;  1OCO B;  1YJN V;  5EBW C;  4LF5 B;  1N33 O;  4MVO A;  3OR7 C;  4FZ0 A;  4JYY A;  1FXK C;  4O4I B;  2UXD B;  2CK3 G;  2CTW A;  1IBL B;  5D5P A;  3QO8 A;  4JI0 B;  4R7C A;  4OPH A;  1VIB A;  2QKS A;  1N32 O;  4I7Z B;  1WB8 A;  4TT3 G;  4KHP O;  4FFK A;  4DYL A;  3UO2 A;  1LUW A;  1VEW A;  4H37 A;  5IYD O;  1D5A A;  4I0X B;  4CH6 A;  1SQG A;  2EIL B;  1AI4 A;  4FVM A;  5C8Y A;  4UB6 Z;  4KUM A;  1PNL A;  5IYZ B;  1S5L Z;  3J80 N;  3FD9 A;  4TQF A;  3JAW B;  3MHH C;  1MZE A;  3SYO A;  4IYI A;  2QWR B;  1HNW B;  3BAA A;  2QWO B;  1PL0 A;  4O4L B;  1NR7 A;  5EZY A;  3E83 A;  5JQG B;  1VQ7 V;  2Z5U A;  3A0R A;  3DSQ A;  5CBH A;  4BTH A;  4DV6 O;  5EK0 A;  4KP4 A;  3ZRW B;  5B66 Z;  3UO3 A;  3E8H A;  5FPR A;  4M1J A;  1F4N A;  2ZE7 A;  4AI8 A;  4UCS A;  3HB3 B;  5IWA B;  2Y48 A;  1F51 A;  1H2N A;  1P7G A;  4YY3 O;  1IBK O;  1FM2 A;  1L0N H;  2FYU H;  2A06 H;  1RSO A;  2XAF A;  3B8N A;  3B40 A;  1BS3 A;  4G2K A;  4IHJ A;  2UXB B;  2ZIO A;  4J7J A;  1E1R G;  4I0X A;  2Q69 A;  2WA3 A;  5LYJ B;  5LYJ A;  3ZCC A;  1N0J A;  3T1H B;  1JR9 A;  2LFS A;  5L3B A;  1MA1 A;  1S76 D;  1CXZ B;  5L3D A;  3FB8 C;  5BXZ A;  1VQN V;  2AXT Z;  2PF4 E;  1K9M W;  4JZ2 A;  2HJD A;  2EIJ C;  3WG7 B;  2YXY A;  1GTO A;  1R3L C;  3RYH A;  4QIW F;  3T4D A;  1BGY H;  4FLY A;  4IT5 A;  2DJV A;  2CE4 A;  2F43 G;  2AE4 A;  1K92 A;  2LW7 A;  4NYK A;  4LWS A;  1XMQ O;  1D2D A;  4MVQ A;  1K5Q A;  4X8A A;  1HR0 O;  3JSL A;  4UV9 A;  4LBE C;  4LNU A;  1RM1 C;  4PEL A;  1EN5 A;  2VQF O;  4PDV A;  3ZHS A;  1SA0 B;  3LDD A;  4X20 B;  1HWY A;  1IBM O;  3BPZ A;  4GYC B;  1SQQ H;  1L1F A;  1Q7Y W;  4MTG A;  1LNQ A;  4J9Y B;  4LC1 A;  1KKC A;  2UUA B;  1HNW O;  4X1I B;  3T1H O;  3IC9 A;  2VQE B;  1JQ0 A;  2X6A A;  4MVU A;  2GUZ B;  4DV1 O;  1HDJ A;  1K97 A;  2P22 C;  4K3A A;  5JH7 B;  1OHH G;  2JDI G;  4ZI7 B;  1J5E B;  3B77 A;  1YVW A;  4DW0 A;  5IWA O;  2UU9 O;  3CCL V;  5CA0 B;  5CA0 A;  4JTD B;  4KHP B;  3E2E A;  1YF2 A;  2DYS B;  3ZHU A;  1Y67 A;  1YTF B;  1H2K A;  1AJP A;  1NVP B;  5B3S C;  4AQY O;  1G6U A;  3M7M X;  5JCO C;  1PNK A;  3STL C;  1JW0 A;  5KMG B;  1JMK C;  4TQD A;  1CPY A;  1NTM H;  2YI9 A;  4JYC A;  3CS5 A;  4KL1 A;  4DV2 B;  5JWP A;  3SRB A;  2IW5 A;  2WYE A;  1VF6 C;  1S0V A;  3SPI A;  2JJ2 G;  5CMU A;  4P2Z A;  4CC5 A;  4DK0 A;  5ITZ B;  3JAR B;  2KG7 B;  3AG2 B;  3JCZ A;  2EIJ B;  1Z5V A;  3G71 V;  2QTO A;  5E1A C;  1ENV A;  2Q0A A;  4P9O A;  4NTX A;  3ZN0 A;  2QWQ B;  1COW G;  3PN1 A;  1QNM A;  5L3G A;  2GTS A;  4DV3 O;  3H1I H;  5LXT A;  5LXT B;  1AI6 A;  2X7R B;  3ZS8 C;  3GB7 C;  4O2B B;  5LA6 B;  4MVM A;  1XMO B;  4JI7 O;  2DWD C;  3OAA G;  2Q8V A;  2RMK B;  4NTW A;  5LMN O;  2P67 A;  1CP9 A;  3HPL C;  1GM8 A;  5KHK A;  1PL4 A;  2P90 A;  4LF7 O;  3ZRX A;  2M7W A;  2ZDI C;  4EEQ A;  4X62 O;  1QCE A;  5KUM A;  1WB7 A;  5H5N A;  1P4R A;  2QDO A;  1IBM B;  3ZHV A;  1QVG U;  2P5O A;  2OIE A;  1Q6H A;  2YIB D;  3JAS B;  2QWP B;  2GBO A;  3HKD A;  1SQV H;  4PEM A;  2FKX A;  2WSS G;  1SES A;  4MVR A;  4B3M O;  2ITD C;  2LO1 A;  4X1I A;  3CP1 A;  5LGU A;  2DQ0 A;  3DXR B;  4PA6 A;  1VQ5 V;  1ZLZ A;  1AB3 A;  3JD4 A;  5LL6 Y;  1EM1 A;  2Q4P A;  3ZHR A;  1XL4 A;  3APO A;  3JAM N;  4NB5 A;  4DR3 B;  3VOU A;  3CCV V;  3ZHT A;  5D5Q A;  3JD2 A;  4FIP C;  2EIK C;  4HYO A;  3IJ4 A;  1UPG A;  4DUZ O;  3J81 N;  2G38 A;  1TVK B;  2EX3 A;  4YF9 A;  1FFX A;  3E22 A;  3K79 A;  4MVS A;  4YJ3 A;  1K73 W;  2E5L O;  3AG2 C;  4BW5 A;  3K59 A;  2N74 A;  3G6E V;  1URF A;  4JAA A;  3K03 A;  4YIP A;  5B1B B;  3B09 A;  2OWO A;  4LF6 O;  3OFN G;  2ZE5 A;  2AE3 A;  4DR2 O;  2ZXW C;  1NR1 A;  4E2L A;  5GTI Z;  3N2G B;  3W7X A;  1Y76 B;  4DV6 B;  1DK1 A;  5EZY B;  2R70 A;  2UXX A;  5CB4 B;  1KB9 F;  1S77 D;  1P7B A;  4KXR A;  2LFR A;  1KMI Z;  3R66 A;  1IZ3 A;  5ITZ A;  5LP6 A;  1I94 B;  4PDR A;  3FKS G;  4ZKI A;  3ZED A;  1RFY A;  1PM9 A;  3LSQ A;  4LF8 B;  2BE3 A;  3FGT A; 
#chains in the Genus database with same CATH homology
 1GK1 A;  1PNM A;  3ABL B;  4XDK A;  2YEV B;  1K7D A;  2ZDI A;  1QR9 A;  3L94 A;  5CN0 A;  2V1D A;  5KUK A;  3W7W A;  3RBZ A;  3W7T A;  3CC2 V;  2DYS C;  1OCO B;  1YJN V;  2Q6A A;  4Z1M G;  5EBW C;  2QE7 G;  4TWK A;  5B3S B;  4ZBM A;  1OCC B;  4FK5 C;  2HJF C;  1QR8 A;  4Q20 A;  1SET A;  4MVO A;  3OR7 C;  5J9P C;  1FXK C;  1GM9 A;  3AG3 B;  1BMF G;  3SRA A;  3FYI B;  3UKM A;  1JVM A;  3D3I A;  3FB7 C;  1NH2 D;  3E89 A;  2CK3 G;  3T2M A;  3K0G A;  5L3E A;  3QNE A;  1Y66 A;  2X6B A;  3ZMV A;  5KA6 A;  1H2G A;  3TK1 A;  1R3J C;  3W7S A;  3JYC A;  3E8B A;  3QO8 A;  4EKW A;  1R3I C;  2DW4 A;  4PA9 A;  4DO2 A;  2ZR3 A;  4R7C A;  3IGA C;  1ARO P;  2QKS A;  2D3O W;  3ZMT A;  4TT3 G;  2PI5 A;  4WFB V;  2WYD A;  1K33 A;  4GX2 A;  2AE5 A;  4JAS A;  1NQT A;  4H37 A;  5IYD O;  1AI7 A;  3ABK C;  3SPH A;  1QLE B;  2EIL B;  1AI4 A;  4RQE A;  3LSS A;  2GSM B;  4ASU G;  1V55 C;  1R73 A;  4LCU C;  2GHY A;  1NKD A;  2EIK B;  3P30 A;  4KUM A;  1PNL A;  4QNH B;  3UM7 A;  1H8E G;  4I9W A;  2Y69 B;  1SER A;  1H38 A;  1R3K C;  3MHH C;  2PI4 A;  3SYO A;  4XDJ A;  1M57 C;  4RAI A;  4JPR A;  1J95 A;  1DF4 A;  1PL0 A;  1WPX A;  5EC1 C;  1DTO A;  1AJQ A;  2HG5 C;  1NR7 A;  3IC7 A;  1KC8 W;  3TET A;  3E83 A;  4K2G A;  1VQ7 V;  2EZO A;  3SYQ A;  1NBM G;  2V7Q G;  1Q86 W;  2Z5U A;  3A0R A;  3CCU V;  2H8P C;  5CBH A;  4BTH A;  3DTU B;  1OCZ C;  3FYE B;  4BAY A;  5EK0 A;  2XAH A;  4KP4 A;  3ZRW B;  2OCC C;  5B1B C;  3E8H A;  2HFE C;  1FXK A;  3ETE A;  4M1J A;  4UXN A;  1OR0 A;  2ZQM A;  1F4N A;  1K5S A;  1QBZ A;  3HB3 B;  2FTK A;  2WAM A;  2DQ3 A;  2Y48 A;  2ZXW B;  4HAM A;  3W7U A;  4WFA V;  1F51 A;  5B1A B;  1M56 C;  3ABM B;  3F7Y C;  1KP2 A;  4H33 A;  1FM2 A;  3KG2 A;  2XAF A;  3OE7 G;  2XAQ A;  1SZT A;  3B8N A;  2OTL V;  1KQS U;  4G2K A;  1Q82 W;  1YJ9 V;  3FB5 C;  4UV8 A;  3ZMS A;  1E1R G;  2WLL B;  3OMA B;  2IJK A;  1B6Q A;  2JK5 C;  5CA3 A;  2Q69 A;  2QA4 V;  5CBF A;  1F23 A;  1YSC A;  1N8R W;  1MOF A;  3ZCC A;  2NNU A;  1EBO A;  1KEC A;  2LFS A;  3ZRW A;  4JTA B;  3K3W A;  3BEH A;  1MAB G;  3ZRS A;  1KKD A;  5L3B A;  3ASO C;  1S76 D;  2A79 B;  3BY6 A;  2R9R B;  5L3D A;  3ABL C;  1VQ8 V;  5C93 A;  3FB8 C;  1VQN V;  1K9M W;  1H8H G;  2EIJ C;  3WG7 B;  1SRY A;  1GTO A;  1R3L C;  3JD3 A;  4QIW F;  3T4D A;  3ZJZ A;  3ZRV A;  5DM6 V;  2DWE C;  3SRC A;  3MHS C;  3SYC A;  4MS2 A;  2F43 G;  3K9A A;  2AE4 A;  2Q68 A;  3QO7 A;  1K92 A;  4U7N A;  4CBC A;  4MVQ A;  1K5Q A;  4X8A A;  5IDJ A;  2QM7 A;  4MT8 A;  3JTR A;  5H6R A;  4UV9 A;  3F5W C;  4LBE C;  1RM1 C;  3M99 B;  1F4M A;  1V54 B;  3AG4 B;  3RW0 A;  4JF3 A;  4PEL A;  2WYC A;  4PDV A;  1K34 A;  4UVC A;  5LGT A;  2B1I A;  5L3F A;  3LDD A;  2QM8 A;  3CCQ V;  5B1O A;  2BOC C;  5DN6 G;  2OTJ V;  1HWY A;  4JAV A;  1XL6 A;  4E55 A;  5LHI A;  1YJW V;  4F4L A;  2IH3 C;  1L1F A;  5IY5 C;  1Q7Y W;  3PJS K;  4MTG A;  1EZJ A;  3LDE A;  2WLL A;  1LNQ A;  1DF5 A;  4J9Y B;  4LC1 A;  4GCZ A;  4JGS A;  1NJI W;  3I56 V;  1QLE C;  1JQ0 A;  3NXS A;  4WF9 V;  2X6A A;  1V55 B;  4MVU A;  1ROP A;  2NLJ C;  5H9C A;  3T4Z A;  3AG1 C;  3WFV A;  4RQF A;  3OMN B;  3OMI B;  4L87 A;  2HVK C;  1K97 A;  2HKO A;  3LUT B;  4P9P A;  1QLN A;  4PDM A;  3LDC A;  1BHA A;  4YXW G;  2R9I A;  1EFR G;  1OHH G;  2JDI G;  3LNM B;  3CD6 V;  2WLI B;  3B77 A;  3ML0 A;  2YSU B;  4RUF A;  5BZB A;  4J9Z B;  3B8M A;  4QE7 A;  4PDL A;  3CCL V;  4JTD B;  1FFT B;  3CPW U;  3EHB B;  3K06 A;  4FMT A;  3F7V C;  1YHQ V;  1E3A A;  3S8R A;  4TSF G;  2EIM C;  2W6J G;  3E2E A;  2DYS B;  2ITC C;  5EBL C;  5GW7 A;  1YTF B;  4GT1 A;  4QPJ A;  4R6Z A;  1AJP A;  4JAU A;  1THZ A;  1NVP B;  5B3S C;  1G8M A;  4G27 B;  4DXW A;  1KEH A;  1VQM V;  4HZ3 A;  5B1A C;  4OXS A;  5FL7 G;  4WFG A;  1ZWI C;  2EJR A;  4QPK A;  4GX5 A;  3ABU A;  2JEU A;  4MTX A;  1PNK A;  2DYR B;  4RO2 A;  3STL C;  3CCM V;  1W0J G;  1JW0 A;  4WKT A;  1K4C C;  2JIZ G;  4KFM A;  4MSW C;  4WKV A;  2XND G;  2EZP A;  1VQ6 V;  1JJ2 U;  1CPY A;  3CMA V;  3RVZ A;  1OCC C;  4CZZ A;  2XAJ A;  1R6K A;  3ETG A;  4JYC A;  3T1C A;  5IYC O;  4G28 B;  3H01 A;  3SRB A;  2WLM A;  2IW5 A;  2WYE A;  4PA4 A;  5KA5 A;  4MTF A;  1S0V A;  3DGE A;  3SPI A;  4HST A;  2JJ2 G;  5CMU A;  3SYP A;  4P2Z A;  4GX0 A;  3AG2 B;  1BL8 A;  3E35 A;  3ABK B;  3JCZ A;  2EIJ B;  1VQ4 V;  2X0L A;  3G71 V;  2QTO A;  1GMG A;  5E1A C;  1K3E A;  4E57 A;  2EIL C;  1ENV A;  3ASN C;  2X6C A;  3K0D A;  3P32 A;  4P9O A;  3K04 A;  3ZN0 A;  2WWW A;  1M9N A;  3AEI A;  1COW G;  4MW8 A;  3CCE V;  3ZMZ A;  2IJJ A;  4K2F A;  3OUS A;  2EIN C;  5L3G A;  3OEH G;  2KB1 A;  1E79 G;  3ZMU A;  1AI6 A;  3RVY A;  4BIZ A;  1I5Y A;  2IU3 A;  2X7R B;  2XOK G;  1OCR B;  3ZIA G;  3GB7 C;  3SPJ A;  3K08 A;  1VQP V;  1M1K W;  3CCJ V;  2IH1 C;  1OCZ B;  2AHZ A;  4PA7 A;  5EBM C;  1MSW D;  3JD1 A;  4MVM A;  2A9H A;  2OT5 A;  2JJ1 G;  4MW3 A;  1M57 B;  2OCC B;  4FPP A;  2A0L A;  5LBQ A;  4X89 A;  2WLN A;  2DWD C;  3OAA G;  5IY5 B;  1FS0 G;  1VQO V;  2P67 A;  1CP9 A;  3HPL C;  3OEE G;  3X2Q B;  1GM8 A;  2B5U A;  1GKF A;  2C2A A;  3ABM C;  1M56 B;  4WFF A;  2P90 A;  1NVP D;  3ZRX A;  4UVA A;  2M7W A;  2ZDI C;  1DLB A;  3IFX A;  3JTQ A;  1W0K G;  5CBG A;  3EFF K;  3E8G A;  4E56 A;  4MVZ A;  1OCO C;  2IJH A;  1JOY A;  1QCE A;  5KUM A;  2Q67 A;  4U7O A;  4WCE V;  2K1E A;  4HSR A;  1K4D C;  2W6I G;  3SYA A;  1YIT V;  4QJF B;  2HR3 A;  1P4R A;  1FXK B;  1QVG U;  3AG3 C;  1S3J A;  3OUF A;  5HFM A;  2ATK C;  4N21 A;  2WLI A;  3OR6 C;  1I5X A;  2AHY A;  2QEX V;  1JVZ A;  1S5H C;  4PEM A;  2WSS G;  2YEV A;  1Q81 W;  1MG1 A;  1KP3 A;  1SES A;  2EIM B;  3MD0 A;  4MVR A;  2ITD C;  3ABT A;  4R50 A;  3QO5 A;  4QE9 A;  3CCS V;  3CP1 A;  5LGU A;  4XBF A;  2LP7 A;  2DQ0 A;  4PA3 A;  2W0F C;  2WYB A;  2HVJ C;  1PD3 A;  2MK3 A;  3CC7 V;  4WFE A;  4PA6 A;  1VQ5 V;  3SJQ C;  3G4S V;  3CC4 V;  2ZD9 A;  1AR1 B;  3JD4 A;  3GWO A;  5LHG A;  2XAG A;  1PKX A;  1GM7 A;  2B1G A;  3R65 A;  2DYR C;  3WG7 C;  2BOB C;  1GK0 A;  1XL4 A;  4P30 A;  5L3C A;  4RUE A;  4N23 A;  3TCU A;  3ZN1 A;  3VOU A;  3CCV V;  5IYB O;  1RM1 B;  3JD2 A;  4FIP C;  4UUJ C;  4MTO A;  1Y4M A;  2WLJ A;  1RPR A;  2EIK C;  3CME V;  3ETD A;  4HYO A;  2IJI A;  4JYB A;  1R6N A;  3E86 A;  3L91 A;  2Y69 C;  5EC2 C;  1VQL V;  3FB6 C;  4WKS A;  1M90 W;  1G4Y B;  4YF9 A;  3K79 A;  1VQ9 V;  3OM3 B;  4MVS A;  1V54 C;  3AG4 C;  1K73 W;  2IU0 A;  3AG2 C;  2Z3Y A;  2XAS A;  4BW5 A;  4XDL A;  3I55 V;  4YFB A;  4UVB A;  4LP8 A;  1QVF U;  4WFH A;  3G6E V;  4JTC B;  1FXV A;  3OGC C;  3ASN B;  3K03 A;  2WLK A;  3SPG A;  3STZ C;  5B1B B;  1OZ0 A;  5HFL A;  3VBB A;  3JD0 A;  2ZR2 A;  2EIN B;  1W2B U;  1S72 V;  1VQK V;  1YI2 V;  1WLE A;  1GK9 A;  3OFN G;  2JEX A;  1FXH A;  2P7T C;  2ZXW C;  1KD1 W;  2AE3 A;  5B1N A;  1K8A W;  1JPX A;  1IXM A;  5LHH A;  1NR1 A;  3CCR V;  4E2L A;  1BHB A;  3W7X A;  2HLD G;  5LGN A;  1OCR C;  1UJW B;  2WPD G;  3OW2 U;  4I5S A;  2UXN A;  2UXX A;  3AG1 B;  1AI5 A;  4FJC C;  1S77 D;  1ORQ C;  4R8C A;  1P7B A;  1TUE B;  1RPO A;  2LFR A;  2WLH A;  5H6Q A;  3CYO A;  4PDR A;  3FKS G;  1CEZ A;  1JX9 A;  3SPC A;  2P6J A;  1GO3 F;  4ZKI A;  1JCH A;  2H94 A;  1YIJ V;  2EBO A;  3LSQ A;  3D36 A;  4BIU A;  3CXC U;  1GHD A;  2ADV A;  4YFA A;  4WKU A;  1YTF D;  3ASO B;  3E8F A;  3X2Q C;  1AJN A;  4X88 A;  1NH2 B;  1E1Q G;  4GX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...