3ML0A

Thermostable penicillin g acylase from alcaligenes faecalis in tetragonal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
b'QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin G acylase, alpha subunit
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
molecule tags Hydrolase
total genus 40
structure length 195
sequence length 195
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ml0A02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3ml0A01
3K3WA 1PNLA 1PNMA 2WYBA 3SRCA 3JTQA 1GKFA 4PELA 4E56A 1AI4A 2ADVA 3L94A 4WKTA 1AJNA 1GM9A 3JTRA 1CP9A 1K5SA 1AI7A 4BTHA 1JVZA 1K5QA 4K2GA 1AJQA 4YF9A 3SRBA 1GM8A 4PEMA 3SRAA 1OR0A 1GK9A 1GK1A 4M1JA 2AE3A 3ML0A 1KECA 4WKVA 1GM7A 4WKSA 4E55A 1FXHA 1FM2A 1JW0A 4WKUA 1GK0A 1AI6A 2AE5A 2WYCA 2WYDA 4K2FA 4E57A 3L91A 1JX9A 1GHDA 1FXVA 1PNKA 1AJPA 2WYEA 1KEHA 2AE4A 4HSRA 4HSTA 1K7DA 4YFAA 4YFBA 1H2GA 3S8RA 1AI5A 1E3AA
chains in the Genus database with same CATH superfamily
5LP6A 1MG1A 4CH3A 2HVKC 2QR4A 4NTWA 4LP8A 4DK0A 1BHBA 2OIEA 4O2AA 4JPRA 1HWYA 1K4CC 1W2BU 4UCTA 5KAIZ 4RQFA 5GONB 1Q6IA 3BCCH 1VARA 3EVKA 1ZUQA 1TUBA 3FX7A 4R7CA 2EX3A 3JASA 4DV3B 2Q0AA 4J10A 4LNUA 4X20B 4JYAB 4PA9A 4QJFB 3AG1B 1S5JA 1QCEA 4D7SA 4O2BA 2EIKB 5D5QA 5KA5A 2W6JG 2EILC 1GRJA 2JS3A 5FNVA 4K8ZA 2UUCB 2XT9A 3CCUV 2EBOA 3DC6A 2XHBA 1IVSA 3T1YO 3RYHB 3CMAV 2Y0IA 3AG2C 1ZWIC 4LWSA 1VQ9V 1GK9A 3CJHB 2BTQB 1IBKB 2ZR3A 3CRRA 3WG7C 2XAQA 3CRAA 4GLXA 2IU3A 1WA8B 4PV1B 3G6EV 1BHAA 5L3BA 2JIZG 1WP8A 1QR9A 1W0JG 4DV6O 5EBMC 1K33A 2DE0X 2XOKG 2QA4V 3LNMB 1OR0A 1VQOV 1FFXB 2Z3YA 3RWRD 3OFNG 3VBBA 1SRYA 4B3RO 1P4RA 5LMNB 4LF4B 1NQTA 4MVRA 4O4IB 4AI8A 2Q73A 3RYCB 2Q7EA 3UQ8A 1E1QG 4YJ3A 4LBEC 4YY3B 4JI7B 2Z0AA 2A79B 1XI1A 1S5HC 5KUKA 5LHIA 1EFRG 4Z1MG 5B1BB 2EIJC 3CMEV 2YI8A 3FAVB 3ETQA 1HR0O 2E5LB 5LMUB 2X0LA 3HKDB 3RVYA 1FXVA 3MHSC 3HKBB 3CWBH 4MSWC 5B3SB 4OPAA 1N34B 1HNXB 1V54B 2P90A 3LDCA 4LFCB 2QKAA 1X4TA 3I5DA 1EBOA 4MTFA 1KP2A 1FXKB 2HVJC 4MVUA 1N4CA 4X65O 1FFTB 1NTMH 3RYFB 4WFAV 3QO8A 2LGQA 2DN9A 1HDJA 3H1LH 3A0HZ 2QWNB 4I7ZB 4DRXA 4NTXA 3CCJV 3CEIA 4JGSA 4E56A 3EHBB 3G71V 3L94A 4I9QA 1AJNA 5CB4B 5E79Z 1R3IC 5KHJA 3E8BA 4H44B 3CHXA 4FJCC 3BA8A 4E55A 3U0ZA 3ABKC 1EN4A 2ZE8A 4K8XA 3X2QB 4GZRB 4BAYA 4DW0A 4W4KA 1DGSA 1K97A 1HNWB 5KUMA 1NVPB 1FJGB 2OCCB 2YEVA 1DTOA 1MMMA 2O57A 4PEMA 4MW8A 1XMQB 1OZ0A 1EN6A 4JV5O 1VQNV 3CCMV 2ITCC 5EZYA 1OCRB 3W7TA 2JS5A 4DV5B 2Y69B 1AVMA 4DV0O 4RO2A 4LF6O 1XMOO 2X7RB 3AK3A 1S5LZ 3OGIB 4MTGA 5FPOA 3JAMN 4DUYO 3M99B 2AE5A 2Y4TA 2ARHA 2Q67A 1K8AW 3CCQV 2OWOA 4I0XB 4J9ZB 4W4LA 2ZXWB 1XNRB 1YJNV 4MTXA 4X1IA 3NR7A 5C8YA 4AHCA 1JQ0A 3ZHTA 3WU2Z 2UXDO 5IWAB 2GTSA 5JCOA 2CTPA 3HR0A 2LFRA 1JCHA 4X1YA 2NLJC 5IYZB 2YS8A 3Q4HA 4JYAO 3JALA 1YZBA 2Q69A 4HAMA 3TXQA 3SJBC 2FL4A 4O4LA 2IJHA 4DO2A 3ASOB 1Y74A 1XL4A 5LP6B 2UUCO 1AR5A 1G4YB 2AGAA 1GN2A 5GW7A 1WPXA 5GTIZ 4GX5A 1MA1A 1RM1B 2IJKA 4EKWA 2XAGA 2H8PC 1Q90D 4O2AB 3ZN0A 3JCUZ 2FTKA 3L72H 3OEEG 4DR1B 5B1AC 4UCOA 1TVKA 5EIBC 2F43G 3ZJZA 2C2AA 4DR2B 4NXMB 4CH5A 1XHXA 2CDYA 1I7FA 2ZR2A 4D6TH 3SRBA 3JASB 3ETDA 2CAZC 5JH7A 4ASUG 4TOIA 5KAFZ 2ZE5A 4IIJA 1AJPA 2YXHA 3ZHUA 5KHIA 2F66C 1KB9F 2N05A 4U3FH 3SPGA 3VQXA 3VQVA 1AP5A 4TT3G 4UB8Z 1QBZA 5B66Z 5LMNO 2CH7A 2UXBB 4TQDA 1DLBA 1Q43A 2AW9A 1M90W 4JZ2A 4H37A 3K04A 2ZE7A 3UO2A 2ZCEA 5CMUA 1B04A 3HB3B 2VQEO 1K92A 3G80A 1BGYH 4LWSB 3SYPA 2OCHA 3AG3C 2F23A 1N8RW 3A0RA 2X6BA 3QF7A 5JJEB 1AR1B 4LF5O 3ABTA 4JAUA 3FYEB 4QE7A 5CA1B 2E5LO 1JOYA 3F7VC 3P32A 2BTQA 2OTLV 5LYJA 4JI4O 3ZIAG 2P4KA 1UPGA 2W0XA 2ZIMA 3RBZA 1WA8A 2LFSA 4P2ZA 1AB3A 1Q6HA 2QSAA 4R6ZA 2X6AA 4DV1O 4YIOA 2Q7HA 4FLZA 2IH3C 3ABLC 4JI2B 4AILC 4LC1A 1URFA 2DMXA 2OT5A 2ZINA 1DF5A 1L8DA 5EC2C 4YJ3B 3E35A 1GN3A 4JI1O 3E8HA 1KECA 4NTYA 3ZRXA 4O4JB 5JWPA 4O4IA 5LGNA 2JEXA 1YI2V 3T1YB 4DYLA 4LFBO 4QNHB 1WLEA 1QLNA 2YXLA 4FK5C 1NVPD 5AG2A 1G1XB 2PI4A 3ZHVA 4KL1A 1GTOA 3WG7B 2FKXA 1U97A 3E8FA 5KA6A 1Z5VA 1JW0A 3U10A 3B2EE 3HKBA 4B7KA 4JYYA 5LL6Y 4DV6B 1X59A 3ZHSA 1RFYA 1LUVA 1ZAUA 3S3WA 2KSDA 3JTRA 4CS2A 4B3RB 1K73W 5H9CA 4DRXB 1Q7YW 4F6RB 1GK0A 1VQ8V 2XAJA 1S0VA 4JI6O 5BY1A 3BFRA 3N2GA 3BABA 2QTOA 2IJJA 3CSXA 3C90A 1Q3EA 4QIWF 2AXTZ 5FL7G 5EYPA 1HR0B 1SC5B 4RQEA 2QWPB 4JI5O 2CK3G 4KFMA 2Q9LA 2YEVB 3FD9A 1JFFA 5IWAO 3WB1A 4ZHQA 4YFAA 5EZYB 3JATA 2EIMC 3F5TA 5H2FZ 4J11A 2Q8VA 3K79A 3K0GA 2X6CA 2ZIOA 1IX9A 4I4TB 4X65B 1N32B 5IYCO 2QKSA 2UUAB 1VQMV 1VEWA 4FZ0A 3CCSV 2UXCO 3LDDA 4GKKO 1N0NA 3MD0A 4WFBV 2B1GA 4G27B 2HJFC 4N23A 2AE4A 1KD1W 4UV8A 1PNLA 4LF8O 1WB7A 4I5SA 2IW5A 4X1IB 4C7UA 5DN6G 5C8YB 4IYIA 3FB8C 4I0XA 4PA3A 1B6QA 1KUQA 1ZL8A 4X1YB 2A3QA 3OT7A 5IYDO 3JD0A 3Q4HB 2GDSA 3T1HO 1IXMA 1ZTEA 4G28B 2CTRA 3K5MA 3JALB 1KU9A 2Y0PA 4JV5B 2ZD9A 2MW2B 1OCCB 1D5AA 2AHZA 3A0BZ 3S3XA 4O4LB 1Y74B 3APQA 2VWKA 2UUBO 2UXBO 2EULA 3K57A 4LF6B 1H2LA 4QPJA 1XMOB 4XDKA 2G38A 1R6TA 1SQPH 3OTOO 3DGEA 1DK1A 4DUYB 3OR6C 1TVKB 4CBCA 3CC4V 2R9RB 4JYCA 4JASA 2Q5ZA 2IH1C 4E4EA 4P30A 1FM2A 1SESA 4K2FA 2UXDB 1M57B 2VQFB 1KMIZ 5JH7B 3F5WC 4J42A 4IIJB 2FYUH 2DYSC 1MOFA 2DOSA 4RWUA 1KC8W 5JQGA 3ZRSA 1JA8A 1SQFA 3OD4A 4UVCA 3JSNA 1U96A 4HNAA 4JI2O 2CH7B 5IYBO 4K0KO 1JVMA 4JTCB 4UFZA 2YIBD 4ZKIA 3RFRA 3OUFA 3C3SA 4QPKA 2WLLA 4B3MO 2JGDB 1VQ4V 5L3DA 4TV9A 5H6QA 1VF6C 3ZMTA 2HKOA 3L73H 1RPOA 4UXNA 3T2MA 2ADQB 2XAFA 4DXWA 5BXZA 2PZSA 5LYJB 1GMGA 3J80N 4MVQA 1M1KW 4KHPB 5A2QN 4LF9O 4DK1A 5H5NA 3ABMC 3WB0A 1OHHG 3SPIA 2PI5A 5CA1A 2P6JA 2CGNA 3NXSA 2L35A 3SJCC 4FVMA 1S72V 4ZOLB 1I5YA 2OYQA 4FLUA 3I55V 2K1EA 3ZX6A 2FB5A 1OCZC 1M56B 3JCZA 4K3AA 1GHDA 3D3QA 1PNKA 2ZM6O 3CXHF 4LFAO 2VQEB 3CPWU 2CTQA 2M6YA 3AG3B 4O4JA 1L0NH 2AE3A 3I56V 4LF5B 4MW3A 2YIBA 3TGUH 3L91A 1DF4A 4HBNA 2WYEA 1ZX3A 4JI4B 1D5NA 1J5EO 5B1NA 4GCZA 5L3FA 2FMLA 4XDLA 4FLYA 2GHYA 1R3KC 4DV1B 4WKVA 2EINC 4MVOA 3KCXA 1FXHA 4MT8A 1N32O 4DR6B 4TWKA 2WLMA 2JJ1G 2WA3A 2UUAO 4MS2A 3CCEV 3B09A 5LA6A 1RSOB 2ETNA 1SQVH 1O9GA 4JI1B 2HFEC 4MVSA 3WFVA 3CC2V 1H8EG 3RYIA 3UKMA 1VIBA 3N2GB 2WAMA 4F6RA 1Y67A 4OX9O 3JSLA 1K5QA 2CUGA 4EB6B 3FB7C 4LFBB 2BOCC 2QKCA 5EYPB 5KHGA 2PY5A 1YJ9V 4BIOA 1PD3A 1NZ6A 4U7NA 1NR7A 2F95B 2RQ6A 1V9PA 1JFFB 3E22B 5CA0A 1P7BA 4ZHQB 1AI4A 2LJ2A 3JATB 3ABUA 4TV8A 4PD4F 5GTHZ 3VQYA 2D2CB 2LW7A 1N33B 5KHKA 3VQWA 5ITZA 3M8AA 5J2TB 4GYCB 3RVZA 3KKYA 4I4TA 2DYRC 4DV2O 3CRQA 1QHTA 2Q6AA 2JJ2G 4NVPA 4FM2A 2AHYA 1YEWA 5KHHA 4JI6B 4DV7O 1LUWA 1NTZH 3L9DA 2ZDIC 5DM6V 2WYCA 2DWEC 3T4DA 4YHHB 3RT3C 2JEUA 5LXTA 3C3TA 1ZL8B 2ITDC 4JI5B 2MK3A 4FMTA 3T4ZA 2VQFO 4QGPA 3K9AA 5J2UB 2QGNA 1I94O 1R6KA 4I50A 1V55B 3STZC 3G4SV 3MAQA 3ZMZA 3ICXA 3W7SA 2JDIG 2KQXA 2GTAA 2P4VA 1S76D 4WFFA 1R3LC 2UXCB 3ZBHA 4GKKB 4Q20A 4BTHA 3QNEA 5BR8O 2HP8A 5CBGA 4UV9A 5EIBD 1IDSA 1BCCH 3H1IH 1BT8A 1XUQA 4JI0O 4LF8B 1JJ2U 1EZVH 2EIKC 1AILA 1KEHA 5LGTA 2AZ0A 1ZLZA 4B3TO 4GX0A 1XEQA 5CBFA 3DXRB 4DR4O 4KHPO 1H38A 3OM3B 1F7YA 4FZ1A 2Y48A 1GK1A 3ML0A 5JQGB 1SF9A 3T1HB 1XILA 3K9SA 5JVDB 4HNAB 5IY5B 1Q82W 1MZFA 2E3CA 3IFXA 1ROPA 4A5UB 4WCEV 2BSKB 1LR1A 1N36B 4Z2WA 3H1JH 4WKTA 1P7GA 2UUBB 2WLLB 1T5EA 1CP9A 3SJAC 2RCVA 1FYJA 1AJQA 4TV9B 1W0KG 5E1AC 3OTOB 3LSSA 1H2SB 1XL6A 3PN1A 1K9MW 1AI6A 1VQ6V 4YJ2B 2JGDA 3ZHQA 3QVNA 2ZKOA 2R72A 3ZMSA 3TETA 3B8MA 3LDEA 1YDXA 1YITV 4BIZA 1QQCA 1XQ8A 3O65A 3IAYA 5EK0A 1TAEA 1IBMB 1IURA 4UCSA 4R50A 2LO1A 1PV0A 4ZBMA 2BOBC 2DYSB 3LSUA 3K03A 2BCCH 5B1BC 2V1DA 1HW7A 1SZXA 2EZPA 1WAZA 4K0KB 3AK1A 2RNBA 3OMIB 1SQGA 4ZOLA 2IBZH 4DR6O 3CCLV 2EILB 1KBHA 3SJQC 4ZI7B 1V54C 5BMVA 4B3MB 1Z2GA 1BQ0A 2F1MA 4JTAB 5J9PC 3FGRA 1FXKC 5TISZ 3S8RA 3AG2B 3TXSA 1I0HA 4JAVA 3RGBA 3HPLC 3R65A 4NB5A 4H13B 4CC5A 3JD1A 4N21A 5IDJA 4XDJA 4LH7A 4LCUC 1JVZA 3UT5A 4K2GA 5IJ9A 4LF9B 4DUZO 3KG2A 4PDLA 2XNDG 5LHHA 1MSWD 2Q7GA 4PA6A 4CS4A 3CB2A 2EJ7A 1Q6UA 2NN4A 2DQ0A 3OMAB 4BWCA 1K7DA 2A06H 3IC9A 1N33O 2WYBA 3X2QC 1IBLO 4UUJC 1JMKC 4WFEA 1HNZB 5LA6B 1K5SA 4DR3O 1PP9H 4OGQB 4KP4A 4BW5A 1L0LH 2ZM6B 4DR5B 3RYIB 1H2MA 3CP1A 1A32A 4B7EA 2OCCC 4KUMA 1JPXA 4LFAB 1EZJA 1Q8IA 1XOUA 1RSOA 2B1IA 2N74A 2CE4A 4LH6A 4TSFG 1CEZA 5IT9N 1NH2D 1Q86W 1YXBA 2Q0OC 2PUSA 2WLNA 3H1KH 4X62O 1G8MA 4YHHO 2EIJB 4EB6A 3THOA 2Y69C 2N04A 4R8CA 5CA0B 4TV8B 2JK5C 3B77A 1K3EA 4B3SO 3ETGA 1J5EB 1R3JC 1THZA 2P67A 3FB6C 3E22A 1NJIW 4JI3B 1PL4A 1XNQB 2W6IG 4NR1A 1JJOA 2WLHA 3BVOA 3K3WA 5ITZB 3SRCA 1FPOA 4AQYO 1GKFA 2CTWA 2WSSG 1WN7A 2XAHA 2ZXWC 1MNGA 3CRCA 1ENVA 3EFFK 3ZEDA 3SRAA 1IZ3A 5J2TA 2WLKA 4HYOA 3N27A 1MSDA 3D8CA 4WKUA 3CXCU 2ZNJA 2E74B 3BRCA 1S77D 2KB1A 3KZIZ 5IJ0B 4OX9B 4JYBA 3MDSA 2DQ3A 3FB5C 4X64B 3R66A 4PELA 1NI8A 5L3EA 5LXTB 3ABKB 1BL8A 4IGGA 5IE9A 5EBWC 4CH4A 1WJZA 4G2KA 4X88A 2QEXV 2YDEA 2B5UA 3CD6V 3SPJA 3FYIB 1FKAO 5LP6C 1WPBA 1K34A 4I50B 2QWQB 1SQQH 4YIPA 1RM1C 1E1RG 1NT2B 4BR6A 1PNMA 4J7KA 5J2UA 2YSUB 3K5LA 1PM9A 1O9HA 1KKDA 5LBQA 4Q6GA 1EM1A 5HFLA 1YCIA 1LNQA 1QLEC 3JAWB 3GB7C 3CCRV 1YJWV 1N36O 1G6UA 2F93B 3FGTA 1AP6A 2DYRB 4DV2B 1N0JA 1SQXH 3K08A 1I08A 3OW2U 4ICGA 3K5OA 4B08A 1EN5A 3ASNC 4DV7B 5KX5A 1YTFB 2WPDG 4JF3A 4BW9A 5FLXN 2LW1A 3CE2A 3HKCB 1IBMO 4X1KB 5BZBA 1Z5WA 2ILMA 5K1PA 5LOVA 3SGIA 3DXRA 1H2GA 1I94B 2YXYA 3TK1A 3LNNA 4WF9V 3AG4C 1AR4A 3K5NA 5H6RA 4Z1VA 2WWWA 4FLWA 4D7TA 5JVDA 2W0FC 1US6A 4P9OA 4FFBB 2XUMA 3IGAC 5JJNB 3IJ4A 1UJWB 1KKCA 2Q4PA 2H3OA 1R1BA 2BSKA 4HSRA 5BR8B 5DEDA 4U7OA 3A8TA 3DTUB 1PPJH 1GN4A 3L70H 4CH6A 1Q5OA 1GO3F 3H01A 3HKEA 4JI0B 4P9PA 1D2DA 4J9YB 2V7QG 2KG7A 3D36C 4YJ2A 1VQ5V 4B3TB 5B1AB 1F4NA 4PA4A 2F4VO 4DR4B 2PF4E 1FAFA 2DJVA 4FLTA 2UU9O 1QVFU 3CC7V 3LUTB 2HLDG 4JI8O 2PYJA 1P84F 4RUFA 2HJDA 3BHPA 4IT5A 4L8JA 3ZHRA 4IHJA 1PKXA 2GBOA 1SZTA 4WFHA 2PTMA 1HNZO 3B8NA 3OTFA 1L1FA 1TGOA 5BMVB 2CGOA 1H8HG 3ZMUA 4DR5O 2P06A 4ZIBA 4J7ZA 3UCSC 4DV4O 5LGUA 3JAKA 2H94A 1HP8A 1OCOC 2IU0A 4ZI7A 1XDCA 4WFGA 5F2VO 4PI2A 1M93A 4HZ3A 3W7XA 4UVBA 1VF6A 2WLJA 3UT5B 5IJ9B 2A7WA 4X66O 3CS5A 3D36A 3UO3A 3F7YC 4YFBA 1AI5A 2YIAA 5JJJB 3L74H 1YIJV 3OEHG 2D3OW 2ADVA 4FLVA 4JI3O 1AI7A 3VOUA 1XNQO 4F6EA 4WBNA 3ZRWA 4M1JA 1S3JA 4F4LA 2QM4A 4UCRA 5LHGA 3ABLB 4NXNB 2WYDA 4I55A 1COWG 1XBLA 1YSCA 2K9PA 4MTOA 4NYKA 1Y76A 2R9IA 2ATKC 3G67A 5K1XA 1TA8A 1F51A 3CYOA 3E86A 2WLIA 3E2EA 2YICA 4H0LB 3J7AU 1MABG 4X64O 1P49A 3CRMA 3O9OA 1VP7A 4HSTA 3U11A 3OGCC 1E3AA 4JTDB 3STLC 4DUZB 2HHHB 3ZS8C 4FPPA 3CX5F 2NNUA 5HFMA 1NS1A 2QM8A 2JVDA 4X89A 3EXAA 3QO7A 4O4HA 4J41A 1F23A 1IBLB 4GX2A 2HR3A 2V4DA 4UCVA 2XASA 5JCOC 1YTFD 1B3QA 3ZRVA 4DR3B 2AZ2A 1VQ7V 5KLVH 4U3JA 1FS0G 5B1OA 4EEQA 4GKJB 3ETEA 2ADPA 1NTKH 3DC5A 4CC6A 1OCCC 3D3IA 3N2KA 5IJ0A 4E57A 4TUYB 4X62B 2M7WA 4KXRA 3B40A 3JD2A 2RJZA 2UXXA 3RN4A 3JARA 2QWRB 5A9GA 3P3NA 1Y66A 1BZKA 4B3SB 1NH2B 5DECA 4LF7O 2BE3A 3QTCA 2L6LA 4K35A 1CPYA 4MVMA 2GUZA 1WP7A 2EIMB 4AQYB 4RAIA 1I5XA 2A9HA 2YIDA 4ABMA 3AK2A 1Y4MA 2B9ZA 3M7MX 3ZMVA 1VQPV 1M57C 1H2NA 3JAWA 1M9NA 1NU1H 3SDLA 4E2LA 1YVWA 3B4SA 1RP3B 5KX5B 4BWAA 1AROP 4PDVA 3AG7A 1IXBA 4DV3O 4EFBA 4DR7B 2QWOB 5EBLC 1SA0A 4JZGA 1Q81W 2JRIA 3AG1C 5KMGA 1GN6A 2ZDIA 2YI9A 5C93A 5LOVB 3MHHC 1VF7A 3UM7A 1RPRA 3HKCA 3JYCA 3RW0A 5CA3A 4X1KA 3BAAA 4FIPC 1KYOF 2UXNA 3OMNB 2ZE6A 4FM0A 1IBKO 1QLEB 2ZT9B 1CXZB 3SR2C 1FD9A 3OAAG 3JTQA 4X8AA 3GWOA 3E83A 1R6NA 4OXSA 1TUBB 3A2FA 3ZN1A 2ZQMA 4FFBA 1OJHA 1SS3A 2R9AA 5GONA 1YHQV 3HKEB 3W7WA 4LNUB 4WKSA 3ASNB 4FFKA 2KG7B 4O2BB 3CCVV 2RDCA 3J81N 3LSQA 3TCUA 5FNVB 1VQKV 3BY6A 1F4MA 4X20A 1MZEA 1M56C 2YUAA 3ZCCA 4LF4O 4CS3A 1BMFG 2HEPA 1Y6XA 1BS3A 4YY3O 4JI7O 3P30A 4IHJB 4UB6Z 2E75B 5L3CA 3L71H 3AEIA 3AG4B 1OV9A 3PJSK 4PJ0Z 3RYHA 4GT1A 2IM9A 3JD3A 3SPCA 5LMUO 4NXNO 2QM7A 3L75H 4J7JA 3CJHA 3SYOA 3JAKB 2Z5UA 4I9WA 5B3SC 1N34O 2KKWA 1HNXO 2QDOA 2RN9A 2ZNIA 4PDMA 3DSQA 4LFCO 3SYQA 1GH6A 4FLXA 4CZZA 4IYHA 1QU7A 4FM1A 2ODMA 3K06A 1FFXA 2IJIA 3OE7G 2Y4UA 1K4DC 4PI0A 1QVGU 2F4VB 3SPHA 2PYLA 3ABMB 2HHHO 2UU9B 1B06A 4JI8B 2LP7A 3RYCA 3K58A 4WBNB 2VS0A 3ZRWB 2VWJA 3BA9A 4I55B 3APOA 1NBMG 3BEHA 5CBHA 3K59A 1XHZA 1HNWO 3FAVA 1GM8A 1OCZB 1Y76B 3HKDA 2NR5A 4UVAA 5CN0A 4PDRA 2GV9A 4UCUA 3E8GA 1FJGO 2E76B 2WLIB 4GKJO 3QO5A 4NKGB 4DV4B 1NKDA 3GVMA 1SERA 1KQSU 5L3GA 1QR8A 1OCOB 1WNSA 3OUSA 1XMQO 2VRZA 3FFQA 1OCRC 4XBFA 3QG5A 1GM9A 3WB2A 1M4UA 4LR3A 3KCYA 4X66B 1FXKA 1SKVA 4DV5O 1NR1A 4H33A 3W7UA 1SETA 4IL6Z 3RYFA 3SYCA 2LQTA 4RUEA 2HG5C 5FPRA 1PL0A 1BE3H 4O4HB 1R73A 5B5EZ 5CB4A 3BPZA 1BQZA 2EJRA 3SYAA 4GX1A 2WA4A 2YC0A 3TJTA 2QJ1A 2EINB 1XNRO 4U3JB 2P5OA 2DW4A 1XREA 1TUEB 2BTOA 3P3PA 3T1CA 4JAAA 1YF2A 1V55C 3GWKC 1ORQC 3N2KB 4YXWG 2R70A 2GSMB 4J80A 4DR7O 4BIUA 1QNMA 2P7TC 1W59A 1E79G 3JARB 4YF9A 1JR9A 2QE7G 4TUYA 1M5IA 2Q68A 3ASOC 3G6BA 4QE9A 1UFIA 4L87A 4X9QA 2P22C 1VF5B 3OR7C 4PA7A 2GUZB 4DW1A 4EFEA 1VMGA 4MVZA 1J95A 2OIGA 4DR1O 1ZSPA 1VQLV 4PHZA 1GM7A 2JGUA 4DR2O 4NXMO 4OPHA 2QTSA 2XTAA 1SQBH 1JX9A 1SA0B 3E89A 2EZOA 3FKSG 5IY5C 5KMGB 5EC1C 1GAXA 2OTJV 2PGGA 1H2KA 1BSMA 3H9VA 5IYZA 5D5PA 2LGWA 1WB8A 2A0LA 2RMKB 4DV0B 4TQFA 1KP3A 3K0DA 2DWDC 3IC7A 4GUNA 4LF7B 3JD4A 3H1HH
chains in the Genus database with same CATH topology
4GX0A 1MG1A 4MTOA 5CBFA 2R9IA 2ATKC 1H38A 3JTRA 3OM3B 2HVKC 1F51A 3CYOA 3E86A 4LP8A 2WLIA 1BHBA 3E2EA 1K73W 5H9CA 2Y48A 1GK1A 4JPRA 1Q7YW 1MABG 1HWYA 3ML0A 1K4CC 1W2BU 1GK0A 4RQFA 1VQ8V 2XAJA 1S0VA 5IY5B 4HSTA 1Q82W 3OGCC 1E3AA 3IFXA 1ROPA 4JTDB 3STLC 2QTOA 2IJJA 4WCEV 4QIWF 4R7CA 4WKTA 5FL7G 2WLLB 1CP9A 4RQEA 4FPPA 1AJQA 4PA9A 4QJFB 2NNUA 3AG1B 5HFMA 2CK3G 1QCEA 4KFMA 2QM8A 2EIKB 1W0KG 5E1AC 3LSSA 4X89A 2YEVB 1XL6A 3QO7A 5KA5A 2W6JG 1AI6A 1K9MW 1VQ6V 2EILC 1F23A 4GX2A 2HR3A 2XASA 1YTFD 4YFAA 3CCUV 3ZRVA 1VQ7V 2EIMC 2EBOA 3ZMSA 3TETA 3B8MA 3LDEA 1YITV 3K79A 1FS0G 4BIZA 3K0GA 5B1OA 2X6CA 5EK0A 3ETEA 3CMAV 3AG2C 1ZWIC 5IYCO 2QKSA 1VQ9V 1VQMV 1GK9A 4R50A 2ZR3A 3CCSV 4ZBMA 1OCCC 3D3IA 3LDDA 2BOBC 3WG7C 2DYSB 4E57A 3MD0A 4WFBV 3K03A 2M7WA 2B1GA 2XAQA 4G27B 2HJFC 2IU3A 4N23A 5B1BC 2V1DA 3JD2A 2AE4A 1KD1W 4UV8A 3G6EV 1BHAA 2UXXA 5L3BA 1PNLA 2JIZG 1QR9A 2EZPA 1W0JG 3OMIB 4I5SA 2IW5A 5DN6G 1Y66A 1NH2B 3CCLV 2EILB 5EBMC 1K33A 2XOKG 2QA4V 3LNMB 1OR0A 3FB8C 1VQOV 3SJQC 1V54C 2Z3YA 1CPYA 4PA3A 4MVMA 1B6QA 3OFNG 3VBBA 1SRYA 2EIMB 4RAIA 1P4RA 1I5XA 2A9HA 4JTAB 1NQTA 5J9PC 4MVRA 5IYDO 3JD0A 1Y4MA 1FXKC 3S8RA 3ZMVA 3AG2B 4JAVA 1IXMA 1E1QG 1VQPV 1M57C 3HPLC 3R65A 4G28B 4LBEC 1M9NA 2ZD9A 3JD1A 4N21A 1OCCB 2A79B 5IDJA 4E2LA 1S5HC 4XDJA 4LCUC 5KUKA 1JVZA 4K2GA 2AHZA 5LHIA 1AROP 3KG2A 4PDLA 2XNDG 4PDVA 1EFRG 4Z1MG 5LHHA 5B1BB 1MSWD 2EIJC 4PA6A 3CMEV 5EBLC 1Q81W 2X0LA 2DQ0A 3OMAB 3RVYA 1FXVA 3AG1C 3MHSC 4QPJA 4XDKA 1K7DA 3DGEA 2WYBA 2ZDIA 3X2QC 4MSWC 5B3SB 5C93A 4UUJC 1V54B 3MHHC 3OR6C 4WFEA 3UM7A 1K5SA 4CBCA 2P90A 3CC4V 1RPRA 2R9RB 3LDCA 4JYCA 4KP4A 4JASA 4BW5A 3JYCA 2IH1C 3RW0A 1EBOA 5CA3A 4FIPC 4MTFA 1KP2A 3CP1A 2UXNA 4P30A 2OCCC 1FXKB 2HVJC 4MVUA 3OMNB 1FM2A 1SESA 4KUMA 4K2FA 1JPXA 1EZJA 1M57B 2B1IA 1FFTB 4WFAV 3F5WC 4TSFG 3QO8A 1CEZA 1QLEB 1NH2D 3OAAG 1Q86W 2DYSC 3JTQA 1MOFA 2WLNA 4X8AA 3GWOA 1G8MA 3CCJV 4JGSA 4E56A 3EHBB 3E83A 2EIJB 1R6NA 4OXSA 3G71V 1AJNA 1KC8W 3ZRSA 3L94A 1R3IC 3E8BA 3ZN1A 2Y69C 2ZQMA 4UVCA 4R8CA 1YHQV 3W7WA 4FJCC 5IYBO 4WKSA 4E55A 1JVMA 3ABKC 4JTCB 2JK5C 3B77A 3ASNB 1K3EA 3ETGA 1R3JC 1THZA 2P67A 3FB6C 4ZKIA 3CCVV 3X2QB 1NJIW 3LSQA 4BAYA 2W6IG 3OUFA 3TCUA 2WLHA 1K97A 4QPKA 2WLLA 3BY6A 1VQKV 3K3WA 1VQ4V 1F4MA 3SRCA 5L3DA 1GKFA 1M56C 2WSSG 5H6QA 2XAHA 5KUMA 3ZCCA 2HKOA 2ZXWC 3ZMTA 1NVPB 2OCCB 1BMFG 2YEVA 1DTOA 1RPOA 1ENVA 3EFFK 4UXNA 3T2MA 3SRAA 4PEMA 2XAFA 4MW8A 1OZ0A 2WLKA 4HYOA 3P30A 4DXWA 1VQNV 4WKUA 3CCMV 1GMGA 5L3CA 3CXCU 2ITCC 4MVQA 1M1KW 1OCRB 3AEIA 3W7TA 1S77D 3AG4B 2KB1A 3ABMC 3PJSK 1OHHG 3SPIA 2PI5A 2P6JA 4JYBA 2Y69B 4GT1A 3JD3A 3NXSA 2DQ3A 3FB5C 4RO2A 3SPCA 4PELA 5L3EA 2QM7A 3ABKB 1BL8A 2X7RB 5EBWC 3SYOA 4G2KA 4X88A 4MTGA 1S72V 2QEXV 4I9WA 2Z5UA 5B3SC 3CD6V 1I5YA 2B5UA 3SPJA 3FYIB 3M99B 3I55V 2K1EA 2AE5A 1K34A 2Q67A 4PDMA 3CCQV 1K8AW 1OCZC 3SYQA 1M56B 3JCZA 1GHDA 4J9ZB 1PNKA 2ZXWB 1YJNV 1RM1C 4MTXA 1E1RG 4CZZA 1JQ0A 1PNMA 2YSUB 1KKDA 5LBQA 3CPWU 3K06A 5HFLA 2IJIA 3OE7G 1K4DC 3AG3B 1LNQA 1QLEC 1QVGU 3GB7C 2LFRA 1JCHA 3CCRV 1YJWV 3SPHA 3ABMB 2AE3A 2NLJC 3I56V 4MW3A 2DYRB 2LP7A 3L91A 1DF4A 3ZRWB 3K08A 3OW2U 2WYEA 2Q69A 4HAMA 3ASNC 1NBMG 3BEHA 5CBHA 5B1NA 1YTFB 2IJHA 4GCZA 4DO2A 3ASOB 1XL4A 5L3FA 2WPDG 4JF3A 4XDLA 1G4YB 1GM8A 1OCZB 5GW7A 1WPXA 5CN0A 2GHYA 4GX5A 1R3KC 4UVAA 4WKVA 4PDRA 2EINC 4MVOA 1RM1B 2IJKA 3E8GA 4EKWA 1FXHA 2WLIB 3QO5A 1NKDA 2XAGA 2H8PC 5BZBA 4MT8A 1SERA 3ZN0A 1KQSU 5L3GA 1QR8A 1OCOB 2WLMA 2JJ1G 3OUSA 4TWKA 4MS2A 2FTKA 3CCEV 1H2GA 3OEEG 5B1AC 2F43G 2HFEC 4MVSA 3TK1A 3WFVA 3ZJZA 3CC2V 1OCRC 2C2AA 4WF9V 3AG4C 4XBFA 1H8EG 3UKMA 1GM9A 2WAMA 2ZR2A 1FXKA 1K5QA 5H6RA 3SRBA 1NR1A 2WWWA 4H33A 2W0FC 3FB7C 2BOCC 3ETDA 3W7UA 1SETA 4P9OA 4ASUG 3IGAC 3SYCA 1UJWB 4RUEA 1YJ9V 2HG5C 1PD3A 1AJPA 4U7NA 1NR7A 1PL0A 4HSRA 1R73A 4U7OA 3DTUB 2EJRA 3SYAA 4GX1A 3SPGA 4TT3G 1P7BA 1QBZA 1AI4A 2EINB 1GO3F 3H01A 4P9PA 3ABUA 1DLBA 4J9YB 1M90W 4H37A 3K04A 2DW4A 2V7QG 1TUEB 5CMUA 1VQ5V 3HB3B 1K92A 3T1CA 5B1AB 1F4NA 4PA4A 3SYPA 3AG3C 1V55C 3A0RA 1N8RW 2X6BA 1ORQC 3RVZA 4YXWG 1AR1B 3ABTA 1QVFU 3CC7V 3LUTB 2HLDG 2GSMB 2DYRC 4JAUA 3FYEB 4QE7A 4RUFA 2Q6AA 2JJ2G 1JOYA 4BIUA 3F7VC 3P32A 2P7TC 2AHYA 1E79G 2OTLV 4YF9A 2QE7G 3ZIAG 1PKXA 1SZTA 2Q68A 4WFHA 3RBZA 3ASOC 2ZDIC 4QE9A 5DM6V 2WYCA 2LFSA 2DWEC 4P2ZA 4L87A 3T4DA 3B8NA 1L1FA 3OR7C 4R6ZA 4PA7A 1H8HG 2X6AA 2JEUA 3ZMUA 2ITDC 2IH3C 3ABLC 4LC1A 2MK3A 4MVZA 2OT5A 1J95A 5EC2C 1DF5A 4FMTA 3T4ZA 5LGUA 2H94A 3K9AA 1OCOC 2IU0A 4WFGA 1R6KA 1VQLV 3E35A 4HZ3A 3W7XA 4UVBA 3E8HA 1V55B 1KECA 1GM7A 3STZC 3ZRXA 2WLJA 3G4SV 3ZMZA 5LGNA 3W7SA 2JEXA 3D36A 1YI2V 2JDIG 3F7YC 4YFBA 4QNHB 1WLEA 1JX9A 1QLNA 4FK5C 1AI5A 1NVPD 1S76D 3E89A 2EZOA 1YIJV 3FKSG 3OEHG 5IY5C 2D3OW 4WFFA 2PI4A 5EC1C 1R3LC 2ADVA 2OTJV 1GTOA 3WG7B 4Q20A 1AI7A 3QNEA 4BTHA 3VOUA 3E8FA 5CBGA 4UV9A 3ZRWA 2A0LA 1S3JA 5KA6A 4M1JA 4F4LA 1JW0A 1KP3A 5LHGA 3ABLB 2WYDA 1JJ2U 3K0DA 2DWDC 1COWG 2EIKC 1YSCA 3IC7A 1KEHA 5LGTA 3JD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3W A;  1PNL A;  1PNM A;  2WYB A;  3SRC A;  3JTQ A;  1GKF A;  4PEL A;  4E56 A;  1AI4 A;  2ADV A;  3L94 A;  4WKT A;  1AJN A;  1GM9 A;  3JTR A;  1CP9 A;  1K5S A;  1AI7 A;  4BTH A;  1JVZ A;  1K5Q A;  4K2G A;  1AJQ A;  4YF9 A;  3SRB A;  1GM8 A;  4PEM A;  3SRA A;  1OR0 A;  1GK9 A;  1GK1 A;  4M1J A;  2AE3 A;  3ML0 A;  1KEC A;  4WKV A;  1GM7 A;  4WKS A;  4E55 A;  1FXH A;  1FM2 A;  1JW0 A;  4WKU A;  1GK0 A;  1AI6 A;  2AE5 A;  2WYC A;  2WYD A;  4K2F A;  4E57 A;  3L91 A;  1JX9 A;  1GHD A;  1FXV A;  1PNK A;  1AJP A;  2WYE A;  1KEH A;  2AE4 A;  4HSR A;  4HST A;  1K7D A;  4YFA A;  4YFB A;  1H2G A;  3S8R A;  1AI5 A;  1E3A A; 
#chains in the Genus database with same CATH topology
 5LP6 A;  1MG1 A;  4CH3 A;  2HVK C;  2QR4 A;  4NTW A;  4LP8 A;  4DK0 A;  1BHB A;  2OIE A;  4O2A A;  4JPR A;  1HWY A;  1K4C C;  1W2B U;  4UCT A;  5KAI Z;  4RQF A;  5GON B;  1Q6I A;  3BCC H;  1VAR A;  3EVK A;  1ZUQ A;  1TUB A;  3FX7 A;  4R7C A;  2EX3 A;  3JAS A;  4DV3 B;  2Q0A A;  4J10 A;  4LNU A;  4X20 B;  4JYA B;  4PA9 A;  4QJF B;  3AG1 B;  1S5J A;  1QCE A;  4D7S A;  4O2B A;  2EIK B;  5D5Q A;  5KA5 A;  2W6J G;  2EIL C;  1GRJ A;  2JS3 A;  5FNV A;  4K8Z A;  2UUC B;  2XT9 A;  3CCU V;  2EBO A;  3DC6 A;  2XHB A;  1IVS A;  3T1Y O;  3RYH B;  3CMA V;  2Y0I A;  3AG2 C;  1ZWI C;  4LWS A;  1VQ9 V;  1GK9 A;  3CJH B;  2BTQ B;  1IBK B;  2ZR3 A;  3CRR A;  3WG7 C;  2XAQ A;  3CRA A;  4GLX A;  2IU3 A;  1WA8 B;  4PV1 B;  3G6E V;  1BHA A;  5L3B A;  2JIZ G;  1WP8 A;  1QR9 A;  1W0J G;  4DV6 O;  5EBM C;  1K33 A;  2DE0 X;  2XOK G;  2QA4 V;  3LNM B;  1OR0 A;  1VQO V;  1FFX B;  2Z3Y A;  3RWR D;  3OFN G;  3VBB A;  1SRY A;  4B3R O;  1P4R A;  5LMN B;  4LF4 B;  1NQT A;  4MVR A;  4O4I B;  4AI8 A;  2Q73 A;  3RYC B;  2Q7E A;  3UQ8 A;  1E1Q G;  4YJ3 A;  4LBE C;  4YY3 B;  4JI7 B;  2Z0A A;  2A79 B;  1XI1 A;  1S5H C;  5KUK A;  5LHI A;  1EFR G;  4Z1M G;  5B1B B;  2EIJ C;  3CME V;  2YI8 A;  3FAV B;  3ETQ A;  1HR0 O;  2E5L B;  5LMU B;  2X0L A;  3HKD B;  3RVY A;  1FXV A;  3MHS C;  3HKB B;  3CWB H;  4MSW C;  5B3S B;  4OPA A;  1N34 B;  1HNX B;  1V54 B;  2P90 A;  3LDC A;  4LFC B;  2QKA A;  1X4T A;  3I5D A;  1EBO A;  4MTF A;  1KP2 A;  1FXK B;  2HVJ C;  4MVU A;  1N4C A;  4X65 O;  1FFT B;  1NTM H;  3RYF B;  4WFA V;  3QO8 A;  2LGQ A;  2DN9 A;  1HDJ A;  3H1L H;  3A0H Z;  2QWN B;  4I7Z B;  4DRX A;  4NTX A;  3CCJ V;  3CEI A;  4JGS A;  4E56 A;  3EHB B;  3G71 V;  3L94 A;  4I9Q A;  1AJN A;  5CB4 B;  5E79 Z;  1R3I C;  5KHJ A;  3E8B A;  4H44 B;  3CHX A;  4FJC C;  3BA8 A;  4E55 A;  3U0Z A;  3ABK C;  1EN4 A;  2ZE8 A;  4K8X A;  3X2Q B;  4GZR B;  4BAY A;  4DW0 A;  4W4K A;  1DGS A;  1K97 A;  1HNW B;  5KUM A;  1NVP B;  1FJG B;  2OCC B;  2YEV A;  1DTO A;  1MMM A;  2O57 A;  4PEM A;  4MW8 A;  1XMQ B;  1OZ0 A;  1EN6 A;  4JV5 O;  1VQN V;  3CCM V;  2ITC C;  5EZY A;  1OCR B;  3W7T A;  2JS5 A;  4DV5 B;  2Y69 B;  1AVM A;  4DV0 O;  4RO2 A;  4LF6 O;  1XMO O;  2X7R B;  3AK3 A;  1S5L Z;  3OGI B;  4MTG A;  5FPO A;  3JAM N;  4DUY O;  3M99 B;  2AE5 A;  2Y4T A;  2ARH A;  2Q67 A;  1K8A W;  3CCQ V;  2OWO A;  4I0X B;  4J9Z B;  4W4L A;  2ZXW B;  1XNR B;  1YJN V;  4MTX A;  4X1I A;  3NR7 A;  5C8Y A;  4AHC A;  1JQ0 A;  3ZHT A;  3WU2 Z;  2UXD O;  5IWA B;  2GTS A;  5JCO A;  2CTP A;  3HR0 A;  2LFR A;  1JCH A;  4X1Y A;  2NLJ C;  5IYZ B;  2YS8 A;  3Q4H A;  4JYA O;  3JAL A;  1YZB A;  2Q69 A;  4HAM A;  3TXQ A;  3SJB C;  2FL4 A;  4O4L A;  2IJH A;  4DO2 A;  3ASO B;  1Y74 A;  1XL4 A;  5LP6 B;  2UUC O;  1AR5 A;  1G4Y B;  2AGA A;  1GN2 A;  5GW7 A;  1WPX A;  5GTI Z;  4GX5 A;  1MA1 A;  1RM1 B;  2IJK A;  4EKW A;  2XAG A;  2H8P C;  1Q90 D;  4O2A B;  3ZN0 A;  3JCU Z;  2FTK A;  3L72 H;  3OEE G;  4DR1 B;  5B1A C;  4UCO A;  1TVK A;  5EIB C;  2F43 G;  3ZJZ A;  2C2A A;  4DR2 B;  4NXM B;  4CH5 A;  1XHX A;  2CDY A;  1I7F A;  2ZR2 A;  4D6T H;  3SRB A;  3JAS B;  3ETD A;  2CAZ C;  5JH7 A;  4ASU G;  4TOI A;  5KAF Z;  2ZE5 A;  4IIJ A;  1AJP A;  2YXH A;  3ZHU A;  5KHI A;  2F66 C;  1KB9 F;  2N05 A;  4U3F H;  3SPG A;  3VQX A;  3VQV A;  1AP5 A;  4TT3 G;  4UB8 Z;  1QBZ A;  5B66 Z;  5LMN O;  2CH7 A;  2UXB B;  4TQD A;  1DLB A;  1Q43 A;  2AW9 A;  1M90 W;  4JZ2 A;  4H37 A;  3K04 A;  2ZE7 A;  3UO2 A;  2ZCE A;  5CMU A;  1B04 A;  3HB3 B;  2VQE O;  1K92 A;  3G80 A;  1BGY H;  4LWS B;  3SYP A;  2OCH A;  3AG3 C;  2F23 A;  1N8R W;  3A0R A;  2X6B A;  3QF7 A;  5JJE B;  1AR1 B;  4LF5 O;  3ABT A;  4JAU A;  3FYE B;  4QE7 A;  5CA1 B;  2E5L O;  1JOY A;  3F7V C;  3P32 A;  2BTQ A;  2OTL V;  5LYJ A;  4JI4 O;  3ZIA G;  2P4K A;  1UPG A;  2W0X A;  2ZIM A;  3RBZ A;  1WA8 A;  2LFS A;  4P2Z A;  1AB3 A;  1Q6H A;  2QSA A;  4R6Z A;  2X6A A;  4DV1 O;  4YIO A;  2Q7H A;  4FLZ A;  2IH3 C;  3ABL C;  4JI2 B;  4AIL C;  4LC1 A;  1URF A;  2DMX A;  2OT5 A;  2ZIN A;  1DF5 A;  1L8D A;  5EC2 C;  4YJ3 B;  3E35 A;  1GN3 A;  4JI1 O;  3E8H A;  1KEC A;  4NTY A;  3ZRX A;  4O4J B;  5JWP A;  4O4I A;  5LGN A;  2JEX A;  1YI2 V;  3T1Y B;  4DYL A;  4LFB O;  4QNH B;  1WLE A;  1QLN A;  2YXL A;  4FK5 C;  1NVP D;  5AG2 A;  1G1X B;  2PI4 A;  3ZHV A;  4KL1 A;  1GTO A;  3WG7 B;  2FKX A;  1U97 A;  3E8F A;  5KA6 A;  1Z5V A;  1JW0 A;  3U10 A;  3B2E E;  3HKB A;  4B7K A;  4JYY A;  5LL6 Y;  4DV6 B;  1X59 A;  3ZHS A;  1RFY A;  1LUV A;  1ZAU A;  3S3W A;  2KSD A;  3JTR A;  4CS2 A;  4B3R B;  1K73 W;  5H9C A;  4DRX B;  1Q7Y W;  4F6R B;  1GK0 A;  1VQ8 V;  2XAJ A;  1S0V A;  4JI6 O;  5BY1 A;  3BFR A;  3N2G A;  3BAB A;  2QTO A;  2IJJ A;  3CSX A;  3C90 A;  1Q3E A;  4QIW F;  2AXT Z;  5FL7 G;  5EYP A;  1HR0 B;  1SC5 B;  4RQE A;  2QWP B;  4JI5 O;  2CK3 G;  4KFM A;  2Q9L A;  2YEV B;  3FD9 A;  1JFF A;  5IWA O;  3WB1 A;  4ZHQ A;  4YFA A;  5EZY B;  3JAT A;  2EIM C;  3F5T A;  5H2F Z;  4J11 A;  2Q8V A;  3K79 A;  3K0G A;  2X6C A;  2ZIO A;  1IX9 A;  4I4T B;  4X65 B;  1N32 B;  5IYC O;  2QKS A;  2UUA B;  1VQM V;  1VEW A;  4FZ0 A;  3CCS V;  2UXC O;  3LDD A;  4GKK O;  1N0N A;  3MD0 A;  4WFB V;  2B1G A;  4G27 B;  2HJF C;  4N23 A;  2AE4 A;  1KD1 W;  4UV8 A;  1PNL A;  4LF8 O;  1WB7 A;  4I5S A;  2IW5 A;  4X1I B;  4C7U A;  5DN6 G;  5C8Y B;  4IYI A;  3FB8 C;  4I0X A;  4PA3 A;  1B6Q A;  1KUQ A;  1ZL8 A;  4X1Y B;  2A3Q A;  3OT7 A;  5IYD O;  3JD0 A;  3Q4H B;  2GDS A;  3T1H O;  1IXM A;  1ZTE A;  4G28 B;  2CTR A;  3K5M A;  3JAL B;  1KU9 A;  2Y0P A;  4JV5 B;  2ZD9 A;  2MW2 B;  1OCC B;  1D5A A;  2AHZ A;  3A0B Z;  3S3X A;  4O4L B;  1Y74 B;  3APQ A;  2VWK A;  2UUB O;  2UXB O;  2EUL A;  3K57 A;  4LF6 B;  1H2L A;  4QPJ A;  1XMO B;  4XDK A;  2G38 A;  1R6T A;  1SQP H;  3OTO O;  3DGE A;  1DK1 A;  4DUY B;  3OR6 C;  1TVK B;  4CBC A;  3CC4 V;  2R9R B;  4JYC A;  4JAS A;  2Q5Z A;  2IH1 C;  4E4E A;  4P30 A;  1FM2 A;  1SES A;  4K2F A;  2UXD B;  1M57 B;  2VQF B;  1KMI Z;  5JH7 B;  3F5W C;  4J42 A;  4IIJ B;  2FYU H;  2DYS C;  1MOF A;  2DOS A;  4RWU A;  1KC8 W;  5JQG A;  3ZRS A;  1JA8 A;  1SQF A;  3OD4 A;  4UVC A;  3JSN A;  1U96 A;  4HNA A;  4JI2 O;  2CH7 B;  5IYB O;  4K0K O;  1JVM A;  4JTC B;  4UFZ A;  2YIB D;  4ZKI A;  3RFR A;  3OUF A;  3C3S A;  4QPK A;  2WLL A;  4B3M O;  2JGD B;  1VQ4 V;  5L3D A;  4TV9 A;  5H6Q A;  1VF6 C;  3ZMT A;  2HKO A;  3L73 H;  1RPO A;  4UXN A;  3T2M A;  2ADQ B;  2XAF A;  4DXW A;  5BXZ A;  2PZS A;  5LYJ B;  1GMG A;  3J80 N;  4MVQ A;  1M1K W;  4KHP B;  5A2Q N;  4LF9 O;  4DK1 A;  5H5N A;  3ABM C;  3WB0 A;  1OHH G;  3SPI A;  2PI5 A;  5CA1 A;  2P6J A;  2CGN A;  3NXS A;  2L35 A;  3SJC C;  4FVM A;  1S72 V;  4ZOL B;  1I5Y A;  2OYQ A;  4FLU A;  3I55 V;  2K1E A;  3ZX6 A;  2FB5 A;  1OCZ C;  1M56 B;  3JCZ A;  4K3A A;  1GHD A;  3D3Q A;  1PNK A;  2ZM6 O;  3CXH F;  4LFA O;  2VQE B;  3CPW U;  2CTQ A;  2M6Y A;  3AG3 B;  4O4J A;  1L0N H;  2AE3 A;  3I56 V;  4LF5 B;  4MW3 A;  2YIB A;  3TGU H;  3L91 A;  1DF4 A;  4HBN A;  2WYE A;  1ZX3 A;  4JI4 B;  1D5N A;  1J5E O;  5B1N A;  4GCZ A;  5L3F A;  2FML A;  4XDL A;  4FLY A;  2GHY A;  1R3K C;  4DV1 B;  4WKV A;  2EIN C;  4MVO A;  3KCX A;  1FXH A;  4MT8 A;  1N32 O;  4DR6 B;  4TWK A;  2WLM A;  2JJ1 G;  2WA3 A;  2UUA O;  4MS2 A;  3CCE V;  3B09 A;  5LA6 A;  1RSO B;  2ETN A;  1SQV H;  1O9G A;  4JI1 B;  2HFE C;  4MVS A;  3WFV A;  3CC2 V;  1H8E G;  3RYI A;  3UKM A;  1VIB A;  3N2G B;  2WAM A;  4F6R A;  1Y67 A;  4OX9 O;  3JSL A;  1K5Q A;  2CUG A;  4EB6 B;  3FB7 C;  4LFB B;  2BOC C;  2QKC A;  5EYP B;  5KHG A;  2PY5 A;  1YJ9 V;  4BIO A;  1PD3 A;  1NZ6 A;  4U7N A;  1NR7 A;  2F95 B;  2RQ6 A;  1V9P A;  1JFF B;  3E22 B;  5CA0 A;  1P7B A;  4ZHQ B;  1AI4 A;  2LJ2 A;  3JAT B;  3ABU A;  4TV8 A;  4PD4 F;  5GTH Z;  3VQY A;  2D2C B;  2LW7 A;  1N33 B;  5KHK A;  3VQW A;  5ITZ A;  3M8A A;  5J2T B;  4GYC B;  3RVZ A;  3KKY A;  4I4T A;  2DYR C;  4DV2 O;  3CRQ A;  1QHT A;  2Q6A A;  2JJ2 G;  4NVP A;  4FM2 A;  2AHY A;  1YEW A;  5KHH A;  4JI6 B;  4DV7 O;  1LUW A;  1NTZ H;  3L9D A;  2ZDI C;  5DM6 V;  2WYC A;  2DWE C;  3T4D A;  4YHH B;  3RT3 C;  2JEU A;  5LXT A;  3C3T A;  1ZL8 B;  2ITD C;  4JI5 B;  2MK3 A;  4FMT A;  3T4Z A;  2VQF O;  4QGP A;  3K9A A;  5J2U B;  2QGN A;  1I94 O;  1R6K A;  4I50 A;  1V55 B;  3STZ C;  3G4S V;  3MAQ A;  3ZMZ A;  3ICX A;  3W7S A;  2JDI G;  2KQX A;  2GTA A;  2P4V A;  1S76 D;  4WFF A;  1R3L C;  2UXC B;  3ZBH A;  4GKK B;  4Q20 A;  4BTH A;  3QNE A;  5BR8 O;  2HP8 A;  5CBG A;  4UV9 A;  5EIB D;  1IDS A;  1BCC H;  3H1I H;  1BT8 A;  1XUQ A;  4JI0 O;  4LF8 B;  1JJ2 U;  1EZV H;  2EIK C;  1AIL A;  1KEH A;  5LGT A;  2AZ0 A;  1ZLZ A;  4B3T O;  4GX0 A;  1XEQ A;  5CBF A;  3DXR B;  4DR4 O;  4KHP O;  1H38 A;  3OM3 B;  1F7Y A;  4FZ1 A;  2Y48 A;  1GK1 A;  3ML0 A;  5JQG B;  1SF9 A;  3T1H B;  1XIL A;  3K9S A;  5JVD B;  4HNA B;  5IY5 B;  1Q82 W;  1MZF A;  2E3C A;  3IFX A;  1ROP A;  4A5U B;  4WCE V;  2BSK B;  1LR1 A;  1N36 B;  4Z2W A;  3H1J H;  4WKT A;  1P7G A;  2UUB B;  2WLL B;  1T5E A;  1CP9 A;  3SJA C;  2RCV A;  1FYJ A;  1AJQ A;  4TV9 B;  1W0K G;  5E1A C;  3OTO B;  3LSS A;  1H2S B;  1XL6 A;  3PN1 A;  1K9M W;  1AI6 A;  1VQ6 V;  4YJ2 B;  2JGD A;  3ZHQ A;  3QVN A;  2ZKO A;  2R72 A;  3ZMS A;  3TET A;  3B8M A;  3LDE A;  1YDX A;  1YIT V;  4BIZ A;  1QQC A;  1XQ8 A;  3O65 A;  3IAY A;  5EK0 A;  1TAE A;  1IBM B;  1IUR A;  4UCS A;  4R50 A;  2LO1 A;  1PV0 A;  4ZBM A;  2BOB C;  2DYS B;  3LSU A;  3K03 A;  2BCC H;  5B1B C;  2V1D A;  1HW7 A;  1SZX A;  2EZP A;  1WAZ A;  4K0K B;  3AK1 A;  2RNB A;  3OMI B;  1SQG A;  4ZOL A;  2IBZ H;  4DR6 O;  3CCL V;  2EIL B;  1KBH A;  3SJQ C;  4ZI7 B;  1V54 C;  5BMV A;  4B3M B;  1Z2G A;  1BQ0 A;  2F1M A;  4JTA B;  5J9P C;  3FGR A;  1FXK C;  5TIS Z;  3S8R A;  3AG2 B;  3TXS A;  1I0H A;  4JAV A;  3RGB A;  3HPL C;  3R65 A;  4NB5 A;  4H13 B;  4CC5 A;  3JD1 A;  4N21 A;  5IDJ A;  4XDJ A;  4LH7 A;  4LCU C;  1JVZ A;  3UT5 A;  4K2G A;  5IJ9 A;  4LF9 B;  4DUZ O;  3KG2 A;  4PDL A;  2XND G;  5LHH A;  1MSW D;  2Q7G A;  4PA6 A;  4CS4 A;  3CB2 A;  2EJ7 A;  1Q6U A;  2NN4 A;  2DQ0 A;  3OMA B;  4BWC A;  1K7D A;  2A06 H;  3IC9 A;  1N33 O;  2WYB A;  3X2Q C;  1IBL O;  4UUJ C;  1JMK C;  4WFE A;  1HNZ B;  5LA6 B;  1K5S A;  4DR3 O;  1PP9 H;  4OGQ B;  4KP4 A;  4BW5 A;  1L0L H;  2ZM6 B;  4DR5 B;  3RYI B;  1H2M A;  3CP1 A;  1A32 A;  4B7E A;  2OCC C;  4KUM A;  1JPX A;  4LFA B;  1EZJ A;  1Q8I A;  1XOU A;  1RSO A;  2B1I A;  2N74 A;  2CE4 A;  4LH6 A;  4TSF G;  1CEZ A;  5IT9 N;  1NH2 D;  1Q86 W;  1YXB A;  2Q0O C;  2PUS A;  2WLN A;  3H1K H;  4X62 O;  1G8M A;  4YHH O;  2EIJ B;  4EB6 A;  3THO A;  2Y69 C;  2N04 A;  4R8C A;  5CA0 B;  4TV8 B;  2JK5 C;  3B77 A;  1K3E A;  4B3S O;  3ETG A;  1J5E B;  1R3J C;  1THZ A;  2P67 A;  3FB6 C;  3E22 A;  1NJI W;  4JI3 B;  1PL4 A;  1XNQ B;  2W6I G;  4NR1 A;  1JJO A;  2WLH A;  3BVO A;  3K3W A;  5ITZ B;  3SRC A;  1FPO A;  4AQY O;  1GKF A;  2CTW A;  2WSS G;  1WN7 A;  2XAH A;  2ZXW C;  1MNG A;  3CRC A;  1ENV A;  3EFF K;  3ZED A;  3SRA A;  1IZ3 A;  5J2T A;  2WLK A;  4HYO A;  3N27 A;  1MSD A;  3D8C A;  4WKU A;  3CXC U;  2ZNJ A;  2E74 B;  3BRC A;  1S77 D;  2KB1 A;  3KZI Z;  5IJ0 B;  4OX9 B;  4JYB A;  3MDS A;  2DQ3 A;  3FB5 C;  4X64 B;  3R66 A;  4PEL A;  1NI8 A;  5L3E A;  5LXT B;  3ABK B;  1BL8 A;  4IGG A;  5IE9 A;  5EBW C;  4CH4 A;  1WJZ A;  4G2K A;  4X88 A;  2QEX V;  2YDE A;  2B5U A;  3CD6 V;  3SPJ A;  3FYI B;  1FKA O;  5LP6 C;  1WPB A;  1K34 A;  4I50 B;  2QWQ B;  1SQQ H;  4YIP A;  1RM1 C;  1E1R G;  1NT2 B;  4BR6 A;  1PNM A;  4J7K A;  5J2U A;  2YSU B;  3K5L A;  1PM9 A;  1O9H A;  1KKD A;  5LBQ A;  4Q6G A;  1EM1 A;  5HFL A;  1YCI A;  1LNQ A;  1QLE C;  3JAW B;  3GB7 C;  3CCR V;  1YJW V;  1N36 O;  1G6U A;  2F93 B;  3FGT A;  1AP6 A;  2DYR B;  4DV2 B;  1N0J A;  1SQX H;  3K08 A;  1I08 A;  3OW2 U;  4ICG A;  3K5O A;  4B08 A;  1EN5 A;  3ASN C;  4DV7 B;  5KX5 A;  1YTF B;  2WPD G;  4JF3 A;  4BW9 A;  5FLX N;  2LW1 A;  3CE2 A;  3HKC B;  1IBM O;  4X1K B;  5BZB A;  1Z5W A;  2ILM A;  5K1P A;  5LOV A;  3SGI A;  3DXR A;  1H2G A;  1I94 B;  2YXY A;  3TK1 A;  3LNN A;  4WF9 V;  3AG4 C;  1AR4 A;  3K5N A;  5H6R A;  4Z1V A;  2WWW A;  4FLW A;  4D7T A;  5JVD A;  2W0F C;  1US6 A;  4P9O A;  4FFB B;  2XUM A;  3IGA C;  5JJN B;  3IJ4 A;  1UJW B;  1KKC A;  2Q4P A;  2H3O A;  1R1B A;  2BSK A;  4HSR A;  5BR8 B;  5DED A;  4U7O A;  3A8T A;  3DTU B;  1PPJ H;  1GN4 A;  3L70 H;  4CH6 A;  1Q5O A;  1GO3 F;  3H01 A;  3HKE A;  4JI0 B;  4P9P A;  1D2D A;  4J9Y B;  2V7Q G;  2KG7 A;  3D36 C;  4YJ2 A;  1VQ5 V;  4B3T B;  5B1A B;  1F4N A;  4PA4 A;  2F4V O;  4DR4 B;  2PF4 E;  1FAF A;  2DJV A;  4FLT A;  2UU9 O;  1QVF U;  3CC7 V;  3LUT B;  2HLD G;  4JI8 O;  2PYJ A;  1P84 F;  4RUF A;  2HJD A;  3BHP A;  4IT5 A;  4L8J A;  3ZHR A;  4IHJ A;  1PKX A;  2GBO A;  1SZT A;  4WFH A;  2PTM A;  1HNZ O;  3B8N A;  3OTF A;  1L1F A;  1TGO A;  5BMV B;  2CGO A;  1H8H G;  3ZMU A;  4DR5 O;  2P06 A;  4ZIB A;  4J7Z A;  3UCS C;  4DV4 O;  5LGU A;  3JAK A;  2H94 A;  1HP8 A;  1OCO C;  2IU0 A;  4ZI7 A;  1XDC A;  4WFG A;  5F2V O;  4PI2 A;  1M93 A;  4HZ3 A;  3W7X A;  4UVB A;  1VF6 A;  2WLJ A;  3UT5 B;  5IJ9 B;  2A7W A;  4X66 O;  3CS5 A;  3D36 A;  3UO3 A;  3F7Y C;  4YFB A;  1AI5 A;  2YIA A;  5JJJ B;  3L74 H;  1YIJ V;  3OEH G;  2D3O W;  2ADV A;  4FLV A;  4JI3 O;  1AI7 A;  3VOU A;  1XNQ O;  4F6E A;  4WBN A;  3ZRW A;  4M1J A;  1S3J A;  4F4L A;  2QM4 A;  4UCR A;  5LHG A;  3ABL B;  4NXN B;  2WYD A;  4I55 A;  1COW G;  1XBL A;  1YSC A;  2K9P A;  4MTO A;  4NYK A;  1Y76 A;  2R9I A;  2ATK C;  3G67 A;  5K1X A;  1TA8 A;  1F51 A;  3CYO A;  3E86 A;  2WLI A;  3E2E A;  2YIC A;  4H0L B;  3J7A U;  1MAB G;  4X64 O;  1P49 A;  3CRM A;  3O9O A;  1VP7 A;  4HST A;  3U11 A;  3OGC C;  1E3A A;  4JTD B;  3STL C;  4DUZ B;  2HHH B;  3ZS8 C;  4FPP A;  3CX5 F;  2NNU A;  5HFM A;  1NS1 A;  2QM8 A;  2JVD A;  4X89 A;  3EXA A;  3QO7 A;  4O4H A;  4J41 A;  1F23 A;  1IBL B;  4GX2 A;  2HR3 A;  2V4D A;  4UCV A;  2XAS A;  5JCO C;  1YTF D;  1B3Q A;  3ZRV A;  4DR3 B;  2AZ2 A;  1VQ7 V;  5KLV H;  4U3J A;  1FS0 G;  5B1O A;  4EEQ A;  4GKJ B;  3ETE A;  2ADP A;  1NTK H;  3DC5 A;  4CC6 A;  1OCC C;  3D3I A;  3N2K A;  5IJ0 A;  4E57 A;  4TUY B;  4X62 B;  2M7W A;  4KXR A;  3B40 A;  3JD2 A;  2RJZ A;  2UXX A;  3RN4 A;  3JAR A;  2QWR B;  5A9G A;  3P3N A;  1Y66 A;  1BZK A;  4B3S B;  1NH2 B;  5DEC A;  4LF7 O;  2BE3 A;  3QTC A;  2L6L A;  4K35 A;  1CPY A;  4MVM A;  2GUZ A;  1WP7 A;  2EIM B;  4AQY B;  4RAI A;  1I5X A;  2A9H A;  2YID A;  4ABM A;  3AK2 A;  1Y4M A;  2B9Z A;  3M7M X;  3ZMV A;  1VQP V;  1M57 C;  1H2N A;  3JAW A;  1M9N A;  1NU1 H;  3SDL A;  4E2L A;  1YVW A;  3B4S A;  1RP3 B;  5KX5 B;  4BWA A;  1ARO P;  4PDV A;  3AG7 A;  1IXB A;  4DV3 O;  4EFB A;  4DR7 B;  2QWO B;  5EBL C;  1SA0 A;  4JZG A;  1Q81 W;  2JRI A;  3AG1 C;  5KMG A;  1GN6 A;  2ZDI A;  2YI9 A;  5C93 A;  5LOV B;  3MHH C;  1VF7 A;  3UM7 A;  1RPR A;  3HKC A;  3JYC A;  3RW0 A;  5CA3 A;  4X1K A;  3BAA A;  4FIP C;  1KYO F;  2UXN A;  3OMN B;  2ZE6 A;  4FM0 A;  1IBK O;  1QLE B;  2ZT9 B;  1CXZ B;  3SR2 C;  1FD9 A;  3OAA G;  3JTQ A;  4X8A A;  3GWO A;  3E83 A;  1R6N A;  4OXS A;  1TUB B;  3A2F A;  3ZN1 A;  2ZQM A;  4FFB A;  1OJH A;  1SS3 A;  2R9A A;  5GON A;  1YHQ V;  3HKE B;  3W7W A;  4LNU B;  4WKS A;  3ASN B;  4FFK A;  2KG7 B;  4O2B B;  3CCV V;  2RDC A;  3J81 N;  3LSQ A;  3TCU A;  5FNV B;  1VQK V;  3BY6 A;  1F4M A;  4X20 A;  1MZE A;  1M56 C;  2YUA A;  3ZCC A;  4LF4 O;  4CS3 A;  1BMF G;  2HEP A;  1Y6X A;  1BS3 A;  4YY3 O;  4JI7 O;  3P30 A;  4IHJ B;  4UB6 Z;  2E75 B;  5L3C A;  3L71 H;  3AEI A;  3AG4 B;  1OV9 A;  3PJS K;  4PJ0 Z;  3RYH A;  4GT1 A;  2IM9 A;  3JD3 A;  3SPC A;  5LMU O;  4NXN O;  2QM7 A;  3L75 H;  4J7J A;  3CJH A;  3SYO A;  3JAK B;  2Z5U A;  4I9W A;  5B3S C;  1N34 O;  2KKW A;  1HNX O;  2QDO A;  2RN9 A;  2ZNI A;  4PDM A;  3DSQ A;  4LFC O;  3SYQ A;  1GH6 A;  4FLX A;  4CZZ A;  4IYH A;  1QU7 A;  4FM1 A;  2ODM A;  3K06 A;  1FFX A;  2IJI A;  3OE7 G;  2Y4U A;  1K4D C;  4PI0 A;  1QVG U;  2F4V B;  3SPH A;  2PYL A;  3ABM B;  2HHH O;  2UU9 B;  1B06 A;  4JI8 B;  2LP7 A;  3RYC A;  3K58 A;  4WBN B;  2VS0 A;  3ZRW B;  2VWJ A;  3BA9 A;  4I55 B;  3APO A;  1NBM G;  3BEH A;  5CBH A;  3K59 A;  1XHZ A;  1HNW O;  3FAV A;  1GM8 A;  1OCZ B;  1Y76 B;  3HKD A;  2NR5 A;  4UVA A;  5CN0 A;  4PDR A;  2GV9 A;  4UCU A;  3E8G A;  1FJG O;  2E76 B;  2WLI B;  4GKJ O;  3QO5 A;  4NKG B;  4DV4 B;  1NKD A;  3GVM A;  1SER A;  1KQS U;  5L3G A;  1QR8 A;  1OCO B;  1WNS A;  3OUS A;  1XMQ O;  2VRZ A;  3FFQ A;  1OCR C;  4XBF A;  3QG5 A;  1GM9 A;  3WB2 A;  1M4U A;  4LR3 A;  3KCY A;  4X66 B;  1FXK A;  1SKV A;  4DV5 O;  1NR1 A;  4H33 A;  3W7U A;  1SET A;  4IL6 Z;  3RYF A;  3SYC A;  2LQT A;  4RUE A;  2HG5 C;  5FPR A;  1PL0 A;  1BE3 H;  4O4H B;  1R73 A;  5B5E Z;  5CB4 A;  3BPZ A;  1BQZ A;  2EJR A;  3SYA A;  4GX1 A;  2WA4 A;  2YC0 A;  3TJT A;  2QJ1 A;  2EIN B;  1XNR O;  4U3J B;  2P5O A;  2DW4 A;  1XRE A;  1TUE B;  2BTO A;  3P3P A;  3T1C A;  4JAA A;  1YF2 A;  1V55 C;  3GWK C;  1ORQ C;  3N2K B;  4YXW G;  2R70 A;  2GSM B;  4J80 A;  4DR7 O;  4BIU A;  1QNM A;  2P7T C;  1W59 A;  1E79 G;  3JAR B;  4YF9 A;  1JR9 A;  2QE7 G;  4TUY A;  1M5I A;  2Q68 A;  3ASO C;  3G6B A;  4QE9 A;  1UFI A;  4L87 A;  4X9Q A;  2P22 C;  1VF5 B;  3OR7 C;  4PA7 A;  2GUZ B;  4DW1 A;  4EFE A;  1VMG A;  4MVZ A;  1J95 A;  2OIG A;  4DR1 O;  1ZSP A;  1VQL V;  4PHZ A;  1GM7 A;  2JGU A;  4DR2 O;  4NXM O;  4OPH A;  2QTS A;  2XTA A;  1SQB H;  1JX9 A;  1SA0 B;  3E89 A;  2EZO A;  3FKS G;  5IY5 C;  5KMG B;  5EC1 C;  1GAX A;  2OTJ V;  2PGG A;  1H2K A;  1BSM A;  3H9V A;  5IYZ A;  5D5P A;  2LGW A;  1WB8 A;  2A0L A;  2RMK B;  4DV0 B;  4TQF A;  1KP3 A;  3K0D A;  2DWD C;  3IC7 A;  4GUN A;  4LF7 B;  3JD4 A;  3H1H H; 
#chains in the Genus database with same CATH homology
 4GX0 A;  1MG1 A;  4MTO A;  5CBF A;  2R9I A;  2ATK C;  1H38 A;  3JTR A;  3OM3 B;  2HVK C;  1F51 A;  3CYO A;  3E86 A;  4LP8 A;  2WLI A;  1BHB A;  3E2E A;  1K73 W;  5H9C A;  2Y48 A;  1GK1 A;  4JPR A;  1Q7Y W;  1MAB G;  1HWY A;  3ML0 A;  1K4C C;  1W2B U;  1GK0 A;  4RQF A;  1VQ8 V;  2XAJ A;  1S0V A;  5IY5 B;  4HST A;  1Q82 W;  3OGC C;  1E3A A;  3IFX A;  1ROP A;  4JTD B;  3STL C;  2QTO A;  2IJJ A;  4WCE V;  4QIW F;  4R7C A;  4WKT A;  5FL7 G;  2WLL B;  1CP9 A;  4RQE A;  4FPP A;  1AJQ A;  4PA9 A;  4QJF B;  2NNU A;  3AG1 B;  5HFM A;  2CK3 G;  1QCE A;  4KFM A;  2QM8 A;  2EIK B;  1W0K G;  5E1A C;  3LSS A;  4X89 A;  2YEV B;  1XL6 A;  3QO7 A;  5KA5 A;  2W6J G;  1AI6 A;  1K9M W;  1VQ6 V;  2EIL C;  1F23 A;  4GX2 A;  2HR3 A;  2XAS A;  1YTF D;  4YFA A;  3CCU V;  3ZRV A;  1VQ7 V;  2EIM C;  2EBO A;  3ZMS A;  3TET A;  3B8M A;  3LDE A;  1YIT V;  3K79 A;  1FS0 G;  4BIZ A;  3K0G A;  5B1O A;  2X6C A;  5EK0 A;  3ETE A;  3CMA V;  3AG2 C;  1ZWI C;  5IYC O;  2QKS A;  1VQ9 V;  1VQM V;  1GK9 A;  4R50 A;  2ZR3 A;  3CCS V;  4ZBM A;  1OCC C;  3D3I A;  3LDD A;  2BOB C;  3WG7 C;  2DYS B;  4E57 A;  3MD0 A;  4WFB V;  3K03 A;  2M7W A;  2B1G A;  2XAQ A;  4G27 B;  2HJF C;  2IU3 A;  4N23 A;  5B1B C;  2V1D A;  3JD2 A;  2AE4 A;  1KD1 W;  4UV8 A;  3G6E V;  1BHA A;  2UXX A;  5L3B A;  1PNL A;  2JIZ G;  1QR9 A;  2EZP A;  1W0J G;  3OMI B;  4I5S A;  2IW5 A;  5DN6 G;  1Y66 A;  1NH2 B;  3CCL V;  2EIL B;  5EBM C;  1K33 A;  2XOK G;  2QA4 V;  3LNM B;  1OR0 A;  3FB8 C;  1VQO V;  3SJQ C;  1V54 C;  2Z3Y A;  1CPY A;  4PA3 A;  4MVM A;  1B6Q A;  3OFN G;  3VBB A;  1SRY A;  2EIM B;  4RAI A;  1P4R A;  1I5X A;  2A9H A;  4JTA B;  1NQT A;  5J9P C;  4MVR A;  5IYD O;  3JD0 A;  1Y4M A;  1FXK C;  3S8R A;  3ZMV A;  3AG2 B;  4JAV A;  1IXM A;  1E1Q G;  1VQP V;  1M57 C;  3HPL C;  3R65 A;  4G28 B;  4LBE C;  1M9N A;  2ZD9 A;  3JD1 A;  4N21 A;  1OCC B;  2A79 B;  5IDJ A;  4E2L A;  1S5H C;  4XDJ A;  4LCU C;  5KUK A;  1JVZ A;  4K2G A;  2AHZ A;  5LHI A;  1ARO P;  3KG2 A;  4PDL A;  2XND G;  4PDV A;  1EFR G;  4Z1M G;  5LHH A;  5B1B B;  1MSW D;  2EIJ C;  4PA6 A;  3CME V;  5EBL C;  1Q81 W;  2X0L A;  2DQ0 A;  3OMA B;  3RVY A;  1FXV A;  3AG1 C;  3MHS C;  4QPJ A;  4XDK A;  1K7D A;  3DGE A;  2WYB A;  2ZDI A;  3X2Q C;  4MSW C;  5B3S B;  5C93 A;  4UUJ C;  1V54 B;  3MHH C;  3OR6 C;  4WFE A;  3UM7 A;  1K5S A;  4CBC A;  2P90 A;  3CC4 V;  1RPR A;  2R9R B;  3LDC A;  4JYC A;  4KP4 A;  4JAS A;  4BW5 A;  3JYC A;  2IH1 C;  3RW0 A;  1EBO A;  5CA3 A;  4FIP C;  4MTF A;  1KP2 A;  3CP1 A;  2UXN A;  4P30 A;  2OCC C;  1FXK B;  2HVJ C;  4MVU A;  3OMN B;  1FM2 A;  1SES A;  4KUM A;  4K2F A;  1JPX A;  1EZJ A;  1M57 B;  2B1I A;  1FFT B;  4WFA V;  3F5W C;  4TSF G;  3QO8 A;  1CEZ A;  1QLE B;  1NH2 D;  3OAA G;  1Q86 W;  2DYS C;  3JTQ A;  1MOF A;  2WLN A;  4X8A A;  3GWO A;  1G8M A;  3CCJ V;  4JGS A;  4E56 A;  3EHB B;  3E83 A;  2EIJ B;  1R6N A;  4OXS A;  3G71 V;  1AJN A;  1KC8 W;  3ZRS A;  3L94 A;  1R3I C;  3E8B A;  3ZN1 A;  2Y69 C;  2ZQM A;  4UVC A;  4R8C A;  1YHQ V;  3W7W A;  4FJC C;  5IYB O;  4WKS A;  4E55 A;  1JVM A;  3ABK C;  4JTC B;  2JK5 C;  3B77 A;  3ASN B;  1K3E A;  3ETG A;  1R3J C;  1THZ A;  2P67 A;  3FB6 C;  4ZKI A;  3CCV V;  3X2Q B;  1NJI W;  3LSQ A;  4BAY A;  2W6I G;  3OUF A;  3TCU A;  2WLH A;  1K97 A;  4QPK A;  2WLL A;  3BY6 A;  1VQK V;  3K3W A;  1VQ4 V;  1F4M A;  3SRC A;  5L3D A;  1GKF A;  1M56 C;  2WSS G;  5H6Q A;  2XAH A;  5KUM A;  3ZCC A;  2HKO A;  2ZXW C;  3ZMT A;  1NVP B;  2OCC B;  1BMF G;  2YEV A;  1DTO A;  1RPO A;  1ENV A;  3EFF K;  4UXN A;  3T2M A;  3SRA A;  4PEM A;  2XAF A;  4MW8 A;  1OZ0 A;  2WLK A;  4HYO A;  3P30 A;  4DXW A;  1VQN V;  4WKU A;  3CCM V;  1GMG A;  5L3C A;  3CXC U;  2ITC C;  4MVQ A;  1M1K W;  1OCR B;  3AEI A;  3W7T A;  1S77 D;  3AG4 B;  2KB1 A;  3ABM C;  3PJS K;  1OHH G;  3SPI A;  2PI5 A;  2P6J A;  4JYB A;  2Y69 B;  4GT1 A;  3JD3 A;  3NXS A;  2DQ3 A;  3FB5 C;  4RO2 A;  3SPC A;  4PEL A;  5L3E A;  2QM7 A;  3ABK B;  1BL8 A;  2X7R B;  5EBW C;  3SYO A;  4G2K A;  4X88 A;  4MTG A;  1S72 V;  2QEX V;  4I9W A;  2Z5U A;  5B3S C;  3CD6 V;  1I5Y A;  2B5U A;  3SPJ A;  3FYI B;  3M99 B;  3I55 V;  2K1E A;  2AE5 A;  1K34 A;  2Q67 A;  4PDM A;  3CCQ V;  1K8A W;  1OCZ C;  3SYQ A;  1M56 B;  3JCZ A;  1GHD A;  4J9Z B;  1PNK A;  2ZXW B;  1YJN V;  1RM1 C;  4MTX A;  1E1R G;  4CZZ A;  1JQ0 A;  1PNM A;  2YSU B;  1KKD A;  5LBQ A;  3CPW U;  3K06 A;  5HFL A;  2IJI A;  3OE7 G;  1K4D C;  3AG3 B;  1LNQ A;  1QLE C;  1QVG U;  3GB7 C;  2LFR A;  1JCH A;  3CCR V;  1YJW V;  3SPH A;  3ABM B;  2AE3 A;  2NLJ C;  3I56 V;  4MW3 A;  2DYR B;  2LP7 A;  3L91 A;  1DF4 A;  3ZRW B;  3K08 A;  3OW2 U;  2WYE A;  2Q69 A;  4HAM A;  3ASN C;  1NBM G;  3BEH A;  5CBH A;  5B1N A;  1YTF B;  2IJH A;  4GCZ A;  4DO2 A;  3ASO B;  1XL4 A;  5L3F A;  2WPD G;  4JF3 A;  4XDL A;  1G4Y B;  1GM8 A;  1OCZ B;  5GW7 A;  1WPX A;  5CN0 A;  2GHY A;  4GX5 A;  1R3K C;  4UVA A;  4WKV A;  4PDR A;  2EIN C;  4MVO A;  1RM1 B;  2IJK A;  3E8G A;  4EKW A;  1FXH A;  2WLI B;  3QO5 A;  1NKD A;  2XAG A;  2H8P C;  5BZB A;  4MT8 A;  1SER A;  3ZN0 A;  1KQS U;  5L3G A;  1QR8 A;  1OCO B;  2WLM A;  2JJ1 G;  3OUS A;  4TWK A;  4MS2 A;  2FTK A;  3CCE V;  1H2G A;  3OEE G;  5B1A C;  2F43 G;  2HFE C;  4MVS A;  3TK1 A;  3WFV A;  3ZJZ A;  3CC2 V;  1OCR C;  2C2A A;  4WF9 V;  3AG4 C;  4XBF A;  1H8E G;  3UKM A;  1GM9 A;  2WAM A;  2ZR2 A;  1FXK A;  1K5Q A;  5H6R A;  3SRB A;  1NR1 A;  2WWW A;  4H33 A;  2W0F C;  3FB7 C;  2BOC C;  3ETD A;  3W7U A;  1SET A;  4P9O A;  4ASU G;  3IGA C;  3SYC A;  1UJW B;  4RUE A;  1YJ9 V;  2HG5 C;  1PD3 A;  1AJP A;  4U7N A;  1NR7 A;  1PL0 A;  4HSR A;  1R73 A;  4U7O A;  3DTU B;  2EJR A;  3SYA A;  4GX1 A;  3SPG A;  4TT3 G;  1P7B A;  1QBZ A;  1AI4 A;  2EIN B;  1GO3 F;  3H01 A;  4P9P A;  3ABU A;  1DLB A;  4J9Y B;  1M90 W;  4H37 A;  3K04 A;  2DW4 A;  2V7Q G;  1TUE B;  5CMU A;  1VQ5 V;  3HB3 B;  1K92 A;  3T1C A;  5B1A B;  1F4N A;  4PA4 A;  3SYP A;  3AG3 C;  1V55 C;  3A0R A;  1N8R W;  2X6B A;  1ORQ C;  3RVZ A;  4YXW G;  1AR1 B;  3ABT A;  1QVF U;  3CC7 V;  3LUT B;  2HLD G;  2GSM B;  2DYR C;  4JAU A;  3FYE B;  4QE7 A;  4RUF A;  2Q6A A;  2JJ2 G;  1JOY A;  4BIU A;  3F7V C;  3P32 A;  2P7T C;  2AHY A;  1E79 G;  2OTL V;  4YF9 A;  2QE7 G;  3ZIA G;  1PKX A;  1SZT A;  2Q68 A;  4WFH A;  3RBZ A;  3ASO C;  2ZDI C;  4QE9 A;  5DM6 V;  2WYC A;  2LFS A;  2DWE C;  4P2Z A;  4L87 A;  3T4D A;  3B8N A;  1L1F A;  3OR7 C;  4R6Z A;  4PA7 A;  1H8H G;  2X6A A;  2JEU A;  3ZMU A;  2ITD C;  2IH3 C;  3ABL C;  4LC1 A;  2MK3 A;  4MVZ A;  2OT5 A;  1J95 A;  5EC2 C;  1DF5 A;  4FMT A;  3T4Z A;  5LGU A;  2H94 A;  3K9A A;  1OCO C;  2IU0 A;  4WFG A;  1R6K A;  1VQL V;  3E35 A;  4HZ3 A;  3W7X A;  4UVB A;  3E8H A;  1V55 B;  1KEC A;  1GM7 A;  3STZ C;  3ZRX A;  2WLJ A;  3G4S V;  3ZMZ A;  5LGN A;  3W7S A;  2JEX A;  3D36 A;  1YI2 V;  2JDI G;  3F7Y C;  4YFB A;  4QNH B;  1WLE A;  1JX9 A;  1QLN A;  4FK5 C;  1AI5 A;  1NVP D;  1S76 D;  3E89 A;  2EZO A;  1YIJ V;  3FKS G;  3OEH G;  5IY5 C;  2D3O W;  4WFF A;  2PI4 A;  5EC1 C;  1R3L C;  2ADV A;  2OTJ V;  1GTO A;  3WG7 B;  4Q20 A;  1AI7 A;  3QNE A;  4BTH A;  3VOU A;  3E8F A;  5CBG A;  4UV9 A;  3ZRW A;  2A0L A;  1S3J A;  5KA6 A;  4M1J A;  4F4L A;  1JW0 A;  1KP3 A;  5LHG A;  3ABL B;  2WYD A;  1JJ2 U;  3K0D A;  2DWD C;  1COW G;  2EIK C;  1YSC A;  3IC7 A;  1KEH A;  5LGT A;  3JD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...