3K3WA

Thermostable penicillin g acylase from alcaligenes faecalis in orthorhombic form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin G acylase
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
molecule tags Hydrolase
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k3wA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3k3wA01
1E3AA 1K5QA 1GK9A 1PNKA 3JTRA 1AI5A 1AI6A 3SRCA 1FXVA 2AE5A 1GHDA 4PELA 1JVZA 2ADVA 4YF9A 3SRBA 1AJNA 1GK1A 1AI4A 1K5SA 4WKUA 3ML0A 4M1JA 4YFAA 2WYEA 4YFBA 1JW0A 4E56A 4K2GA 1JX9A 1FXHA 4WKVA 1OR0A 1GK0A 4WKSA 4E55A 1GM7A 3L91A 4E57A 1GM8A 1H2GA 2AE4A 4HSRA 2AE3A 1KECA 2WYCA 1K7DA 4WKTA 3SRAA 1AI7A 1FM2A 2WYDA 3S8RA 1PNMA 2WYBA 1AJQA 4PEMA 1PNLA 1AJPA 1CP9A 1KEHA 3L94A 1GM9A 1GKFA 4BTHA 3JTQA 4HSTA 4K2FA 3K3WA
chains in the Genus database with same CATH superfamily
2YIDA 1XI1A 5B66Z 1BGYH 5EC2C 3Q4HA 2YSUB 1QNMA 3S3XA 2R70A 4ZKIA 2OTLV 4ZI7A 5EYPB 1OCOC 2B1GA 3UT5B 1VQ5V 4X64O 3ZJZA 3K06A 4NXMB 4BAYA 4H37A 4J80A 4DR4B 3E8BA 1H38A 3TJTA 3CCMV 1MSDA 4O4HB 2WAMA 4LF4O 3B8MA 4JI4O 4NTXA 2GUZA 3FB8C 1V54C 4KHPO 1GK1A 3L9DA 4WFHA 2BCCH 4YFBA 2JVDA 5L3FA 1MMMA 4HNAA 2CTRA 2LGWA 1JOYA 2X6CA 3JASB 3UM7A 5LMNO 1PKXA 4CZZA 3W7WA 2UUBO 2V1DA 4I9QA 2QSAA 4JI8B 4JYBA 1MZFA 1GK9A 5JVDB 4B3TO 2CTPA 1L0LH 1QLEB 3WU2Z 2ODMA 2JGUA 1L0NH 1PPJH 1XL6A 1XNRB 5J2TA 2ZE6A 4DYLA 4CC6A 4JAUA 2L35A 5IYZA 1K7DA 2LW7A 3CX5F 3AG2C 3W7UA 5FLXN 4DV4B 4PA6A 4DK0A 3ZRSA 2ZIMA 1AP5A 4QNHB 1YI2V 1J5EO 4BWCA 3R65A 2HHHB 1NVPD 3A0BZ 4LFAO 1NZ6A 3ML0A 3N2KA 1HNWB 1ROPA 3ZCCA 3TK1A 2YXLA 4LFCB 1HNXO 3J81N 2RJZA 2Y4UA 1BT8A 2HKOA 3SPGA 1JJOA 4BR6A 1S76D 3ABTA 1WA8A 4PDMA 2WLIB 3L71H 5J2UA 3OUFA 4DR2B 1KKDA 1HNZO 1FFTB 1TAEA 4KP4A 4DUZB 4IIJB 1Z5WA 2WYEA 3HKCA 3IC7A 1JFFA 4HSRA 4I50A 2EZOA 3CRCA 5IWAO 4ASUG 1AR1B 3J7AU 3OEHG 4FLVA 4X65O 1KUQA 1GTOA 5B3SB 5IJ9A 5LA6B 1VEWA 1E1QG 4MSWC 2N74A 1COWG 5JCOA 4X1IA 3G71V 1JCHA 3H1KH 4MTOA 3DGEA 4F6EA 5KHKA 1F7YA 3DXRA 4DR7O 3SR2C 4KL1A 2DYSB 1IURA 1I94B 2Y0IA 2Q7EA 5HFMA 5EIBD 1BL8A 2UXNA 1KU9A 2V7QG 2WLMA 2XAQA 4LWSB 5JQGB 3RN4A 1FJGB 4DV5B 5IJ0B 2PI5A 2YEVA 2RDCA 4JI2O 4JPRA 3HKDB 2D3OW 1SC5B 1S3JA 3CEIA 3S8RA 2BTQA 4X88A 3AEIA 4W4KA 3FB6C 1H8HG 4PA3A 2OCCC 4F6RB 4LH7A 4X9QA 4JI5O 3DTUB 3VQWA 4DR5B 5IT9N 1E3AA 1QQCA 4I0XA 2V4DA 1VP7A 4H0LB 4M1JA 3LNMB 2OT5A 3WFVA 1PM9A 2YS8A 4DV0B 5IY5C 1YCIA 1TVKB 3N2GB 3T1CA 2KKWA 3E8GA 3ZRWA 4YJ3B 3M7MX 4DRXA 1XHXA 2JS3A 1FXVA 5LHHA 4HAMA 1YDXA 1JQ0A 3CYOA 3JSLA 2NNUA 4BIUA 1NBMG 1VQPV 1Z2GA 2ITCC 2E75B 1Y66A 4FM1A 5IDJA 2QWPB 3JCZA 5D5QA 2VQEO 2DW4A 4O4JA 1S77D 3FYIB 1K4CC 3FAVA 3BCCH 1DF5A 3BFRA 4YY3O 1M5IA 2EIJB 3K04A 1XILA 4LF9B 2O57A 1QVGU 1DF4A 1GN4A 1RPRA 5EBMC 4AILC 4PA7A 4J41A 3SPJA 1Q7YW 4WFEA 2WLJA 3L73H 2ITDC 5LHIA 2P5OA 1XDCA 4IHJA 4DK1A 3CCEV 1YZBA 5BMVA 3I56V 5L3CA 3RYFB 1NTKH 3QO8A 2XAGA 4WKTA 1SQVH 1R6NA 1K33A 4P2ZA 5CA1A 2CGOA 4X64B 3ASNB 3SJQC 1CP9A 1SETA 4C7UA 2ATKC 4U7OA 4UCOA 1SZTA 4LF4B 4JI4B 4KHPB 1AVMA 3CWBH 4MVMA 4MTGA 4NKGB 4Q20A 4YJ2B 4YFAA 4FIPC 1N33O 1YTFD 1URFA 3HB3B 2QM8A 2Q7HA 4CH3A 3K59A 1RM1C 3OGIB 5LMNB 2MK3A 3MAQA 3ZHVA 2UUBB 1VQ4V 4NTWA 4FFBB 5LGTA 4B3TB 5K1PA 1KMIZ 2XUMA 3CPWU 3RYCB 4O4LA 3QTCA 1M90W 2JIZG 2ETNA 1QVFU 1KBHA 2P6JA 1Q3EA 2FB5A 2FYUH 1NT2B 4MVSA 5B1BC 1YJ9V 4JYCA 1SA0A 2M6YA 2ZE8A 2JJ2G 1E1RG 1J5EB 4MT8A 5TISZ 4HYOA 3H1IH 4PELA 3UO3A 1VMGA 4LFAB 4IL6Z 1G1XB 1Q6UA 3SJAC 4H44B 3OM3B 1DK1A 2YC0A 2VQFO 4GKJO 1NU1H 4UCVA 3ABKC 2QWOB 4AHCA 1KB9F 3OFNG 4TV9A 1HNXB 5KHIA 3R66A 1DGSA 4J7ZA 3ICXA 1YJWV 1JR9A 1ZL8A 3K08A 1AB3A 4Z1MG 1TGOA 1R1BA 3AG7A 1HNZB 4LH6A 1B06A 1VF7A 4OGQB 2WLHA 3T1YO 4ZI7B 4EFEA 3E22A 3CE2A 1PL0A 3D36C 1YITV 5IWAB 4B3SO 4UUJC 4FLXA 1AROP 1EFRG 4X65B 4K3AA 2GUZB 4HSTA 4WFGA 4B3RO 1O9HA 4UCRA 3K5OA 1AI4A 2QDOA 1PP9H 3ZIAG 2ZIOA 5GTIZ 1KQSU 3SDLA 3WG7B 3ZHTA 3JATA 4PI0A 4R6ZA 5LL6Y 4DR7B 4X1YA 1AP6A 1OCZC 1RSOB 3SPIA 1AJQA 1B6QA 5IYDO 3U11A 4FLTA 2JDIG 3KCYA 2HJFC 1D5AA 2UU9O 4D7TA 2QWQB 3WB2A 2QKAA 2W6JG 4YIPA 5J2TB 1HDJA 1XOUA 3G4SV 1NI8A 4JI2B 2DMXA 1OR0A 1R73A 3F7YC 1H2GA 4OPAA 2IJKA 1V54B 4LNUB 4PA4A 3ZX6A 1SESA 1XQ8A 4CH6A 3CCQV 1NQTA 1SQGA 4TSFG 5EIBC 4JI5B 3VOUA 3W7SA 2ZNIA 4J7KA 3P30A 3N2KB 4GUNA 2IH1C 3OUSA 2YUAA 1VQNV 1OCCB 4YIOA 1GK0A 5A2QN 1GM8A 3L74H 2CGNA 4ICGA 1WA8B 2XAJA 3RBZA 5J2UB 4UFZA 5ITZA 1NR1A 2A79B 2C2AA 2E5LO 2MW2B 3OD4A 3HKCB 1GRJA 2K9PA 2YIBD 2EJ7A 2WA4A 3OR6C 1JFFB 2KG7A 4CS2A 4I50B 2HVKC 3BA9A 4PHZA 5GONB 4BIZA 4RUEA 4UCTA 2QA4V 1F51A 1IZ3A 1JVMA 2NN4A 2WYDA 3AG1B 4JF3A 2EX3A 2VQEB 3CCLV 2BSKA 1HP8A 1SS3A 5IJ9B 3A0HZ 1BS3A 3GB7C 3A0RA 1YVWA 4X1IB 4JAAA 3TETA 4YY3B 5LXTB 3DXRB 5B1AC 5LYJA 4WKSA 4J10A 1Q43A 1MNGA 4JI6O 1FXKC 3IAYA 2UUAO 1A32A 4O2BA 1M1KW 3GWOA 3FYEB 1IBKO 3CJHA 2WSSG 3VQVA 3AK1A 1FM2A 1N32O 3L75H 5CA0A 2QEXV 2YEVB 1I5YA 1RP3B 5GTHZ 4X20B 2PYLA 1F23A 4NYKA 2ZR2A 4GCZA 4JV5O 1FAFA 4JTAB 3SYCA 2BTQB 4G27B 2ZM6O 2N05A 3JAMN 3L94A 5IE9A 2F4VO 3CXHF 4XDKA 4LFBO 2DE0X 1PNKA 3P3PA 1OV9A 1FXKA 1SQBH 3DSQA 4DUYO 1YEWA 1YXBA 1N33B 1FXHA 4FMTA 1W2BU 3EXAA 4PA9A 2OCHA 3ZHQA 3KCXA 3D8CA 4DO2A 1PNMA 5BXZA 3ZMTA 1QR8A 3N27A 3C3SA 2W0XA 5LGNA 4K8XA 3JSNA 1H2NA 1PL4A 1JVZA 3JAKA 3BVOA 3UCSC 4GLXA 1VIBA 4E55A 4MTXA 1CPYA 4ZBMA 1MSWD 1UPGA 2P7TC 4O4JB 4UV9A 4EB6A 3I55V 4NTYA 4PDRA 4K2FA 1K8AW 2WLLB 3JD0A 4AQYO 4R7CA 3U10A 4TQFA 5LP6C 3FB5C 3JARA 5EZYA 3FX7A 3JD4A 2Z0AA 3SJBC 3E83A 2VQFB 4GKJB 1LR1A 1IX9A 3LSQA 3OW2U 3AG4C 3WB0A 4X8AA 1NTMH 4X62O 2IJHA 2A7WA 4IHJB 2UXCO 4RO2A 1GKFA 5KAFZ 1BCCH 5KX5A 1YF2A 3MHHC 5BMVB 4I5SA 2LFSA 5L3GA 2EINC 2EIKB 2YDEA 4QPJA 5CBGA 4WKUA 2AW9A 3T1YB 3FKSG 1Q6IA 1KD1W 2BOCC 5CA1B 1ZSPA 1N36O 2Q73A 4JTCB 3GWKC 3G80A 2GV9A 3CXCU 4B3SB 3K0GA 1MOFA 4P9PA 3X2QB 2WA3A 2RMKB 3LSSA 1VF6C 4AI8A 5LP6A 4PI2A 3D3QA 3RVYA 4B3RB 3NR7A 2CTQA 2ZD9A 3QF7A 2CE4A 4EKWA 5BZBA 3STZC 1YIJV 4TOIA 1G8MA 2EIMC 3B09A 3HR0A 3T4DA 2YXYA 3CB2A 3BRCA 1K73W 2P4VA 2UU9B 2ILMA 4U3JB 3CRRA 5IYBO 3ABLC 4H33A 1XMQO 4O4LB 2RN9A 1R6TA 4DV3O 4R8CA 1BMFG 5E79Z 1M56C 4NB5A 2BTOA 3CRMA 3E2EA 1VF6A 1XUQA 2XAFA 2DOSA 1SA0B 4LR3A 2P06A 5FNVA 2W0FC 3SYAA 2PY5A 4FLUA 4JI7O 3O9OA 1VQ9V 2EZPA 2H8PC 4XBFA 1CEZA 4DV6O 4OPHA 5J9PC 1VQ6V 1AJNA 2FMLA 1U97A 3SYPA 2DN9A 5B5EZ 4O2AA 5CA3A 3JD3A 4FFKA 4CS3A 2KB1A 2KSDA 1WN7A 3RYIA 2LGQA 3L70H 3KZIZ 2WPDG 5KA5A 1VQLV 1BHAA 4O4IB 3BHPA 2UXBO 2Y69B 2E5LB 1THZA 2PUSA 2R9IA 1J95A 1JX9A 5CB4A 4GX1A 4DXWA 4E57A 1OCRC 1B04A 4QJFB 3K9AA 2JGDB 3JYCA 3P3NA 5FL7G 1G4YB 3UQ8A 3JCUZ 1NTZH 1E79G 5E1AC 1ENVA 1VQKV 2P22C 4TWKA 3CCJV 2VS0A 4WBNB 3JATB 5JJNB 2HP8A 5L3BA 4JI1O 5C8YB 4X1YB 1LUVA 2QKCA 2GHYA 4JI6B 1WP7A 5EYPA 4GYCB 2UUAB 1QLEC 1PNLA 1SF9A 2L6LA 1IBKB 1Y76A 4NXNO 2A3QA 3APQA 4LBEC 2BE3A 4GX5A 1N32B 2RNBA 1AI5A 2WLNA 4GZRB 2GTAA 5LHGA 3OE7G 4KFMA 4MW8A 1BQ0A 4ZHQA 2YICA 5DECA 4JV5B 4F4LA 2ZQMA 2ZINA 4DV7O 3EFFK 4TT3G 2ZM6B 1NKDA 5EC1C 2ZXWC 2ZKOA 3K5MA 1VQ7V 2VWKA 3CD6V 3OEEG 1ZX3A 2F4VB 1OCZB 3JALA 1O9GA 4LFBB 1GAXA 2ZR3A 1CXZB 4UCSA 2F66C 2B5UA 5JVDA 4GT1A 4FLZA 2DJVA 4DUYB 3F7VC 1EM1A 2OWOA 2R9AA 2WWWA 3AG3B 5ITZB 4RQEA 3QVNA 3PN1A 4IGGA 4MVUA 3ABUA 1Y74A 2UXDO 1Q90D 3ASOC 4J11A 4RAIA 1RFYA 1WB7A 1KC8W 3L72H 1P84F 4YXWG 2LQTA 3LDEA 2Q69A 1JJ2U 5JWPA 2DYRC 1BE3H 1LNQA 3BEHA 4LF7O 3CP1A 3HKEA 2LW1A 5B3SC 3NXSA 2BSKB 2A06H 2X6AA 3THOA 1KEHA 4XDLA 4TUYA 1L8DA 1GM9A 1Q5OA 4RUFA 3H1LH 1W59A 1ZTEA 5LYJB 2QJ1A 1XL4A 2F93B 1Y6XA 1GN3A 3LDDA 4AQYB 2QM7A 3A2FA 1OZ0A 1IBMO 2BOBC 4H13B 3T1HO 4X62B 2B9ZA 2UXCB 1AILA 2AZ2A 1BQZA 1WPBA 3K0DA 2NR5A 1TUEB 4Q6GA 1NJIW 3FGRA 1H2SB 4N21A 3RGBA 4U7NA 4MVOA 4YHHO 1GM7A 3TCUA 3CCVV 2JRIA 1N36B 2EBOA 1M9NA 5B1AB 2Y48A 2AZ0A 3LDCA 1HW7A 4WFBV 3U0ZA 2ADQB 3Q4HB 2Z5UA 5HFLA 2IJJA 1P49A 4Z1VA 4FJCC 3B4SA 5BR8O 3G6EV 3FB7C 1SKVA 3HKDA 4X1KA 1MA1A 3H1JH 1H2MA 3IJ4A 1K34A 1B3QA 1I0HA 3OMIB 1SQPH 2EILC 3AK3A 2YIAA 4HZ3A 5FPOA 3JAKB 5B1NA 1XMQB 3TXSA 4HNAB 5H6RA 4CH4A 4DV3B 1IVSA 4I7ZB 4W4LA 2M7WA 1W0KG 2EIJC 4DW0A 1TVKA 4JI7B 4YJ3A 4FLYA 3MHSC 1OCOB 3RFRA 4FVMA 4DV6B 1BHBA 1XEQA 2AE5A 2E3CA 3D36A 2CUGA 4UXNA 3JARB 5EZYB 5IYZB 3IFXA 1JMKC 4ZOLA 4CBCA 2FL4A 2H94A 1F4MA 5KX5B 2Q0AA 4BWAA 2LP7A 2UXBB 1WB8A 1X4TA 2XT9A 4E4EA 2IH3C 4B08A 1R3JC 2QE7G 1JW0A 1ORQC 2Q8VA 1PV0A 1WAZA 4JZ2A 3A8TA 4TQDA 3VBBA 2HVJC 1NS1A 1IXMA 4DV2O 3AG2B 3AG4B 4IYIA 2AXTZ 1YSCA 3SPHA 2B1IA 4JI1B 1UJWB 4WKVA 3F5WC 2R9RB 4I55A 3CCUV 4MTFA 4NXNB 4JASA 1Q6HA 2ZE7A 5IYCO 1R3KC 2ZE5A 2X6BA 3B2EE 3QG5A 3K5LA 3ETDA 3CCSV 3BPZA 4K8ZA 2ZNJA 3ZN1A 4KUMA 4E56A 2X0LA 4JI0O 2EULA 1VQ8V 2P90A 5FNVB 4DV7B 1R3IC 3VQXA 3AK2A 3BY6A 2WYBA 4X89A 1M57C 4DR6O 1OHHG 3ABMC 2EIMB 3IGAC 2E74B 1P7BA 1WP8A 3K5NA 2Q0OC 2JS5A 1T5EA 4LF5O 4O2AB 3OMNB 1SQXH 3ABLB 3RYCA 4I9WA 3RYIB 3ETGA 3KKYA 2UUCO 3K58A 4MVRA 5H2FZ 3RYHA 1M56B 2XNDG 2UXDB 4Z2WA 1XREA 3M99B 4I0XB 3STLC 3UO2A 5CB4B 5C93A 3FFQA 4TV8A 4ZIBA 4I4TA 3CMEV 3F5TA 1K3EA 3CMAV 4PDVA 4WCEV 1Y4MA 4LF7B 1P4RA 3ZRWB 2EJRA 3IC9A 2E76B 4DRXB 3QO7A 2IJIA 3I5DA 1H8EG 4FM2A 4MVQA 2OCCB 3CS5A 5DM6V 1QR9A 2QWRB 2GTSA 3BAAA 4FPPA 2AE3A 1IBMB 3E8HA 3T1HB 1Y76B 3QNEA 4LF8O 1SQFA 1N0JA 1OCRB 4FK5C 3TXQA 3FAVB 5IY5B 4KXRA 2HLDG 5KHHA 4ZHQB 4GX2A 5KHJA 1Y67A 3RVZA 5EBWC 5JJJB 4DR3O 1N0NA 4YHHB 3L91A 1HR0O 2QR4A 2LO1A 5CBFA 2YXHA 1RSOA 2AHYA 4FM0A 3JALB 1UFIA 2Q9LA 1IBLO 4QE9A 1OCCC 4LF6O 1G6UA 3VQYA 2JEXA 4R50A 2FTKA 2ZCEA 1D5NA 4UB6Z 2ADVA 3W7TA 1WLEA 1R3LC 1GH6A 3B8NA 1H2KA 3ZHRA 3O65A 2HJDA 1MABG 3KG2A 4QPKA 5KA6A 1FFXA 3C90A 5KLVH 5BR8B 1S5HC 1IDSA 4LNUA 1Y74B 4K35A 1I5XA 1LUWA 1ZLZA 1ZUQA 2F43G 2X7RB 1QHTA 4JGSA 4LC1A 2IU3A 4XDJA 2ZXWB 1SERA 2DWDC 3JAWA 5L3DA 3AG1C 1TA8A 2QTSA 1TUBA 3HKEB 2JJ1G 4DR1O 1KP3A 5LOVA 5JCOC 1AI7A 2Y4TA 4TUYB 2PGGA 4K0KO 1V9PA 3FGTA 4G2KA 1XBLA 3K57A 5KMGA 1QLNA 1K9MW 2GBOA 5LMUO 2KQXA 1ZAUA 3LNNA 4NR1A 1K92A 3ASOB 4GKKO 4ABMA 2RCVA 2FKXA 3E86A 4WFAV 2PZSA 5GONA 2ARHA 2DQ3A 3K03A 5DN6G 4WF9V 4EFBA 2P4KA 2QM4A 1FD9A 5D5PA 5KUKA 3OTFA 3T4ZA 4BW5A 2DYRB 5JH7A 2RQ6A 2WLKA 3ZHUA 4JYAO 3SRBA 1RPOA 1RM1B 4JI3O 4CS4A 5F2VO 5LXTA 1KKCA 4RWUA 4JAVA 1BZKA 1V55C 3T2MA 4NVPA 4TV9B 3SJCC 3GVMA 1EN4A 1ZL8B 4QGPA 4PV1B 2PF4E 1GN6A 3OAAG 4DV2B 4CH5A 4IT5A 3UKMA 1DTOA 3ZBHA 1M4UA 2HG5C 5B1BB 5CBHA 1Q8IA 3E22B 3SYQA 2UXXA 3ETQA 1SQQH 4X20A 4JZGA 3QO5A 4X1KB 2CH7A 2PTMA 5DEDA 5L3EA 1KYOF 3HKBA 4UVCA 1S72V 4BTHA 3HPLC 3ABKB 2P67A 4PD4F 1K5SA 1Q82W 4B7EA 2F1MA 3MDSA 1XNQO 4JI0B 3OGCC 5GW7A 1NVPB 1M93A 2QWNB 2NLJC 2AHZA 2R72A 3UT5A 4DR6B 3OTOO 3ZMUA 1VQMV 1K5QA 4OX9O 1AR5A 1F4NA 4O4HA 3J80N 2Q7GA 4LF5B 2EILB 2HEPA 3MD0A 4ZOLB 5JJEB 2LFRA 3H9VA 2UUCB 2VWJA 3CRQA 2EIKC 4D6TH 4UB8Z 2YIBA 3JASA 1XMOO 3JTQA 2GSMB 1KP2A 3ZMSA 2HR3A 4B3MO 1DLBA 2Z3YA 5KAIZ 2WLLA 4DV1O 3X2QC 1GN2A 3E8FA 4X66O 4LP8A 1BSMA 2XAHA 3EHBB 4PEMA 3E35A 4LCUC 1AJPA 2A9HA 5LGUA 3WB1A 4CC5A 1NR7A 1FS0G 3JD2A 2AGAA 1NH2D 2CK3G 2KG7B 4P9OA 3OR7C 2Q67A 1EZJA 1D2DA 4JTDB 4HBNA 4I55B 3K79A 1S5JA 3B40A 1QU7A 1N34O 4UVAA 1EZVH 2N04A 4LF8B 2F95B 1VF5B 3CC7V 4P30A 1AR4A 2JK5C 2Q6AA 5BY1A 1MG1A 2OIEA 3SYOA 4FZ1A 2WLIA 2A0LA 4OXSA 5KUMA 2DYSC 2H3OA 1SRYA 4DR3B 2Q4PA 4IIJA 4QE7A 1HR0B 1OJHA 1HWYA 1WNSA 4O2BB 2IU0A 2XASA 1ZWIC 4NXMO 4UV8A 3CJHB 2XHBA 4DR4O 1IBLB 1MZEA 5CA0B 5H5NA 2ZDIC 4WFFA 3OT7A 4LF6B 1U96A 1YJNV 1AI6A 4U3JA 3SRCA 2PI4A 1GHDA 3E89A 1JPXA 5LA6A 4PDLA 2IW5A 4UCUA 4RQFA 2CDYA 2HFEC 2Y69C 4J9YB 3EVKA 3RYHB 3CC4V 2XTAA 3DC5A 5CMUA 4FZ0A 2YI9A 1QBZA 1L1FA 4BIOA 3SPCA 4JI8O 4N23A 1FXKB 1S5LZ 3OMAB 5H9CA 4YF9A 4TV8B 1GMGA 1M57B 3ABMB 4I4TB 1WPXA 4LWSA 5JQGA 1EN6A 1XNRO 5IJ0A 4DR1B 3ZS8C 3ZMVA 5H6QA 2ZDIA 4L87A 4DV4O 2Q5ZA 4K0KB 4J42A 3TGUH 3ZRVA 3CRAA 3ZEDA 5A9GA 4EEQA 4O4IA 1QCEA 4F6RA 3ZN0A 3H01A 2HHHO 5LMUB 4GKKB 3RW0A 3ZHSA 1HNWO 3CCRV 2AE4A 4MS2A 3FD9A 1NH2B 4LFCO 3PJSK 3JD1A 4EB6B 2PYJA 1FPOA 3CHXA 2JGDA 3N2GA 3P32A 3APOA 5EK0A 4GX0A 4DR2O 2ZT9B 3CC2V 3D3IA 4JYAB 4DUZO 1EN5A 2LJ2A 5EBLC 4QIWF 4MW3A 4JI3B 2K1EA 4WBNA 3H1HH 2GDSA 4U3FH 5C8YA 4MVZA 3DC6A 1YTFB 3ETEA 1H2LA 1N8RW 1US6A 1GO3F 2ADPA 3LUTB 4UVBA 1K97A 1IXBA 2OIGA 1Q86W 3AG3C 1W0JG 1FFXB 3ASNC 3K9SA 1P7GA 2WYCA 1Z5VA 3SRAA 2W6IG 1I94O 4J7JA 5LP6B 4B7KA 4BW9A 3JAWB 3K3WA 5FPRA 1XHZA 3JTRA 3ZRXA 1VARA 4J9ZB 1FJGO 1TUBB 3C3TA 4DV5O 4D7SA 2DQ0A 2QGNA 5LOVB 1FYJA 1XNQB 2D2CB 2F23A 1KECA 2CAZC 2EINB 3W7XA 2QKSA 3RYFA 3ZMZA 4JYYA 1N4CA 3SGIA 2DWEC 1PD3A 4IYHA 5KMGB 3OTOB 4DR5O 3B77A 3S3WA 4OX9B 1K4DC 2OYQA 3G6BA 3LSUA 1VQOV 4DV0O 4YJ2A 4PJ0Z 1S0VA 3G67A 1I08A 4A5UB 4L8JA 1WJZA 5JH7B 1FKAO 1R6KA 3RWRD 1XMOB 5B1OA 2G38A 2JEUA 5K1XA 3BABA 4B3MB 5CN0A 4FFBA 2Y0PA 1I7FA 1Q81W 1X59A 4K2GA 4DV1B 2CTWA 1EBOA 4X66B 5KHGA 2IBZH 3M8AA 4FLWA 2OTJV 4G28B 4DW1A 3RT3C 2QTOA 5LBQA 2Q68A 2CH7B 2YI8A 2XOKG 4LF9O 5AG2A 2VRZA 3CSXA 3HKBB 2IM9A 1JA8A 1YHQV 1N34B 4E2LA 1V55B 3WG7C 1SZXA 3BA8A
chains in the Genus database with same CATH topology
4RAIA 2WLKA 1KC8W 4YXWG 2W6JG 5EC2C 1RPOA 3SRBA 1RM1B 2YSUB 3G4SV 3LDEA 2Q69A 1JJ2U 4JAVA 1OR0A 1R73A 3F7YC 1V55C 1H2GA 3T2MA 2IJKA 4ZKIA 2OTLV 1V54B 2DYRC 4PA4A 1LNQA 3BEHA 1OCOC 2B1GA 3CP1A 1SESA 5B3SC 3NXSA 1VQ5V 3ZJZA 3K06A 3CCQV 1NQTA 2X6AA 4BAYA 4H37A 1KEHA 4XDLA 4TSFG 1GM9A 3E8BA 1H38A 3W7SA 3VOUA 3CCMV 3OAAG 4RUFA 2WAMA 3UKMA 1DTOA 3B8MA 3P30A 3FB8C 1V54C 2HG5C 1GK1A 2IH1C 5B1BB 1XL4A 5CBHA 3OUSA 4WFHA 4YFBA 1VQNV 5L3FA 3LDDA 3SYQA 1OCCB 2UXXA 1GK0A 2QM7A 3QO5A 1GM8A 1OZ0A 5L3EA 2BOBC 1JOYA 2X6CA 3UM7A 4UVCA 2XAJA 3RBZA 1PKXA 4CZZA 3W7WA 1S72V 2V1DA 4BTHA 1NR1A 2A79B 2C2AA 3K0DA 3HPLC 4JYBA 3ABKB 1GK9A 1NJIW 1TUEB 2P67A 1QLEB 4N21A 1K5SA 4U7NA 3OR6C 1Q82W 4MVOA 1XL6A 2HVKC 1GM7A 4JAUA 4BIZA 4RUEA 3TCUA 2QA4V 1F51A 3OGCC 3CCVV 5GW7A 1K7DA 2EBOA 1NVPB 3AG2C 1JVMA 3W7UA 2WYDA 1M9NA 3AG1B 5B1AB 4JF3A 2NLJC 2Y48A 4PA6A 2AHZA 3ZRSA 3CCLV 3LDCA 4WFBV 3GB7C 3ZMUA 4QNHB 1YI2V 3A0RA 1VQMV 1K5QA 3R65A 3TETA 2Z5UA 1NVPD 1F4NA 5HFLA 2IJJA 3ML0A 5B1AC 2EILB 3MD0A 4WKSA 1ROPA 4FJCC 3ZCCA 2LFRA 3G6EV 3FB7C 3TK1A 1FXKC 1M1KW 2EIKC 3GWOA 3FYEB 1K34A 2HKOA 3SPGA 1S76D 3ABTA 3OMIB 4PDMA 3JTQA 2EILC 2WLIB 2GSMB 2WSSG 1KP2A 1FM2A 3OUFA 4HZ3A 3ZMSA 2HR3A 5B1NA 2QEXV 1KKDA 2YEVB 1FFTB 1DLBA 4KP4A 1I5YA 2Z3YA 5H6RA 2WLLA 2WYEA 1F23A 2ZR2A 3X2QC 4GCZA 3E8FA 3IC7A 4HSRA 4JTAB 3SYCA 4G27B 2EZOA 4LP8A 4ASUG 2M7WA 2XAHA 1AR1B 3EHBB 4PEMA 3E35A 3OEHG 1W0KG 2EIJC 1AJPA 4LCUC 2A9HA 3L94A 5LGUA 1GTOA 4XDKA 1NR7A 1FS0G 3MHSC 1OCOB 1PNKA 5B3SB 3JD2A 1BHBA 1E1QG 4MSWC 1NH2D 2AE5A 2CK3G 1FXKA 1COWG 3D36A 4UXNA 3G71V 4P9OA 1JCHA 3OR7C 2Q67A 1FXHA 1EZJA 3DGEA 4FMTA 3IFXA 4JTDB 4MTOA 1W2BU 4PA9A 3K79A 4DO2A 2DYSB 4UVAA 4CBCA 1PNMA 2H94A 1F4MA 3ZMTA 1QR8A 3CC7V 5HFMA 4P30A 2LP7A 1BL8A 2UXNA 2Q6AA 1MG1A 2V7QG 2WLMA 2XAQA 3SYOA 1JVZA 2WLIA 2A0LA 4OXSA 2IH3C 5KUMA 1R3JC 2DYSC 2QE7G 2YEVA 2PI5A 1JW0A 1ORQC 1SRYA 4E55A 4MTXA 4JPRA 1CPYA 4ZBMA 4QE7A 1MSWD 1HWYA 2D3OW 1S3JA 2IU0A 2XASA 1ZWIC 3S8RA 4X88A 3AEIA 2P7TC 3FB6C 4UV8A 2HVJC 1H8HG 4UV9A 3VBBA 4PA3A 2OCCC 3I55V 1IXMA 3DTUB 4PDRA 4K2FA 2ZDIC 4WFFA 1K8AW 3AG2B 1E3AA 3AG4B 1YJNV 1AI6A 3SRCA 2PI4A 1GHDA 1YSCA 3E89A 2WLLB 1JPXA 3SPHA 2B1IA 3JD0A 4PDLA 4M1JA 3LNMB 2IW5A 2OT5A 1UJWB 3WFVA 4R7CA 4WKVA 4RQFA 3FB5C 3F5WC 2HFEC 5IY5C 2Y69C 4J9YB 3JD4A 3E83A 3CC4V 2R9RB 3LSQA 5CMUA 3OW2U 3AG4C 4X8AA 3T1CA 2IJHA 3CCUV 3E8GA 4MTFA 4RO2A 3ZRWA 1QBZA 1L1FA 1GKFA 4JASA 5IYCO 3SPCA 1R3KC 4N23A 2X6BA 1FXKB 3MHHC 3OMAB 4I5SA 2LFSA 5H9CA 1FXVA 5L3GA 4YF9A 2EINC 1GMGA 1M57B 5LHHA 2EIKB 3ABMB 1WPXA 3ETDA 4QPJA 4HAMA 5CBGA 3CCSV 3ZN1A 4WKUA 4KUMA 1JQ0A 3CYOA 4E56A 3FKSG 2NNUA 2X0LA 1KD1W 4BIUA 1NBMG 2BOCC 1VQPV 3ZMVA 1VQ8V 5H6QA 2P90A 4JTCB 2ITCC 2ZDIA 1R3IC 3CXCU 3K0GA 1Y66A 3BY6A 1MOFA 4L87A 4P9PA 3JCZA 4X89A 5IDJA 2WYBA 1M57C 1OHHG 3ABMC 3X2QB 3ZRVA 2EIMB 2DW4A 3IGAC 3LSSA 1P7BA 1S77D 3FYIB 1K4CC 1QCEA 3RVYA 1DF5A 3ZN0A 3H01A 2EIJB 2ZD9A 3K04A 4EKWA 5BZBA 3OMNB 3RW0A 3STZC 3CCRV 1YIJV 3ABLB 4I9WA 1QVGU 1DF4A 1G8MA 1RPRA 2EIMC 3ETGA 4MS2A 4PA7A 5EBMC 3SPJA 2AE4A 1Q7YW 1NH2B 4WFEA 3T4DA 3PJSK 2WLJA 3JD1A 4MVRA 2ITDC 5LHIA 1M56B 2XNDG 1K73W 3P32A 5IYBO 5EK0A 4GX0A 3CCEV 3ABLC 3M99B 4H33A 3CC2V 3D3IA 3STLC 5EBLC 4QIWF 4MW3A 2K1EA 5C93A 3I56V 4R8CA 1BMFG 5L3CA 3CMEV 1M56C 3QO8A 1K3EA 3CMAV 2XAGA 4PDVA 3E2EA 4WKTA 2XAFA 1Y4MA 4MVZA 4WCEV 1R6NA 1K33A 4P2ZA 1P4RA 3ZRWB 3ASNB 1YTFB 3SJQC 2EJRA 2W0FC 1CP9A 1SETA 3ETEA 3SYAA 1N8RW 1VQ9V 2EZPA 2ATKC 4U7OA 2H8PC 3QO7A 4XBFA 1CEZA 1GO3F 1SZTA 2IJIA 3LUTB 1H8EG 4UVBA 5J9PC 1VQ6V 1AJNA 1K97A 4MVQA 4MVMA 4MTGA 4Q20A 1Q86W 3AG3C 1W0JG 3SYPA 2OCCB 4FIPC 4YFAA 1YTFD 3ASNC 3HB3B 5DM6V 2QM8A 5CA3A 1QR9A 3JD3A 4FPPA 2AE3A 2WYCA 3SRAA 2W6IG 3E8HA 2KB1A 3QNEA 1RM1C 2MK3A 2WPDG 1OCRB 4FK5C 5KA5A 1VQLV 1VQ4V 1BHAA 5IY5B 2Y69B 3K3WA 2HLDG 1THZA 5LGTA 3JTRA 4GX2A 3ZRXA 2R9IA 4J9ZB 3RVZA 1J95A 2DQ0A 5EBWC 3CPWU 1JX9A 1M90W 2JIZG 4GX1A 3L91A 4DXWA 1QVFU 1OCRC 4E57A 2P6JA 1KECA 4QJFB 5CBFA 2EINB 3K9AA 3W7XA 2QKSA 3ZMZA 3JYCA 5FL7G 1G4YB 4MVSA 5B1BC 4JYCA 2AHYA 1YJ9V 1E79G 2DWEC 1PD3A 4QE9A 5E1AC 1ENVA 1OCCC 2JJ2G 1E1RG 1VQKV 3B77A 4MT8A 2JEXA 4HYOA 4R50A 2FTKA 1K4DC 4TWKA 3CCJV 4PELA 2ADVA 3W7TA 1WLEA 1R3LC 5L3BA 3B8NA 1VQOV 1MABG 3OM3B 3KG2A 2GHYA 4QPKA 5KA6A 1S0VA 1S5HC 3ABKC 3OFNG 1QLEC 1I5XA 1PNLA 1R6KA 2F43G 2X7RB 4JGSA 1YJWV 5B1OA 4LBEC 4LC1A 3K08A 2IU3A 4Z1MG 4GX5A 4XDJA 2JEUA 1AI5A 2ZXWB 2WLNA 5CN0A 1SERA 2DWDC 5LHGA 5L3DA 3AG1C 3OE7G 4KFMA 4MW8A 2WLHA 1Q81W 4K2GA 4F4LA 2JJ1G 2ZQMA 1EBOA 1KP3A 3EFFK 4TT3G 1AI7A 1PL0A 1NKDA 1YITV 5EC1C 2ZXWC 1VQ7V 2OTJV 4UUJC 3CD6V 1AROP 3OEEG 1EFRG 4G28B 4G2KA 4HSTA 1OCZB 4WFGA 2ZR3A 2QTOA 1QLNA 1K9MW 5LBQA 2B5UA 1AI4A 4GT1A 3ZIAG 2Q68A 1K92A 3ASOB 3F7VC 1KQSU 3WG7B 2XOKG 4R6ZA 3E86A 4WFAV 1YHQV 1OCZC 2DQ3A 3K03A 3SPIA 5DN6G 4WF9V 2WWWA 1AJQA 1B6QA 3AG3B 5IYDO 4RQEA 4MVUA 4E2LA 2JDIG 1V55B 3ABUA 5KUKA 3T4ZA 4BW5A 2DYRB 2HJFC 3ASOC 3WG7C 5LGNA 2JK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3A A;  1K5Q A;  1GK9 A;  1PNK A;  3JTR A;  1AI5 A;  1AI6 A;  3SRC A;  1FXV A;  2AE5 A;  1GHD A;  4PEL A;  1JVZ A;  2ADV A;  4YF9 A;  3SRB A;  1AJN A;  1GK1 A;  1AI4 A;  1K5S A;  4WKU A;  3ML0 A;  4M1J A;  4YFA A;  2WYE A;  4YFB A;  1JW0 A;  4E56 A;  4K2G A;  1JX9 A;  1FXH A;  4WKV A;  1OR0 A;  1GK0 A;  4WKS A;  4E55 A;  1GM7 A;  3L91 A;  4E57 A;  1GM8 A;  1H2G A;  2AE4 A;  4HSR A;  2AE3 A;  1KEC A;  2WYC A;  1K7D A;  4WKT A;  3SRA A;  1AI7 A;  1FM2 A;  2WYD A;  3S8R A;  1PNM A;  2WYB A;  1AJQ A;  4PEM A;  1PNL A;  1AJP A;  1CP9 A;  1KEH A;  3L94 A;  1GM9 A;  1GKF A;  4BTH A;  3JTQ A;  4HST A;  4K2F A;  3K3W A; 
#chains in the Genus database with same CATH topology
 2YID A;  1XI1 A;  5B66 Z;  1BGY H;  5EC2 C;  3Q4H A;  2YSU B;  1QNM A;  3S3X A;  2R70 A;  4ZKI A;  2OTL V;  4ZI7 A;  5EYP B;  1OCO C;  2B1G A;  3UT5 B;  1VQ5 V;  4X64 O;  3ZJZ A;  3K06 A;  4NXM B;  4BAY A;  4H37 A;  4J80 A;  4DR4 B;  3E8B A;  1H38 A;  3TJT A;  3CCM V;  1MSD A;  4O4H B;  2WAM A;  4LF4 O;  3B8M A;  4JI4 O;  4NTX A;  2GUZ A;  3FB8 C;  1V54 C;  4KHP O;  1GK1 A;  3L9D A;  4WFH A;  2BCC H;  4YFB A;  2JVD A;  5L3F A;  1MMM A;  4HNA A;  2CTR A;  2LGW A;  1JOY A;  2X6C A;  3JAS B;  3UM7 A;  5LMN O;  1PKX A;  4CZZ A;  3W7W A;  2UUB O;  2V1D A;  4I9Q A;  2QSA A;  4JI8 B;  4JYB A;  1MZF A;  1GK9 A;  5JVD B;  4B3T O;  2CTP A;  1L0L H;  1QLE B;  3WU2 Z;  2ODM A;  2JGU A;  1L0N H;  1PPJ H;  1XL6 A;  1XNR B;  5J2T A;  2ZE6 A;  4DYL A;  4CC6 A;  4JAU A;  2L35 A;  5IYZ A;  1K7D A;  2LW7 A;  3CX5 F;  3AG2 C;  3W7U A;  5FLX N;  4DV4 B;  4PA6 A;  4DK0 A;  3ZRS A;  2ZIM A;  1AP5 A;  4QNH B;  1YI2 V;  1J5E O;  4BWC A;  3R65 A;  2HHH B;  1NVP D;  3A0B Z;  4LFA O;  1NZ6 A;  3ML0 A;  3N2K A;  1HNW B;  1ROP A;  3ZCC A;  3TK1 A;  2YXL A;  4LFC B;  1HNX O;  3J81 N;  2RJZ A;  2Y4U A;  1BT8 A;  2HKO A;  3SPG A;  1JJO A;  4BR6 A;  1S76 D;  3ABT A;  1WA8 A;  4PDM A;  2WLI B;  3L71 H;  5J2U A;  3OUF A;  4DR2 B;  1KKD A;  1HNZ O;  1FFT B;  1TAE A;  4KP4 A;  4DUZ B;  4IIJ B;  1Z5W A;  2WYE A;  3HKC A;  3IC7 A;  1JFF A;  4HSR A;  4I50 A;  2EZO A;  3CRC A;  5IWA O;  4ASU G;  1AR1 B;  3J7A U;  3OEH G;  4FLV A;  4X65 O;  1KUQ A;  1GTO A;  5B3S B;  5IJ9 A;  5LA6 B;  1VEW A;  1E1Q G;  4MSW C;  2N74 A;  1COW G;  5JCO A;  4X1I A;  3G71 V;  1JCH A;  3H1K H;  4MTO A;  3DGE A;  4F6E A;  5KHK A;  1F7Y A;  3DXR A;  4DR7 O;  3SR2 C;  4KL1 A;  2DYS B;  1IUR A;  1I94 B;  2Y0I A;  2Q7E A;  5HFM A;  5EIB D;  1BL8 A;  2UXN A;  1KU9 A;  2V7Q G;  2WLM A;  2XAQ A;  4LWS B;  5JQG B;  3RN4 A;  1FJG B;  4DV5 B;  5IJ0 B;  2PI5 A;  2YEV A;  2RDC A;  4JI2 O;  4JPR A;  3HKD B;  2D3O W;  1SC5 B;  1S3J A;  3CEI A;  3S8R A;  2BTQ A;  4X88 A;  3AEI A;  4W4K A;  3FB6 C;  1H8H G;  4PA3 A;  2OCC C;  4F6R B;  4LH7 A;  4X9Q A;  4JI5 O;  3DTU B;  3VQW A;  4DR5 B;  5IT9 N;  1E3A A;  1QQC A;  4I0X A;  2V4D A;  1VP7 A;  4H0L B;  4M1J A;  3LNM B;  2OT5 A;  3WFV A;  1PM9 A;  2YS8 A;  4DV0 B;  5IY5 C;  1YCI A;  1TVK B;  3N2G B;  3T1C A;  2KKW A;  3E8G A;  3ZRW A;  4YJ3 B;  3M7M X;  4DRX A;  1XHX A;  2JS3 A;  1FXV A;  5LHH A;  4HAM A;  1YDX A;  1JQ0 A;  3CYO A;  3JSL A;  2NNU A;  4BIU A;  1NBM G;  1VQP V;  1Z2G A;  2ITC C;  2E75 B;  1Y66 A;  4FM1 A;  5IDJ A;  2QWP B;  3JCZ A;  5D5Q A;  2VQE O;  2DW4 A;  4O4J A;  1S77 D;  3FYI B;  1K4C C;  3FAV A;  3BCC H;  1DF5 A;  3BFR A;  4YY3 O;  1M5I A;  2EIJ B;  3K04 A;  1XIL A;  4LF9 B;  2O57 A;  1QVG U;  1DF4 A;  1GN4 A;  1RPR A;  5EBM C;  4AIL C;  4PA7 A;  4J41 A;  3SPJ A;  1Q7Y W;  4WFE A;  2WLJ A;  3L73 H;  2ITD C;  5LHI A;  2P5O A;  1XDC A;  4IHJ A;  4DK1 A;  3CCE V;  1YZB A;  5BMV A;  3I56 V;  5L3C A;  3RYF B;  1NTK H;  3QO8 A;  2XAG A;  4WKT A;  1SQV H;  1R6N A;  1K33 A;  4P2Z A;  5CA1 A;  2CGO A;  4X64 B;  3ASN B;  3SJQ C;  1CP9 A;  1SET A;  4C7U A;  2ATK C;  4U7O A;  4UCO A;  1SZT A;  4LF4 B;  4JI4 B;  4KHP B;  1AVM A;  3CWB H;  4MVM A;  4MTG A;  4NKG B;  4Q20 A;  4YJ2 B;  4YFA A;  4FIP C;  1N33 O;  1YTF D;  1URF A;  3HB3 B;  2QM8 A;  2Q7H A;  4CH3 A;  3K59 A;  1RM1 C;  3OGI B;  5LMN B;  2MK3 A;  3MAQ A;  3ZHV A;  2UUB B;  1VQ4 V;  4NTW A;  4FFB B;  5LGT A;  4B3T B;  5K1P A;  1KMI Z;  2XUM A;  3CPW U;  3RYC B;  4O4L A;  3QTC A;  1M90 W;  2JIZ G;  2ETN A;  1QVF U;  1KBH A;  2P6J A;  1Q3E A;  2FB5 A;  2FYU H;  1NT2 B;  4MVS A;  5B1B C;  1YJ9 V;  4JYC A;  1SA0 A;  2M6Y A;  2ZE8 A;  2JJ2 G;  1E1R G;  1J5E B;  4MT8 A;  5TIS Z;  4HYO A;  3H1I H;  4PEL A;  3UO3 A;  1VMG A;  4LFA B;  4IL6 Z;  1G1X B;  1Q6U A;  3SJA C;  4H44 B;  3OM3 B;  1DK1 A;  2YC0 A;  2VQF O;  4GKJ O;  1NU1 H;  4UCV A;  3ABK C;  2QWO B;  4AHC A;  1KB9 F;  3OFN G;  4TV9 A;  1HNX B;  5KHI A;  3R66 A;  1DGS A;  4J7Z A;  3ICX A;  1YJW V;  1JR9 A;  1ZL8 A;  3K08 A;  1AB3 A;  4Z1M G;  1TGO A;  1R1B A;  3AG7 A;  1HNZ B;  4LH6 A;  1B06 A;  1VF7 A;  4OGQ B;  2WLH A;  3T1Y O;  4ZI7 B;  4EFE A;  3E22 A;  3CE2 A;  1PL0 A;  3D36 C;  1YIT V;  5IWA B;  4B3S O;  4UUJ C;  4FLX A;  1ARO P;  1EFR G;  4X65 B;  4K3A A;  2GUZ B;  4HST A;  4WFG A;  4B3R O;  1O9H A;  4UCR A;  3K5O A;  1AI4 A;  2QDO A;  1PP9 H;  3ZIA G;  2ZIO A;  5GTI Z;  1KQS U;  3SDL A;  3WG7 B;  3ZHT A;  3JAT A;  4PI0 A;  4R6Z A;  5LL6 Y;  4DR7 B;  4X1Y A;  1AP6 A;  1OCZ C;  1RSO B;  3SPI A;  1AJQ A;  1B6Q A;  5IYD O;  3U11 A;  4FLT A;  2JDI G;  3KCY A;  2HJF C;  1D5A A;  2UU9 O;  4D7T A;  2QWQ B;  3WB2 A;  2QKA A;  2W6J G;  4YIP A;  5J2T B;  1HDJ A;  1XOU A;  3G4S V;  1NI8 A;  4JI2 B;  2DMX A;  1OR0 A;  1R73 A;  3F7Y C;  1H2G A;  4OPA A;  2IJK A;  1V54 B;  4LNU B;  4PA4 A;  3ZX6 A;  1SES A;  1XQ8 A;  4CH6 A;  3CCQ V;  1NQT A;  1SQG A;  4TSF G;  5EIB C;  4JI5 B;  3VOU A;  3W7S A;  2ZNI A;  4J7K A;  3P30 A;  3N2K B;  4GUN A;  2IH1 C;  3OUS A;  2YUA A;  1VQN V;  1OCC B;  4YIO A;  1GK0 A;  5A2Q N;  1GM8 A;  3L74 H;  2CGN A;  4ICG A;  1WA8 B;  2XAJ A;  3RBZ A;  5J2U B;  4UFZ A;  5ITZ A;  1NR1 A;  2A79 B;  2C2A A;  2E5L O;  2MW2 B;  3OD4 A;  3HKC B;  1GRJ A;  2K9P A;  2YIB D;  2EJ7 A;  2WA4 A;  3OR6 C;  1JFF B;  2KG7 A;  4CS2 A;  4I50 B;  2HVK C;  3BA9 A;  4PHZ A;  5GON B;  4BIZ A;  4RUE A;  4UCT A;  2QA4 V;  1F51 A;  1IZ3 A;  1JVM A;  2NN4 A;  2WYD A;  3AG1 B;  4JF3 A;  2EX3 A;  2VQE B;  3CCL V;  2BSK A;  1HP8 A;  1SS3 A;  5IJ9 B;  3A0H Z;  1BS3 A;  3GB7 C;  3A0R A;  1YVW A;  4X1I B;  4JAA A;  3TET A;  4YY3 B;  5LXT B;  3DXR B;  5B1A C;  5LYJ A;  4WKS A;  4J10 A;  1Q43 A;  1MNG A;  4JI6 O;  1FXK C;  3IAY A;  2UUA O;  1A32 A;  4O2B A;  1M1K W;  3GWO A;  3FYE B;  1IBK O;  3CJH A;  2WSS G;  3VQV A;  3AK1 A;  1FM2 A;  1N32 O;  3L75 H;  5CA0 A;  2QEX V;  2YEV B;  1I5Y A;  1RP3 B;  5GTH Z;  4X20 B;  2PYL A;  1F23 A;  4NYK A;  2ZR2 A;  4GCZ A;  4JV5 O;  1FAF A;  4JTA B;  3SYC A;  2BTQ B;  4G27 B;  2ZM6 O;  2N05 A;  3JAM N;  3L94 A;  5IE9 A;  2F4V O;  3CXH F;  4XDK A;  4LFB O;  2DE0 X;  1PNK A;  3P3P A;  1OV9 A;  1FXK A;  1SQB H;  3DSQ A;  4DUY O;  1YEW A;  1YXB A;  1N33 B;  1FXH A;  4FMT A;  1W2B U;  3EXA A;  4PA9 A;  2OCH A;  3ZHQ A;  3KCX A;  3D8C A;  4DO2 A;  1PNM A;  5BXZ A;  3ZMT A;  1QR8 A;  3N27 A;  3C3S A;  2W0X A;  5LGN A;  4K8X A;  3JSN A;  1H2N A;  1PL4 A;  1JVZ A;  3JAK A;  3BVO A;  3UCS C;  4GLX A;  1VIB A;  4E55 A;  4MTX A;  1CPY A;  4ZBM A;  1MSW D;  1UPG A;  2P7T C;  4O4J B;  4UV9 A;  4EB6 A;  3I55 V;  4NTY A;  4PDR A;  4K2F A;  1K8A W;  2WLL B;  3JD0 A;  4AQY O;  4R7C A;  3U10 A;  4TQF A;  5LP6 C;  3FB5 C;  3JAR A;  5EZY A;  3FX7 A;  3JD4 A;  2Z0A A;  3SJB C;  3E83 A;  2VQF B;  4GKJ B;  1LR1 A;  1IX9 A;  3LSQ A;  3OW2 U;  3AG4 C;  3WB0 A;  4X8A A;  1NTM H;  4X62 O;  2IJH A;  2A7W A;  4IHJ B;  2UXC O;  4RO2 A;  1GKF A;  5KAF Z;  1BCC H;  5KX5 A;  1YF2 A;  3MHH C;  5BMV B;  4I5S A;  2LFS A;  5L3G A;  2EIN C;  2EIK B;  2YDE A;  4QPJ A;  5CBG A;  4WKU A;  2AW9 A;  3T1Y B;  3FKS G;  1Q6I A;  1KD1 W;  2BOC C;  5CA1 B;  1ZSP A;  1N36 O;  2Q73 A;  4JTC B;  3GWK C;  3G80 A;  2GV9 A;  3CXC U;  4B3S B;  3K0G A;  1MOF A;  4P9P A;  3X2Q B;  2WA3 A;  2RMK B;  3LSS A;  1VF6 C;  4AI8 A;  5LP6 A;  4PI2 A;  3D3Q A;  3RVY A;  4B3R B;  3NR7 A;  2CTQ A;  2ZD9 A;  3QF7 A;  2CE4 A;  4EKW A;  5BZB A;  3STZ C;  1YIJ V;  4TOI A;  1G8M A;  2EIM C;  3B09 A;  3HR0 A;  3T4D A;  2YXY A;  3CB2 A;  3BRC A;  1K73 W;  2P4V A;  2UU9 B;  2ILM A;  4U3J B;  3CRR A;  5IYB O;  3ABL C;  4H33 A;  1XMQ O;  4O4L B;  2RN9 A;  1R6T A;  4DV3 O;  4R8C A;  1BMF G;  5E79 Z;  1M56 C;  4NB5 A;  2BTO A;  3CRM A;  3E2E A;  1VF6 A;  1XUQ A;  2XAF A;  2DOS A;  1SA0 B;  4LR3 A;  2P06 A;  5FNV A;  2W0F C;  3SYA A;  2PY5 A;  4FLU A;  4JI7 O;  3O9O A;  1VQ9 V;  2EZP A;  2H8P C;  4XBF A;  1CEZ A;  4DV6 O;  4OPH A;  5J9P C;  1VQ6 V;  1AJN A;  2FML A;  1U97 A;  3SYP A;  2DN9 A;  5B5E Z;  4O2A A;  5CA3 A;  3JD3 A;  4FFK A;  4CS3 A;  2KB1 A;  2KSD A;  1WN7 A;  3RYI A;  2LGQ A;  3L70 H;  3KZI Z;  2WPD G;  5KA5 A;  1VQL V;  1BHA A;  4O4I B;  3BHP A;  2UXB O;  2Y69 B;  2E5L B;  1THZ A;  2PUS A;  2R9I A;  1J95 A;  1JX9 A;  5CB4 A;  4GX1 A;  4DXW A;  4E57 A;  1OCR C;  1B04 A;  4QJF B;  3K9A A;  2JGD B;  3JYC A;  3P3N A;  5FL7 G;  1G4Y B;  3UQ8 A;  3JCU Z;  1NTZ H;  1E79 G;  5E1A C;  1ENV A;  1VQK V;  2P22 C;  4TWK A;  3CCJ V;  2VS0 A;  4WBN B;  3JAT B;  5JJN B;  2HP8 A;  5L3B A;  4JI1 O;  5C8Y B;  4X1Y B;  1LUV A;  2QKC A;  2GHY A;  4JI6 B;  1WP7 A;  5EYP A;  4GYC B;  2UUA B;  1QLE C;  1PNL A;  1SF9 A;  2L6L A;  1IBK B;  1Y76 A;  4NXN O;  2A3Q A;  3APQ A;  4LBE C;  2BE3 A;  4GX5 A;  1N32 B;  2RNB A;  1AI5 A;  2WLN A;  4GZR B;  2GTA A;  5LHG A;  3OE7 G;  4KFM A;  4MW8 A;  1BQ0 A;  4ZHQ A;  2YIC A;  5DEC A;  4JV5 B;  4F4L A;  2ZQM A;  2ZIN A;  4DV7 O;  3EFF K;  4TT3 G;  2ZM6 B;  1NKD A;  5EC1 C;  2ZXW C;  2ZKO A;  3K5M A;  1VQ7 V;  2VWK A;  3CD6 V;  3OEE G;  1ZX3 A;  2F4V B;  1OCZ B;  3JAL A;  1O9G A;  4LFB B;  1GAX A;  2ZR3 A;  1CXZ B;  4UCS A;  2F66 C;  2B5U A;  5JVD A;  4GT1 A;  4FLZ A;  2DJV A;  4DUY B;  3F7V C;  1EM1 A;  2OWO A;  2R9A A;  2WWW A;  3AG3 B;  5ITZ B;  4RQE A;  3QVN A;  3PN1 A;  4IGG A;  4MVU A;  3ABU A;  1Y74 A;  2UXD O;  1Q90 D;  3ASO C;  4J11 A;  4RAI A;  1RFY A;  1WB7 A;  1KC8 W;  3L72 H;  1P84 F;  4YXW G;  2LQT A;  3LDE A;  2Q69 A;  1JJ2 U;  5JWP A;  2DYR C;  1BE3 H;  1LNQ A;  3BEH A;  4LF7 O;  3CP1 A;  3HKE A;  2LW1 A;  5B3S C;  3NXS A;  2BSK B;  2A06 H;  2X6A A;  3THO A;  1KEH A;  4XDL A;  4TUY A;  1L8D A;  1GM9 A;  1Q5O A;  4RUF A;  3H1L H;  1W59 A;  1ZTE A;  5LYJ B;  2QJ1 A;  1XL4 A;  2F93 B;  1Y6X A;  1GN3 A;  3LDD A;  4AQY B;  2QM7 A;  3A2F A;  1OZ0 A;  1IBM O;  2BOB C;  4H13 B;  3T1H O;  4X62 B;  2B9Z A;  2UXC B;  1AIL A;  2AZ2 A;  1BQZ A;  1WPB A;  3K0D A;  2NR5 A;  1TUE B;  4Q6G A;  1NJI W;  3FGR A;  1H2S B;  4N21 A;  3RGB A;  4U7N A;  4MVO A;  4YHH O;  1GM7 A;  3TCU A;  3CCV V;  2JRI A;  1N36 B;  2EBO A;  1M9N A;  5B1A B;  2Y48 A;  2AZ0 A;  3LDC A;  1HW7 A;  4WFB V;  3U0Z A;  2ADQ B;  3Q4H B;  2Z5U A;  5HFL A;  2IJJ A;  1P49 A;  4Z1V A;  4FJC C;  3B4S A;  5BR8 O;  3G6E V;  3FB7 C;  1SKV A;  3HKD A;  4X1K A;  1MA1 A;  3H1J H;  1H2M A;  3IJ4 A;  1K34 A;  1B3Q A;  1I0H A;  3OMI B;  1SQP H;  2EIL C;  3AK3 A;  2YIA A;  4HZ3 A;  5FPO A;  3JAK B;  5B1N A;  1XMQ B;  3TXS A;  4HNA B;  5H6R A;  4CH4 A;  4DV3 B;  1IVS A;  4I7Z B;  4W4L A;  2M7W A;  1W0K G;  2EIJ C;  4DW0 A;  1TVK A;  4JI7 B;  4YJ3 A;  4FLY A;  3MHS C;  1OCO B;  3RFR A;  4FVM A;  4DV6 B;  1BHB A;  1XEQ A;  2AE5 A;  2E3C A;  3D36 A;  2CUG A;  4UXN A;  3JAR B;  5EZY B;  5IYZ B;  3IFX A;  1JMK C;  4ZOL A;  4CBC A;  2FL4 A;  2H94 A;  1F4M A;  5KX5 B;  2Q0A A;  4BWA A;  2LP7 A;  2UXB B;  1WB8 A;  1X4T A;  2XT9 A;  4E4E A;  2IH3 C;  4B08 A;  1R3J C;  2QE7 G;  1JW0 A;  1ORQ C;  2Q8V A;  1PV0 A;  1WAZ A;  4JZ2 A;  3A8T A;  4TQD A;  3VBB A;  2HVJ C;  1NS1 A;  1IXM A;  4DV2 O;  3AG2 B;  3AG4 B;  4IYI A;  2AXT Z;  1YSC A;  3SPH A;  2B1I A;  4JI1 B;  1UJW B;  4WKV A;  3F5W C;  2R9R B;  4I55 A;  3CCU V;  4MTF A;  4NXN B;  4JAS A;  1Q6H A;  2ZE7 A;  5IYC O;  1R3K C;  2ZE5 A;  2X6B A;  3B2E E;  3QG5 A;  3K5L A;  3ETD A;  3CCS V;  3BPZ A;  4K8Z A;  2ZNJ A;  3ZN1 A;  4KUM A;  4E56 A;  2X0L A;  4JI0 O;  2EUL A;  1VQ8 V;  2P90 A;  5FNV B;  4DV7 B;  1R3I C;  3VQX A;  3AK2 A;  3BY6 A;  2WYB A;  4X89 A;  1M57 C;  4DR6 O;  1OHH G;  3ABM C;  2EIM B;  3IGA C;  2E74 B;  1P7B A;  1WP8 A;  3K5N A;  2Q0O C;  2JS5 A;  1T5E A;  4LF5 O;  4O2A B;  3OMN B;  1SQX H;  3ABL B;  3RYC A;  4I9W A;  3RYI B;  3ETG A;  3KKY A;  2UUC O;  3K58 A;  4MVR A;  5H2F Z;  3RYH A;  1M56 B;  2XND G;  2UXD B;  4Z2W A;  1XRE A;  3M99 B;  4I0X B;  3STL C;  3UO2 A;  5CB4 B;  5C93 A;  3FFQ A;  4TV8 A;  4ZIB A;  4I4T A;  3CME V;  3F5T A;  1K3E A;  3CMA V;  4PDV A;  4WCE V;  1Y4M A;  4LF7 B;  1P4R A;  3ZRW B;  2EJR A;  3IC9 A;  2E76 B;  4DRX B;  3QO7 A;  2IJI A;  3I5D A;  1H8E G;  4FM2 A;  4MVQ A;  2OCC B;  3CS5 A;  5DM6 V;  1QR9 A;  2QWR B;  2GTS A;  3BAA A;  4FPP A;  2AE3 A;  1IBM B;  3E8H A;  3T1H B;  1Y76 B;  3QNE A;  4LF8 O;  1SQF A;  1N0J A;  1OCR B;  4FK5 C;  3TXQ A;  3FAV B;  5IY5 B;  4KXR A;  2HLD G;  5KHH A;  4ZHQ B;  4GX2 A;  5KHJ A;  1Y67 A;  3RVZ A;  5EBW C;  5JJJ B;  4DR3 O;  1N0N A;  4YHH B;  3L91 A;  1HR0 O;  2QR4 A;  2LO1 A;  5CBF A;  2YXH A;  1RSO A;  2AHY A;  4FM0 A;  3JAL B;  1UFI A;  2Q9L A;  1IBL O;  4QE9 A;  1OCC C;  4LF6 O;  1G6U A;  3VQY A;  2JEX A;  4R50 A;  2FTK A;  2ZCE A;  1D5N A;  4UB6 Z;  2ADV A;  3W7T A;  1WLE A;  1R3L C;  1GH6 A;  3B8N A;  1H2K A;  3ZHR A;  3O65 A;  2HJD A;  1MAB G;  3KG2 A;  4QPK A;  5KA6 A;  1FFX A;  3C90 A;  5KLV H;  5BR8 B;  1S5H C;  1IDS A;  4LNU A;  1Y74 B;  4K35 A;  1I5X A;  1LUW A;  1ZLZ A;  1ZUQ A;  2F43 G;  2X7R B;  1QHT A;  4JGS A;  4LC1 A;  2IU3 A;  4XDJ A;  2ZXW B;  1SER A;  2DWD C;  3JAW A;  5L3D A;  3AG1 C;  1TA8 A;  2QTS A;  1TUB A;  3HKE B;  2JJ1 G;  4DR1 O;  1KP3 A;  5LOV A;  5JCO C;  1AI7 A;  2Y4T A;  4TUY B;  2PGG A;  4K0K O;  1V9P A;  3FGT A;  4G2K A;  1XBL A;  3K57 A;  5KMG A;  1QLN A;  1K9M W;  2GBO A;  5LMU O;  2KQX A;  1ZAU A;  3LNN A;  4NR1 A;  1K92 A;  3ASO B;  4GKK O;  4ABM A;  2RCV A;  2FKX A;  3E86 A;  4WFA V;  2PZS A;  5GON A;  2ARH A;  2DQ3 A;  3K03 A;  5DN6 G;  4WF9 V;  4EFB A;  2P4K A;  2QM4 A;  1FD9 A;  5D5P A;  5KUK A;  3OTF A;  3T4Z A;  4BW5 A;  2DYR B;  5JH7 A;  2RQ6 A;  2WLK A;  3ZHU A;  4JYA O;  3SRB A;  1RPO A;  1RM1 B;  4JI3 O;  4CS4 A;  5F2V O;  5LXT A;  1KKC A;  4RWU A;  4JAV A;  1BZK A;  1V55 C;  3T2M A;  4NVP A;  4TV9 B;  3SJC C;  3GVM A;  1EN4 A;  1ZL8 B;  4QGP A;  4PV1 B;  2PF4 E;  1GN6 A;  3OAA G;  4DV2 B;  4CH5 A;  4IT5 A;  3UKM A;  1DTO A;  3ZBH A;  1M4U A;  2HG5 C;  5B1B B;  5CBH A;  1Q8I A;  3E22 B;  3SYQ A;  2UXX A;  3ETQ A;  1SQQ H;  4X20 A;  4JZG A;  3QO5 A;  4X1K B;  2CH7 A;  2PTM A;  5DED A;  5L3E A;  1KYO F;  3HKB A;  4UVC A;  1S72 V;  4BTH A;  3HPL C;  3ABK B;  2P67 A;  4PD4 F;  1K5S A;  1Q82 W;  4B7E A;  2F1M A;  3MDS A;  1XNQ O;  4JI0 B;  3OGC C;  5GW7 A;  1NVP B;  1M93 A;  2QWN B;  2NLJ C;  2AHZ A;  2R72 A;  3UT5 A;  4DR6 B;  3OTO O;  3ZMU A;  1VQM V;  1K5Q A;  4OX9 O;  1AR5 A;  1F4N A;  4O4H A;  3J80 N;  2Q7G A;  4LF5 B;  2EIL B;  2HEP A;  3MD0 A;  4ZOL B;  5JJE B;  2LFR A;  3H9V A;  2UUC B;  2VWJ A;  3CRQ A;  2EIK C;  4D6T H;  4UB8 Z;  2YIB A;  3JAS A;  1XMO O;  3JTQ A;  2GSM B;  1KP2 A;  3ZMS A;  2HR3 A;  4B3M O;  1DLB A;  2Z3Y A;  5KAI Z;  2WLL A;  4DV1 O;  3X2Q C;  1GN2 A;  3E8F A;  4X66 O;  4LP8 A;  1BSM A;  2XAH A;  3EHB B;  4PEM A;  3E35 A;  4LCU C;  1AJP A;  2A9H A;  5LGU A;  3WB1 A;  4CC5 A;  1NR7 A;  1FS0 G;  3JD2 A;  2AGA A;  1NH2 D;  2CK3 G;  2KG7 B;  4P9O A;  3OR7 C;  2Q67 A;  1EZJ A;  1D2D A;  4JTD B;  4HBN A;  4I55 B;  3K79 A;  1S5J A;  3B40 A;  1QU7 A;  1N34 O;  4UVA A;  1EZV H;  2N04 A;  4LF8 B;  2F95 B;  1VF5 B;  3CC7 V;  4P30 A;  1AR4 A;  2JK5 C;  2Q6A A;  5BY1 A;  1MG1 A;  2OIE A;  3SYO A;  4FZ1 A;  2WLI A;  2A0L A;  4OXS A;  5KUM A;  2DYS C;  2H3O A;  1SRY A;  4DR3 B;  2Q4P A;  4IIJ A;  4QE7 A;  1HR0 B;  1OJH A;  1HWY A;  1WNS A;  4O2B B;  2IU0 A;  2XAS A;  1ZWI C;  4NXM O;  4UV8 A;  3CJH B;  2XHB A;  4DR4 O;  1IBL B;  1MZE A;  5CA0 B;  5H5N A;  2ZDI C;  4WFF A;  3OT7 A;  4LF6 B;  1U96 A;  1YJN V;  1AI6 A;  4U3J A;  3SRC A;  2PI4 A;  1GHD A;  3E89 A;  1JPX A;  5LA6 A;  4PDL A;  2IW5 A;  4UCU A;  4RQF A;  2CDY A;  2HFE C;  2Y69 C;  4J9Y B;  3EVK A;  3RYH B;  3CC4 V;  2XTA A;  3DC5 A;  5CMU A;  4FZ0 A;  2YI9 A;  1QBZ A;  1L1F A;  4BIO A;  3SPC A;  4JI8 O;  4N23 A;  1FXK B;  1S5L Z;  3OMA B;  5H9C A;  4YF9 A;  4TV8 B;  1GMG A;  1M57 B;  3ABM B;  4I4T B;  1WPX A;  4LWS A;  5JQG A;  1EN6 A;  1XNR O;  5IJ0 A;  4DR1 B;  3ZS8 C;  3ZMV A;  5H6Q A;  2ZDI A;  4L87 A;  4DV4 O;  2Q5Z A;  4K0K B;  4J42 A;  3TGU H;  3ZRV A;  3CRA A;  3ZED A;  5A9G A;  4EEQ A;  4O4I A;  1QCE A;  4F6R A;  3ZN0 A;  3H01 A;  2HHH O;  5LMU B;  4GKK B;  3RW0 A;  3ZHS A;  1HNW O;  3CCR V;  2AE4 A;  4MS2 A;  3FD9 A;  1NH2 B;  4LFC O;  3PJS K;  3JD1 A;  4EB6 B;  2PYJ A;  1FPO A;  3CHX A;  2JGD A;  3N2G A;  3P32 A;  3APO A;  5EK0 A;  4GX0 A;  4DR2 O;  2ZT9 B;  3CC2 V;  3D3I A;  4JYA B;  4DUZ O;  1EN5 A;  2LJ2 A;  5EBL C;  4QIW F;  4MW3 A;  4JI3 B;  2K1E A;  4WBN A;  3H1H H;  2GDS A;  4U3F H;  5C8Y A;  4MVZ A;  3DC6 A;  1YTF B;  3ETE A;  1H2L A;  1N8R W;  1US6 A;  1GO3 F;  2ADP A;  3LUT B;  4UVB A;  1K97 A;  1IXB A;  2OIG A;  1Q86 W;  3AG3 C;  1W0J G;  1FFX B;  3ASN C;  3K9S A;  1P7G A;  2WYC A;  1Z5V A;  3SRA A;  2W6I G;  1I94 O;  4J7J A;  5LP6 B;  4B7K A;  4BW9 A;  3JAW B;  3K3W A;  5FPR A;  1XHZ A;  3JTR A;  3ZRX A;  1VAR A;  4J9Z B;  1FJG O;  1TUB B;  3C3T A;  4DV5 O;  4D7S A;  2DQ0 A;  2QGN A;  5LOV B;  1FYJ A;  1XNQ B;  2D2C B;  2F23 A;  1KEC A;  2CAZ C;  2EIN B;  3W7X A;  2QKS A;  3RYF A;  3ZMZ A;  4JYY A;  1N4C A;  3SGI A;  2DWE C;  1PD3 A;  4IYH A;  5KMG B;  3OTO B;  4DR5 O;  3B77 A;  3S3W A;  4OX9 B;  1K4D C;  2OYQ A;  3G6B A;  3LSU A;  1VQO V;  4DV0 O;  4YJ2 A;  4PJ0 Z;  1S0V A;  3G67 A;  1I08 A;  4A5U B;  4L8J A;  1WJZ A;  5JH7 B;  1FKA O;  1R6K A;  3RWR D;  1XMO B;  5B1O A;  2G38 A;  2JEU A;  5K1X A;  3BAB A;  4B3M B;  5CN0 A;  4FFB A;  2Y0P A;  1I7F A;  1Q81 W;  1X59 A;  4K2G A;  4DV1 B;  2CTW A;  1EBO A;  4X66 B;  5KHG A;  2IBZ H;  3M8A A;  4FLW A;  2OTJ V;  4G28 B;  4DW1 A;  3RT3 C;  2QTO A;  5LBQ A;  2Q68 A;  2CH7 B;  2YI8 A;  2XOK G;  4LF9 O;  5AG2 A;  2VRZ A;  3CSX A;  3HKB B;  2IM9 A;  1JA8 A;  1YHQ V;  1N34 B;  4E2L A;  1V55 B;  3WG7 C;  1SZX A;  3BA8 A; 
#chains in the Genus database with same CATH homology
 4RAI A;  2WLK A;  1KC8 W;  4YXW G;  2W6J G;  5EC2 C;  1RPO A;  3SRB A;  1RM1 B;  2YSU B;  3G4S V;  3LDE A;  2Q69 A;  1JJ2 U;  4JAV A;  1OR0 A;  1R73 A;  3F7Y C;  1V55 C;  1H2G A;  3T2M A;  2IJK A;  4ZKI A;  2OTL V;  1V54 B;  2DYR C;  4PA4 A;  1LNQ A;  3BEH A;  1OCO C;  2B1G A;  3CP1 A;  1SES A;  5B3S C;  3NXS A;  1VQ5 V;  3ZJZ A;  3K06 A;  3CCQ V;  1NQT A;  2X6A A;  4BAY A;  4H37 A;  1KEH A;  4XDL A;  4TSF G;  1GM9 A;  3E8B A;  1H38 A;  3W7S A;  3VOU A;  3CCM V;  3OAA G;  4RUF A;  2WAM A;  3UKM A;  1DTO A;  3B8M A;  3P30 A;  3FB8 C;  1V54 C;  2HG5 C;  1GK1 A;  2IH1 C;  5B1B B;  1XL4 A;  5CBH A;  3OUS A;  4WFH A;  4YFB A;  1VQN V;  5L3F A;  3LDD A;  3SYQ A;  1OCC B;  2UXX A;  1GK0 A;  2QM7 A;  3QO5 A;  1GM8 A;  1OZ0 A;  5L3E A;  2BOB C;  1JOY A;  2X6C A;  3UM7 A;  4UVC A;  2XAJ A;  3RBZ A;  1PKX A;  4CZZ A;  3W7W A;  1S72 V;  2V1D A;  4BTH A;  1NR1 A;  2A79 B;  2C2A A;  3K0D A;  3HPL C;  4JYB A;  3ABK B;  1GK9 A;  1NJI W;  1TUE B;  2P67 A;  1QLE B;  4N21 A;  1K5S A;  4U7N A;  3OR6 C;  1Q82 W;  4MVO A;  1XL6 A;  2HVK C;  1GM7 A;  4JAU A;  4BIZ A;  4RUE A;  3TCU A;  2QA4 V;  1F51 A;  3OGC C;  3CCV V;  5GW7 A;  1K7D A;  2EBO A;  1NVP B;  3AG2 C;  1JVM A;  3W7U A;  2WYD A;  1M9N A;  3AG1 B;  5B1A B;  4JF3 A;  2NLJ C;  2Y48 A;  4PA6 A;  2AHZ A;  3ZRS A;  3CCL V;  3LDC A;  4WFB V;  3GB7 C;  3ZMU A;  4QNH B;  1YI2 V;  3A0R A;  1VQM V;  1K5Q A;  3R65 A;  3TET A;  2Z5U A;  1NVP D;  1F4N A;  5HFL A;  2IJJ A;  3ML0 A;  5B1A C;  2EIL B;  3MD0 A;  4WKS A;  1ROP A;  4FJC C;  3ZCC A;  2LFR A;  3G6E V;  3FB7 C;  3TK1 A;  1FXK C;  1M1K W;  2EIK C;  3GWO A;  3FYE B;  1K34 A;  2HKO A;  3SPG A;  1S76 D;  3ABT A;  3OMI B;  4PDM A;  3JTQ A;  2EIL C;  2WLI B;  2GSM B;  2WSS G;  1KP2 A;  1FM2 A;  3OUF A;  4HZ3 A;  3ZMS A;  2HR3 A;  5B1N A;  2QEX V;  1KKD A;  2YEV B;  1FFT B;  1DLB A;  4KP4 A;  1I5Y A;  2Z3Y A;  5H6R A;  2WLL A;  2WYE A;  1F23 A;  2ZR2 A;  3X2Q C;  4GCZ A;  3E8F A;  3IC7 A;  4HSR A;  4JTA B;  3SYC A;  4G27 B;  2EZO A;  4LP8 A;  4ASU G;  2M7W A;  2XAH A;  1AR1 B;  3EHB B;  4PEM A;  3E35 A;  3OEH G;  1W0K G;  2EIJ C;  1AJP A;  4LCU C;  2A9H A;  3L94 A;  5LGU A;  1GTO A;  4XDK A;  1NR7 A;  1FS0 G;  3MHS C;  1OCO B;  1PNK A;  5B3S B;  3JD2 A;  1BHB A;  1E1Q G;  4MSW C;  1NH2 D;  2AE5 A;  2CK3 G;  1FXK A;  1COW G;  3D36 A;  4UXN A;  3G71 V;  4P9O A;  1JCH A;  3OR7 C;  2Q67 A;  1FXH A;  1EZJ A;  3DGE A;  4FMT A;  3IFX A;  4JTD B;  4MTO A;  1W2B U;  4PA9 A;  3K79 A;  4DO2 A;  2DYS B;  4UVA A;  4CBC A;  1PNM A;  2H94 A;  1F4M A;  3ZMT A;  1QR8 A;  3CC7 V;  5HFM A;  4P30 A;  2LP7 A;  1BL8 A;  2UXN A;  2Q6A A;  1MG1 A;  2V7Q G;  2WLM A;  2XAQ A;  3SYO A;  1JVZ A;  2WLI A;  2A0L A;  4OXS A;  2IH3 C;  5KUM A;  1R3J C;  2DYS C;  2QE7 G;  2YEV A;  2PI5 A;  1JW0 A;  1ORQ C;  1SRY A;  4E55 A;  4MTX A;  4JPR A;  1CPY A;  4ZBM A;  4QE7 A;  1MSW D;  1HWY A;  2D3O W;  1S3J A;  2IU0 A;  2XAS A;  1ZWI C;  3S8R A;  4X88 A;  3AEI A;  2P7T C;  3FB6 C;  4UV8 A;  2HVJ C;  1H8H G;  4UV9 A;  3VBB A;  4PA3 A;  2OCC C;  3I55 V;  1IXM A;  3DTU B;  4PDR A;  4K2F A;  2ZDI C;  4WFF A;  1K8A W;  3AG2 B;  1E3A A;  3AG4 B;  1YJN V;  1AI6 A;  3SRC A;  2PI4 A;  1GHD A;  1YSC A;  3E89 A;  2WLL B;  1JPX A;  3SPH A;  2B1I A;  3JD0 A;  4PDL A;  4M1J A;  3LNM B;  2IW5 A;  2OT5 A;  1UJW B;  3WFV A;  4R7C A;  4WKV A;  4RQF A;  3FB5 C;  3F5W C;  2HFE C;  5IY5 C;  2Y69 C;  4J9Y B;  3JD4 A;  3E83 A;  3CC4 V;  2R9R B;  3LSQ A;  5CMU A;  3OW2 U;  3AG4 C;  4X8A A;  3T1C A;  2IJH A;  3CCU V;  3E8G A;  4MTF A;  4RO2 A;  3ZRW A;  1QBZ A;  1L1F A;  1GKF A;  4JAS A;  5IYC O;  3SPC A;  1R3K C;  4N23 A;  2X6B A;  1FXK B;  3MHH C;  3OMA B;  4I5S A;  2LFS A;  5H9C A;  1FXV A;  5L3G A;  4YF9 A;  2EIN C;  1GMG A;  1M57 B;  5LHH A;  2EIK B;  3ABM B;  1WPX A;  3ETD A;  4QPJ A;  4HAM A;  5CBG A;  3CCS V;  3ZN1 A;  4WKU A;  4KUM A;  1JQ0 A;  3CYO A;  4E56 A;  3FKS G;  2NNU A;  2X0L A;  1KD1 W;  4BIU A;  1NBM G;  2BOC C;  1VQP V;  3ZMV A;  1VQ8 V;  5H6Q A;  2P90 A;  4JTC B;  2ITC C;  2ZDI A;  1R3I C;  3CXC U;  3K0G A;  1Y66 A;  3BY6 A;  1MOF A;  4L87 A;  4P9P A;  3JCZ A;  4X89 A;  5IDJ A;  2WYB A;  1M57 C;  1OHH G;  3ABM C;  3X2Q B;  3ZRV A;  2EIM B;  2DW4 A;  3IGA C;  3LSS A;  1P7B A;  1S77 D;  3FYI B;  1K4C C;  1QCE A;  3RVY A;  1DF5 A;  3ZN0 A;  3H01 A;  2EIJ B;  2ZD9 A;  3K04 A;  4EKW A;  5BZB A;  3OMN B;  3RW0 A;  3STZ C;  3CCR V;  1YIJ V;  3ABL B;  4I9W A;  1QVG U;  1DF4 A;  1G8M A;  1RPR A;  2EIM C;  3ETG A;  4MS2 A;  4PA7 A;  5EBM C;  3SPJ A;  2AE4 A;  1Q7Y W;  1NH2 B;  4WFE A;  3T4D A;  3PJS K;  2WLJ A;  3JD1 A;  4MVR A;  2ITD C;  5LHI A;  1M56 B;  2XND G;  1K73 W;  3P32 A;  5IYB O;  5EK0 A;  4GX0 A;  3CCE V;  3ABL C;  3M99 B;  4H33 A;  3CC2 V;  3D3I A;  3STL C;  5EBL C;  4QIW F;  4MW3 A;  2K1E A;  5C93 A;  3I56 V;  4R8C A;  1BMF G;  5L3C A;  3CME V;  1M56 C;  3QO8 A;  1K3E A;  3CMA V;  2XAG A;  4PDV A;  3E2E A;  4WKT A;  2XAF A;  1Y4M A;  4MVZ A;  4WCE V;  1R6N A;  1K33 A;  4P2Z A;  1P4R A;  3ZRW B;  3ASN B;  1YTF B;  3SJQ C;  2EJR A;  2W0F C;  1CP9 A;  1SET A;  3ETE A;  3SYA A;  1N8R W;  1VQ9 V;  2EZP A;  2ATK C;  4U7O A;  2H8P C;  3QO7 A;  4XBF A;  1CEZ A;  1GO3 F;  1SZT A;  2IJI A;  3LUT B;  1H8E G;  4UVB A;  5J9P C;  1VQ6 V;  1AJN A;  1K97 A;  4MVQ A;  4MVM A;  4MTG A;  4Q20 A;  1Q86 W;  3AG3 C;  1W0J G;  3SYP A;  2OCC B;  4FIP C;  4YFA A;  1YTF D;  3ASN C;  3HB3 B;  5DM6 V;  2QM8 A;  5CA3 A;  1QR9 A;  3JD3 A;  4FPP A;  2AE3 A;  2WYC A;  3SRA A;  2W6I G;  3E8H A;  2KB1 A;  3QNE A;  1RM1 C;  2MK3 A;  2WPD G;  1OCR B;  4FK5 C;  5KA5 A;  1VQL V;  1VQ4 V;  1BHA A;  5IY5 B;  2Y69 B;  3K3W A;  2HLD G;  1THZ A;  5LGT A;  3JTR A;  4GX2 A;  3ZRX A;  2R9I A;  4J9Z B;  3RVZ A;  1J95 A;  2DQ0 A;  5EBW C;  3CPW U;  1JX9 A;  1M90 W;  2JIZ G;  4GX1 A;  3L91 A;  4DXW A;  1QVF U;  1OCR C;  4E57 A;  2P6J A;  1KEC A;  4QJF B;  5CBF A;  2EIN B;  3K9A A;  3W7X A;  2QKS A;  3ZMZ A;  3JYC A;  5FL7 G;  1G4Y B;  4MVS A;  5B1B C;  4JYC A;  2AHY A;  1YJ9 V;  1E79 G;  2DWE C;  1PD3 A;  4QE9 A;  5E1A C;  1ENV A;  1OCC C;  2JJ2 G;  1E1R G;  1VQK V;  3B77 A;  4MT8 A;  2JEX A;  4HYO A;  4R50 A;  2FTK A;  1K4D C;  4TWK A;  3CCJ V;  4PEL A;  2ADV A;  3W7T A;  1WLE A;  1R3L C;  5L3B A;  3B8N A;  1VQO V;  1MAB G;  3OM3 B;  3KG2 A;  2GHY A;  4QPK A;  5KA6 A;  1S0V A;  1S5H C;  3ABK C;  3OFN G;  1QLE C;  1I5X A;  1PNL A;  1R6K A;  2F43 G;  2X7R B;  4JGS A;  1YJW V;  5B1O A;  4LBE C;  4LC1 A;  3K08 A;  2IU3 A;  4Z1M G;  4GX5 A;  4XDJ A;  2JEU A;  1AI5 A;  2ZXW B;  2WLN A;  5CN0 A;  1SER A;  2DWD C;  5LHG A;  5L3D A;  3AG1 C;  3OE7 G;  4KFM A;  4MW8 A;  2WLH A;  1Q81 W;  4K2G A;  4F4L A;  2JJ1 G;  2ZQM A;  1EBO A;  1KP3 A;  3EFF K;  4TT3 G;  1AI7 A;  1PL0 A;  1NKD A;  1YIT V;  5EC1 C;  2ZXW C;  1VQ7 V;  2OTJ V;  4UUJ C;  3CD6 V;  1ARO P;  3OEE G;  1EFR G;  4G28 B;  4G2K A;  4HST A;  1OCZ B;  4WFG A;  2ZR3 A;  2QTO A;  1QLN A;  1K9M W;  5LBQ A;  2B5U A;  1AI4 A;  4GT1 A;  3ZIA G;  2Q68 A;  1K92 A;  3ASO B;  3F7V C;  1KQS U;  3WG7 B;  2XOK G;  4R6Z A;  3E86 A;  4WFA V;  1YHQ V;  1OCZ C;  2DQ3 A;  3K03 A;  3SPI A;  5DN6 G;  4WF9 V;  2WWW A;  1AJQ A;  1B6Q A;  3AG3 B;  5IYD O;  4RQE A;  4MVU A;  4E2L A;  2JDI G;  1V55 B;  3ABU A;  5KUK A;  3T4Z A;  4BW5 A;  2DYR B;  2HJF C;  3ASO C;  3WG7 C;  5LGN A;  2JK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...