3K3WA

Thermostable penicillin g acylase from alcaligenes faecalis in orthorhombic form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
QVQSVEVMRDSYGVPHVFADSHYGLYYGYGYAVAQDRLFQMDMARRSFVGTTAAVLGPGEQDAYVKYDMQVRQNFTPASIQRQIAALSKDERDIFRGYADGYNAYLEQVRRRPELLPKEYVDFDFQPEPLTDFDVVMIWVGSMANRFSDTNLEVTALAMRQSLEKQHGPERGRALFDELLWINDTTAPTTVPAPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Penicillin G acylase
publication title Crystallization and X-ray structure analysis of a thermostable penicillin G acylase from Alcaligenes faecalis
doi rcsb
source organism Alcaligenes faecalis
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 3.5.1.11: Penicillin amidase.
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.150 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k3wA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3k3wA01
1AI7A 2AE4A 3SRBA 2WYBA 1K5SA 1PNMA 4M1JA 4YFAA 2WYDA 1JX9A 1GKFA 2AE5A 3S8RA 1H2GA 4WKSA 4WKUA 4HSRA 1FXVA 3SRAA 1GM7A 1AJQA 1AI4A 1GK0A 2ADVA 2WYCA 1AJPA 2WYEA 4K2FA 1K5QA 1FM2A 1KEHA 1CP9A 3ML0A 1JVZA 4PELA 4E55A 4E57A 4K2GA 1GM8A 1K7DA 2AE3A 4PEMA 1JW0A 3K3WA 3JTRA 1AI6A 4WKVA 3L94A 4YF9A 3SRCA 1OR0A 1PNLA 3JTQA 1GK9A 4WKTA 4HSTA 1AI5A 1PNKA 1GK1A 1FXHA 4YFBA 4BTHA 1GHDA 1KECA 4E56A 1E3AA 3L91A 1GM9A 1AJNA
chains in the Genus database with same CATH superfamily
3AG4C 1AI7A 2VQFB 2G38A 1N8RW 4YFAA 4WKSA 1XMOO 4O2AA 1BQ0A 3ZHTA 1T5EA 3U10A 1K97A 2YEVB 5KMGA 2UUBB 3I55V 4IGGA 1K73W 3LDCA 4NKGB 2QWRB 2KQXA 4NB5A 4CC6A 3DC6A 4MT8A 5CMUA 2X6AA 5LMNB 4NXMB 2Q4PA 1P4RA 2YDEA 1HNZB 2HHHO 3CP1A 1EN6A 4PDMA 1FAFA 3JD0A 3CRAA 1N0JA 4JAUA 3CD6V 4KUMA 4UFZA 4ZHQB 2OT5A 1JVMA 3WG7B 3B40A 2B9ZA 1V55B 3G6BA 1N33O 1FD9A 4HZ3A 3TETA 1Y74A 4GX0A 5CA0A 1FXKA 4MVQA 3EFFK 3OMNB 1AJPA 1AR5A 5LP6C 4I9QA 4YHHB 3G71V 3SPJA 2EIJC 1CXZB 4HYOA 3D3QA 3ZRWA 3ZMTA 1GK1A 2EIKC 3EVKA 1NH2B 2RMKB 3SJAC 1FFTB 1S76D 1JX9A 2R9IA 4UCOA 3MD0A 4GCZA 1BL8A 2AGAA 1Q6IA 4LR3A 3UO2A 3JASA 1AI4A 1ORQC 3UKMA 4LF7O 1XL6A 4X65B 1N36B 4CS2A 1WA8B 1E79G 1PPJH 3CCJV 2YUAA 1M90W 3G80A 4B08A 2X7RB 3M99B 1DTOA 3AG3C 4YJ3B 3BEHA 4ZBMA 4LFBO 1NQTA 4B3TB 4OPAA 1WB8A 1Z5VA 4K2FA 2AHZA 2IBZH 4J9ZB 4X1KA 1CP9A 4FIPC 2XUMA 1YITV 4OX9B 2DJVA 1IBLB 4DV1O 4NXNB 3ZHSA 1MZFA 4PA7A 3KZIZ 4YFBA 3OEHG 4GKJO 4H13B 4IL6Z 3RBZA 1N32B 1QBZA 2LGWA 4TUYB 3SRAA 4FJCC 4JI0O 5C8YA 1K5QA 1OCCC 5B1OA 1XMQO 2E5LB 3N2KA 5LGNA 2Q67A 3CEIA 2EULA 2BOBC 5L3FA 3G67A 3LUTB 2JEUA 1PV0A 3ZHQA 3LNMB 5IYZB 4GUNA 1SS3A 3JAWB 2ARHA 3C90A 3HKDB 3JYCA 4FFBA 1K4DC 3K9AA 2ZR3A 4JI3O 1SQPH 3ML0A 3K79A 2B5UA 1Q43A 1JW0A 2BCCH 4Z2WA 5FNVB 4U3JB 4JI4O 1PNLA 4X1IB 3K57A 1G4YB 5L3DA 1DK1A 4KHPO 2QE7G 2VWJA 1AR4A 2XAHA 4DR3B 1K4CC 1MSDA 3ZX6A 2CTQA 3JARA 1JVZA 1NVPB 4ASUG 4DV2O 1QLEB 3APQA 2ZE6A 5BMVA 3GB7C 2EIMB 4UCTA 1RP3B 4WFBV 1EN4A 2F4VO 2WLIA 5BY1A 3OD4A 5CN0A 3VQXA 4WFEA 5JJEB 3CXHF 1HWYA 4YIOA 3ZMZA 2Y4TA 5DEDA 4ZKIA 2ZXWC 1YF2A 1JFFA 3SPGA 4E57A 1H8EG 3SPIA 2F43G 5IWAB 4GKJB 4K35A 2ZIMA 3ETEA 5KUKA 2XASA 1E3AA 2Y0PA 4FPPA 1F51A 4PI2A 3CX5F 4JZGA 4K8ZA 3FB8C 2BTQA 3ZIAG 2OCHA 4UV8A 4DV5O 3R66A 3K04A 1FXKB 1DGSA 1SQBH 2W6IG 5BXZA 3L74H 1SQXH 2UU9O 1QVGU 1KKDA 4C7UA 1SQVH 4MVMA 3CYOA 2QM8A 1ENVA 5LGUA 3ZRWB 4LWSA 4O4JA 2WA3A 5KHHA 2VRZA 2M6YA 2RCVA 4LH6A 1XREA 2EJ7A 3BA9A 1KYOF 1G8MA 3JASB 2CAZC 2P4VA 2B1GA 5EC2C 4DV7B 3L72H 1JA8A 5KLVH 2X0LA 2ZDIC 5CA3A 2DYSC 2UXDB 4FZ1A 1KUQA 3ICXA 5GW7A 3LSSA 1YI2V 4WBNA 1B04A 3OGIB 1TA8A 1R3IC 3FGRA 2Q7GA 4DV2B 5IYBO 3PJSK 5JCOC 3B2EE 4E4EA 3CCUV 1FPOA 3K5NA 4X1KB 5B3SC 1TGOA 2QSAA 4O4HA 2F4VB 4FM0A 2OTJV 1TVKA 1IBMO 1NTZH 5J2TA 1KECA 4OXSA 1YJWV 2XT9A 4GX5A 2PY5A 3O65A 4R8CA 4J11A 2P22C 5C8YB 1W59A 4MVZA 3UM7A 3N2KB 4O4LA 3C3SA 4DV5B 3VQVA 3L91A 1QHTA 3RYFB 5IY5B 2W0FC 1YZBA 3ZJZA 2ZR2A 1LUVA 3BCCH 3K0DA 4JI8B 1SC5B 3GWOA 1GK0A 3VOUA 5ITZA 1DF4A 1ZUQA 4TQFA 1Y76B 4FFBB 2PI4A 2GTAA 1SETA 4DR6B 4UV9A 4P2ZA 1Y66A 1WAZA 2VS0A 4YIPA 3TGUH 2QA4V 3JATB 2A0LA 2PYLA 4JPRA 2P5OA 2WYDA 3WG7C 2F66C 1V55C 2Q5ZA 5IJ0A 5BR8B 4LBEC 1IXBA 1YCIA 3CCQV 3ASOB 4JTDB 3RN4A 2P6JA 4ABMA 1OZ0A 2BOCC 5BMVB 4IIJB 5CBHA 3ZHUA 4H37A 2XAQA 2JS3A 1XNRO 4WCEV 2WLIB 3BAAA 3CC7V 2ZE8A 1AVMA 4UVCA 4DUZB 4MSWC 3OFNG 3N27A 1H2MA 1JFFB 4PEMA 1D5AA 3JD1A 4I9WA 4FLWA 1E1QG 4TV9A 4NTYA 1SERA 2HKOA 1N34B 3ETQA 4LH7A 4AQYB 1SQQH 1SA0A 4EB6A 1VARA 1ZSPA 5DECA 1AP6A 4YY3B 4DR1O 2BTQB 4JGSA 4FLXA 2QM4A 3UCSC 3WU2Z 4JI5B 2BE3A 4DV4O 1HNXO 4P9PA 1K7DA 4PA9A 3KCYA 4FM1A 2QWOB 3ABMB 2Y48A 3KKYA 4X62B 3OW2U 1US6A 5D5QA 2CUGA 4U7OA 3HKBA 4LWSB 4MW3A 4JV5O 4O4JB 2AW9A 3BFRA 3DGEA 2FB5A 5CBFA 2PTMA 2VQFO 4FLZA 1CPYA 1B06A 2DE0X 3A0RA 1K8AW 2OCCC 4W4KA 3OMAB 4B3MB 3JSLA 4I0XA 2UUBO 3RWRD 3BHPA 4PI0A 1BZKA 2HVJC 4BWAA 5E79Z 4WBNB 4EKWA 1ZTEA 4D6TH 2OWOA 1RM1C 2GV9A 5LMNO 4CH6A 4RUEA 1GAXA 1LUWA 1HNZO 3CB2A 4CH4A 5F2VO 1JR9A 4O4HB 4CZZA 5IYCO 1OCZB 5J2TB 3VBBA 1FKAO 4LFCO 3S3WA 2UXXA 2Q68A 3NXSA 4XBFA 3M8AA 4NR1A 4PDLA 2WYCA 3T4DA 2IH1C 5LBQA 3MHHC 2F93B 2D2CB 4FK5C 1H8HG 1IVSA 4O4LB 1BHAA 3K5OA 4AHCA 1QLEC 3LSQA 2DQ0A 4RWUA 4DV4B 2EIMC 2NLJC 1MG1A 4FVMA 2ZM6B 1FJGB 2JS5A 2NNUA 1NH2D 2IJIA 3UT5A 5ITZB 3W7SA 1Q86W 3QG5A 1M56B 5FL7G 2ODMA 2R9AA 3B8NA 4GX2A 5JWPA 4BW9A 1GRJA 2QKAA 4PA4A 3G6EV 5H2FZ 4X65O 2DOSA 1N36O 2C2AA 2XAGA 2ITDC 3ZMUA 4GKKB 2EX3A 4NTXA 3CCRV 1NJIW 1BCCH 1HR0O 1S0VA 1XEQA 2PI5A 4HSRA 1JQ0A 4G28B 5IJ0B 3SYOA 2DWDC 1H2SB 3N2GB 2UXNA 4R7CA 3SJQC 1FXKC 1V9PA 4B3TO 3ZHRA 3E86A 4TSFG 1P84F 1QQCA 1AI5A 2LW7A 4IHJA 4OX9O 2YS8A 2Q8VA 5GTIZ 1IBLO 3NR7A 4NXNO 3MAQA 4JAVA 2LFRA 1I94O 4NTWA 1R73A 2JJ2G 1N32O 2XNDG 2UXCB 2VQEO 4LFCB 3F7VC 4TV9B 1YJNV 2E5LO 1AJNA 1GN4A 1GO3F 3CMAV 1XILA 2HJDA 1SA0B 2Q0OC 3TJTA 2LP7A 2YIBA 5EZYB 1FXVA 2H94A 1RPRA 4DUYB 2Q6AA 1VF6A 1IURA 3DXRA 4X20B 4X1YA 1P49A 5CB4A 1EZJA 1Q6HA 4DV3B 4EEQA 1H2NA 1QNMA 4ZI7A 1M57B 2P4KA 1E1RG 3E2EA 5A9GA 3Q4HA 4WFGA 2Y69C 2HVKC 1YTFB 1XHXA 3UQ8A 1HP8A 1K3EA 2LQTA 4AILC 3K58A 5JQGA 1M9NA 5J2UB 2ETNA 3SRCA 4DR3O 3CCMV 2FTKA 2EZOA 1HR0B 3J80N 3U0ZA 1XHZA 3IAYA 4TV8A 1I5YA 3E83A 2HJFC 1MNGA 4I0XB 1PD3A 2EILB 2GSMB 1VP7A 4Z1VA 1NVPD 3BVOA 4I55A 5LHGA 4MVUA 1VEWA 1SRYA 1Q82W 1M5IA 3D8CA 5IY5C 4O2BA 2JIZG 1L0NH 3D36A 2QTSA 2KSDA 2QJ1A 3E22A 4TWKA 4PDRA 4W4LA 1RPOA 1I5XA 2HLDG 1I94B 4Z1MG 4BWCA 1NZ6A 3FX7A 1MZEA 3TCUA 5EBLC 5IWAO 5LGTA 5LMUB 4J80A 3OEEG 3BABA 2H8PC 4LCUC 2VQEB 4EFBA 2LGQA 3H9VA 4LF9B 3K3WA 1AI6A 5LYJA 3ASOC 3QVNA 2KKWA 4DV6O 1I7FA 4HBNA 1TAEA 1R3KC 2ILMA 3F5TA 5FPOA 3CRQA 3A0HZ 2PGGA 1W2BU 3UT5B 3OT7A 3HB3B 4IT5A 1W0JG 3CC4V 2HR3A 2JEXA 3ASNB 4L87A 4CBCA 4DW0A 1MSWD 1PNKA 5EBWC 5EC1C 3QTCA 4DV7O 1LNQA 5HFMA 2A3QA 2UXDO 3LSUA 1YHQV 2MK3A 5FLXN 1IXMA 4O2AB 1IBKO 4KXRA 2RJZA 5KMGB 1YJ9V 3ETGA 1OCRB 1OCOB 4QGPA 1URFA 2IM9A 1UJWB 2Q73A 4IHJB 1DF5A 3CWBH 3AG7A 2RNBA 5A2QN 3RYCA 3ZN0A 3FFQA 3JD4A 3CPWU 1VQ9V 2GTSA 3RYHA 3SJBC 2V7QG 1TUBA 3G4SV 4FLVA 2ZE7A 4M1JA 1KMIZ 4DR2B 2DYRB 1M4UA 3QF7A 3K03A 1Y74B 5CA0B 3K0GA 5CA1A 4JI7O 4ICGA 4FMTA 2EZPA 4JI8O 3P32A 4DV6B 4H0LB 5CB4B 1QR8A 4DRXA 1HDJA 3A2FA 4MTOA 4DR6O 4JTCB 5LOVA 3QNEA 5IT9N 2EINB 1H2LA 1S5JA 3Q4HB 3GVMA 3JALA 2A9HA 1OCZC 4NVPA 5LXTA 2P90A 4JI1B 4J42A 1GTOA 5LHHA 4LC1A 1KC8W 3ABLB 4RUFA 1RFYA 1YSCA 5JQGB 2K9PA 5BR8O 2CK3G 1QR9A 2ITCC 1VF5B 1PL0A 1GH6A 2HFEC 5EYPA 3OE7G 1SESA 5EK0A 3M7MX 1BS3A 4FLYA 4IYIA 1R6KA 2ZCEA 4I55B 1IBKB 1GM7A 1W0KG 2L35A 4OGQB 2OIGA 3FYIB 4N21A 4B7EA 3H1IH 2YI9A 1S5LZ 3F5WC 2DWEC 1K9MW 4DUZO 4HNAA 3ZS8C 1NR7A 4D7TA 4NYKA 1M56C 4PA3A 1GHDA 3JD2A 2EJRA 4DR7O 5JH7A 2AE5A 1N34O 3U11A 4PD4F 4AQYO 2E76B 2ADVA 3WB2A 4YY3O 2Y4UA 3CRRA 3L94A 1XDCA 1XL4A 4B7KA 3IC9A 3CE2A 1P7GA 4JI5O 3RVYA 4BTHA 3TXSA 5LYJB 5L3GA 1R1BA 4XDLA 1FFXA 1WNSA 4X62O 1THZA 2JGDA 4XDJA 4JI7B 3C3TA 3QO7A 4JYAB 3ZBHA 1AJQA 5JVDA 2YI8A 2YXLA 4J10A 5GONA 3FD9A 4MVRA 3RW0A 3B77A 2JJ1G 4LF4B 3JAKA 5JCOA 3SRBA 4MTFA 3T1YB 2LFSA 1AROP 2QKSA 1UFIA 4OPHA 1F23A 2V4DA 4B3MO 1WPXA 2BTOA 3E35A 3SYCA 1WPBA 3HKCA 1G6UA 2WYEA 1NKDA 2W6JG 4GZRB 4QIWF 4PA6A 1AR1B 5B5EZ 3JARB 3STLC 1NR1A 2ZE5A 2YXHA 3RYIA 2Z0AA 3AEIA 4FLTA 4G2KA 3K08A 3KCXA 3UO3A 2BSKA 3W7TA 2L6LA 1M57C 1KQSU 3RYCB 3AK1A 3S3XA 4JAAA 1H2KA 3B8MA 1GMGA 1OJHA 4QNHB 1QLNA 2Q9LA 2CH7A 2X6CA 3K5MA 4PDVA 4DR7B 1K5SA 1BHBA 3SJCC 2QKCA 4J7KA 2EILC 4UVAA 3RFRA 3IFXA 3CCSV 3RT3C 2KG7A 4BIOA 3FB5C 2ZM6O 1FJGO 2PF4E 4DO2A 1MABG 4WFHA 1L0LH 3TK1A 1AILA 3VQWA 4H44B 4X88A 4X9QA 1VQOV 2WLKA 4XDKA 3SR2C 4YJ2A 4UB8Z 1U97A 2R9RB 2X6BA 2JDIG 1QU7A 4L8JA 1QVFU 1FM2A 3AK3A 2XOKG 4GKKO 3ABTA 1UPGA 2Z5UA 4DW1A 3FB7C 3L75H 1EZVH 4BW5A 3T1HO 3A0BZ 4J7ZA 5FPRA 3ZMSA 4UVBA 4I50A 5EYPB 1PNMA 2RN9A 1ZAUA 4JI2O 2ZXWB 1SZXA 4RO2A 4D7SA 4J9YB 2UUCB 4CS3A 3IC7A 3SDLA 2A7WA 1NI8A 4QE9A 2AHYA 4BIZA 1VF7A 2XAFA 2VWKA 1ROPA 5TISZ 4BR6A 5GTHZ 1XQ8A 1TVKB 3CCLV 2UXCO 3ASNC 2IU0A 2PYJA 3FYEB 5JH7B 1Y67A 5H5NA 2P67A 2QWQB 4U3FH 2B1IA 4JI6B 5H6RA 4DUYO 1EM1A 2IJKA 3APOA 3F7YC 3T1CA 5B1AB 4GX1A 3T2MA 4DV3O 4KL1A 1FFXB 1OCRC 1OCOC 3STZC 2JGDB 3CJHA 1S72V 3QO8A 4CH5A 3ZN1A 3K06A 3SPCA 2DYSB 5JVDB 5B1BB 2YSUB 5GONB 2ZINA 2QGNA 2HP8A 1YTFD 1I08A 3JAKB 1M93A 3CXCU 3ABKB 3E8GA 2AZ2A 1QCEA 2ZQMA 2Q0AA 4E2LA 3T1HB 1KKCA 4E55A 2DYRC 1VQ5V 3MHSC 5EIBD 2W0XA 3VQYA 1Q8IA 3RGBA 3JTRA 4JI2B 1YVWA 3ZRXA 5KHIA 1I0HA 2UXBB 2IU3A 1XNQB 2AE4A 1KU9A 2IW5A 4JASA 4JF3A 1YXBA 1ZWIC 2N05A 1L1FA 2BSKB 4X8AA 2Q7EA 3K9SA 2EINC 5LMUO 5L3BA 3WB0A 1VIBA 3I56V 1SKVA 2CH7B 1N4CA 2UUAB 5JJNB 3OR7C 3H1JH 3ABLC 1J95A 4LF9O 3P3PA 1SZTA 2Q7HA 3IJ4A 4EB6B 3JAMN 3L71H 3BY6A 1KP2A 2ZD9A 4K8XA 2R70A 2GHYA 4UCUA 4WF9V 1MMMA 2NR5A 4UCSA 1IDSA 2KG7B 2WA4A 2ZNIA 2DQ3A 5KX5A 4I7ZB 4DR5B 3D36C 5C93A 5BZBA 1J5EO 1K92A 4LF5B 4KFMA 3H01A 3HKBB 4J7JA 4YJ2B 4GT1A 1Q5OA 1AB3A 2O57A 2Q69A 2E74B 1L8DA 4P9OA 3OTOB 1R6TA 4UCVA 3X2QB 3L73H 4LF6O 1HW7A 3CHXA 4RQFA 2F23A 2JVDA 4I50B 3B09A 3P3NA 4BIUA 4AI8A 1LR1A 2PZSA 1NBMG 4X64B 3ZRSA 4DYLA 1K33A 4UUJC 1K34A 1OHHG 3DC5A 5JJJB 5KA6A 1GN6A 4B3SB 4KP4A 2WWWA 3MDSA 4P30A 4GYCB 4JYYA 1XMOB 1B6QA 5LP6A 4FLUA 3EHBB 3CSXA 4ZOLA 4CC5A 4UCRA 3AG2B 2ZNJA 3GWKC 3E8FA 1S5HC 5LA6A 2FKXA 2GDSA 2YC0A 4DR2O 2F1MA 4K2GA 3T4ZA 3OUSA 4PJ0Z 1F4MA 4N23A 3LDDA 2YIBD 4R6ZA 5KHKA 1GM9A 2HHHB 1TUEB 2GUZA 1JJOA 3DSQA 4MW8A 4QE7A 1EN5A 1OV9A 4FFKA 4MS2A 4WFAV 3CJHB 2OCCB 4GLXA 1D2DA 3EXAA 1BGYH 3JSNA 2R72A 3SPHA 1J5EB 1N33B 1OR0A 3W7UA 4JI1O 5KHGA 4BAYA 3RYFA 2Z3YA 4F6EA 1RM1B 1V54B 2IJHA 1NTKH 1FS0G 4WFFA 1MOFA 2IH3C 4DK1A 1Y76A 1XBLA 1S77D 2P06A 4LF6B 4F6RA 1WB7A 3JATA 2AE3A 1VQ7V 1JMKC 5D5PA 2A06H 2GBOA 4LF7B 2ZKOA 3ABMC 2HEPA 3OUFA 4JZ2A 2WLLA 5CBGA 2ZT9B 2FMLA 5DN6G 4LFAO 2OIEA 4PV1B 3FGTA 4IIJA 3OM3B 5K1PA 3WB1A 4Q6GA 2OYQA 4LFBB 2CGOA 1IX9A 1Z2GA 1RSOA 3S8RA 3OGCC 4FM2A 4DV0O 4DV1B 3CCVV 3AG1B 3HPLC 4F4LA 1Z5WA 3DXRB 1XUQA 2KB1A 1PM9A 4UXNA 4JYAO 3AG4B 4X1YB 4I4TA 1GN2A 3AK2A 1CEZA 3CRMA 4JTAB 1NTMH 1SQFA 4LNUA 5KX5B 4JI0B 4ZI7B 2ZIOA 2WYBA 1XMQB 4LF4O 2WLMA 2Y0IA 2DMXA 4CH3A 2OTLV 5L3EA 3T1YO 2N74A 3TXQA 1BT8A 3OMIB 1FYJA 4WKTA 4HSTA 1ZL8A 2QWPB 3BA8A 3A8TA 2WLJA 4TT3G 5E1AC 1VQ8V 3CC2V 2AZ0A 5KUMA 1YIJV 1ZX3A 3J7AU 4JI3B 4TV8B 3ZCCA 5B1AC 5IJ9A 4JI4B 4QPKA 3SGIA 3ZMVA 4CS4A 1Q3EA 3CMEV 2ADQB 4O2BB 4KHPB 3E22B 1PP9H 5B1BC 1VQ6V 2CE4A 4X66O 1JPXA 2QR4A 1BSMA 2YIDA 1VQNV 3E89A 3FB6C 5LP6B 4I5SA 1GKFA 4ZOLB 4LFAB 1ZLZA 2EIJB 2QM7A 1NU1H 3HKEA 4MTXA 2HG5C 3ABKC 3WFVA 5LA6B 2EIKB 5IDJA 3SYPA 1EBOA 5B1NA 4WKVA 2CTPA 2Y69B 2WPDG 4RQEA 1VQLV 3LNNA 4DV0B 3B4SA 1VMGA 4X89A 2XTAA 2YXYA 2GUZB 3FAVA 1VQ4V 3SYAA 1O9HA 3R65A 2ZDIA 3H1KH 3P30A 4MTGA 4O4IA 3L9DA 5HFLA 1Q6UA 1GN3A 4ZIBA 1XOUA 5H9CA 4YF9A 1A32A 3AG3B 4PHZA 3ZHVA 4LF8O 3JTQA 2D3OW 4B3RO 2H3OA 4DXWA 1VQMV 2EBOA 3E8HA 1BE3H 2QWNB 1S3JA 2UU9B 2LO1A 2RDCA 2QDOA 4HAMA 3QO5A 5J9PC 1KD1W 1M1KW 3OTFA 1P7BA 1GM8A 2UUCO 4F6RB 1PL4A 3J81N 2AXTZ 2WAMA 1DLBA 1XI1A 3D3IA 4UB6Z 1KP3A 1AP5A 1OCCB 2FYUH 2FL4A 4WKUA 1JOYA 2F95B 2WLLB 3LDEA 3N2GA 4EFEA 3CRCA 4K3AA 2YEVA 4X66B 3W7XA 1VQKV 4YXWG 1JJ2U 1COWG 1X59A 3RYHB 4H33A 1Y4MA 2YIAA 5AG2A 2DN9A 1TUBB 4R50A 4G27B 3X2QC 4JI6O 2RQ6A 2DW4A 2CTWA 2LW1A 2MW2B 1Y6XA 1RSOB 4FZ0A 1MA1A 5EBMC 2PUSA 1IBMB 5L3CA 5EIBC 4PELA 3K5LA 1PKXA 5KAIZ 1KBHA 1NT2B 1R3LC 3RVZA 4ZHQA 5CA1B 5IYDO 2A79B 3H1HH 2K1EA 3OR6C 4I4TB 3SYQA 3L70H 3H1LH 4DRXB 3OAAG 4LNUB 1D5NA 3K59A 2V1DA 4DK0A 2JRIA 5EZYA 3THOA 5H6QA 1B3QA 5LOVB 5B66Z 4X20A 2IJJA 1HNWO 4K0KO 3JALB 3AG2C 4LF8B 4DR4O 5KAFZ 1F7YA 5LXTB 4TOIA 4B3RB 2WLHA 2WLNA 5IE9A 1Q7YW 5DM6V 5KHJA 3HR0A 3JD3A 1BQZA 1GK9A 3CCEV 4E56A 1YEWA 1ZL8B 4QJFB 2CGNA 1WLEA 1R6NA 1WJZA 2E3CA 2UXBO 2JK5C 3ABUA 2NN4A 4MVSA 1XNQO 5J2UA 1O9GA 1KEHA 5IJ9B 1WA8A 5KA5A 1U96A 1N0NA 4QPJA 2N04A 3BRCA 3KG2A 4HNAB 1WN7A 4TQDA 1EFRG 4YJ3A 1X4TA 2XHBA 2UUAO 1SF9A 2CTRA 2JGUA 4J41A 3ZEDA 2P7TC 1YDXA 4JYCA 1V54C 4NXMO 1IZ3A 1G1XB 3HKEB 5LL6Y 2QTOA 2QEXV 1JCHA 1XNRB 2E75B 1FXHA 4JYBA 3E8BA 3IGAC 5K1XA 1BMFG 4TUYA 1H2GA 1SQGA 4DR5O 3FAVB 4IYHA 1F4NA 1Q81W 4LF5O 3ZRVA 3CS5A 3PN1A 4O4IB 3I5DA 1R3JC 1WP8A 2YICA 2WSSG 4DR1B 4MVOA 4YHHO 2LJ2A 4U7NA 3OTOO 2CDYA 2XAJA 4Q20A 5IYZA 3W7WA 1HNWB 3DTUB 4K0KB 4RAIA 3JAWA 5LHIA 1HNXB 3O9OA 4DR4B 1Q90D 1H38A 2ADPA 3HKDA 2M7WA 2ATKC 5B3SB 3FKSG 1WP7A 1VQPV 3HKCB 3JCZA 1NS1A 3JCUZ 4X64O 4LP8A 5FNVA 4U3JA 4X1IA 1KB9F 4JV5B 3BPZA 3AG1C 4A5UB 1VF6C 3ETDA 3RYIB 4B3SO
chains in the Genus database with same CATH topology
3AG4C 1AI7A 1TUEB 1N8RW 4YFAA 4JGSA 4MW8A 4QE7A 1R6KA 4WKSA 1GM7A 4MS2A 4WFAV 2OCCB 1W0KG 3FYIB 4N21A 4P9PA 1K7DA 1K97A 2YEVB 4PA9A 3SPHA 3I55V 3F5WC 2DWEC 1K9MW 1K73W 3ABMB 1OR0A 2Y48A 1NR7A 3LDCA 3W7UA 3OW2U 4BAYA 1M56C 4PA3A 1GHDA 2Z3YA 4U7OA 5CMUA 4MT8A 1RM1B 3JD2A 2X6AA 1V54B 2EJRA 2IJHA 4MW3A 2AE5A 1FS0G 1P4RA 4WFFA 1MOFA 2IH3C 3DGEA 2ADVA 5CBFA 3CP1A 1S77D 4PDMA 3JD0A 4JAUA 1CPYA 3CD6V 2AE3A 3A0RA 1VQ7V 4KUMA 1K8AW 3L94A 1XL4A 2OCCC 2OT5A 1JVMA 3RVYA 3OMAB 4BTHA 3WG7B 5L3GA 1V55B 4XDLA 3ABMC 4HZ3A 2HVJC 1THZA 3OUFA 4GX0A 3TETA 4XDJA 1FXKA 2WLLA 4MVQA 3EFFK 3QO7A 4EKWA 1AJQA 3OMNB 5CBGA 1AJPA 5DN6G 1RM1C 3G71V 3SPJA 4MVRA 4RUEA 2EIJC 3RW0A 3B77A 4HYOA 3OM3B 2JJ1G 3ZRWA 3ZMTA 1GK1A 4CZZA 2EIKC 5IYCO 1NH2B 1OCZB 1FFTB 3VBBA 3SRBA 4MTFA 2UXXA 2LFSA 1S76D 1AROP 2Q68A 1JX9A 2QKSA 2R9IA 3MD0A 3NXSA 4GCZA 4XBFA 3S8RA 3OGCC 1F23A 1BL8A 1WPXA 3E35A 3SYCA 1AI4A 1ORQC 4PDLA 3UKMA 1NKDA 2W6JG 3T4DA 2WYCA 2IH1C 5LBQA 2WYEA 3CCVV 1XL6A 4QIWF 4PA6A 3AG1B 3MHHC 3HPLC 1AR1B 4F4LA 2KB1A 3STLC 1E79G 1NR1A 4UXNA 3AG4B 4FK5C 1CEZA 3CCJV 1H8HG 4JTAB 1M90W 3AEIA 1BHAA 2X7RB 4G2KA 3K08A 3M99B 1DTOA 3AG3C 1QLEC 3LSQA 2DQ0A 2WYBA 3W7TA 3BEHA 1M57C 2EIMC 2NLJC 1KQSU 4ZBMA 1MG1A 1NQTA 2NNUA 3B8MA 4K2FA 1GMGA 2WLMA 2AHZA 4QNHB 1NH2D 2IJIA 4J9ZB 1QLNA 1CP9A 5L3EA 4FIPC 3W7SA 2OTLV 1Q86W 1YITV 2X6CA 1M56B 5FL7G 4GX2A 3B8NA 3OMIB 4WKTA 4PA4A 4PDVA 4PA7A 3G6EV 4HSTA 4YFBA 5E1AC 4TT3G 1VQ8V 2WLJA 3OEHG 3CC2V 5KUMA 1YIJV 2C2AA 2XAGA 3RBZA 2ITDC 1K5SA 3ZMUA 3ZCCA 1BHBA 3CCRV 1NJIW 1S0VA 1QBZA 2PI5A 5B1AC 4HSRA 3SRAA 1JQ0A 2EILC 4FJCC 4G28B 4QPKA 4UVAA 1K5QA 1OCCC 3IFXA 5B1OA 3SYOA 3CCSV 3ZMVA 2DWDC 3CMEV 2UXNA 5LGNA 2Q67A 3FB5C 4R7CA 3SJQC 1FXKC 2BOBC 5L3FA 3E86A 4DO2A 1MABG 4TSFG 4WFHA 3TK1A 1VQ6V 5B1BC 1AI5A 3LUTB 1JPXA 4X88A 2JEUA 1VQOV 2WLKA 3LNMB 1VQNV 3E89A 3FB6C 4XDKA 4I5SA 1GKFA 2R9RB 2LFRA 4JAVA 2X6BA 2EIJB 1R73A 2JJ2G 2JDIG 2QM7A 3JYCA 1K4DC 3K9AA 1QVFU 1FM2A 2XOKG 2ZR3A 4MTXA 3ML0A 3ABTA 2HG5C 2B5UA 3ABKC 3K79A 3WFVA 2XNDG 2EIKB 5IDJA 2Z5UA 3SYPA 1EBOA 5B1NA 1JW0A 4WKVA 3FB7C 4BW5A 2Y69B 1PNLA 3F7VC 1G4YB 2WPDG 3ZMSA 1YJNV 4UVBA 4RQEA 5L3DA 1VQLV 1AJNA 1PNMA 1GO3F 3CMAV 2QE7G 4X89A 2ZXWB 2XAHA 4RO2A 4J9YB 1VQ4V 3SYAA 2LP7A 1FXVA 2H94A 1K4CC 1RPRA 3IC7A 2ZDIA 3R65A 2Q6AA 3P30A 4MTGA 4QE9A 4BIZA 2AHYA 1JVZA 5HFLA 2XAFA 1NVPB 1ROPA 1EZJA 5H9CA 4ASUG 4YF9A 3AG3B 1QLEB 3JTQA 2D3OW 3GB7C 1M57B 2EIMB 1E1RG 3CCLV 4DXWA 1VQMV 3E2EA 3ASNC 2IU0A 4WFBV 2EBOA 2WLIA 4WFGA 2Y69C 3E8HA 5CN0A 2HVKC 1S3JA 4WFEA 3FYEB 1HWYA 4HAMA 3ZMZA 1YTFB 2P67A 1K3EA 3QO5A 5J9PC 4ZKIA 2ZXWC 1KD1W 3SPGA 1M1KW 4E57A 1M9NA 1H8EG 1GM8A 1P7BA 2B1IA 5H6RA 3SPIA 2F43G 3SRCA 3CCMV 2FTKA 2EZOA 2IJKA 2WAMA 1DLBA 3ETEA 3F7YC 5KUKA 2XASA 3D3IA 3T1CA 1E3AA 4FPPA 5B1AB 4GX1A 1I5YA 1F51A 3E83A 1KP3A 2HJFC 3T2MA 3FB8C 1PD3A 2EILB 2GSMB 3ZIAG 1NVPD 1OCCB 4UV8A 5LHGA 4MVUA 1OCRC 1OCOC 3STZC 4WKUA 1SRYA 3K04A 1Q82W 1S72V 1JOYA 3QO8A 1FXKB 3ZN1A 2WLLB 3K06A 3LDEA 5IY5C 3SPCA 2W6IG 2JIZG 2DYSB 5B1BB 3D36A 2YEVA 2YSUB 3W7XA 4TWKA 1VQKV 4YXWG 1JJ2U 1QVGU 1COWG 4H33A 1KKDA 1Y4MA 4PDRA 1RPOA 1I5XA 4MVMA 3CYOA 2HLDG 1YTFD 2QM8A 1ENVA 4R50A 4Z1MG 5LGUA 4G27B 3ZRWB 3X2QC 3TCUA 5EBLC 3CXCU 2DW4A 5LGTA 3OEEG 2H8PC 3ABKB 3E8GA 4LCUC 1QCEA 2ZQMA 5EBMC 4E2LA 1G8MA 5L3CA 4PELA 4E55A 2B1GA 1PKXA 2DYRC 5EC2C 1VQ5V 3MHSC 1R3LC 3RVZA 5IYDO 3K3WA 3JTRA 1AI6A 2A79B 2K1EA 2X0LA 3OR6C 2ZDIC 3ZRXA 5CA3A 3SYQA 2DYSC 3ASOC 2IU3A 5GW7A 3OAAG 3LSSA 1YI2V 2AE4A 2IW5A 2V1DA 4JASA 4JF3A 1ZWIC 1L1FA 5H6QA 4X8AA 1R3IC 1R3KC 2IJJA 2EINC 3AG2C 5IYBO 3PJSK 5L3BA 3CCUV 1W2BU 3HB3B 2WLHA 2WLNA 3I56V 1Q7YW 1W0JG 5DM6V 2HR3A 2JEXA 5B3SC 3CC4V 3OR7C 3ASNB 3JD3A 4L87A 2OTJV 1GK9A 4CBCA 1MSWD 1PNKA 5EBWC 3ABLC 3CCEV 4E56A 1KECA 5EC1C 1J95A 4OXSA 1YJWV 1SZTA 4QJFB 4GX5A 1LNQA 1WLEA 5HFMA 1R6NA 4R8CA 1YHQV 2JK5C 3ABUA 1KP2A 2ZD9A 3BY6A 2MK3A 4MVSA 1IXMA 1KEHA 2GHYA 4MVZA 3UM7A 5KA5A 4WF9V 4QPJA 1YJ9V 2DQ3A 3ETGA 1OCRB 1OCOB 3KG2A 5C93A 1UJWB 5BZBA 1EFRG 3L91A 1DF5A 1K92A 5IY5B 2W0FC 4KFMA 3H01A 3ZJZA 3ZN0A 2ZR2A 3K0DA 4GT1A 3JD4A 3GWOA 1GK0A 3VOUA 3CPWU 1VQ9V 2P7TC 1DF4A 4JYCA 1V54C 2Q69A 2PI4A 4P9OA 1SETA 2V7QG 3X2QB 4UV9A 4P2ZA 1Y66A 2QA4V 2QTOA 2QEXV 1JCHA 2A0LA 1FXHA 4JYBA 3G4SV 3E8BA 4RQFA 3IGAC 4JPRA 1BMFG 4BIUA 4M1JA 2WYDA 3WG7C 1H2GA 1NBMG 2DYRB 3ZRSA 1V55C 3K03A 1F4NA 4LBEC 1K33A 4UUJC 1Q81W 3CCQV 3K0GA 1K34A 3ZRVA 1OHHG 3ASOB 4FMTA 2EZPA 5KA6A 4JTDB 1R3JC 4KP4A 2P6JA 2WWWA 3P32A 4P30A 1QR8A 2WSSG 1OZ0A 4MVOA 2BOCC 4U7NA 1B6QA 2XAJA 5CBHA 4MTOA 4Q20A 4H37A 3EHBB 3W7WA 4JTCB 3QNEA 2EINB 2XAQA 3DTUB 3AG2B 4RAIA 5LHIA 4WCEV 3E8FA 2WLIB 3CC7V 1H38A 1S5HC 2A9HA 1OCZC 2M7WA 2ATKC 4UVCA 5B3SB 3FKSG 4MSWC 3OFNG 2P90A 1VQPV 1GTOA 5LHHA 4LC1A 1KC8W 3ABLB 3JCZA 4K2GA 4RUFA 3T4ZA 3OUSA 1YSCA 4LP8A 4PEMA 1F4MA 3JD1A 4I9WA 1E1QG 2CK3G 1QR9A 2ITCC 1SERA 2HKOA 4N23A 3AG1C 1PL0A 3LDDA 2HFEC 3OE7G 1SESA 3ETDA 4R6ZA 5EK0A 1GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AI7 A;  2AE4 A;  3SRB A;  2WYB A;  1K5S A;  1PNM A;  4M1J A;  4YFA A;  2WYD A;  1JX9 A;  1GKF A;  2AE5 A;  3S8R A;  1H2G A;  4WKS A;  4WKU A;  4HSR A;  1FXV A;  3SRA A;  1GM7 A;  1AJQ A;  1AI4 A;  1GK0 A;  2ADV A;  2WYC A;  1AJP A;  2WYE A;  4K2F A;  1K5Q A;  1FM2 A;  1KEH A;  1CP9 A;  3ML0 A;  1JVZ A;  4PEL A;  4E55 A;  4E57 A;  4K2G A;  1GM8 A;  1K7D A;  2AE3 A;  4PEM A;  1JW0 A;  3K3W A;  3JTR A;  1AI6 A;  4WKV A;  3L94 A;  4YF9 A;  3SRC A;  1OR0 A;  1PNL A;  3JTQ A;  1GK9 A;  4WKT A;  4HST A;  1AI5 A;  1PNK A;  1GK1 A;  1FXH A;  4YFB A;  4BTH A;  1GHD A;  1KEC A;  4E56 A;  1E3A A;  3L91 A;  1GM9 A;  1AJN A; 
#chains in the Genus database with same CATH topology
 3AG4 C;  1AI7 A;  2VQF B;  2G38 A;  1N8R W;  4YFA A;  4WKS A;  1XMO O;  4O2A A;  1BQ0 A;  3ZHT A;  1T5E A;  3U10 A;  1K97 A;  2YEV B;  5KMG A;  2UUB B;  3I55 V;  4IGG A;  1K73 W;  3LDC A;  4NKG B;  2QWR B;  2KQX A;  4NB5 A;  4CC6 A;  3DC6 A;  4MT8 A;  5CMU A;  2X6A A;  5LMN B;  4NXM B;  2Q4P A;  1P4R A;  2YDE A;  1HNZ B;  2HHH O;  3CP1 A;  1EN6 A;  4PDM A;  1FAF A;  3JD0 A;  3CRA A;  1N0J A;  4JAU A;  3CD6 V;  4KUM A;  4UFZ A;  4ZHQ B;  2OT5 A;  1JVM A;  3WG7 B;  3B40 A;  2B9Z A;  1V55 B;  3G6B A;  1N33 O;  1FD9 A;  4HZ3 A;  3TET A;  1Y74 A;  4GX0 A;  5CA0 A;  1FXK A;  4MVQ A;  3EFF K;  3OMN B;  1AJP A;  1AR5 A;  5LP6 C;  4I9Q A;  4YHH B;  3G71 V;  3SPJ A;  2EIJ C;  1CXZ B;  4HYO A;  3D3Q A;  3ZRW A;  3ZMT A;  1GK1 A;  2EIK C;  3EVK A;  1NH2 B;  2RMK B;  3SJA C;  1FFT B;  1S76 D;  1JX9 A;  2R9I A;  4UCO A;  3MD0 A;  4GCZ A;  1BL8 A;  2AGA A;  1Q6I A;  4LR3 A;  3UO2 A;  3JAS A;  1AI4 A;  1ORQ C;  3UKM A;  4LF7 O;  1XL6 A;  4X65 B;  1N36 B;  4CS2 A;  1WA8 B;  1E79 G;  1PPJ H;  3CCJ V;  2YUA A;  1M90 W;  3G80 A;  4B08 A;  2X7R B;  3M99 B;  1DTO A;  3AG3 C;  4YJ3 B;  3BEH A;  4ZBM A;  4LFB O;  1NQT A;  4B3T B;  4OPA A;  1WB8 A;  1Z5V A;  4K2F A;  2AHZ A;  2IBZ H;  4J9Z B;  4X1K A;  1CP9 A;  4FIP C;  2XUM A;  1YIT V;  4OX9 B;  2DJV A;  1IBL B;  4DV1 O;  4NXN B;  3ZHS A;  1MZF A;  4PA7 A;  3KZI Z;  4YFB A;  3OEH G;  4GKJ O;  4H13 B;  4IL6 Z;  3RBZ A;  1N32 B;  1QBZ A;  2LGW A;  4TUY B;  3SRA A;  4FJC C;  4JI0 O;  5C8Y A;  1K5Q A;  1OCC C;  5B1O A;  1XMQ O;  2E5L B;  3N2K A;  5LGN A;  2Q67 A;  3CEI A;  2EUL A;  2BOB C;  5L3F A;  3G67 A;  3LUT B;  2JEU A;  1PV0 A;  3ZHQ A;  3LNM B;  5IYZ B;  4GUN A;  1SS3 A;  3JAW B;  2ARH A;  3C90 A;  3HKD B;  3JYC A;  4FFB A;  1K4D C;  3K9A A;  2ZR3 A;  4JI3 O;  1SQP H;  3ML0 A;  3K79 A;  2B5U A;  1Q43 A;  1JW0 A;  2BCC H;  4Z2W A;  5FNV B;  4U3J B;  4JI4 O;  1PNL A;  4X1I B;  3K57 A;  1G4Y B;  5L3D A;  1DK1 A;  4KHP O;  2QE7 G;  2VWJ A;  1AR4 A;  2XAH A;  4DR3 B;  1K4C C;  1MSD A;  3ZX6 A;  2CTQ A;  3JAR A;  1JVZ A;  1NVP B;  4ASU G;  4DV2 O;  1QLE B;  3APQ A;  2ZE6 A;  5BMV A;  3GB7 C;  2EIM B;  4UCT A;  1RP3 B;  4WFB V;  1EN4 A;  2F4V O;  2WLI A;  5BY1 A;  3OD4 A;  5CN0 A;  3VQX A;  4WFE A;  5JJE B;  3CXH F;  1HWY A;  4YIO A;  3ZMZ A;  2Y4T A;  5DED A;  4ZKI A;  2ZXW C;  1YF2 A;  1JFF A;  3SPG A;  4E57 A;  1H8E G;  3SPI A;  2F43 G;  5IWA B;  4GKJ B;  4K35 A;  2ZIM A;  3ETE A;  5KUK A;  2XAS A;  1E3A A;  2Y0P A;  4FPP A;  1F51 A;  4PI2 A;  3CX5 F;  4JZG A;  4K8Z A;  3FB8 C;  2BTQ A;  3ZIA G;  2OCH A;  4UV8 A;  4DV5 O;  3R66 A;  3K04 A;  1FXK B;  1DGS A;  1SQB H;  2W6I G;  5BXZ A;  3L74 H;  1SQX H;  2UU9 O;  1QVG U;  1KKD A;  4C7U A;  1SQV H;  4MVM A;  3CYO A;  2QM8 A;  1ENV A;  5LGU A;  3ZRW B;  4LWS A;  4O4J A;  2WA3 A;  5KHH A;  2VRZ A;  2M6Y A;  2RCV A;  4LH6 A;  1XRE A;  2EJ7 A;  3BA9 A;  1KYO F;  1G8M A;  3JAS B;  2CAZ C;  2P4V A;  2B1G A;  5EC2 C;  4DV7 B;  3L72 H;  1JA8 A;  5KLV H;  2X0L A;  2ZDI C;  5CA3 A;  2DYS C;  2UXD B;  4FZ1 A;  1KUQ A;  3ICX A;  5GW7 A;  3LSS A;  1YI2 V;  4WBN A;  1B04 A;  3OGI B;  1TA8 A;  1R3I C;  3FGR A;  2Q7G A;  4DV2 B;  5IYB O;  3PJS K;  5JCO C;  3B2E E;  4E4E A;  3CCU V;  1FPO A;  3K5N A;  4X1K B;  5B3S C;  1TGO A;  2QSA A;  4O4H A;  2F4V B;  4FM0 A;  2OTJ V;  1TVK A;  1IBM O;  1NTZ H;  5J2T A;  1KEC A;  4OXS A;  1YJW V;  2XT9 A;  4GX5 A;  2PY5 A;  3O65 A;  4R8C A;  4J11 A;  2P22 C;  5C8Y B;  1W59 A;  4MVZ A;  3UM7 A;  3N2K B;  4O4L A;  3C3S A;  4DV5 B;  3VQV A;  3L91 A;  1QHT A;  3RYF B;  5IY5 B;  2W0F C;  1YZB A;  3ZJZ A;  2ZR2 A;  1LUV A;  3BCC H;  3K0D A;  4JI8 B;  1SC5 B;  3GWO A;  1GK0 A;  3VOU A;  5ITZ A;  1DF4 A;  1ZUQ A;  4TQF A;  1Y76 B;  4FFB B;  2PI4 A;  2GTA A;  1SET A;  4DR6 B;  4UV9 A;  4P2Z A;  1Y66 A;  1WAZ A;  2VS0 A;  4YIP A;  3TGU H;  2QA4 V;  3JAT B;  2A0L A;  2PYL A;  4JPR A;  2P5O A;  2WYD A;  3WG7 C;  2F66 C;  1V55 C;  2Q5Z A;  5IJ0 A;  5BR8 B;  4LBE C;  1IXB A;  1YCI A;  3CCQ V;  3ASO B;  4JTD B;  3RN4 A;  2P6J A;  4ABM A;  1OZ0 A;  2BOC C;  5BMV B;  4IIJ B;  5CBH A;  3ZHU A;  4H37 A;  2XAQ A;  2JS3 A;  1XNR O;  4WCE V;  2WLI B;  3BAA A;  3CC7 V;  2ZE8 A;  1AVM A;  4UVC A;  4DUZ B;  4MSW C;  3OFN G;  3N27 A;  1H2M A;  1JFF B;  4PEM A;  1D5A A;  3JD1 A;  4I9W A;  4FLW A;  1E1Q G;  4TV9 A;  4NTY A;  1SER A;  2HKO A;  1N34 B;  3ETQ A;  4LH7 A;  4AQY B;  1SQQ H;  1SA0 A;  4EB6 A;  1VAR A;  1ZSP A;  5DEC A;  1AP6 A;  4YY3 B;  4DR1 O;  2BTQ B;  4JGS A;  4FLX A;  2QM4 A;  3UCS C;  3WU2 Z;  4JI5 B;  2BE3 A;  4DV4 O;  1HNX O;  4P9P A;  1K7D A;  4PA9 A;  3KCY A;  4FM1 A;  2QWO B;  3ABM B;  2Y48 A;  3KKY A;  4X62 B;  3OW2 U;  1US6 A;  5D5Q A;  2CUG A;  4U7O A;  3HKB A;  4LWS B;  4MW3 A;  4JV5 O;  4O4J B;  2AW9 A;  3BFR A;  3DGE A;  2FB5 A;  5CBF A;  2PTM A;  2VQF O;  4FLZ A;  1CPY A;  1B06 A;  2DE0 X;  3A0R A;  1K8A W;  2OCC C;  4W4K A;  3OMA B;  4B3M B;  3JSL A;  4I0X A;  2UUB O;  3RWR D;  3BHP A;  4PI0 A;  1BZK A;  2HVJ C;  4BWA A;  5E79 Z;  4WBN B;  4EKW A;  1ZTE A;  4D6T H;  2OWO A;  1RM1 C;  2GV9 A;  5LMN O;  4CH6 A;  4RUE A;  1GAX A;  1LUW A;  1HNZ O;  3CB2 A;  4CH4 A;  5F2V O;  1JR9 A;  4O4H B;  4CZZ A;  5IYC O;  1OCZ B;  5J2T B;  3VBB A;  1FKA O;  4LFC O;  3S3W A;  2UXX A;  2Q68 A;  3NXS A;  4XBF A;  3M8A A;  4NR1 A;  4PDL A;  2WYC A;  3T4D A;  2IH1 C;  5LBQ A;  3MHH C;  2F93 B;  2D2C B;  4FK5 C;  1H8H G;  1IVS A;  4O4L B;  1BHA A;  3K5O A;  4AHC A;  1QLE C;  3LSQ A;  2DQ0 A;  4RWU A;  4DV4 B;  2EIM C;  2NLJ C;  1MG1 A;  4FVM A;  2ZM6 B;  1FJG B;  2JS5 A;  2NNU A;  1NH2 D;  2IJI A;  3UT5 A;  5ITZ B;  3W7S A;  1Q86 W;  3QG5 A;  1M56 B;  5FL7 G;  2ODM A;  2R9A A;  3B8N A;  4GX2 A;  5JWP A;  4BW9 A;  1GRJ A;  2QKA A;  4PA4 A;  3G6E V;  5H2F Z;  4X65 O;  2DOS A;  1N36 O;  2C2A A;  2XAG A;  2ITD C;  3ZMU A;  4GKK B;  2EX3 A;  4NTX A;  3CCR V;  1NJI W;  1BCC H;  1HR0 O;  1S0V A;  1XEQ A;  2PI5 A;  4HSR A;  1JQ0 A;  4G28 B;  5IJ0 B;  3SYO A;  2DWD C;  1H2S B;  3N2G B;  2UXN A;  4R7C A;  3SJQ C;  1FXK C;  1V9P A;  4B3T O;  3ZHR A;  3E86 A;  4TSF G;  1P84 F;  1QQC A;  1AI5 A;  2LW7 A;  4IHJ A;  4OX9 O;  2YS8 A;  2Q8V A;  5GTI Z;  1IBL O;  3NR7 A;  4NXN O;  3MAQ A;  4JAV A;  2LFR A;  1I94 O;  4NTW A;  1R73 A;  2JJ2 G;  1N32 O;  2XND G;  2UXC B;  2VQE O;  4LFC B;  3F7V C;  4TV9 B;  1YJN V;  2E5L O;  1AJN A;  1GN4 A;  1GO3 F;  3CMA V;  1XIL A;  2HJD A;  1SA0 B;  2Q0O C;  3TJT A;  2LP7 A;  2YIB A;  5EZY B;  1FXV A;  2H94 A;  1RPR A;  4DUY B;  2Q6A A;  1VF6 A;  1IUR A;  3DXR A;  4X20 B;  4X1Y A;  1P49 A;  5CB4 A;  1EZJ A;  1Q6H A;  4DV3 B;  4EEQ A;  1H2N A;  1QNM A;  4ZI7 A;  1M57 B;  2P4K A;  1E1R G;  3E2E A;  5A9G A;  3Q4H A;  4WFG A;  2Y69 C;  2HVK C;  1YTF B;  1XHX A;  3UQ8 A;  1HP8 A;  1K3E A;  2LQT A;  4AIL C;  3K58 A;  5JQG A;  1M9N A;  5J2U B;  2ETN A;  3SRC A;  4DR3 O;  3CCM V;  2FTK A;  2EZO A;  1HR0 B;  3J80 N;  3U0Z A;  1XHZ A;  3IAY A;  4TV8 A;  1I5Y A;  3E83 A;  2HJF C;  1MNG A;  4I0X B;  1PD3 A;  2EIL B;  2GSM B;  1VP7 A;  4Z1V A;  1NVP D;  3BVO A;  4I55 A;  5LHG A;  4MVU A;  1VEW A;  1SRY A;  1Q82 W;  1M5I A;  3D8C A;  5IY5 C;  4O2B A;  2JIZ G;  1L0N H;  3D36 A;  2QTS A;  2KSD A;  2QJ1 A;  3E22 A;  4TWK A;  4PDR A;  4W4L A;  1RPO A;  1I5X A;  2HLD G;  1I94 B;  4Z1M G;  4BWC A;  1NZ6 A;  3FX7 A;  1MZE A;  3TCU A;  5EBL C;  5IWA O;  5LGT A;  5LMU B;  4J80 A;  3OEE G;  3BAB A;  2H8P C;  4LCU C;  2VQE B;  4EFB A;  2LGQ A;  3H9V A;  4LF9 B;  3K3W A;  1AI6 A;  5LYJ A;  3ASO C;  3QVN A;  2KKW A;  4DV6 O;  1I7F A;  4HBN A;  1TAE A;  1R3K C;  2ILM A;  3F5T A;  5FPO A;  3CRQ A;  3A0H Z;  2PGG A;  1W2B U;  3UT5 B;  3OT7 A;  3HB3 B;  4IT5 A;  1W0J G;  3CC4 V;  2HR3 A;  2JEX A;  3ASN B;  4L87 A;  4CBC A;  4DW0 A;  1MSW D;  1PNK A;  5EBW C;  5EC1 C;  3QTC A;  4DV7 O;  1LNQ A;  5HFM A;  2A3Q A;  2UXD O;  3LSU A;  1YHQ V;  2MK3 A;  5FLX N;  1IXM A;  4O2A B;  1IBK O;  4KXR A;  2RJZ A;  5KMG B;  1YJ9 V;  3ETG A;  1OCR B;  1OCO B;  4QGP A;  1URF A;  2IM9 A;  1UJW B;  2Q73 A;  4IHJ B;  1DF5 A;  3CWB H;  3AG7 A;  2RNB A;  5A2Q N;  3RYC A;  3ZN0 A;  3FFQ A;  3JD4 A;  3CPW U;  1VQ9 V;  2GTS A;  3RYH A;  3SJB C;  2V7Q G;  1TUB A;  3G4S V;  4FLV A;  2ZE7 A;  4M1J A;  1KMI Z;  4DR2 B;  2DYR B;  1M4U A;  3QF7 A;  3K03 A;  1Y74 B;  5CA0 B;  3K0G A;  5CA1 A;  4JI7 O;  4ICG A;  4FMT A;  2EZP A;  4JI8 O;  3P32 A;  4DV6 B;  4H0L B;  5CB4 B;  1QR8 A;  4DRX A;  1HDJ A;  3A2F A;  4MTO A;  4DR6 O;  4JTC B;  5LOV A;  3QNE A;  5IT9 N;  2EIN B;  1H2L A;  1S5J A;  3Q4H B;  3GVM A;  3JAL A;  2A9H A;  1OCZ C;  4NVP A;  5LXT A;  2P90 A;  4JI1 B;  4J42 A;  1GTO A;  5LHH A;  4LC1 A;  1KC8 W;  3ABL B;  4RUF A;  1RFY A;  1YSC A;  5JQG B;  2K9P A;  5BR8 O;  2CK3 G;  1QR9 A;  2ITC C;  1VF5 B;  1PL0 A;  1GH6 A;  2HFE C;  5EYP A;  3OE7 G;  1SES A;  5EK0 A;  3M7M X;  1BS3 A;  4FLY A;  4IYI A;  1R6K A;  2ZCE A;  4I55 B;  1IBK B;  1GM7 A;  1W0K G;  2L35 A;  4OGQ B;  2OIG A;  3FYI B;  4N21 A;  4B7E A;  3H1I H;  2YI9 A;  1S5L Z;  3F5W C;  2DWE C;  1K9M W;  4DUZ O;  4HNA A;  3ZS8 C;  1NR7 A;  4D7T A;  4NYK A;  1M56 C;  4PA3 A;  1GHD A;  3JD2 A;  2EJR A;  4DR7 O;  5JH7 A;  2AE5 A;  1N34 O;  3U11 A;  4PD4 F;  4AQY O;  2E76 B;  2ADV A;  3WB2 A;  4YY3 O;  2Y4U A;  3CRR A;  3L94 A;  1XDC A;  1XL4 A;  4B7K A;  3IC9 A;  3CE2 A;  1P7G A;  4JI5 O;  3RVY A;  4BTH A;  3TXS A;  5LYJ B;  5L3G A;  1R1B A;  4XDL A;  1FFX A;  1WNS A;  4X62 O;  1THZ A;  2JGD A;  4XDJ A;  4JI7 B;  3C3T A;  3QO7 A;  4JYA B;  3ZBH A;  1AJQ A;  5JVD A;  2YI8 A;  2YXL A;  4J10 A;  5GON A;  3FD9 A;  4MVR A;  3RW0 A;  3B77 A;  2JJ1 G;  4LF4 B;  3JAK A;  5JCO A;  3SRB A;  4MTF A;  3T1Y B;  2LFS A;  1ARO P;  2QKS A;  1UFI A;  4OPH A;  1F23 A;  2V4D A;  4B3M O;  1WPX A;  2BTO A;  3E35 A;  3SYC A;  1WPB A;  3HKC A;  1G6U A;  2WYE A;  1NKD A;  2W6J G;  4GZR B;  4QIW F;  4PA6 A;  1AR1 B;  5B5E Z;  3JAR B;  3STL C;  1NR1 A;  2ZE5 A;  2YXH A;  3RYI A;  2Z0A A;  3AEI A;  4FLT A;  4G2K A;  3K08 A;  3KCX A;  3UO3 A;  2BSK A;  3W7T A;  2L6L A;  1M57 C;  1KQS U;  3RYC B;  3AK1 A;  3S3X A;  4JAA A;  1H2K A;  3B8M A;  1GMG A;  1OJH A;  4QNH B;  1QLN A;  2Q9L A;  2CH7 A;  2X6C A;  3K5M A;  4PDV A;  4DR7 B;  1K5S A;  1BHB A;  3SJC C;  2QKC A;  4J7K A;  2EIL C;  4UVA A;  3RFR A;  3IFX A;  3CCS V;  3RT3 C;  2KG7 A;  4BIO A;  3FB5 C;  2ZM6 O;  1FJG O;  2PF4 E;  4DO2 A;  1MAB G;  4WFH A;  1L0L H;  3TK1 A;  1AIL A;  3VQW A;  4H44 B;  4X88 A;  4X9Q A;  1VQO V;  2WLK A;  4XDK A;  3SR2 C;  4YJ2 A;  4UB8 Z;  1U97 A;  2R9R B;  2X6B A;  2JDI G;  1QU7 A;  4L8J A;  1QVF U;  1FM2 A;  3AK3 A;  2XOK G;  4GKK O;  3ABT A;  1UPG A;  2Z5U A;  4DW1 A;  3FB7 C;  3L75 H;  1EZV H;  4BW5 A;  3T1H O;  3A0B Z;  4J7Z A;  5FPR A;  3ZMS A;  4UVB A;  4I50 A;  5EYP B;  1PNM A;  2RN9 A;  1ZAU A;  4JI2 O;  2ZXW B;  1SZX A;  4RO2 A;  4D7S A;  4J9Y B;  2UUC B;  4CS3 A;  3IC7 A;  3SDL A;  2A7W A;  1NI8 A;  4QE9 A;  2AHY A;  4BIZ A;  1VF7 A;  2XAF A;  2VWK A;  1ROP A;  5TIS Z;  4BR6 A;  5GTH Z;  1XQ8 A;  1TVK B;  3CCL V;  2UXC O;  3ASN C;  2IU0 A;  2PYJ A;  3FYE B;  5JH7 B;  1Y67 A;  5H5N A;  2P67 A;  2QWQ B;  4U3F H;  2B1I A;  4JI6 B;  5H6R A;  4DUY O;  1EM1 A;  2IJK A;  3APO A;  3F7Y C;  3T1C A;  5B1A B;  4GX1 A;  3T2M A;  4DV3 O;  4KL1 A;  1FFX B;  1OCR C;  1OCO C;  3STZ C;  2JGD B;  3CJH A;  1S72 V;  3QO8 A;  4CH5 A;  3ZN1 A;  3K06 A;  3SPC A;  2DYS B;  5JVD B;  5B1B B;  2YSU B;  5GON B;  2ZIN A;  2QGN A;  2HP8 A;  1YTF D;  1I08 A;  3JAK B;  1M93 A;  3CXC U;  3ABK B;  3E8G A;  2AZ2 A;  1QCE A;  2ZQM A;  2Q0A A;  4E2L A;  3T1H B;  1KKC A;  4E55 A;  2DYR C;  1VQ5 V;  3MHS C;  5EIB D;  2W0X A;  3VQY A;  1Q8I A;  3RGB A;  3JTR A;  4JI2 B;  1YVW A;  3ZRX A;  5KHI A;  1I0H A;  2UXB B;  2IU3 A;  1XNQ B;  2AE4 A;  1KU9 A;  2IW5 A;  4JAS A;  4JF3 A;  1YXB A;  1ZWI C;  2N05 A;  1L1F A;  2BSK B;  4X8A A;  2Q7E A;  3K9S A;  2EIN C;  5LMU O;  5L3B A;  3WB0 A;  1VIB A;  3I56 V;  1SKV A;  2CH7 B;  1N4C A;  2UUA B;  5JJN B;  3OR7 C;  3H1J H;  3ABL C;  1J95 A;  4LF9 O;  3P3P A;  1SZT A;  2Q7H A;  3IJ4 A;  4EB6 B;  3JAM N;  3L71 H;  3BY6 A;  1KP2 A;  2ZD9 A;  4K8X A;  2R70 A;  2GHY A;  4UCU A;  4WF9 V;  1MMM A;  2NR5 A;  4UCS A;  1IDS A;  2KG7 B;  2WA4 A;  2ZNI A;  2DQ3 A;  5KX5 A;  4I7Z B;  4DR5 B;  3D36 C;  5C93 A;  5BZB A;  1J5E O;  1K92 A;  4LF5 B;  4KFM A;  3H01 A;  3HKB B;  4J7J A;  4YJ2 B;  4GT1 A;  1Q5O A;  1AB3 A;  2O57 A;  2Q69 A;  2E74 B;  1L8D A;  4P9O A;  3OTO B;  1R6T A;  4UCV A;  3X2Q B;  3L73 H;  4LF6 O;  1HW7 A;  3CHX A;  4RQF A;  2F23 A;  2JVD A;  4I50 B;  3B09 A;  3P3N A;  4BIU A;  4AI8 A;  1LR1 A;  2PZS A;  1NBM G;  4X64 B;  3ZRS A;  4DYL A;  1K33 A;  4UUJ C;  1K34 A;  1OHH G;  3DC5 A;  5JJJ B;  5KA6 A;  1GN6 A;  4B3S B;  4KP4 A;  2WWW A;  3MDS A;  4P30 A;  4GYC B;  4JYY A;  1XMO B;  1B6Q A;  5LP6 A;  4FLU A;  3EHB B;  3CSX A;  4ZOL A;  4CC5 A;  4UCR A;  3AG2 B;  2ZNJ A;  3GWK C;  3E8F A;  1S5H C;  5LA6 A;  2FKX A;  2GDS A;  2YC0 A;  4DR2 O;  2F1M A;  4K2G A;  3T4Z A;  3OUS A;  4PJ0 Z;  1F4M A;  4N23 A;  3LDD A;  2YIB D;  4R6Z A;  5KHK A;  1GM9 A;  2HHH B;  1TUE B;  2GUZ A;  1JJO A;  3DSQ A;  4MW8 A;  4QE7 A;  1EN5 A;  1OV9 A;  4FFK A;  4MS2 A;  4WFA V;  3CJH B;  2OCC B;  4GLX A;  1D2D A;  3EXA A;  1BGY H;  3JSN A;  2R72 A;  3SPH A;  1J5E B;  1N33 B;  1OR0 A;  3W7U A;  4JI1 O;  5KHG A;  4BAY A;  3RYF A;  2Z3Y A;  4F6E A;  1RM1 B;  1V54 B;  2IJH A;  1NTK H;  1FS0 G;  4WFF A;  1MOF A;  2IH3 C;  4DK1 A;  1Y76 A;  1XBL A;  1S77 D;  2P06 A;  4LF6 B;  4F6R A;  1WB7 A;  3JAT A;  2AE3 A;  1VQ7 V;  1JMK C;  5D5P A;  2A06 H;  2GBO A;  4LF7 B;  2ZKO A;  3ABM C;  2HEP A;  3OUF A;  4JZ2 A;  2WLL A;  5CBG A;  2ZT9 B;  2FML A;  5DN6 G;  4LFA O;  2OIE A;  4PV1 B;  3FGT A;  4IIJ A;  3OM3 B;  5K1P A;  3WB1 A;  4Q6G A;  2OYQ A;  4LFB B;  2CGO A;  1IX9 A;  1Z2G A;  1RSO A;  3S8R A;  3OGC C;  4FM2 A;  4DV0 O;  4DV1 B;  3CCV V;  3AG1 B;  3HPL C;  4F4L A;  1Z5W A;  3DXR B;  1XUQ A;  2KB1 A;  1PM9 A;  4UXN A;  4JYA O;  3AG4 B;  4X1Y B;  4I4T A;  1GN2 A;  3AK2 A;  1CEZ A;  3CRM A;  4JTA B;  1NTM H;  1SQF A;  4LNU A;  5KX5 B;  4JI0 B;  4ZI7 B;  2ZIO A;  2WYB A;  1XMQ B;  4LF4 O;  2WLM A;  2Y0I A;  2DMX A;  4CH3 A;  2OTL V;  5L3E A;  3T1Y O;  2N74 A;  3TXQ A;  1BT8 A;  3OMI B;  1FYJ A;  4WKT A;  4HST A;  1ZL8 A;  2QWP B;  3BA8 A;  3A8T A;  2WLJ A;  4TT3 G;  5E1A C;  1VQ8 V;  3CC2 V;  2AZ0 A;  5KUM A;  1YIJ V;  1ZX3 A;  3J7A U;  4JI3 B;  4TV8 B;  3ZCC A;  5B1A C;  5IJ9 A;  4JI4 B;  4QPK A;  3SGI A;  3ZMV A;  4CS4 A;  1Q3E A;  3CME V;  2ADQ B;  4O2B B;  4KHP B;  3E22 B;  1PP9 H;  5B1B C;  1VQ6 V;  2CE4 A;  4X66 O;  1JPX A;  2QR4 A;  1BSM A;  2YID A;  1VQN V;  3E89 A;  3FB6 C;  5LP6 B;  4I5S A;  1GKF A;  4ZOL B;  4LFA B;  1ZLZ A;  2EIJ B;  2QM7 A;  1NU1 H;  3HKE A;  4MTX A;  2HG5 C;  3ABK C;  3WFV A;  5LA6 B;  2EIK B;  5IDJ A;  3SYP A;  1EBO A;  5B1N A;  4WKV A;  2CTP A;  2Y69 B;  2WPD G;  4RQE A;  1VQL V;  3LNN A;  4DV0 B;  3B4S A;  1VMG A;  4X89 A;  2XTA A;  2YXY A;  2GUZ B;  3FAV A;  1VQ4 V;  3SYA A;  1O9H A;  3R65 A;  2ZDI A;  3H1K H;  3P30 A;  4MTG A;  4O4I A;  3L9D A;  5HFL A;  1Q6U A;  1GN3 A;  4ZIB A;  1XOU A;  5H9C A;  4YF9 A;  1A32 A;  3AG3 B;  4PHZ A;  3ZHV A;  4LF8 O;  3JTQ A;  2D3O W;  4B3R O;  2H3O A;  4DXW A;  1VQM V;  2EBO A;  3E8H A;  1BE3 H;  2QWN B;  1S3J A;  2UU9 B;  2LO1 A;  2RDC A;  2QDO A;  4HAM A;  3QO5 A;  5J9P C;  1KD1 W;  1M1K W;  3OTF A;  1P7B A;  1GM8 A;  2UUC O;  4F6R B;  1PL4 A;  3J81 N;  2AXT Z;  2WAM A;  1DLB A;  1XI1 A;  3D3I A;  4UB6 Z;  1KP3 A;  1AP5 A;  1OCC B;  2FYU H;  2FL4 A;  4WKU A;  1JOY A;  2F95 B;  2WLL B;  3LDE A;  3N2G A;  4EFE A;  3CRC A;  4K3A A;  2YEV A;  4X66 B;  3W7X A;  1VQK V;  4YXW G;  1JJ2 U;  1COW G;  1X59 A;  3RYH B;  4H33 A;  1Y4M A;  2YIA A;  5AG2 A;  2DN9 A;  1TUB B;  4R50 A;  4G27 B;  3X2Q C;  4JI6 O;  2RQ6 A;  2DW4 A;  2CTW A;  2LW1 A;  2MW2 B;  1Y6X A;  1RSO B;  4FZ0 A;  1MA1 A;  5EBM C;  2PUS A;  1IBM B;  5L3C A;  5EIB C;  4PEL A;  3K5L A;  1PKX A;  5KAI Z;  1KBH A;  1NT2 B;  1R3L C;  3RVZ A;  4ZHQ A;  5CA1 B;  5IYD O;  2A79 B;  3H1H H;  2K1E A;  3OR6 C;  4I4T B;  3SYQ A;  3L70 H;  3H1L H;  4DRX B;  3OAA G;  4LNU B;  1D5N A;  3K59 A;  2V1D A;  4DK0 A;  2JRI A;  5EZY A;  3THO A;  5H6Q A;  1B3Q A;  5LOV B;  5B66 Z;  4X20 A;  2IJJ A;  1HNW O;  4K0K O;  3JAL B;  3AG2 C;  4LF8 B;  4DR4 O;  5KAF Z;  1F7Y A;  5LXT B;  4TOI A;  4B3R B;  2WLH A;  2WLN A;  5IE9 A;  1Q7Y W;  5DM6 V;  5KHJ A;  3HR0 A;  3JD3 A;  1BQZ A;  1GK9 A;  3CCE V;  4E56 A;  1YEW A;  1ZL8 B;  4QJF B;  2CGN A;  1WLE A;  1R6N A;  1WJZ A;  2E3C A;  2UXB O;  2JK5 C;  3ABU A;  2NN4 A;  4MVS A;  1XNQ O;  5J2U A;  1O9G A;  1KEH A;  5IJ9 B;  1WA8 A;  5KA5 A;  1U96 A;  1N0N A;  4QPJ A;  2N04 A;  3BRC A;  3KG2 A;  4HNA B;  1WN7 A;  4TQD A;  1EFR G;  4YJ3 A;  1X4T A;  2XHB A;  2UUA O;  1SF9 A;  2CTR A;  2JGU A;  4J41 A;  3ZED A;  2P7T C;  1YDX A;  4JYC A;  1V54 C;  4NXM O;  1IZ3 A;  1G1X B;  3HKE B;  5LL6 Y;  2QTO A;  2QEX V;  1JCH A;  1XNR B;  2E75 B;  1FXH A;  4JYB A;  3E8B A;  3IGA C;  5K1X A;  1BMF G;  4TUY A;  1H2G A;  1SQG A;  4DR5 O;  3FAV B;  4IYH A;  1F4N A;  1Q81 W;  4LF5 O;  3ZRV A;  3CS5 A;  3PN1 A;  4O4I B;  3I5D A;  1R3J C;  1WP8 A;  2YIC A;  2WSS G;  4DR1 B;  4MVO A;  4YHH O;  2LJ2 A;  4U7N A;  3OTO O;  2CDY A;  2XAJ A;  4Q20 A;  5IYZ A;  3W7W A;  1HNW B;  3DTU B;  4K0K B;  4RAI A;  3JAW A;  5LHI A;  1HNX B;  3O9O A;  4DR4 B;  1Q90 D;  1H38 A;  2ADP A;  3HKD A;  2M7W A;  2ATK C;  5B3S B;  3FKS G;  1WP7 A;  1VQP V;  3HKC B;  3JCZ A;  1NS1 A;  3JCU Z;  4X64 O;  4LP8 A;  5FNV A;  4U3J A;  4X1I A;  1KB9 F;  4JV5 B;  3BPZ A;  3AG1 C;  4A5U B;  1VF6 C;  3ETD A;  3RYI B;  4B3S O; 
#chains in the Genus database with same CATH homology
 3AG4 C;  1AI7 A;  1TUE B;  1N8R W;  4YFA A;  4JGS A;  4MW8 A;  4QE7 A;  1R6K A;  4WKS A;  1GM7 A;  4MS2 A;  4WFA V;  2OCC B;  1W0K G;  3FYI B;  4N21 A;  4P9P A;  1K7D A;  1K97 A;  2YEV B;  4PA9 A;  3SPH A;  3I55 V;  3F5W C;  2DWE C;  1K9M W;  1K73 W;  3ABM B;  1OR0 A;  2Y48 A;  1NR7 A;  3LDC A;  3W7U A;  3OW2 U;  4BAY A;  1M56 C;  4PA3 A;  1GHD A;  2Z3Y A;  4U7O A;  5CMU A;  4MT8 A;  1RM1 B;  3JD2 A;  2X6A A;  1V54 B;  2EJR A;  2IJH A;  4MW3 A;  2AE5 A;  1FS0 G;  1P4R A;  4WFF A;  1MOF A;  2IH3 C;  3DGE A;  2ADV A;  5CBF A;  3CP1 A;  1S77 D;  4PDM A;  3JD0 A;  4JAU A;  1CPY A;  3CD6 V;  2AE3 A;  3A0R A;  1VQ7 V;  4KUM A;  1K8A W;  3L94 A;  1XL4 A;  2OCC C;  2OT5 A;  1JVM A;  3RVY A;  3OMA B;  4BTH A;  3WG7 B;  5L3G A;  1V55 B;  4XDL A;  3ABM C;  4HZ3 A;  2HVJ C;  1THZ A;  3OUF A;  4GX0 A;  3TET A;  4XDJ A;  1FXK A;  2WLL A;  4MVQ A;  3EFF K;  3QO7 A;  4EKW A;  1AJQ A;  3OMN B;  5CBG A;  1AJP A;  5DN6 G;  1RM1 C;  3G71 V;  3SPJ A;  4MVR A;  4RUE A;  2EIJ C;  3RW0 A;  3B77 A;  4HYO A;  3OM3 B;  2JJ1 G;  3ZRW A;  3ZMT A;  1GK1 A;  4CZZ A;  2EIK C;  5IYC O;  1NH2 B;  1OCZ B;  1FFT B;  3VBB A;  3SRB A;  4MTF A;  2UXX A;  2LFS A;  1S76 D;  1ARO P;  2Q68 A;  1JX9 A;  2QKS A;  2R9I A;  3MD0 A;  3NXS A;  4GCZ A;  4XBF A;  3S8R A;  3OGC C;  1F23 A;  1BL8 A;  1WPX A;  3E35 A;  3SYC A;  1AI4 A;  1ORQ C;  4PDL A;  3UKM A;  1NKD A;  2W6J G;  3T4D A;  2WYC A;  2IH1 C;  5LBQ A;  2WYE A;  3CCV V;  1XL6 A;  4QIW F;  4PA6 A;  3AG1 B;  3MHH C;  3HPL C;  1AR1 B;  4F4L A;  2KB1 A;  3STL C;  1E79 G;  1NR1 A;  4UXN A;  3AG4 B;  4FK5 C;  1CEZ A;  3CCJ V;  1H8H G;  4JTA B;  1M90 W;  3AEI A;  1BHA A;  2X7R B;  4G2K A;  3K08 A;  3M99 B;  1DTO A;  3AG3 C;  1QLE C;  3LSQ A;  2DQ0 A;  2WYB A;  3W7T A;  3BEH A;  1M57 C;  2EIM C;  2NLJ C;  1KQS U;  4ZBM A;  1MG1 A;  1NQT A;  2NNU A;  3B8M A;  4K2F A;  1GMG A;  2WLM A;  2AHZ A;  4QNH B;  1NH2 D;  2IJI A;  4J9Z B;  1QLN A;  1CP9 A;  5L3E A;  4FIP C;  3W7S A;  2OTL V;  1Q86 W;  1YIT V;  2X6C A;  1M56 B;  5FL7 G;  4GX2 A;  3B8N A;  3OMI B;  4WKT A;  4PA4 A;  4PDV A;  4PA7 A;  3G6E V;  4HST A;  4YFB A;  5E1A C;  4TT3 G;  1VQ8 V;  2WLJ A;  3OEH G;  3CC2 V;  5KUM A;  1YIJ V;  2C2A A;  2XAG A;  3RBZ A;  2ITD C;  1K5S A;  3ZMU A;  3ZCC A;  1BHB A;  3CCR V;  1NJI W;  1S0V A;  1QBZ A;  2PI5 A;  5B1A C;  4HSR A;  3SRA A;  1JQ0 A;  2EIL C;  4FJC C;  4G28 B;  4QPK A;  4UVA A;  1K5Q A;  1OCC C;  3IFX A;  5B1O A;  3SYO A;  3CCS V;  3ZMV A;  2DWD C;  3CME V;  2UXN A;  5LGN A;  2Q67 A;  3FB5 C;  4R7C A;  3SJQ C;  1FXK C;  2BOB C;  5L3F A;  3E86 A;  4DO2 A;  1MAB G;  4TSF G;  4WFH A;  3TK1 A;  1VQ6 V;  5B1B C;  1AI5 A;  3LUT B;  1JPX A;  4X88 A;  2JEU A;  1VQO V;  2WLK A;  3LNM B;  1VQN V;  3E89 A;  3FB6 C;  4XDK A;  4I5S A;  1GKF A;  2R9R B;  2LFR A;  4JAV A;  2X6B A;  2EIJ B;  1R73 A;  2JJ2 G;  2JDI G;  2QM7 A;  3JYC A;  1K4D C;  3K9A A;  1QVF U;  1FM2 A;  2XOK G;  2ZR3 A;  4MTX A;  3ML0 A;  3ABT A;  2HG5 C;  2B5U A;  3ABK C;  3K79 A;  3WFV A;  2XND G;  2EIK B;  5IDJ A;  2Z5U A;  3SYP A;  1EBO A;  5B1N A;  1JW0 A;  4WKV A;  3FB7 C;  4BW5 A;  2Y69 B;  1PNL A;  3F7V C;  1G4Y B;  2WPD G;  3ZMS A;  1YJN V;  4UVB A;  4RQE A;  5L3D A;  1VQL V;  1AJN A;  1PNM A;  1GO3 F;  3CMA V;  2QE7 G;  4X89 A;  2ZXW B;  2XAH A;  4RO2 A;  4J9Y B;  1VQ4 V;  3SYA A;  2LP7 A;  1FXV A;  2H94 A;  1K4C C;  1RPR A;  3IC7 A;  2ZDI A;  3R65 A;  2Q6A A;  3P30 A;  4MTG A;  4QE9 A;  4BIZ A;  2AHY A;  1JVZ A;  5HFL A;  2XAF A;  1NVP B;  1ROP A;  1EZJ A;  5H9C A;  4ASU G;  4YF9 A;  3AG3 B;  1QLE B;  3JTQ A;  2D3O W;  3GB7 C;  1M57 B;  2EIM B;  1E1R G;  3CCL V;  4DXW A;  1VQM V;  3E2E A;  3ASN C;  2IU0 A;  4WFB V;  2EBO A;  2WLI A;  4WFG A;  2Y69 C;  3E8H A;  5CN0 A;  2HVK C;  1S3J A;  4WFE A;  3FYE B;  1HWY A;  4HAM A;  3ZMZ A;  1YTF B;  2P67 A;  1K3E A;  3QO5 A;  5J9P C;  4ZKI A;  2ZXW C;  1KD1 W;  3SPG A;  1M1K W;  4E57 A;  1M9N A;  1H8E G;  1GM8 A;  1P7B A;  2B1I A;  5H6R A;  3SPI A;  2F43 G;  3SRC A;  3CCM V;  2FTK A;  2EZO A;  2IJK A;  2WAM A;  1DLB A;  3ETE A;  3F7Y C;  5KUK A;  2XAS A;  3D3I A;  3T1C A;  1E3A A;  4FPP A;  5B1A B;  4GX1 A;  1I5Y A;  1F51 A;  3E83 A;  1KP3 A;  2HJF C;  3T2M A;  3FB8 C;  1PD3 A;  2EIL B;  2GSM B;  3ZIA G;  1NVP D;  1OCC B;  4UV8 A;  5LHG A;  4MVU A;  1OCR C;  1OCO C;  3STZ C;  4WKU A;  1SRY A;  3K04 A;  1Q82 W;  1S72 V;  1JOY A;  3QO8 A;  1FXK B;  3ZN1 A;  2WLL B;  3K06 A;  3LDE A;  5IY5 C;  3SPC A;  2W6I G;  2JIZ G;  2DYS B;  5B1B B;  3D36 A;  2YEV A;  2YSU B;  3W7X A;  4TWK A;  1VQK V;  4YXW G;  1JJ2 U;  1QVG U;  1COW G;  4H33 A;  1KKD A;  1Y4M A;  4PDR A;  1RPO A;  1I5X A;  4MVM A;  3CYO A;  2HLD G;  1YTF D;  2QM8 A;  1ENV A;  4R50 A;  4Z1M G;  5LGU A;  4G27 B;  3ZRW B;  3X2Q C;  3TCU A;  5EBL C;  3CXC U;  2DW4 A;  5LGT A;  3OEE G;  2H8P C;  3ABK B;  3E8G A;  4LCU C;  1QCE A;  2ZQM A;  5EBM C;  4E2L A;  1G8M A;  5L3C A;  4PEL A;  4E55 A;  2B1G A;  1PKX A;  2DYR C;  5EC2 C;  1VQ5 V;  3MHS C;  1R3L C;  3RVZ A;  5IYD O;  3K3W A;  3JTR A;  1AI6 A;  2A79 B;  2K1E A;  2X0L A;  3OR6 C;  2ZDI C;  3ZRX A;  5CA3 A;  3SYQ A;  2DYS C;  3ASO C;  2IU3 A;  5GW7 A;  3OAA G;  3LSS A;  1YI2 V;  2AE4 A;  2IW5 A;  2V1D A;  4JAS A;  4JF3 A;  1ZWI C;  1L1F A;  5H6Q A;  4X8A A;  1R3I C;  1R3K C;  2IJJ A;  2EIN C;  3AG2 C;  5IYB O;  3PJS K;  5L3B A;  3CCU V;  1W2B U;  3HB3 B;  2WLH A;  2WLN A;  3I56 V;  1Q7Y W;  1W0J G;  5DM6 V;  2HR3 A;  2JEX A;  5B3S C;  3CC4 V;  3OR7 C;  3ASN B;  3JD3 A;  4L87 A;  2OTJ V;  1GK9 A;  4CBC A;  1MSW D;  1PNK A;  5EBW C;  3ABL C;  3CCE V;  4E56 A;  1KEC A;  5EC1 C;  1J95 A;  4OXS A;  1YJW V;  1SZT A;  4QJF B;  4GX5 A;  1LNQ A;  1WLE A;  5HFM A;  1R6N A;  4R8C A;  1YHQ V;  2JK5 C;  3ABU A;  1KP2 A;  2ZD9 A;  3BY6 A;  2MK3 A;  4MVS A;  1IXM A;  1KEH A;  2GHY A;  4MVZ A;  3UM7 A;  5KA5 A;  4WF9 V;  4QPJ A;  1YJ9 V;  2DQ3 A;  3ETG A;  1OCR B;  1OCO B;  3KG2 A;  5C93 A;  1UJW B;  5BZB A;  1EFR G;  3L91 A;  1DF5 A;  1K92 A;  5IY5 B;  2W0F C;  4KFM A;  3H01 A;  3ZJZ A;  3ZN0 A;  2ZR2 A;  3K0D A;  4GT1 A;  3JD4 A;  3GWO A;  1GK0 A;  3VOU A;  3CPW U;  1VQ9 V;  2P7T C;  1DF4 A;  4JYC A;  1V54 C;  2Q69 A;  2PI4 A;  4P9O A;  1SET A;  2V7Q G;  3X2Q B;  4UV9 A;  4P2Z A;  1Y66 A;  2QA4 V;  2QTO A;  2QEX V;  1JCH A;  2A0L A;  1FXH A;  4JYB A;  3G4S V;  3E8B A;  4RQF A;  3IGA C;  4JPR A;  1BMF G;  4BIU A;  4M1J A;  2WYD A;  3WG7 C;  1H2G A;  1NBM G;  2DYR B;  3ZRS A;  1V55 C;  3K03 A;  1F4N A;  4LBE C;  1K33 A;  4UUJ C;  1Q81 W;  3CCQ V;  3K0G A;  1K34 A;  3ZRV A;  1OHH G;  3ASO B;  4FMT A;  2EZP A;  5KA6 A;  4JTD B;  1R3J C;  4KP4 A;  2P6J A;  2WWW A;  3P32 A;  4P30 A;  1QR8 A;  2WSS G;  1OZ0 A;  4MVO A;  2BOC C;  4U7N A;  1B6Q A;  2XAJ A;  5CBH A;  4MTO A;  4Q20 A;  4H37 A;  3EHB B;  3W7W A;  4JTC B;  3QNE A;  2EIN B;  2XAQ A;  3DTU B;  3AG2 B;  4RAI A;  5LHI A;  4WCE V;  3E8F A;  2WLI B;  3CC7 V;  1H38 A;  1S5H C;  2A9H A;  1OCZ C;  2M7W A;  2ATK C;  4UVC A;  5B3S B;  3FKS G;  4MSW C;  3OFN G;  2P90 A;  1VQP V;  1GTO A;  5LHH A;  4LC1 A;  1KC8 W;  3ABL B;  3JCZ A;  4K2G A;  4RUF A;  3T4Z A;  3OUS A;  1YSC A;  4LP8 A;  4PEM A;  1F4M A;  3JD1 A;  4I9W A;  1E1Q G;  2CK3 G;  1QR9 A;  2ITC C;  1SER A;  2HKO A;  4N23 A;  3AG1 C;  1PL0 A;  3LDD A;  2HFE C;  3OE7 G;  1SES A;  3ETD A;  4R6Z A;  5EK0 A;  1GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...