4HSTA

Crystal structure of a double mutant of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hstA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hstA01
1AI5A 4BTHA 4E56A 4E55A 1PNKA 1AI4A 4HSRA 1GHDA 3L94A 4PEMA 1FXVA 3JTRA 4WKSA 4YFAA 1GM8A 1AJQA 1PNLA 4WKVA 1FXHA 4K2GA 1K5QA 3L91A 4WKTA 1GK0A 1AJNA 4YF9A 1GKFA 1K5SA 2AE5A 1KEHA 2WYCA 1PNMA 1GK1A 3ML0A 1AI6A 4HSTA 3SRCA 1KECA 1FM2A 1OR0A 1JW0A 3S8RA 1JX9A 1JVZA 1H2GA 3K3WA 4YFBA 2AE3A 1E3AA 4M1JA 3SRAA 1AJPA 2AE4A 4K2FA 4E57A 1AI7A 1CP9A 2WYEA 4WKUA 2WYBA 3SRBA 1GK9A 4PELA 1GM9A 1K7DA 2ADVA 3JTQA 2WYDA 1GM7A
chains in the Genus database with same CATH superfamily
1P6RA 3I71A 4BXFA 3FGTA 1SANA 3MVPA 2RV8A 3HRSA 1V5GA 1W1WE 4LK0F 1BW5A 1W4MA 1T33A 1LEAA 5LHGA 4BDZA 2EH3A 4HF0A 1PYVA 2A3SA 4KN4X 5D4SA 2ZSHB 2PLYA 2NVTJ 3BP8A 4DJAA 3PM1A 3U21A 2PX9A 4M72A 1R9TJ 3K6GA 5LRRA 4BDYA 3SEQA 2DYSH 1X1PA 3WE2A 5DYMA 1NTCA 3H3VK 4FETA 1LFUP 3R0JA 3L2CA 4IHTA 3BJAA 3K2ZA 4FISA 1GDTA 5LBQA 1W0TA 3AFHA 3K4NA 3MKZA 2K9QA 2K4BA 2FQ3A 5EZHA 1KEHA 3ONQA 4KA4A 3OYEA 3SHFA 1OPCA 2YU3A 4G7OF 4B4CA 1IN5A 2L5QA 2VT2A 3S1RJ 4CO8A 1FLIA 1ETWA 2L9NA 2LF8A 3BG5A 4Q47A 2L9VA 3CCYA 3IH2A 4Y3OA 3H9QA 3QU3A 5L3GA 1B4AA 1GM7A 4BQNA 2OJED 3KEOA 2H09A 1XMKA 3HG9A 2OA4A 4KIBA 2STTA 4A3IJ 4L0ZB 2KL4A 2ZBKA 3KLOA 5FKKA 4Y52J 3OYAA 1QVTA 4DGWB 4BE2A 4XONA 5D5XB 3JTGA 1K79A 3G2BA 5DCFA 5FD6A 1R5HA 2XPVA 2YUSA 1MW7A 5FFZA 2DOEA 3DLAA 2UXNA 2WAEA 1BA5A 1VTNC 5JLXA 1K7DA 2DMNA 2GA1A 1EKEA 3BTLA 3S16J 3S1NJ 4B8XA 1BOBA 2P8TA 1TQMA 1AKHB 2NOGA 2ZSIB 4L5JA 4PDKA 2CV0A 3OYLA 4RB3C 2X6XA 3H9JA 4E7IA 4OIQF 2NRAC 4IX7A 2F4OB 3RJPA 1APLC 2F5CA 3SJMA 2EA4A 1G4DA 3J80K 5D5UB 4MIMA 3GZ6A 2X6YA 3JREA 2CV1A 3QAHA 4EQQA 1BI2A 4XLPF 3I55I 1O3RA 3Q9VA 3WHCA 1AI5A 2IEKA 3GX4X 1FP2A 2KMUA 3CUQA 4N9IA 1S7EA 2UXXA 5CVIA 1YLFA 3FDYA 1FXHA 2K27A 1MBFA 1WI3A 2M3AA 3KP3A 4ANJA 4RLQA 1Z0XA 2EZKA 3BG9A 2IP2A 5JR3A 1XB4A 1LE8B 3S1MJ 2F5DA 1FBUA 3K9TA 4D5CA 4CCOA 1MZBA 3RQIA 3RI4A 1DDNA 1B9NA 4WX9A 4GFBA 1VQMI 1XSVA 4B1RA 1IN6A 4IRGA 2JZYA 4DBRA 4NB5A 4WWCA 3K10A 3O8HA 2C6YA 3F72A 4PJ0C 1HF0A 1OCOH 2ZNZA 1VQ6I 2CG4A 1R22A 3ERMA 2I5UA 1OYWA 2HXIA 3RPQA 5FKLA 2CUJA 4XRSG 1T95A 4M9ZA 1V5EA 1PUFA 4XOTA 2HVQA 2CWEA 4QLCU 3TP3A 2VQCA 3OOUA 3VODA 5K1YA 2RGVA 1UMQA 2OCEA 4OU0A 4BACA 1W36D 3LA7A 2ECCA 3CC7I 2PI0A 2LSOA 4WXCA 4BL0B 2CRGA 5IP7J 1I3QJ 3M3YJ 3CP8A 1SD5A 1ZGWA 1WVRA 4PEMA 3NAUA 3TW7A 2DOFA 2RREA 1JKOC 2K3FA 1D1BA 3PIOF 1O3TA 2ACJA 2XAGA 2QSHX 1K5SA 3FX3A 4MTDA 3DFGA 5L3CA 1MGTA 1Z77A 3LQQA 1IC8A 5EEHA 3GFIA 3HHGA 2X1DA 2OD5A 1QA6A 2IGNA 4L0YB 2ZXHA 3Q0WA 5BPIA 3Q0VA 3ZMSA 3WU1B 3S15J 3NEUA 4DIQA 4GRIA 4GXOA 5EDNA 2MYSA 3E6DA 1YG2A 1PP8F 3DKWA 2CUEA 2PMHA 3IL2A 3ZRGA 3FMSA 3FBNB 4MQVA 4XORA 4R1HA 3CDIA 3S2WA 4KYWA 2A6HF 4EVIA 1FTTA 5BMZA 1XCBA 2PMZN 3I58A 2IJLA 3WG9A 2CS3A 3TBIA 1ON1A 2XPUA 1FJLA 3N4MA 4HLYA 1BJAA 4HV6A 3HBLA 4NDLA 4PJMA 2LKXA 2V9KA 4YG2F 2E1NA 1F4KA 2Y75A 3CQZJ 3RPUA 2E34A 1G3SA 2MH9A 2WV0A 1FXVA 1YX5A 1SAUA 4M9SA 3SZTA 3L09A 2A69F 1GKFA 1DGRM 3PJRA 2R7WA 2BHYA 4EM2A 4WXDA 2OUMA 3LSKA 2K5CA 2XAUA 3IKTA 1U5TA 5IT9Z 1YHQI 3CUQB 3HSRA 5K5OA 2DMQA 2F5FA 2R7SA 4E57A 4RGSA 4D0PA 4PZJA 3TOAA 2W1OA 2BW3A 3I59B 2DA6A 2R7VA 4L9NA 3I64A 4B47A 1UHMA 4LLGF 2DA4A 1VQ9I 5J8CA 3MEXA 3H36A 3CDLA 1Y6IA 2G7HA 3O6BB 2M1BA 3AKZA 2EWNA 4V19K 4HNUA 2RDPA 5DD4A 3GCMA 3QOPA 4M3EA 2XKPA 1DQUA 3QRFF 3FM3A 2BEOA 4HQEA 3JCUC 4UVCA 2QQAA 3LA2A 4HLXA 5ICEA 2OTLI 2WYDA 1PUFB 5HS9A 2E1MB 1ITYA 2JSPA 3M9AA 1JKRC 2HFHA 1E3HA 4AVPA 5J3LA 4BKXA 4WKSA 2M9HA 1LFBA 2HZTA 5BOXA 2FUG2 2DMUA 2LYCA 3ASOH 5E1WA 3SQNA 4W97A 3EPZA 1FM2A 4HX7A 2L7MP 3HPHA 2DYRH 2KZGA 1HKSA 3H35A 4M3FA 2PFBA 4A0ZA 1LJ9A 1F5TA 2VC1A 3B02A 1YIOA 2JRMA 2DODA 4WKUA 5GPAA 5GADJ 1T08B 3BQYA 4A3GJ 1HA8A 5D4RA 3DTIA 2XGXA 3O3KA 4YIRX 4HPQA 1SFEA 1WJCA 4AIJA 4NUBA 1T39A 1EH6A 3BY6A 5EG0A 3L91A 1K78A 1VQKI 1IN7A 2JK3A 3GTOJ 1WJDA 1TWGJ 1T56A 2VKDA 4IF4A 3I4PA 1UG2A 2LH9A 2CJJA 4U0VA 3BPXA 3HDDA 1RNLA 1R4MB 1TL8A 5DS9A 2W24A 4B09A 1EF4A 5FB2A 4IHXA 2GOMA 5IYDJ 3RPUD 1R00A 4QWQA 1U0JA 1S3JA 1U9OA 1STZA 2DA7A 3GO5A 3GBGA 1R58A 3A01A 4ZYHA 3F6VA 3JRIA 2R7FA 3WGIA 4BY7J 4CCMA 2NNYA 1IRGA 4ZDOA 1FMWA 3K4LA 3I4NJ 2GZWA 1HCRA 3N05A 2EFNA 2W25A 1DP3A 5K7ZA 4HQMA 2JRTA 1E0EA 2QVOA 2XAQA 3FXUA 2XF6A 2O7OA 1TQPA 1V5FA 3OYNA 4GO1A 5FLMJ 3HSFA 2X6OA 3HRMA 5F0HA 2PJRA 1KA8A 2EV6A 5FRNA 1RETA 4QSHA 1ZK8A 2KJCA 4KFCA 1U5TB 5ICFA 1KONA 3PO2J 4BQQA 3NWTA 3ZN0A 3WTSC 1ETKA 3QP5A 2CUZA 1R5GA 4A0XA 1J2XA 2HZDA 4LMYA 2KIMA 4IZZA 2O8KA 2BW3B 3S1QJ 4Q5SF 1H2GA 4I0BA 1E3AA 2BYVE 5E3OA 3A1YA 1QRYA 1SVMA 4EJTA 1SFKA 4KICA 2ZMEC 2EB7A 4HF1A 2LR8A 2BVMA 5AONA 1S8NA 4NQWA 4XIDA 2LBFA 2R7DA 4KNYA 4Z2YA 3X2QH 4AM3A 3LFUA 5A2QZ 3EUKL 3KP6A 4IQ4A 2Z99A 5LLQA 2A05A 2WB1A 1IO2A 2JT1A 2EK5A 3BJOA 3GMEA 3GWZA 2MW8A 1ZH5A 2IS4A 3DTKA 1IJWC 1ERDA 1R4NB 3DEEA 2DFHA 4G94A 3HOWJ 2MLKA 3J80Z 3IH3A 1YW9A 5F6FA 4HYEA 4MFDA 5H2FC 3KX2A 1BBYA 1QHGA 4NC8A 2X85A 4WF2A 3JRHA 1FC3A 3TMOA 3VDXA 1T0FA 1ODDA 1XMXA 3LSPA 2OV7A 1I1GA 5IOYA 3L7WA 2EFOA 3WTUC 1JHFA 4ZZDA 3EUHC 4BHBA 5B5EC 1FY7A 3LOCA 2A6TA 3RYRA 4B48A 1TWAJ 4CYDA 3TO6A 2B63J 2H1LA 1I5ZA 1W0UA 1XDUA 2P6TA 4GGGA 3RKYA 5FJ8J 2AHQA 2O5RA 3MKYB 2VE9A 4ENMA 5EG0B 4I6ZA 3K70D 2V9PA 3BC8A 2E36A 3LSIA 3B73A 3ZXSA 2KRHA 2QEXI 4IKFA 2GOXB 3CZ6A 5FRMA 3F3XA 4PJNA 4UVAA 2RQPA 3GUDA 5C44J 2J5PA 4UUVA 3JTHA 2F2EA 5L3EA 5IP9J 5JVGF 4ENNA 2V26A 3MKLA 4IHYA 2HS5A 2AQEA 1KECA 1IXCA 1TT5B 2L0KA 4HZFA 5HLHA 1BI3A 1ZREA 2WY8Q 4YIIA 4NHJA 4A3MJ 2OAZA 1HDDC 3GYHX 2CGPA 3I0TA 3OIQA 1R7JA 3CO6C 1I6XA 2L7FP 4A6EA 4XICA 1Z91A 3L00A 4F3QA 3OS0A 3WTWC 1IRFA 2HYFA 2DMPA 5CVRA 2FQ4A 3CCQI 1R1TA 4Y17A 1YQAA 2PJRB 1VQLI 1RKTA 3CCMI 3NARA 1ETYA 2LDUA 2WB1N 3DEWA 3ZQQA 1TNSA 4CYCA 3OS2A 1ZG3A 1RESA 1IUYA 1BR2A 2LMDA 3CESA 4NC7A 2A5WA 5C3EJ 4IOCF 3ELKA 2A07F 5M3MJ 3JTQA 1A5JA 3H92A 4ZYAA 1IV6A 5HVQC 2LP0A 2W4SA 4XL9A 5CKTA 5E79C 2COBA 3AG1H 5C4XJ 4WKVA 1XC5A 3LSRA 1ONVA 2IBDA 3KP4A 2QQ8A 3C3WA 3LSGA 3FK7A 3K69A 2FU4A 4P55A 3TO9A 4ZYEA 2VLAA 3UR3C 5H20A 1LDKB 1LB2A 2F6CA 3RDIA 1YIJI 2GWRA 2L3DA 2DTZA 2FMYA 3ZQCA 1G3TA 2M0CA 4NQWB 3S3OA 4A6DA 2GXGA 2JTVA 1GLNA 2LBFB 4YELA 1ZGJA 1FBQA 1PVEA 5LEJA 1B9MA 1EA3A 2CW8A 3BG7A 5DUKA 1ZR4A 1P2FA 2HOAA 4NNJA 5E1ZB 1GXQA 1OCTC 1Y8QB 2E60A 2XASA 1ZGAA 4FASD 3WTZA 2Z9OA 3PQKA 1KQ8A 2LF7A 3M1CA 2NVYJ 4UVBA 1XTAA 3OYDA 3V8JA 3ABLH 3DXJF 3CCSI 3CCUI 2XC7A 3OR1C 4ON0A 5J8FA 1NHAA 4BJTA 4MHGA 4CDGA 3IC7A 4PUSA 2ISYA 1DGWY 1GV2A 2HPIA 1I27A 4OAYA 2IGMA 2IS2A 3HTSB 4N4NB 4G7ZF 1L3LA 3D0SA 5LFAA 4L9VA 1XSXA 4I09A 2JWTA 3P9CA 3RKQA 2CQXA 2D1HA 2JPCA 5IYBJ 1T6SA 4LIUA 3JSPA 2CW7A 4HSTA 1D5VA 2Y0SA 4M71A 1UB9A 2FJ1A 1HBXG 3OSGA 2CFOA 2Y2ZA 1FNNA 1VI0A 1B72A 3LWFA 3ZOBA 2ZXWH 1RRJA 3JW4A 1YX3A 2DBBA 3WGGA 1TC3C 5CJ9A 2R7QA 3QPTA 4MGRA 3G6EI 4RAFA 3KP2A 2HDWA 4PK4A 1MSEC 1DUXC 1Z3XA 1QHHD 5E3MA 1AHDP 2WBMA 1A35A 2X4HA 4I76A 4YF9A 1X3UA 2HWVA 2O3FA 3M8JA 4I0AA 3K1NA 4CZZA 5CQGA 3JRAA 2O9LA 2DK5A 4IJAA 3M8FA 5DTDA 2ME6A 4LB5A 4A2UA 5TRDA 5IY5H 2XAHA 2OQGA 1HKQA 1Z67A 2R3SA 2NS0A 3QP6A 4PGGA 5EYRA 4DOZA 5JHUA 1UELB 1F9NA 4P96A 3ESWB 5KCMA 3D1NI 1A04A 3OYIA 3H5NA 4MO7A 1OCRH 4PJLA 1WPKA 2MGQA 2RQQA 4XM3A 3AL0B 4ZH4F 1W36C 1MMAA 1ENHA 1TW2A 2GAUA 4IO9F 4CYCB 1FBSA 5D6FA 5H6QA 2XB0X 5HS7A 1LKXA 3VYSB 5AIPA 5KVRA 2HTSA 2P5LC 1WQ2A 2KRCA 4XR6A 1XS9A 4ENJA 2KIQA 1YJWI 1G59A 2KKOA 1QO0D 2Y30A 4KT5C 1XGOA 4UV8A 3WGHA 4RMNA 2W57A 5EZGA 2MG4A 5EF6A 5DCMA 1D5YA 1FMVA 1MMSA 1P4WA 5CVVA 4C9YA 1MDMB 3IUOA 4JOMA 2X1EA 4XLEA 1F43A 2EIJH 1Y0NA 5IPAA 4U87A 2WWYA 2EA2A 3NRVA 4RBOA 3CCLI 1PUEE 2F4MB 2H8RA 4B44A 2DXIA 1AA7A 4RGRA 3ZPLA 4XOPA 4RA2A 1MJBA 3JSOA 3FKJA 3MMYB 2M30A 1D1CA 2M5WA 1P4XA 3W6JB 2ELJA 3SRAA 1E3PA 2HNHA 4W1UA 3E5UA 2H94A 1TZLA 1J9IA 2DO7A 2GIZA 2KHMA 3BTCA 2P81A 4IRHA 3BR6A 3U1KA 4AYBA 3K4BA 1Z3YA 2HDCA 3L2VA 1ZR2A 2H6BA 3FXLA 1LEBA 1BJZA 4UNOA 3OYMA 3V8KA 1ZKGA 2WYCA 5A2QK 2XSJC 4H4KC 4ZTFA 2E1OA 2DJIA 3HKZA 2X1CA 2LY9A 1JX9A 3ASNH 4ETSA 1G3WA 3H0GJ 2PJPA 4G12A 1CF7B 3EDPA 3K4CA 3I4MJ 4QPOA 3DBRB 3V8LA 1QPMA 4HNVA 2GM4A 4JP0A 3GFJA 4UHTA 4G8XA 3MD2A 5GAEJ 3MKWB 2EIKH 4E56A 3QPLA 3S2DJ 1X1CA 2MH2A 1S7OA 3E1SA 4PSWA 1B72B 3C2GA 3E97A 1X3ZB 1T98A 3BCBA 1FIPA 2CMPA 4UB8C 3I59A 2HI3A 3OYBA 5EGOA 2A68F 2ID3A 4IHVA 1IG7A 2BY0A 3HM5A 3ZMUA 4F7ZA 5CVUA 2CQ7A 4XBFA 2P7CB 1JT6A 3QWLA 3HOVJ 3PUBA 2E1MC 1GK9A 2V7FA 5IT3A 2DPDA 4E7ZA 1BW6A 2Q2EA 5GAHJ 4BTHA 2JA6J 5DD8A 3AG4H 4OOIA 2Q0OA 2FMLA 2ISZA 1G3YA 2M8EA 3A4CA 2V1DA 3HOYJ 2M4GA 1HC8A 2ZFUA 3K4MA 3IWZA 3RSNA 2AE3A 1MH4A 1J7KA 2YX4A 3CJTB 1S9HA 1JXSA 3LNQA 3AAFA 3PNTA 5HLGA 1OYIA 1Z9CA 4CH7A 1LNWA 4N4OB 3QOEA 2H8WA 3FMQA 2CH0A 2RAEA 2Q1ZB 4R79A 4M74A 5D8LB 1MBEA 2HXOA 3PSFA 1K83J 4AYBN 3U2RA 3BCAA 3WTXC 4UUSB 1ZELA 3I54A 2DTRA 2HU9A 1B59A 3M7GA 1YE9A 4HAMA 1A36A 1KGSA 3V42A 4FCYA 5DCMB 3HKZN 4U7DA 4MLOA 2L4AA 3SFIA 2VIXA 1YW7A 2P4WA 5E18F 4BHPA 5C4JJ 1WI9A 5E17F 2IPQX 2P5VA 4KUMA 3HOXJ 2RNGA 4I2OA 1EH8A 3E6MA 2HEOA 4DZPA 1CQTA 3FXQA 3B6AA 5EJCA 2ID6A 2XGDA 2ESNA 4DBQA 1P4AA 3OYGA 3LMMA 2Y9ZA 2MD0A 2L7KA 1LUJB 1U3EM 1JW0A 3OSFA 3OL4A 5CVJA 2IVMA 4DQ2A 3IAM2 3S3NA 1HKTA 4IPAA 3K3WA 1WJFA 1D3YA 2P7VB 3HOZJ 1YS6A 3BLYA 2ECBA 2JUGA 2MBFA 3KZIC 5ERIA 3W3CA 4B3AA 4CCJA 4D5FA 3ERED 2Y69H 5FKNA 3CCVI 9ANTA 5KNLA 2V9VA 2KDOA 4E55A 3VSLA 2PBIA 2Y9YA 3HB9A 4WKTA 1FOYA 3W2WA 4BNCA 1UCRA 2HR3A 2IW5A 4CZCA 4BH9A 4G6QA 2VJIA 5BQTA 4FX0A 3MN2A 3R6SA 1TT0A 5ILSA 4ASNA 1P92A 2LNBA 1O7FA 4ENKA 2V1UA 2QBYA 3C18A 4AIHA 1GUUA 5LHHA 2HOTA 5FLVA 2VONA 4ZDLA 1LDJA 1T8IA 1HXDA 2ZJPF 3CC2I 3KZZA 1YTYA 4EGYA 2KQRA 5EGOB 5B1AH 4BQAA 3T5XA 1MBJA 5CYVA 2DT5A 4ZC3A 4YEJA 1JUPA 3CCEI 2GA2A 5FD5A 2OCCH 5L3FA 2E2JJ 1QZEA 1KU3A 4LGWA 2A5YB 2Q2EB 3QYBA 2V79A 1QNTA 1VZ0A 2Z3YA 1KU7A 3M07A 1S29A 3VYTB 1MNMC 2VJJA 3VYRB 4LFUA 1CGPA 3F8FA 1Y56A 5HDKA 4UV9A 6PAXA 4A3DJ 3H5RA 3R0AA 2DFFA 2R92J 4XLCA 5CQEA 3TKYA 4ESJA 1UFMA 2MC4A 1I6HJ 3HTUA 4A5MA 4RB2C 4P9UA 3RTRA 3HOSA 2ZNYA 2CW0F 2VUMJ 3DPUA 5FKOA 1HLVA 5GTIC 2IA1A 2Z33A 1VQPI 2K85A 4CCLA 3DCFA 1ZG1A 3KIOA 4A12A 1SD4A 4A3BJ 2ZO4A 2ELKA 1F36A 5GAGJ 3ABMH 5F1JA 3K1PA 3ZP5A 1V3FA 1H88C 1ZAOA 4ZYGA 5J47A 2OU2A 2VL8A 2E2HJ 1XDSA 3BZ6A 1U6GA 1MKMA 2K9NA 2ZC2A 2QYOA 2DA1A 1OCCH 3K70C 1Y1WJ 4EJVA 3CMMA 1OR7A 3GTMJ 4QTRA 1OMIA 2K4JA 4A3EJ 1J0RA 3A03A 3OIPA 3FKIJ 3RZDJ 3EYYA 4JYKA 3ECHA 5DUIA 1OLTA 1J09A 1UG0A 2XIGA 2XDVA 3WG7H 5E3NA 2JVGA 2LREA 1W5CC 1ZYRF 3CP2A 4RAGA 3H3UA 3KLNA 2XRLA 4KN7X 2XGEA 1R49A 2QQBA 2HQRA 4XN3A 3L9FA 3CJNA 2R0QC 1UHSA 1JT0A 3DKXA 2HQNA 2FSWA 4XQFA 1RUOA 1P9QC 3S3MA 5LRSA 3I53A 4YIFA 3DF8A 3TEDA 3HL2A 2W48A 1X4PA 2M2EA 5J1UA 1SFXA 3KPHA 2FNAA 4YFXF 1TWHJ 3T1BA 4UXNA 3QODA 2ADUA 3ZQ7A 3FHZA 4J19A 3B6CA 2H27A 5GTHC 2B0LA 4RLFA 1D8JA 1T2KA 2QBYB 5DV5A 3GVAA 3VSKA 2XF7A 1IUFA 4KT6A 2GXAA 4XLHA 2CQQA 2KFDA 1WHUA 1RR8C 2W84A 2GIVA 2Z5UA 4HF2A 2KP6A 3BZCA 3HRTA 2RNJA 4BUPA 4DYCA 4MTEA 3EYIA 3CD6I 1XGSA 2DU9A 2VC0A 2FBIA 3LSJA 2V1XA 2VXDA 5EEGA 2QF7A 3F23A 3GTQJ 1ZN2A 1M1EB 4HA8A 4HV5A 5GP9A 4DYQA 3GTPJ 4HW0A 5IP6A 2VPLA 1GVDA 1OCZH 1WWXA 3R4KA 4E7LA 2AO9A 5M5YJ 1QU3A 1JKPC 3DLLF 2ZJRF 2LK2A 2L9RA 1AI6A 2E5ZA 3KFWX 2EFWA 4P5OA 1U78A 1T0FC 2VBYA 1YYVA 2QUFA 2PQ8A 2WAQA 4C2UA 4M1JA 4XK4A 2B7EA 1X58A 4JK1X 2IA0A 4O5VA 1RC9A 3SDGA 5HNFA 2HYGD 5B66C 3G73A 1RUNA 1XGNA 4PSXA 3LSHA 3W6VA 3BR0A 5AIQA 5J1YA 4O6JA 4G6DA 2L54A 1D0YA 3DKYA 1E17A 2Z1DA 2PG4A 1RI7A 2JSCA 2FD5A 3ZQIA 1QQIA 3K1MA 1TTYA 2LKSA 3BT9A 3F6OA 4HX8A 5F27A 5LEKA 1IW7F 2OZ6A 5HDGA 3PIPF 3ZCOA 3E5QA 2R7UA 4F91B 1BIBA 1CP9A 1WJEA 4D9JA 2R5YA 3M4OJ 1Q1VA 3T8TA 1JHHA 1XD7A 2PEXA 2VJ5A 4P1WA 1G2HA 2DQLA 1Y8RB 4RB0A 2VT3A 4QIWN 3ZQGA 5F64A 5HLIA 2M45A 4GDFA 3W6KB 4LLNA 5E8GA 1DPRA 5KHDA 1G8XA 4I98B 3S2HJ 4KIGA 3VWBA 2RKHA 3KP5A 1FEXA 4HBLA 2LD5A 3WTVC 2MABA 4FE4A 1LFPA 4EM1A 2WADA 2BHZA 2F5VA 1USSA 2J5OA 3FK6A 3EUHA 3NQOA 1A6QA 2OC6A 3DV8A 5J4YA 3MFKA 2HKOA 4LG0B 2WV1A 4S05A 1VNDA 2MA3A 4S04A 2JJ7A 1Z7LA 3FGRA 3VEPA 4XSZF 3K4KA 5J6XA 2FA5A 4ZTJA 2VKHA 2G9WA 2ZXJA 4YFKF 3KYLA 4KISA 2DQRA 2YPRA 4XMYA 3ABTA 4IHWA 4CSWA 2R4GA 4XSXF 4LITA 1WJAA 2WAQN 3EQLF 5FGMA 2HOSA 2PN6A 3U9GA 4C3JJ 3P9KA 4HNTA 3HGYA 1U8BA 2EZLA 3FXJA 3N97A 3SRBA 2LLKA 4D7MA 2XSDC 4M6XA 1A6IA 1UHWA 3MAJA 3TGNA 3DTEA 2VN2A 3HYIA 4BJ5C 3J7AY 1POGA 2KIFA 1HW1A 4A0YA 3BPVA 5GPCA 1REPC 3AG2H 3M8EA 2EJRA 3S8PA 4K2GA 1R36A 3FXOA 4HOBA 1XSDA 4B3XA 3LSMA 3WTTC 3JRGA 3HEFA 3SRCA 1KQ0A 1TWCJ 1JTYA 1QZYA 1X3WB 1MDMA 1WH5A 4Z6YA 1ZTRA 1X1DA 3OOPA 3BR1A 4YFBA 4G7HF 1J5YA 3CJRB 1ETOA 3CDHA 1A31A 1FOWA 1JJ6C 2VQGA 3H0DA 4I01A 2D1VA 2EPFA 3O8GA 5D8KB 3WU2C 4X0GA 2WTEA 3ML6A 2KISA 1FSEA 1YRNA 3FF5A 2CYYA 4F93B 4IOAF 4Y7NJ 2WC2A 4LIVA 3I9V2 2VJ4A 2ELHA 1E2XA 2ZKZA 4PFPA 4II2A 2FEZA 4MFEA 2YU9J 1GK1A 2HVSA 4BEHA 2O61A 1F1ZA 5J1RA 1X19A 4CGZA 4AC0A 1B8IA 3BR3A 3IV5A 3E6CC 2QM3A 4C2MJ 4DYRA 1VQ7I 3G1OA 1WGXA 2D2WA 1HSTA 1JUSA 3OYJA 2KRFA 2ZMEB 3CUOA 4I99C 5ILVA 1MBHA 3ZMTA 1CF7A 2Y31A 1OKRA 2HVRA 1U8RA 1SMYF 2BY1A 2JVHA 4G6TB 2BVLA 1AJNA 2JMWA 3KEYA 3HRUA 4XLAA 1SMTA 1H89C 1MMNA 2HOEA 4KITB 2R5YB 3UKGA 3GTJJ 2LOOA 3W2AA 1JVZA 4E70A 2AQFA 4JQFA 1HW2A 3BG6A 4BE0A 2NXNB 2JN6A 2BZTA 1XPXA 4ZYDA 3GTKJ 1ETVA 1W5SA 3BQZA 4XLFA 4IRIA 2EV0A 1IN8A 3P5JA 5TJJA 4KJZA 3LFKA 3OYKA 3CLQA 2N8GA 5L3DA 2Z2SB 3DPLC 2ETHA 3BWGA 5JI6A 2AE5A 2X48A 2XAFA 5J40A 1O3SA 1IGNA 1ACIA 2E71A 4ITVA 1MSFC 1LDDA 3QYFA 1L0OC 4N0BA 3Q3SA 1B1BA 1MBGA 5HODA 3ROUA 1V54H 3RIRA 1N77A 3E6BA 3FXRA 4AVZA 3ZR8X 3NWSA 1I3AA 2R7XA 4PGHA 4WCGA 3JRCA 4Q4ZF 5F0CA 2LY2A 1SEUA 1GM9A 1H8AC 4A3KJ 4A3FJ 4BU2A 4BY1J 3HGGA 4C30A 2BOLA 3CLOA 1USTA 5KAFC 3OYHA 4A3JJ 1JGSA 3GEZA 3G3ZA 2K7LA 2CSOA 1E3OC 3JAMK 2M0MA 4FT8A 1FPQA 2PMUA 2JA8J 4FHTA 4EV0A 3J7ZI 2VQHA 2VE8A 4X1EA 4MEYF 3F8CA 4ZDPA 2DJNA 1FYKA 4YFNF 3PO3J 1GT0C 3LSTA 1FIAA 2W85A 3OL3A 4UUSA 3KETA 1QBJA 1HSJA 4BBSJ 1FOXA 1Z6TA 4M6VA 5M5XJ 1AI7A 2Q8KA 1X2NA 3F8BA 2QSFX 2BBYA 5F04A 4L9TA 1XMAA 4II3A 3J81K 4DNCA 2D5VA 2R7OA 3RYPA 1QZZA 1GHDA 1B6AA 1MMGA 1TP4A 2XGCA 2VBXA 4E7JA 1FZPB 1NG7A 1NG6A 2QKLB 2V1NA 1N78A 2IRFG 4JX5A 3R61A 1WSUA 1IZ1A 4LLLA 3E3VA 2Y0SN 4YRVA 1YRNB 3OYFA 3Q0UA 2YX7A 1ZQ3P 2V6CA 3GFMA 4IQJA 1AWCA 4AUXA 2ZB9A 3MZHA 2EV5A 4IEJA 1VF9A 1HW5A 3QU6A 3ZGKA 4DW6A 2L2OA 1WH7A 5F1RA 2R7RA 4BJ6C 5E8IA 3RCOA 4BEHB 1RKWA 4EMSA 4M3GA 5DDGA 3DBLB 3L94A 3H5AA 1B8IB 1LVAA 2HDDA 3KYCB 3TP0A 2BGCA 2CUFA 2LTPA 3A02A 3CMYA 4EATA 2DK8A 1R5ID 1IN4A 2DA5A 3D5RC 4LOCA 5FLXK 1LQ1A 2VPRA 3A0BC 3F0CA 2ICWG 3CUQC 4R8HA 1AOYA 4HDVA 2X9DA 5K7HA 1YI2I 3KYDB 2AE4A 3IH4A 2KLOA 1IRZA 1IF1A 3T8RA 2QKMB 4XKWA 3HSEA 3CCRI 3LAJA 3BR5A 1R23A 4FTHA 2AS5F 1QGPA 2L9SA 2FE3A 3I3LA 1ZARA 5LHIA 3V4GA 2XROA 3D5SC 2QENA 3DPTA 3VYUB 1PNMA 4M73A 3OWTA 4A3CJ 1TNTA 2KDZA 2FOWA 3C7JA 2X51A 1ZRFA 3FMRA 4A93J 2FXAA 2FNPA 2HQAA 5D5WB 3BJ6A 1SD7A 1ETXA 4XN0A 4S0HB 1Y39A 1JJ8C 3T0YA 1X4OA 5E3LA 3MQ0A 2FX0A 4CCKA 1AI4A 2P6SA 3A0HC 1IV8A 4M3BA 2VKVA 5DEQA 1GM8A 1MJ9A 4N9HA 4FE7A 5HNHA 1DP7P 1SD6A 1FWZA 2F4IA 4MQ9F 2PMZA 1N25A 3EETA 1MBKA 3MCZA 2VBZA 1SVLA 1YITI 3PFYA 3VPRA 2B9SA 1S7AA 3GZ5A 1WRJA 4XRSA 4NBQA 2K9LA 3COAC 1D8KA 3GF2A 5K5RA 3KEQA 2NNNA 1P7JA 2WY7Q 3HOUJ 4OIPF 3FHNA 1VFCA 4I7HA 2XUBA 2NS8A 1GVJA 3FXMA 2HGCA 1C0WA 2KZVA 1D1AA 1NK3P 5K5QA 5HLTA 1BL0A 4KMUX 3U1DA 2X6WA 2WA0A 1X1AA 4E7SA 1TBXA 2NOJB 1MJAA 4G9YA 5B3SH 3KP7A 1RIOH 2IGKA 1GXPA 2HYJA 4CA0A 3ZMVA 2LY1A 2RC4A 3CJQB 1PDNC 2W00A 2K9SA 1SAXA 4V2GA 3L2WA 2ZJ2A 3J7YJ 2IAIA 3ISPA 1H0MA 5E1XA 3HZJA 4XRMA 1BN5A 4PFOA 1W5TA 3QPHA 4GYIA 1YJNI 1S72I 1XG1A 1K4TA 4M9XA 3DBHB 1AJQA 3G4SI 2LFBA 3OY9A 2R93J 3GFLA 3F22A 4BS9A 1KQ9A 5ILUA 4XKVA 2Y48A 4I02A 2QQ9A 4M6YA 3GTLJ 5FROA 3E7LA 2DN0A 4L5IA 1H9GA 5J4VA 5HDNA 2M87A 4A3LJ 1VQOI 3HC7A 2VASA 5CLSA 3G1LA 1U5TC 1DU6A 1UJ8A 3AG3H 1WJ5A 3CC4I 4E7KA 3PFIA 1FTZA 4KMFA 3RZOJ 4P9FA 3SFZA 1HOMA 2UV1A 4B43A 3HUGA 2DAOA 2VKEA 3WTYC 4E6KG 1R1UA 3DU6A 4OWRB 2G0EA 3FXKA 1ZHFA 3W2VA 3BTIA 1ZRDA 1IDZA 4OIRF 2QSGX 3H1CA 3O2PE 5BPDA 1PJRA 4L5EA 4U7BA 5LGUA 3VOEA 2IT0A 1QVUA 1O4XA 1RPWA 3PSIA 1K7AA 2OBPA 4M3DA 1BIAA 1BM9A 3A2KA 1BOAA 2CQKA 3OR2C 2GLOA 2Z16A 2DA2A 3HXLA 2YR2A 4XLNF 2D45A 3C2BA 3L1PA 1BC8C 1FSHA 5BNGA 5K7FA 5DM7F 2AXLA 3SXYA 4KDPA 1Y0UA 1LPQA 4LD5A 2FBHA 3OIOA 2VOPA 3IKVA 2KIUA 3RKXA 2DDBA 2M7BA 1VQ8I 3SDBA 4RM3A 2ZJQF 1WJBA 1K4SA 2R7ZJ 3F21A 5F08A 2HQ5A 2CV2A 3FZVA 3OMYA 4WK8F 5D5VB 3VFZA 1PNLA 2XB5A 2CO5A 1AU7A 4V2FA 4RB1A 2O8XA 1GV5A 2ZCWA 1QPIA 3REOA 3MZ8A 3OV8A 2VQLA 5ED4A 1OJLA 2UZKA 3QYEA 2LG4A 3S8RA 1Z21A 2KPMA 2WAFA 4ESFA 5BS6A 1MIJA 5L3BA 1FYLA 1KZHA 1YJ9I 2HPMA 1WFXA 1FYMA 1ZLKA 3GW2A 2L7ZA 4J01A 1AJPA 3E5XA 2R7TA 1OR7C 1J75A 1YW8A 4XKBA 5JHFA 2XAJA 4PELA 3PQJA 2A61A 3DQVC 4A5NA 1IAWA 3K2AA 1SFUA 1I50J 1H9TA 4C2TA 3VB2A 2XRNA 4HSRA 2P0WA 4AWXB 3G71I 2NVXJ 2CU7A 4EJOA 1Y1VJ 2E7WA 1JE8A 2X0LA 1WZ2A 1YOVB 4FQGA 3SZGA 3JRBA 1XGMA 2K9MA 3GZNB 3RKWA 4ABZA 2V6EA 4Y33A 3IRQA 1G6NA 3DP7A 2HKXA 2GQQA 2H6CA 1HDPA 3LAPA 4LK1F 1SFOJ 3S93A 2UWMA 4UY8I 2OF7A 5H6RA 1NK2P 2BY3A 1FT9A 1DU0A 2DFEA 3L2UA 3GTGJ 4RS8A 5M5WJ 2LVSA 3S17J 1XN7A 4RM2A 3JAMZ 2BXZA 3QPSA 1FX7A 1O7LA 3WHBA 4ESBA 3IHUA 2GXBA 2TRTA 5D6EA 4LG0A 4AIDA 1ETQA 3P7NA 4RGUA 2E2IJ 3WODF 1BI0A 4CHUA 2LRDA 3S32A 4EM0B 4Q48A 2MD5A 3PNYA 2FRHA 1ON2A 2FF4A 3I56I 2EBIA 4BE1A 3ABKH 5IYCJ 1K6OA 1JTXA 3P9IA 2COMA 3HIFA 3HUGB 3J81Z 1VQNI 3BR2A 4RGXA 1D0XA 2DOAA 3D5LA 3WU0A 5DM6F 3OS1A 4OMZA 5KAIC 2W7NA 2FOKA 3TO7A 2EZHA 2IGOA 2OQRA 5HOOA 5ICGA 3ULQB 1OCPA 4E7HA 2DI3A 3HHHA 3Q5FA 3H9GA 3ZMZA 1VQ5I 4XRFA 3DU5A 2L4MA 4BYYA 2YS9A 2EIMH 3MZYA 5IOZA 2K40A 2RVCA 4HRIA 1OISA 2DMTA 1TLHB 1ZLJA 2NS7A 2R5ZA 3CTAA 1MD0A 2DLLA 4RAYA 1PNKA 1JI8A 4GYGA 1Z1DA 2E19A 1MNDA 2G7UA 4DZJA 4ZJZA 3E0JB 2BE5F 2O0YA 2XPWA 3QQAA 4F52A 4RDUA 2BY2A 4PJJA 2HTJA 2EFQA 1O57A 3IAS2 3RQ4A 3IWFA 1JKQC 3TDUC 5FLXZ 2E7XA 5LD2C 1SC7A 4Y15A 2L01A 3ZQFA 1IDYA 4AIKA 4AU7A 3TQNA 1EJ9A 4JBAA 3ZN1A 3SZPA 2QA4I 4UB6C 1K61A 2O03A 3G1MA 4Y4RA 3FBIB 4J00A 1U9NA 1KU9A 3CF5F 2M4KA 3L2RA 2W82A 1V4RA 2VB6A 4HDUA 3BZKA 1X2MA 4JX4A 4XNFA 2IA2A 2OPTA 3CMAI 2I8DA 2KT0A 1Z7UA 2VI6A 5E20A 4QPQA 5LGTA 2JQ7A 3MWMA 4OINF 3HPGA 2ZMEA 2K02A 2MSYA 1EV7A 3GXOA 2FBKA 4EJWA 2LKPA 4L9JA 4A69C 2ZFWA 1LVKA 2QZ8A 4UUTA 5FFXA 3BROA 3TL4X 2JA2A 3H3ZA 1YO5C 3FM5A 2EILH 1RR7A 3F9KA 4HG2A 4BQOA 4CICA 1MH3A 4U0YA 2JA7J 3CMEI 1KYZA 4JX6A 1JGGA 1W7PA 1X1BA 1K5QA 4CXFA 2JA5J 4O3MA 2RN7A 1ZRCA 4U0WA 2K86A 4FX4A 3JR9A 1PP7U 3HOTA 2QGUA 3JRDA 4OMYA 4BXUA 3V7RA 2DDAA 3SEZA 4Y13A 1IXSB 4BWCA 4NC6A 2IS1A 1TWFJ 3F8NA 4K2FA 1YS7A 1GHCA 1K78B 3JRFA 1SVOA 2ADVA 4D1QA 4OIOF 2OTJI 3AL0C 1JUMA 1DPUA 4MEXF 5KK1A 1KU2A 2QCOA 1I1SA 2DT7B 2DW4A 3ECOA 4EEFG 2DT6A 3ML0A 2NYXA 3IRRA 3BG3A 1OR0A 2CFXA 3ZQLA 4IXAA 2A6EF 2DPUA 1ZG5A 2I10A 1IXRC 3F8MA 1FOKA 3A01B 4BXXJ 2M8GX 3PL8A 5FO5A 5F0FA 1KYWA 2AXTC 4CCNA 1FP1D 2F5EA 1Z6RA 3ABUA 2E5NA 3K0LA 2CQNA 2MLGA 2EQRA 3ZQHA 3KE2A 2NVQJ 1VQ4I 3I5UA 1OFCX 3LQRA 2VOOA 4YFAA 3LA3A 1I39A 1Q1HA 2BXYA 1GK0A 4EJUA 2BV6A 2M7AA 1TW3A 4C3IJ 1ORKA 1O3QA 1BI1A 3LL7A 2KJBA 2R5ZB 2QWWA 2XHKA 4EGZA 1ULYA 2EFPA 2XV4S 1WKMA 2EZIA 1R71A 1S6LA 2JPBA 1XCVA 2XKOA 2IS6A 1BC7C 2STWA 2JUCA 1WCMJ 4F92B 2ZXIA 4IHSA 5B1BH 1UAAA 4AD9A 3SYTA 5LGNA 5JLWA 4LG3A 2H1KA 4ZZLA 4BAYA 4IL6C 4BBRJ 3KZYA 3CO7C 3TW6A 2P5KA 3GLXA 2NAZA 2K3PA 3UNGC 5HS8A 1EH7A 1S5LC 4LB6B 4CUGA 1YFHA 5IT9K 2ME0A 4LJZF 2GBYA 2E1CA 5ICCA 1K6YA 1V55H 1T38A 4TV7A 3V7CA 4X6AJ 2QLZA 5JFRA 1D0ZA 5JVTA 2MC3A 3R60A 3TOBA 5CPRB 1R6RA 2F48A 3FIWA 5TGTA 2VODA 2Y0MA 3K4JA 1J59A 3C1DA 3GLLA 5FKMA 3BDDA 3FWEA 3CF2A 3JTRA 3L2QA 3HJEA 2VXZA 4BHCA 3OYCA 3S14J 2TCTA 1W7PD 4PCQA 2MFZA 1UZCA 3EUAA 3PNVA 2O6GE 4GCVA 1IRXA 2E35A 2YSRA 3V7SA 2NVUB 4L18B 2TDXA 1R1VA 2DFIA 1AKHA 4HEA2 5EEAA 3C2HA 4E4HA 1U2WA 3DWLE 3ZMDA 1NH3A 3PUFA 4F55A 2ESHA 1W7PB 4U88A 4C3HJ 3FISA 4HX4A 1N75A 2XF5A 2WYBA 1MNEA 1TQIA 5M3FJ 1MMDA 1BR1A 4KIFA 2DA3A 3DEUA 3IP4B 4OAZA 2OZUA 4RAZA 3Q9SA 3WE3A 2V4JC 1OYYA 3KCCA 4H0EA 2IXSA 4WXHA 2VBWA 1Z05A 4MNUA 1BR4A 3BOQA 2UUZA 3M1EA 4IVNA 4K2EA 3TDZC 1RZ4A 2XVCA 2DCEA 4D7NA 1HQCA 1XX5A 3BTJA 4BGDA 3J7AO 5TISC 1P7IA 2EINH 4XKCA 2WYEA 3CCJI 1LE8A 1OQYA 2M34A 3K7AJ 2L02A 2LC2A
chains in the Genus database with same CATH topology
3FHNA 3ZXSA 2KRHA 2VL8A 4BXFA 4IKFA 2GOXB 3CZ6A 5FRMA 4PJNA 2KZVA 1D1AA 1V5GA 3K70C 5HLTA 3CMMA 2V26A 3PJRA 2X6WA 2WA0A 1X1AA 4E7SA 2AQEA 4BDZA 1KECA 2NOJB 1PYVA 2IGKA 3OIPA 4CA0A 2LY1A 2ZSHB 3CJQB 4DJAA 2W00A 3U21A 2WY8Q 3L2WA 1OLTA 1J09A 1UG0A 3K6GA 2XDVA 4BDYA 3SEQA 3OIQA 2JVGA 2LREA 3CP2A 4PFOA 4FETA 4F3QA 1AJQA 4XN3A 3OS0A 3AFHA 3K4NA 3OY9A 3MKZA 1KEHA 3DKXA 3ONQA 3OYEA 4BS9A 4XQFA 2PJRB 1P9QC 3S3MA 4XKVA 2L5QA 5FROA 3HL2A 3ZQQA 3OS2A 1X4PA 2L9NA 1BR2A 3CESA 4NC7A 2A5WA 4Y3OA 3H9QA 3QODA 3JTQA 3HC7A 2VASA 1GM7A 4BQNA 4ZYAA 5HVQC 3HG9A 2W4SA 1WJ5A 4XL9A 5CKTA 4WKVA 2KL4A 4E7KA 4RLFA 3OYAA 2VLAA 3LSGA 4DGWB 4BE2A 3VSKA 2XF7A 2UV1A 4KT6A 4XONA 4B43A 3UR3C 4XLHA 1LDKB 3DU6A 3G2BA 4E6KG 2F6CA 4OWRB 2KP6A 1MW7A 4NQWB 3DLAA 3W2VA 4BUPA 3S3OA 2WAEA 1GLNA 1PJRA 2LBFB 4YELA 4U7BA 2VXDA 1K7DA 2CW8A 1EA3A 3BG7A 3PSIA 4NNJA 3A2KA 1BOBA 2E60A 3OR2C 2VPLA 2Z16A 3HXLA 4FASD 2ZSIB 4E7LA 2CV0A 3M1CA 3OYLA 1QU3A 2X6XA 3H9JA 3OYDA 2XC7A 3OR1C 4E7IA 1AI6A 2E5ZA 4P5OA 4IX7A 4BJTA 1T0FC 2WAQA 4PUSA 4C2UA 2M7BA 4M1JA 1DGWY 2HPIA 3SDBA 4RM3A 2X6YA 4OAYA 1WJBA 2IGMA 2CV1A 2IS2A 4N4NB 5HNFA 5LFAA 1AI5A 2CV2A 3OMYA 2KMUA 4PSXA 3LSHA 1PNLA 3FDYA 1FXHA 2M3AA 4LIUA 4ANJA 4RLQA 1D0YA 3DKYA 2CW7A 4HSTA 2VQLA 2Z1DA 2Y0SA 3QYEA 2LG4A 3S8RA 1Z21A 2KPMA 2CFOA 2WAFA 4CCOA 2HPMA 1WFXA 4J01A 1AJPA 3ZCOA 2R7TA 2R7UA 1OR7C 4DBRA 4XKBA 1YX3A 4F91B 1CP9A 1WJEA 5JHFA 3K10A 4D9JA 4PELA 2R7QA 3DQVC 4P1WA 2VJ5A 4C2TA 2HDWA 4PK4A 4HSRA 2P0WA 1Z3XA 1QHHD 2WBMA 2CUJA 3SZGA 1T95A 4YF9A 1V5EA 3M8JA 5KHDA 1G8XA 2K9MA 4XOTA 2HVQA 3VWBA 5CQGA 2V6EA 4Y33A 2VQCA 3OOUA 2MABA 1LFPA 2WADA 4BACA 2F5VA 3S93A 1W36D 4DOZA 2UWMA 1UELB 4BL0B 2OC6A 5KCMA 3OYIA 3CP8A 3H5NA 4PJLA 1Z7LA 3L2UA 2RQQA 4XM3A 3AL0B 4PEMA 1W36C 3K4KA 1MMAA 4RM2A 4ZTJA 2VKHA 2RREA 1D1BA 3KYLA 4KISA 1K5SA 1LKXA 4XMYA 3VYSB 4CSWA 2KRCA 4XR6A 2LRDA 2R4GA 4LITA 3S32A 2X1DA 1G59A 1WJAA 2IGNA 3PNYA 4BE1A 2ZXHA 4HNTA 4RMNA 3SRBA 1FMVA 4DIQA 4GRIA 4C9YA 3HUGB 3DTEA 4BJ5C 2MYSA 3J7AY 3IUOA 4JOMA 1D0XA 2X1EA 2DOAA 3D5LA 4XLEA 3FBNB 3ZRGA 3OS1A 4XORA 4U87A 3S8PA 2W7NA 4K2GA 4B3XA 3LSMA 2IGOA 5HOOA 4B44A 2DXIA 1AA7A 3SRCA 4E7HA 4XOPA 2CS3A 3FKJA 3MMYB 3TBIA 1D1CA 3H9GA 1X1DA 4YFBA 2ELJA 3DU5A 3SRAA 3CJRB 4PJMA 2V9KA 2HNHA 2VQGA 3H0DA 4HRIA 1TZLA 2KHMA 4X0GA 4AYBA 3K4BA 1Z3YA 4F93B 1PNKA 1FXVA 1JI8A 1YX5A 3L2VA 1SAUA 4LIVA 3I9V2 2VJ4A 4PFPA 1MNDA 4ZJZA 3E0JB 4II2A 3OYMA 1GKFA 4F52A 2WYCA 1DGRM 1GK1A 4PJJA 2XSJC 4H4KC 3IAS2 3RQ4A 2DJIA 3HKZA 4BEHA 2R7WA 4ZTFA 2HVSA 2X1CA 2OUMA 1X19A 3LSKA 2K5CA 2XAUA 5LD2C 1JX9A 4AU7A 3K4CA 4QPOA 2R7SA 4Y4RA 4J00A 4E57A 3FBIB 2W1OA 2BW3A 3OYJA 2M4KA 3MKWB 3MD2A 3L2RA 2W82A 2VB6A 4E56A 2R7VA 1X1CA 4B47A 2HVRA 3E1SA 4XNFA 4PSWA 2JVHA 4G6TB 3C2GA 2I8DA 2BVLA 4QPQA 1AJNA 3KEYA 3BCBA 2CMPA 4XLAA 3AKZA 1Y6IA 1MMNA 3HPGA 4KITB 3OYBA 3W2AA 4HNUA 2LOOA 1JVZA 2AQFA 4JQFA 1DQUA 3BG6A 4BE0A 1LVKA 3PUBA 2E1MC 1GK9A 2V7FA 3TL4X 2WYDA 2JA2A 4XLFA 2E1MB 4E7ZA 2JSPA 4BTHA 3F9KA 4HG2A 4BQOA 4WKSA 4KJZA 3OYKA 2FUG2 1X1BA 2LYCA 1K5QA 2Z2SB 3DPLC 2AE5A 3A4CA 3EPZA 4ITVA 1FM2A 2M4GA 3HOTA 2ZFUA 3K4MA 3QYFA 3SEZA 3HPHA 3H35A 3RSNA 1N77A 2AE3A 4AVZA 2IS1A 3ZR8X 1S9HA 3NWSA 4K2FA 2R7XA 3PNTA 4WKUA 2LY2A 4CH7A 4N4OB 1GM9A 2ADVA 3QOEA 1HA8A 4D1QA 4BU2A 2CH0A 4C30A 3AL0C 2BOLA 2Q1ZB 3DTIA 4R79A 3OYHA 3PSFA 4HPQA 1WJCA 2M0MA 3BCAA 4NUBA 1ZELA 3L91A 2DT7B 2HU9A 1YE9A 2DT6A 3ML0A 3V42A 2VQHA 1WJDA 4ZDPA 1OR0A 2VKDA 4MLOA 2LH9A 2VIXA 3OL3A 1AI7A 3PL8A 4CCNA 2RNGA 4II3A 2E5NA 2GOMA 2R7OA 3RPUD 1GHDA 1MMGA 1U0JA 4YFAA 4E7JA 1NG7A 1NG6A 2QKLB 3GBGA 1GK0A 2V1NA 1N78A 4DBQA 3OYGA 2M7AA 3LMMA 2MD0A 4CCMA 2L7KA 4ZDOA 1FMWA 3K4LA 1JW0A 3OL4A 3LL7A 3N05A 3S3NA 3IAM2 4YRVA 1DP3A 3K3WA 3OYFA 1WJFA 4IQJA 1E0EA 3OYNA 3BLYA 2XF6A 1V5FA 2JUGA 3W3CA 2IS6A 4CCJA 3ZGKA 2PJRA 2L2OA 4F92B 2ZXIA 2R7RA 4BJ6C 3RCOA 4BEHB 5KNLA 1UAAA 5FRNA 2KDOA 4E55A 3VSLA 3SYTA 3L94A 3H5AA 4LG3A 1KONA 4BQQA 3NWTA 4WKTA 3W2WA 2CUZA 2K3PA 3UNGC 2HZDA 4CZCA 4EATA 4IZZA 3D5RC 4CUGA 2VJIA 2BW3B 1TT0A 1H2GA 1K6YA 1E3AA 3A1YA 2AE4A 2KLOA 1D0ZA 1SFKA 2QKMB 5CPRB 1R6RA 4ZDLA 4XKWA 5TGTA 2KQRA 3K4JA 2BVMA 3CF2A 3JTRA 3L2QA 2L9SA 3I3LA 2LBFA 2VXZA 3OYCA 3LFUA 2MFZA 3D5SC 3DPTA 3EUAA 4ZC3A 3PNVA 4YEJA 3EUKL 3VYUB 1PNMA 1IRXA 3OWTA 4IQ4A 2X51A 2WB1A 2Q2EB 3QYBA 4HEA2 2IS4A 2HQAA 3C2HA 3DTKA 4E4HA 3DEEA 1ERDA 3DWLE 1VZ0A 4F55A 1N75A 2XF5A 3VYTB 2WYBA 1MNEA 4XN0A 3KX2A 1QHGA 1MMDA 4NC8A 1BR1A 1X4OA 2VJJA 3VYRB 1Y56A 2X85A 3IP4B 4OAZA 3H5RA 3TMOA 3VDXA 4CCKA 1AI4A 4XLCA 5CQEA 2V4JC 2OV7A 2IXSA 2MC4A 1GM8A 1BR4A 5HNHA 3RTRA 3HOSA 3EUHC 2F4IA 3DPUA 2PMZA 2A6TA 2UUZA 4B48A 2DCEA 3PFYA 4CCLA 4BGDA 2O5RA 2K9LA 3MKYB 4XKCA 2WYEA 3K70D 2WY7Q 3BC8A 3LSIA 2LC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AI5 A;  4BTH A;  4E56 A;  4E55 A;  1PNK A;  1AI4 A;  4HSR A;  1GHD A;  3L94 A;  4PEM A;  1FXV A;  3JTR A;  4WKS A;  4YFA A;  1GM8 A;  1AJQ A;  1PNL A;  4WKV A;  1FXH A;  4K2G A;  1K5Q A;  3L91 A;  4WKT A;  1GK0 A;  1AJN A;  4YF9 A;  1GKF A;  1K5S A;  2AE5 A;  1KEH A;  2WYC A;  1PNM A;  1GK1 A;  3ML0 A;  1AI6 A;  4HST A;  3SRC A;  1KEC A;  1FM2 A;  1OR0 A;  1JW0 A;  3S8R A;  1JX9 A;  1JVZ A;  1H2G A;  3K3W A;  4YFB A;  2AE3 A;  1E3A A;  4M1J A;  3SRA A;  1AJP A;  2AE4 A;  4K2F A;  4E57 A;  1AI7 A;  1CP9 A;  2WYE A;  4WKU A;  2WYB A;  3SRB A;  1GK9 A;  4PEL A;  1GM9 A;  1K7D A;  2ADV A;  3JTQ A;  2WYD A;  1GM7 A; 
#chains in the Genus database with same CATH topology
 1P6R A;  3I71 A;  4BXF A;  3FGT A;  1SAN A;  3MVP A;  2RV8 A;  3HRS A;  1V5G A;  1W1W E;  4LK0 F;  1BW5 A;  1W4M A;  1T33 A;  1LEA A;  5LHG A;  4BDZ A;  2EH3 A;  4HF0 A;  1PYV A;  2A3S A;  4KN4 X;  5D4S A;  2ZSH B;  2PLY A;  2NVT J;  3BP8 A;  4DJA A;  3PM1 A;  3U21 A;  2PX9 A;  4M72 A;  1R9T J;  3K6G A;  5LRR A;  4BDY A;  3SEQ A;  2DYS H;  1X1P A;  3WE2 A;  5DYM A;  1NTC A;  3H3V K;  4FET A;  1LFU P;  3R0J A;  3L2C A;  4IHT A;  3BJA A;  3K2Z A;  4FIS A;  1GDT A;  5LBQ A;  1W0T A;  3AFH A;  3K4N A;  3MKZ A;  2K9Q A;  2K4B A;  2FQ3 A;  5EZH A;  1KEH A;  3ONQ A;  4KA4 A;  3OYE A;  3SHF A;  1OPC A;  2YU3 A;  4G7O F;  4B4C A;  1IN5 A;  2L5Q A;  2VT2 A;  3S1R J;  4CO8 A;  1FLI A;  1ETW A;  2L9N A;  2LF8 A;  3BG5 A;  4Q47 A;  2L9V A;  3CCY A;  3IH2 A;  4Y3O A;  3H9Q A;  3QU3 A;  5L3G A;  1B4A A;  1GM7 A;  4BQN A;  2OJE D;  3KEO A;  2H09 A;  1XMK A;  3HG9 A;  2OA4 A;  4KIB A;  2STT A;  4A3I J;  4L0Z B;  2KL4 A;  2ZBK A;  3KLO A;  5FKK A;  4Y52 J;  3OYA A;  1QVT A;  4DGW B;  4BE2 A;  4XON A;  5D5X B;  3JTG A;  1K79 A;  3G2B A;  5DCF A;  5FD6 A;  1R5H A;  2XPV A;  2YUS A;  1MW7 A;  5FFZ A;  2DOE A;  3DLA A;  2UXN A;  2WAE A;  1BA5 A;  1VTN C;  5JLX A;  1K7D A;  2DMN A;  2GA1 A;  1EKE A;  3BTL A;  3S16 J;  3S1N J;  4B8X A;  1BOB A;  2P8T A;  1TQM A;  1AKH B;  2NOG A;  2ZSI B;  4L5J A;  4PDK A;  2CV0 A;  3OYL A;  4RB3 C;  2X6X A;  3H9J A;  4E7I A;  4OIQ F;  2NRA C;  4IX7 A;  2F4O B;  3RJP A;  1APL C;  2F5C A;  3SJM A;  2EA4 A;  1G4D A;  3J80 K;  5D5U B;  4MIM A;  3GZ6 A;  2X6Y A;  3JRE A;  2CV1 A;  3QAH A;  4EQQ A;  1BI2 A;  4XLP F;  3I55 I;  1O3R A;  3Q9V A;  3WHC A;  1AI5 A;  2IEK A;  3GX4 X;  1FP2 A;  2KMU A;  3CUQ A;  4N9I A;  1S7E A;  2UXX A;  5CVI A;  1YLF A;  3FDY A;  1FXH A;  2K27 A;  1MBF A;  1WI3 A;  2M3A A;  3KP3 A;  4ANJ A;  4RLQ A;  1Z0X A;  2EZK A;  3BG9 A;  2IP2 A;  5JR3 A;  1XB4 A;  1LE8 B;  3S1M J;  2F5D A;  1FBU A;  3K9T A;  4D5C A;  4CCO A;  1MZB A;  3RQI A;  3RI4 A;  1DDN A;  1B9N A;  4WX9 A;  4GFB A;  1VQM I;  1XSV A;  4B1R A;  1IN6 A;  4IRG A;  2JZY A;  4DBR A;  4NB5 A;  4WWC A;  3K10 A;  3O8H A;  2C6Y A;  3F72 A;  4PJ0 C;  1HF0 A;  1OCO H;  2ZNZ A;  1VQ6 I;  2CG4 A;  1R22 A;  3ERM A;  2I5U A;  1OYW A;  2HXI A;  3RPQ A;  5FKL A;  2CUJ A;  4XRS G;  1T95 A;  4M9Z A;  1V5E A;  1PUF A;  4XOT A;  2HVQ A;  2CWE A;  4QLC U;  3TP3 A;  2VQC A;  3OOU A;  3VOD A;  5K1Y A;  2RGV A;  1UMQ A;  2OCE A;  4OU0 A;  4BAC A;  1W36 D;  3LA7 A;  2ECC A;  3CC7 I;  2PI0 A;  2LSO A;  4WXC A;  4BL0 B;  2CRG A;  5IP7 J;  1I3Q J;  3M3Y J;  3CP8 A;  1SD5 A;  1ZGW A;  1WVR A;  4PEM A;  3NAU A;  3TW7 A;  2DOF A;  2RRE A;  1JKO C;  2K3F A;  1D1B A;  3PIO F;  1O3T A;  2ACJ A;  2XAG A;  2QSH X;  1K5S A;  3FX3 A;  4MTD A;  3DFG A;  5L3C A;  1MGT A;  1Z77 A;  3LQQ A;  1IC8 A;  5EEH A;  3GFI A;  3HHG A;  2X1D A;  2OD5 A;  1QA6 A;  2IGN A;  4L0Y B;  2ZXH A;  3Q0W A;  5BPI A;  3Q0V A;  3ZMS A;  3WU1 B;  3S15 J;  3NEU A;  4DIQ A;  4GRI A;  4GXO A;  5EDN A;  2MYS A;  3E6D A;  1YG2 A;  1PP8 F;  3DKW A;  2CUE A;  2PMH A;  3IL2 A;  3ZRG A;  3FMS A;  3FBN B;  4MQV A;  4XOR A;  4R1H A;  3CDI A;  3S2W A;  4KYW A;  2A6H F;  4EVI A;  1FTT A;  5BMZ A;  1XCB A;  2PMZ N;  3I58 A;  2IJL A;  3WG9 A;  2CS3 A;  3TBI A;  1ON1 A;  2XPU A;  1FJL A;  3N4M A;  4HLY A;  1BJA A;  4HV6 A;  3HBL A;  4NDL A;  4PJM A;  2LKX A;  2V9K A;  4YG2 F;  2E1N A;  1F4K A;  2Y75 A;  3CQZ J;  3RPU A;  2E34 A;  1G3S A;  2MH9 A;  2WV0 A;  1FXV A;  1YX5 A;  1SAU A;  4M9S A;  3SZT A;  3L09 A;  2A69 F;  1GKF A;  1DGR M;  3PJR A;  2R7W A;  2BHY A;  4EM2 A;  4WXD A;  2OUM A;  3LSK A;  2K5C A;  2XAU A;  3IKT A;  1U5T A;  5IT9 Z;  1YHQ I;  3CUQ B;  3HSR A;  5K5O A;  2DMQ A;  2F5F A;  2R7S A;  4E57 A;  4RGS A;  4D0P A;  4PZJ A;  3TOA A;  2W1O A;  2BW3 A;  3I59 B;  2DA6 A;  2R7V A;  4L9N A;  3I64 A;  4B47 A;  1UHM A;  4LLG F;  2DA4 A;  1VQ9 I;  5J8C A;  3MEX A;  3H36 A;  3CDL A;  1Y6I A;  2G7H A;  3O6B B;  2M1B A;  3AKZ A;  2EWN A;  4V19 K;  4HNU A;  2RDP A;  5DD4 A;  3GCM A;  3QOP A;  4M3E A;  2XKP A;  1DQU A;  3QRF F;  3FM3 A;  2BEO A;  4HQE A;  3JCU C;  4UVC A;  2QQA A;  3LA2 A;  4HLX A;  5ICE A;  2OTL I;  2WYD A;  1PUF B;  5HS9 A;  2E1M B;  1ITY A;  2JSP A;  3M9A A;  1JKR C;  2HFH A;  1E3H A;  4AVP A;  5J3L A;  4BKX A;  4WKS A;  2M9H A;  1LFB A;  2HZT A;  5BOX A;  2FUG 2;  2DMU A;  2LYC A;  3ASO H;  5E1W A;  3SQN A;  4W97 A;  3EPZ A;  1FM2 A;  4HX7 A;  2L7M P;  3HPH A;  2DYR H;  2KZG A;  1HKS A;  3H35 A;  4M3F A;  2PFB A;  4A0Z A;  1LJ9 A;  1F5T A;  2VC1 A;  3B02 A;  1YIO A;  2JRM A;  2DOD A;  4WKU A;  5GPA A;  5GAD J;  1T08 B;  3BQY A;  4A3G J;  1HA8 A;  5D4R A;  3DTI A;  2XGX A;  3O3K A;  4YIR X;  4HPQ A;  1SFE A;  1WJC A;  4AIJ A;  4NUB A;  1T39 A;  1EH6 A;  3BY6 A;  5EG0 A;  3L91 A;  1K78 A;  1VQK I;  1IN7 A;  2JK3 A;  3GTO J;  1WJD A;  1TWG J;  1T56 A;  2VKD A;  4IF4 A;  3I4P A;  1UG2 A;  2LH9 A;  2CJJ A;  4U0V A;  3BPX A;  3HDD A;  1RNL A;  1R4M B;  1TL8 A;  5DS9 A;  2W24 A;  4B09 A;  1EF4 A;  5FB2 A;  4IHX A;  2GOM A;  5IYD J;  3RPU D;  1R00 A;  4QWQ A;  1U0J A;  1S3J A;  1U9O A;  1STZ A;  2DA7 A;  3GO5 A;  3GBG A;  1R58 A;  3A01 A;  4ZYH A;  3F6V A;  3JRI A;  2R7F A;  3WGI A;  4BY7 J;  4CCM A;  2NNY A;  1IRG A;  4ZDO A;  1FMW A;  3K4L A;  3I4N J;  2GZW A;  1HCR A;  3N05 A;  2EFN A;  2W25 A;  1DP3 A;  5K7Z A;  4HQM A;  2JRT A;  1E0E A;  2QVO A;  2XAQ A;  3FXU A;  2XF6 A;  2O7O A;  1TQP A;  1V5F A;  3OYN A;  4GO1 A;  5FLM J;  3HSF A;  2X6O A;  3HRM A;  5F0H A;  2PJR A;  1KA8 A;  2EV6 A;  5FRN A;  1RET A;  4QSH A;  1ZK8 A;  2KJC A;  4KFC A;  1U5T B;  5ICF A;  1KON A;  3PO2 J;  4BQQ A;  3NWT A;  3ZN0 A;  3WTS C;  1ETK A;  3QP5 A;  2CUZ A;  1R5G A;  4A0X A;  1J2X A;  2HZD A;  4LMY A;  2KIM A;  4IZZ A;  2O8K A;  2BW3 B;  3S1Q J;  4Q5S F;  1H2G A;  4I0B A;  1E3A A;  2BYV E;  5E3O A;  3A1Y A;  1QRY A;  1SVM A;  4EJT A;  1SFK A;  4KIC A;  2ZME C;  2EB7 A;  4HF1 A;  2LR8 A;  2BVM A;  5AON A;  1S8N A;  4NQW A;  4XID A;  2LBF A;  2R7D A;  4KNY A;  4Z2Y A;  3X2Q H;  4AM3 A;  3LFU A;  5A2Q Z;  3EUK L;  3KP6 A;  4IQ4 A;  2Z99 A;  5LLQ A;  2A05 A;  2WB1 A;  1IO2 A;  2JT1 A;  2EK5 A;  3BJO A;  3GME A;  3GWZ A;  2MW8 A;  1ZH5 A;  2IS4 A;  3DTK A;  1IJW C;  1ERD A;  1R4N B;  3DEE A;  2DFH A;  4G94 A;  3HOW J;  2MLK A;  3J80 Z;  3IH3 A;  1YW9 A;  5F6F A;  4HYE A;  4MFD A;  5H2F C;  3KX2 A;  1BBY A;  1QHG A;  4NC8 A;  2X85 A;  4WF2 A;  3JRH A;  1FC3 A;  3TMO A;  3VDX A;  1T0F A;  1ODD A;  1XMX A;  3LSP A;  2OV7 A;  1I1G A;  5IOY A;  3L7W A;  2EFO A;  3WTU C;  1JHF A;  4ZZD A;  3EUH C;  4BHB A;  5B5E C;  1FY7 A;  3LOC A;  2A6T A;  3RYR A;  4B48 A;  1TWA J;  4CYD A;  3TO6 A;  2B63 J;  2H1L A;  1I5Z A;  1W0U A;  1XDU A;  2P6T A;  4GGG A;  3RKY A;  5FJ8 J;  2AHQ A;  2O5R A;  3MKY B;  2VE9 A;  4ENM A;  5EG0 B;  4I6Z A;  3K70 D;  2V9P A;  3BC8 A;  2E36 A;  3LSI A;  3B73 A;  3ZXS A;  2KRH A;  2QEX I;  4IKF A;  2GOX B;  3CZ6 A;  5FRM A;  3F3X A;  4PJN A;  4UVA A;  2RQP A;  3GUD A;  5C44 J;  2J5P A;  4UUV A;  3JTH A;  2F2E A;  5L3E A;  5IP9 J;  5JVG F;  4ENN A;  2V26 A;  3MKL A;  4IHY A;  2HS5 A;  2AQE A;  1KEC A;  1IXC A;  1TT5 B;  2L0K A;  4HZF A;  5HLH A;  1BI3 A;  1ZRE A;  2WY8 Q;  4YII A;  4NHJ A;  4A3M J;  2OAZ A;  1HDD C;  3GYH X;  2CGP A;  3I0T A;  3OIQ A;  1R7J A;  3CO6 C;  1I6X A;  2L7F P;  4A6E A;  4XIC A;  1Z91 A;  3L00 A;  4F3Q A;  3OS0 A;  3WTW C;  1IRF A;  2HYF A;  2DMP A;  5CVR A;  2FQ4 A;  3CCQ I;  1R1T A;  4Y17 A;  1YQA A;  2PJR B;  1VQL I;  1RKT A;  3CCM I;  3NAR A;  1ETY A;  2LDU A;  2WB1 N;  3DEW A;  3ZQQ A;  1TNS A;  4CYC A;  3OS2 A;  1ZG3 A;  1RES A;  1IUY A;  1BR2 A;  2LMD A;  3CES A;  4NC7 A;  2A5W A;  5C3E J;  4IOC F;  3ELK A;  2A07 F;  5M3M J;  3JTQ A;  1A5J A;  3H92 A;  4ZYA A;  1IV6 A;  5HVQ C;  2LP0 A;  2W4S A;  4XL9 A;  5CKT A;  5E79 C;  2COB A;  3AG1 H;  5C4X J;  4WKV A;  1XC5 A;  3LSR A;  1ONV A;  2IBD A;  3KP4 A;  2QQ8 A;  3C3W A;  3LSG A;  3FK7 A;  3K69 A;  2FU4 A;  4P55 A;  3TO9 A;  4ZYE A;  2VLA A;  3UR3 C;  5H20 A;  1LDK B;  1LB2 A;  2F6C A;  3RDI A;  1YIJ I;  2GWR A;  2L3D A;  2DTZ A;  2FMY A;  3ZQC A;  1G3T A;  2M0C A;  4NQW B;  3S3O A;  4A6D A;  2GXG A;  2JTV A;  1GLN A;  2LBF B;  4YEL A;  1ZGJ A;  1FBQ A;  1PVE A;  5LEJ A;  1B9M A;  1EA3 A;  2CW8 A;  3BG7 A;  5DUK A;  1ZR4 A;  1P2F A;  2HOA A;  4NNJ A;  5E1Z B;  1GXQ A;  1OCT C;  1Y8Q B;  2E60 A;  2XAS A;  1ZGA A;  4FAS D;  3WTZ A;  2Z9O A;  3PQK A;  1KQ8 A;  2LF7 A;  3M1C A;  2NVY J;  4UVB A;  1XTA A;  3OYD A;  3V8J A;  3ABL H;  3DXJ F;  3CCS I;  3CCU I;  2XC7 A;  3OR1 C;  4ON0 A;  5J8F A;  1NHA A;  4BJT A;  4MHG A;  4CDG A;  3IC7 A;  4PUS A;  2ISY A;  1DGW Y;  1GV2 A;  2HPI A;  1I27 A;  4OAY A;  2IGM A;  2IS2 A;  3HTS B;  4N4N B;  4G7Z F;  1L3L A;  3D0S A;  5LFA A;  4L9V A;  1XSX A;  4I09 A;  2JWT A;  3P9C A;  3RKQ A;  2CQX A;  2D1H A;  2JPC A;  5IYB J;  1T6S A;  4LIU A;  3JSP A;  2CW7 A;  4HST A;  1D5V A;  2Y0S A;  4M71 A;  1UB9 A;  2FJ1 A;  1HBX G;  3OSG A;  2CFO A;  2Y2Z A;  1FNN A;  1VI0 A;  1B72 A;  3LWF A;  3ZOB A;  2ZXW H;  1RRJ A;  3JW4 A;  1YX3 A;  2DBB A;  3WGG A;  1TC3 C;  5CJ9 A;  2R7Q A;  3QPT A;  4MGR A;  3G6E I;  4RAF A;  3KP2 A;  2HDW A;  4PK4 A;  1MSE C;  1DUX C;  1Z3X A;  1QHH D;  5E3M A;  1AHD P;  2WBM A;  1A35 A;  2X4H A;  4I76 A;  4YF9 A;  1X3U A;  2HWV A;  2O3F A;  3M8J A;  4I0A A;  3K1N A;  4CZZ A;  5CQG A;  3JRA A;  2O9L A;  2DK5 A;  4IJA A;  3M8F A;  5DTD A;  2ME6 A;  4LB5 A;  4A2U A;  5TRD A;  5IY5 H;  2XAH A;  2OQG A;  1HKQ A;  1Z67 A;  2R3S A;  2NS0 A;  3QP6 A;  4PGG A;  5EYR A;  4DOZ A;  5JHU A;  1UEL B;  1F9N A;  4P96 A;  3ESW B;  5KCM A;  3D1N I;  1A04 A;  3OYI A;  3H5N A;  4MO7 A;  1OCR H;  4PJL A;  1WPK A;  2MGQ A;  2RQQ A;  4XM3 A;  3AL0 B;  4ZH4 F;  1W36 C;  1MMA A;  1ENH A;  1TW2 A;  2GAU A;  4IO9 F;  4CYC B;  1FBS A;  5D6F A;  5H6Q A;  2XB0 X;  5HS7 A;  1LKX A;  3VYS B;  5AIP A;  5KVR A;  2HTS A;  2P5L C;  1WQ2 A;  2KRC A;  4XR6 A;  1XS9 A;  4ENJ A;  2KIQ A;  1YJW I;  1G59 A;  2KKO A;  1QO0 D;  2Y30 A;  4KT5 C;  1XGO A;  4UV8 A;  3WGH A;  4RMN A;  2W57 A;  5EZG A;  2MG4 A;  5EF6 A;  5DCM A;  1D5Y A;  1FMV A;  1MMS A;  1P4W A;  5CVV A;  4C9Y A;  1MDM B;  3IUO A;  4JOM A;  2X1E A;  4XLE A;  1F43 A;  2EIJ H;  1Y0N A;  5IPA A;  4U87 A;  2WWY A;  2EA2 A;  3NRV A;  4RBO A;  3CCL I;  1PUE E;  2F4M B;  2H8R A;  4B44 A;  2DXI A;  1AA7 A;  4RGR A;  3ZPL A;  4XOP A;  4RA2 A;  1MJB A;  3JSO A;  3FKJ A;  3MMY B;  2M30 A;  1D1C A;  2M5W A;  1P4X A;  3W6J B;  2ELJ A;  3SRA A;  1E3P A;  2HNH A;  4W1U A;  3E5U A;  2H94 A;  1TZL A;  1J9I A;  2DO7 A;  2GIZ A;  2KHM A;  3BTC A;  2P81 A;  4IRH A;  3BR6 A;  3U1K A;  4AYB A;  3K4B A;  1Z3Y A;  2HDC A;  3L2V A;  1ZR2 A;  2H6B A;  3FXL A;  1LEB A;  1BJZ A;  4UNO A;  3OYM A;  3V8K A;  1ZKG A;  2WYC A;  5A2Q K;  2XSJ C;  4H4K C;  4ZTF A;  2E1O A;  2DJI A;  3HKZ A;  2X1C A;  2LY9 A;  1JX9 A;  3ASN H;  4ETS A;  1G3W A;  3H0G J;  2PJP A;  4G12 A;  1CF7 B;  3EDP A;  3K4C A;  3I4M J;  4QPO A;  3DBR B;  3V8L A;  1QPM A;  4HNV A;  2GM4 A;  4JP0 A;  3GFJ A;  4UHT A;  4G8X A;  3MD2 A;  5GAE J;  3MKW B;  2EIK H;  4E56 A;  3QPL A;  3S2D J;  1X1C A;  2MH2 A;  1S7O A;  3E1S A;  4PSW A;  1B72 B;  3C2G A;  3E97 A;  1X3Z B;  1T98 A;  3BCB A;  1FIP A;  2CMP A;  4UB8 C;  3I59 A;  2HI3 A;  3OYB A;  5EGO A;  2A68 F;  2ID3 A;  4IHV A;  1IG7 A;  2BY0 A;  3HM5 A;  3ZMU A;  4F7Z A;  5CVU A;  2CQ7 A;  4XBF A;  2P7C B;  1JT6 A;  3QWL A;  3HOV J;  3PUB A;  2E1M C;  1GK9 A;  2V7F A;  5IT3 A;  2DPD A;  4E7Z A;  1BW6 A;  2Q2E A;  5GAH J;  4BTH A;  2JA6 J;  5DD8 A;  3AG4 H;  4OOI A;  2Q0O A;  2FML A;  2ISZ A;  1G3Y A;  2M8E A;  3A4C A;  2V1D A;  3HOY J;  2M4G A;  1HC8 A;  2ZFU A;  3K4M A;  3IWZ A;  3RSN A;  2AE3 A;  1MH4 A;  1J7K A;  2YX4 A;  3CJT B;  1S9H A;  1JXS A;  3LNQ A;  3AAF A;  3PNT A;  5HLG A;  1OYI A;  1Z9C A;  4CH7 A;  1LNW A;  4N4O B;  3QOE A;  2H8W A;  3FMQ A;  2CH0 A;  2RAE A;  2Q1Z B;  4R79 A;  4M74 A;  5D8L B;  1MBE A;  2HXO A;  3PSF A;  1K83 J;  4AYB N;  3U2R A;  3BCA A;  3WTX C;  4UUS B;  1ZEL A;  3I54 A;  2DTR A;  2HU9 A;  1B59 A;  3M7G A;  1YE9 A;  4HAM A;  1A36 A;  1KGS A;  3V42 A;  4FCY A;  5DCM B;  3HKZ N;  4U7D A;  4MLO A;  2L4A A;  3SFI A;  2VIX A;  1YW7 A;  2P4W A;  5E18 F;  4BHP A;  5C4J J;  1WI9 A;  5E17 F;  2IPQ X;  2P5V A;  4KUM A;  3HOX J;  2RNG A;  4I2O A;  1EH8 A;  3E6M A;  2HEO A;  4DZP A;  1CQT A;  3FXQ A;  3B6A A;  5EJC A;  2ID6 A;  2XGD A;  2ESN A;  4DBQ A;  1P4A A;  3OYG A;  3LMM A;  2Y9Z A;  2MD0 A;  2L7K A;  1LUJ B;  1U3E M;  1JW0 A;  3OSF A;  3OL4 A;  5CVJ A;  2IVM A;  4DQ2 A;  3IAM 2;  3S3N A;  1HKT A;  4IPA A;  3K3W A;  1WJF A;  1D3Y A;  2P7V B;  3HOZ J;  1YS6 A;  3BLY A;  2ECB A;  2JUG A;  2MBF A;  3KZI C;  5ERI A;  3W3C A;  4B3A A;  4CCJ A;  4D5F A;  3ERE D;  2Y69 H;  5FKN A;  3CCV I;  9ANT A;  5KNL A;  2V9V A;  2KDO A;  4E55 A;  3VSL A;  2PBI A;  2Y9Y A;  3HB9 A;  4WKT A;  1FOY A;  3W2W A;  4BNC A;  1UCR A;  2HR3 A;  2IW5 A;  4CZC A;  4BH9 A;  4G6Q A;  2VJI A;  5BQT A;  4FX0 A;  3MN2 A;  3R6S A;  1TT0 A;  5ILS A;  4ASN A;  1P92 A;  2LNB A;  1O7F A;  4ENK A;  2V1U A;  2QBY A;  3C18 A;  4AIH A;  1GUU A;  5LHH A;  2HOT A;  5FLV A;  2VON A;  4ZDL A;  1LDJ A;  1T8I A;  1HXD A;  2ZJP F;  3CC2 I;  3KZZ A;  1YTY A;  4EGY A;  2KQR A;  5EGO B;  5B1A H;  4BQA A;  3T5X A;  1MBJ A;  5CYV A;  2DT5 A;  4ZC3 A;  4YEJ A;  1JUP A;  3CCE I;  2GA2 A;  5FD5 A;  2OCC H;  5L3F A;  2E2J J;  1QZE A;  1KU3 A;  4LGW A;  2A5Y B;  2Q2E B;  3QYB A;  2V79 A;  1QNT A;  1VZ0 A;  2Z3Y A;  1KU7 A;  3M07 A;  1S29 A;  3VYT B;  1MNM C;  2VJJ A;  3VYR B;  4LFU A;  1CGP A;  3F8F A;  1Y56 A;  5HDK A;  4UV9 A;  6PAX A;  4A3D J;  3H5R A;  3R0A A;  2DFF A;  2R92 J;  4XLC A;  5CQE A;  3TKY A;  4ESJ A;  1UFM A;  2MC4 A;  1I6H J;  3HTU A;  4A5M A;  4RB2 C;  4P9U A;  3RTR A;  3HOS A;  2ZNY A;  2CW0 F;  2VUM J;  3DPU A;  5FKO A;  1HLV A;  5GTI C;  2IA1 A;  2Z33 A;  1VQP I;  2K85 A;  4CCL A;  3DCF A;  1ZG1 A;  3KIO A;  4A12 A;  1SD4 A;  4A3B J;  2ZO4 A;  2ELK A;  1F36 A;  5GAG J;  3ABM H;  5F1J A;  3K1P A;  3ZP5 A;  1V3F A;  1H88 C;  1ZAO A;  4ZYG A;  5J47 A;  2OU2 A;  2VL8 A;  2E2H J;  1XDS A;  3BZ6 A;  1U6G A;  1MKM A;  2K9N A;  2ZC2 A;  2QYO A;  2DA1 A;  1OCC H;  3K70 C;  1Y1W J;  4EJV A;  3CMM A;  1OR7 A;  3GTM J;  4QTR A;  1OMI A;  2K4J A;  4A3E J;  1J0R A;  3A03 A;  3OIP A;  3FKI J;  3RZD J;  3EYY A;  4JYK A;  3ECH A;  5DUI A;  1OLT A;  1J09 A;  1UG0 A;  2XIG A;  2XDV A;  3WG7 H;  5E3N A;  2JVG A;  2LRE A;  1W5C C;  1ZYR F;  3CP2 A;  4RAG A;  3H3U A;  3KLN A;  2XRL A;  4KN7 X;  2XGE A;  1R49 A;  2QQB A;  2HQR A;  4XN3 A;  3L9F A;  3CJN A;  2R0Q C;  1UHS A;  1JT0 A;  3DKX A;  2HQN A;  2FSW A;  4XQF A;  1RUO A;  1P9Q C;  3S3M A;  5LRS A;  3I53 A;  4YIF A;  3DF8 A;  3TED A;  3HL2 A;  2W48 A;  1X4P A;  2M2E A;  5J1U A;  1SFX A;  3KPH A;  2FNA A;  4YFX F;  1TWH J;  3T1B A;  4UXN A;  3QOD A;  2ADU A;  3ZQ7 A;  3FHZ A;  4J19 A;  3B6C A;  2H27 A;  5GTH C;  2B0L A;  4RLF A;  1D8J A;  1T2K A;  2QBY B;  5DV5 A;  3GVA A;  3VSK A;  2XF7 A;  1IUF A;  4KT6 A;  2GXA A;  4XLH A;  2CQQ A;  2KFD A;  1WHU A;  1RR8 C;  2W84 A;  2GIV A;  2Z5U A;  4HF2 A;  2KP6 A;  3BZC A;  3HRT A;  2RNJ A;  4BUP A;  4DYC A;  4MTE A;  3EYI A;  3CD6 I;  1XGS A;  2DU9 A;  2VC0 A;  2FBI A;  3LSJ A;  2V1X A;  2VXD A;  5EEG A;  2QF7 A;  3F23 A;  3GTQ J;  1ZN2 A;  1M1E B;  4HA8 A;  4HV5 A;  5GP9 A;  4DYQ A;  3GTP J;  4HW0 A;  5IP6 A;  2VPL A;  1GVD A;  1OCZ H;  1WWX A;  3R4K A;  4E7L A;  2AO9 A;  5M5Y J;  1QU3 A;  1JKP C;  3DLL F;  2ZJR F;  2LK2 A;  2L9R A;  1AI6 A;  2E5Z A;  3KFW X;  2EFW A;  4P5O A;  1U78 A;  1T0F C;  2VBY A;  1YYV A;  2QUF A;  2PQ8 A;  2WAQ A;  4C2U A;  4M1J A;  4XK4 A;  2B7E A;  1X58 A;  4JK1 X;  2IA0 A;  4O5V A;  1RC9 A;  3SDG A;  5HNF A;  2HYG D;  5B66 C;  3G73 A;  1RUN A;  1XGN A;  4PSX A;  3LSH A;  3W6V A;  3BR0 A;  5AIQ A;  5J1Y A;  4O6J A;  4G6D A;  2L54 A;  1D0Y A;  3DKY A;  1E17 A;  2Z1D A;  2PG4 A;  1RI7 A;  2JSC A;  2FD5 A;  3ZQI A;  1QQI A;  3K1M A;  1TTY A;  2LKS A;  3BT9 A;  3F6O A;  4HX8 A;  5F27 A;  5LEK A;  1IW7 F;  2OZ6 A;  5HDG A;  3PIP F;  3ZCO A;  3E5Q A;  2R7U A;  4F91 B;  1BIB A;  1CP9 A;  1WJE A;  4D9J A;  2R5Y A;  3M4O J;  1Q1V A;  3T8T A;  1JHH A;  1XD7 A;  2PEX A;  2VJ5 A;  4P1W A;  1G2H A;  2DQL A;  1Y8R B;  4RB0 A;  2VT3 A;  4QIW N;  3ZQG A;  5F64 A;  5HLI A;  2M45 A;  4GDF A;  3W6K B;  4LLN A;  5E8G A;  1DPR A;  5KHD A;  1G8X A;  4I98 B;  3S2H J;  4KIG A;  3VWB A;  2RKH A;  3KP5 A;  1FEX A;  4HBL A;  2LD5 A;  3WTV C;  2MAB A;  4FE4 A;  1LFP A;  4EM1 A;  2WAD A;  2BHZ A;  2F5V A;  1USS A;  2J5O A;  3FK6 A;  3EUH A;  3NQO A;  1A6Q A;  2OC6 A;  3DV8 A;  5J4Y A;  3MFK A;  2HKO A;  4LG0 B;  2WV1 A;  4S05 A;  1VND A;  2MA3 A;  4S04 A;  2JJ7 A;  1Z7L A;  3FGR A;  3VEP A;  4XSZ F;  3K4K A;  5J6X A;  2FA5 A;  4ZTJ A;  2VKH A;  2G9W A;  2ZXJ A;  4YFK F;  3KYL A;  4KIS A;  2DQR A;  2YPR A;  4XMY A;  3ABT A;  4IHW A;  4CSW A;  2R4G A;  4XSX F;  4LIT A;  1WJA A;  2WAQ N;  3EQL F;  5FGM A;  2HOS A;  2PN6 A;  3U9G A;  4C3J J;  3P9K A;  4HNT A;  3HGY A;  1U8B A;  2EZL A;  3FXJ A;  3N97 A;  3SRB A;  2LLK A;  4D7M A;  2XSD C;  4M6X A;  1A6I A;  1UHW A;  3MAJ A;  3TGN A;  3DTE A;  2VN2 A;  3HYI A;  4BJ5 C;  3J7A Y;  1POG A;  2KIF A;  1HW1 A;  4A0Y A;  3BPV A;  5GPC A;  1REP C;  3AG2 H;  3M8E A;  2EJR A;  3S8P A;  4K2G A;  1R36 A;  3FXO A;  4HOB A;  1XSD A;  4B3X A;  3LSM A;  3WTT C;  3JRG A;  3HEF A;  3SRC A;  1KQ0 A;  1TWC J;  1JTY A;  1QZY A;  1X3W B;  1MDM A;  1WH5 A;  4Z6Y A;  1ZTR A;  1X1D A;  3OOP A;  3BR1 A;  4YFB A;  4G7H F;  1J5Y A;  3CJR B;  1ETO A;  3CDH A;  1A31 A;  1FOW A;  1JJ6 C;  2VQG A;  3H0D A;  4I01 A;  2D1V A;  2EPF A;  3O8G A;  5D8K B;  3WU2 C;  4X0G A;  2WTE A;  3ML6 A;  2KIS A;  1FSE A;  1YRN A;  3FF5 A;  2CYY A;  4F93 B;  4IOA F;  4Y7N J;  2WC2 A;  4LIV A;  3I9V 2;  2VJ4 A;  2ELH A;  1E2X A;  2ZKZ A;  4PFP A;  4II2 A;  2FEZ A;  4MFE A;  2YU9 J;  1GK1 A;  2HVS A;  4BEH A;  2O61 A;  1F1Z A;  5J1R A;  1X19 A;  4CGZ A;  4AC0 A;  1B8I A;  3BR3 A;  3IV5 A;  3E6C C;  2QM3 A;  4C2M J;  4DYR A;  1VQ7 I;  3G1O A;  1WGX A;  2D2W A;  1HST A;  1JUS A;  3OYJ A;  2KRF A;  2ZME B;  3CUO A;  4I99 C;  5ILV A;  1MBH A;  3ZMT A;  1CF7 A;  2Y31 A;  1OKR A;  2HVR A;  1U8R A;  1SMY F;  2BY1 A;  2JVH A;  4G6T B;  2BVL A;  1AJN A;  2JMW A;  3KEY A;  3HRU A;  4XLA A;  1SMT A;  1H89 C;  1MMN A;  2HOE A;  4KIT B;  2R5Y B;  3UKG A;  3GTJ J;  2LOO A;  3W2A A;  1JVZ A;  4E70 A;  2AQF A;  4JQF A;  1HW2 A;  3BG6 A;  4BE0 A;  2NXN B;  2JN6 A;  2BZT A;  1XPX A;  4ZYD A;  3GTK J;  1ETV A;  1W5S A;  3BQZ A;  4XLF A;  4IRI A;  2EV0 A;  1IN8 A;  3P5J A;  5TJJ A;  4KJZ A;  3LFK A;  3OYK A;  3CLQ A;  2N8G A;  5L3D A;  2Z2S B;  3DPL C;  2ETH A;  3BWG A;  5JI6 A;  2AE5 A;  2X48 A;  2XAF A;  5J40 A;  1O3S A;  1IGN A;  1ACI A;  2E71 A;  4ITV A;  1MSF C;  1LDD A;  3QYF A;  1L0O C;  4N0B A;  3Q3S A;  1B1B A;  1MBG A;  5HOD A;  3ROU A;  1V54 H;  3RIR A;  1N77 A;  3E6B A;  3FXR A;  4AVZ A;  3ZR8 X;  3NWS A;  1I3A A;  2R7X A;  4PGH A;  4WCG A;  3JRC A;  4Q4Z F;  5F0C A;  2LY2 A;  1SEU A;  1GM9 A;  1H8A C;  4A3K J;  4A3F J;  4BU2 A;  4BY1 J;  3HGG A;  4C30 A;  2BOL A;  3CLO A;  1UST A;  5KAF C;  3OYH A;  4A3J J;  1JGS A;  3GEZ A;  3G3Z A;  2K7L A;  2CSO A;  1E3O C;  3JAM K;  2M0M A;  4FT8 A;  1FPQ A;  2PMU A;  2JA8 J;  4FHT A;  4EV0 A;  3J7Z I;  2VQH A;  2VE8 A;  4X1E A;  4MEY F;  3F8C A;  4ZDP A;  2DJN A;  1FYK A;  4YFN F;  3PO3 J;  1GT0 C;  3LST A;  1FIA A;  2W85 A;  3OL3 A;  4UUS A;  3KET A;  1QBJ A;  1HSJ A;  4BBS J;  1FOX A;  1Z6T A;  4M6V A;  5M5X J;  1AI7 A;  2Q8K A;  1X2N A;  3F8B A;  2QSF X;  2BBY A;  5F04 A;  4L9T A;  1XMA A;  4II3 A;  3J81 K;  4DNC A;  2D5V A;  2R7O A;  3RYP A;  1QZZ A;  1GHD A;  1B6A A;  1MMG A;  1TP4 A;  2XGC A;  2VBX A;  4E7J A;  1FZP B;  1NG7 A;  1NG6 A;  2QKL B;  2V1N A;  1N78 A;  2IRF G;  4JX5 A;  3R61 A;  1WSU A;  1IZ1 A;  4LLL A;  3E3V A;  2Y0S N;  4YRV A;  1YRN B;  3OYF A;  3Q0U A;  2YX7 A;  1ZQ3 P;  2V6C A;  3GFM A;  4IQJ A;  1AWC A;  4AUX A;  2ZB9 A;  3MZH A;  2EV5 A;  4IEJ A;  1VF9 A;  1HW5 A;  3QU6 A;  3ZGK A;  4DW6 A;  2L2O A;  1WH7 A;  5F1R A;  2R7R A;  4BJ6 C;  5E8I A;  3RCO A;  4BEH B;  1RKW A;  4EMS A;  4M3G A;  5DDG A;  3DBL B;  3L94 A;  3H5A A;  1B8I B;  1LVA A;  2HDD A;  3KYC B;  3TP0 A;  2BGC A;  2CUF A;  2LTP A;  3A02 A;  3CMY A;  4EAT A;  2DK8 A;  1R5I D;  1IN4 A;  2DA5 A;  3D5R C;  4LOC A;  5FLX K;  1LQ1 A;  2VPR A;  3A0B C;  3F0C A;  2ICW G;  3CUQ C;  4R8H A;  1AOY A;  4HDV A;  2X9D A;  5K7H A;  1YI2 I;  3KYD B;  2AE4 A;  3IH4 A;  2KLO A;  1IRZ A;  1IF1 A;  3T8R A;  2QKM B;  4XKW A;  3HSE A;  3CCR I;  3LAJ A;  3BR5 A;  1R23 A;  4FTH A;  2AS5 F;  1QGP A;  2L9S A;  2FE3 A;  3I3L A;  1ZAR A;  5LHI A;  3V4G A;  2XRO A;  3D5S C;  2QEN A;  3DPT A;  3VYU B;  1PNM A;  4M73 A;  3OWT A;  4A3C J;  1TNT A;  2KDZ A;  2FOW A;  3C7J A;  2X51 A;  1ZRF A;  3FMR A;  4A93 J;  2FXA A;  2FNP A;  2HQA A;  5D5W B;  3BJ6 A;  1SD7 A;  1ETX A;  4XN0 A;  4S0H B;  1Y39 A;  1JJ8 C;  3T0Y A;  1X4O A;  5E3L A;  3MQ0 A;  2FX0 A;  4CCK A;  1AI4 A;  2P6S A;  3A0H C;  1IV8 A;  4M3B A;  2VKV A;  5DEQ A;  1GM8 A;  1MJ9 A;  4N9H A;  4FE7 A;  5HNH A;  1DP7 P;  1SD6 A;  1FWZ A;  2F4I A;  4MQ9 F;  2PMZ A;  1N25 A;  3EET A;  1MBK A;  3MCZ A;  2VBZ A;  1SVL A;  1YIT I;  3PFY A;  3VPR A;  2B9S A;  1S7A A;  3GZ5 A;  1WRJ A;  4XRS A;  4NBQ A;  2K9L A;  3COA C;  1D8K A;  3GF2 A;  5K5R A;  3KEQ A;  2NNN A;  1P7J A;  2WY7 Q;  3HOU J;  4OIP F;  3FHN A;  1VFC A;  4I7H A;  2XUB A;  2NS8 A;  1GVJ A;  3FXM A;  2HGC A;  1C0W A;  2KZV A;  1D1A A;  1NK3 P;  5K5Q A;  5HLT A;  1BL0 A;  4KMU X;  3U1D A;  2X6W A;  2WA0 A;  1X1A A;  4E7S A;  1TBX A;  2NOJ B;  1MJA A;  4G9Y A;  5B3S H;  3KP7 A;  1RIO H;  2IGK A;  1GXP A;  2HYJ A;  4CA0 A;  3ZMV A;  2LY1 A;  2RC4 A;  3CJQ B;  1PDN C;  2W00 A;  2K9S A;  1SAX A;  4V2G A;  3L2W A;  2ZJ2 A;  3J7Y J;  2IAI A;  3ISP A;  1H0M A;  5E1X A;  3HZJ A;  4XRM A;  1BN5 A;  4PFO A;  1W5T A;  3QPH A;  4GYI A;  1YJN I;  1S72 I;  1XG1 A;  1K4T A;  4M9X A;  3DBH B;  1AJQ A;  3G4S I;  2LFB A;  3OY9 A;  2R93 J;  3GFL A;  3F22 A;  4BS9 A;  1KQ9 A;  5ILU A;  4XKV A;  2Y48 A;  4I02 A;  2QQ9 A;  4M6Y A;  3GTL J;  5FRO A;  3E7L A;  2DN0 A;  4L5I A;  1H9G A;  5J4V A;  5HDN A;  2M87 A;  4A3L J;  1VQO I;  3HC7 A;  2VAS A;  5CLS A;  3G1L A;  1U5T C;  1DU6 A;  1UJ8 A;  3AG3 H;  1WJ5 A;  3CC4 I;  4E7K A;  3PFI A;  1FTZ A;  4KMF A;  3RZO J;  4P9F A;  3SFZ A;  1HOM A;  2UV1 A;  4B43 A;  3HUG A;  2DAO A;  2VKE A;  3WTY C;  4E6K G;  1R1U A;  3DU6 A;  4OWR B;  2G0E A;  3FXK A;  1ZHF A;  3W2V A;  3BTI A;  1ZRD A;  1IDZ A;  4OIR F;  2QSG X;  3H1C A;  3O2P E;  5BPD A;  1PJR A;  4L5E A;  4U7B A;  5LGU A;  3VOE A;  2IT0 A;  1QVU A;  1O4X A;  1RPW A;  3PSI A;  1K7A A;  2OBP A;  4M3D A;  1BIA A;  1BM9 A;  3A2K A;  1BOA A;  2CQK A;  3OR2 C;  2GLO A;  2Z16 A;  2DA2 A;  3HXL A;  2YR2 A;  4XLN F;  2D45 A;  3C2B A;  3L1P A;  1BC8 C;  1FSH A;  5BNG A;  5K7F A;  5DM7 F;  2AXL A;  3SXY A;  4KDP A;  1Y0U A;  1LPQ A;  4LD5 A;  2FBH A;  3OIO A;  2VOP A;  3IKV A;  2KIU A;  3RKX A;  2DDB A;  2M7B A;  1VQ8 I;  3SDB A;  4RM3 A;  2ZJQ F;  1WJB A;  1K4S A;  2R7Z J;  3F21 A;  5F08 A;  2HQ5 A;  2CV2 A;  3FZV A;  3OMY A;  4WK8 F;  5D5V B;  3VFZ A;  1PNL A;  2XB5 A;  2CO5 A;  1AU7 A;  4V2F A;  4RB1 A;  2O8X A;  1GV5 A;  2ZCW A;  1QPI A;  3REO A;  3MZ8 A;  3OV8 A;  2VQL A;  5ED4 A;  1OJL A;  2UZK A;  3QYE A;  2LG4 A;  3S8R A;  1Z21 A;  2KPM A;  2WAF A;  4ESF A;  5BS6 A;  1MIJ A;  5L3B A;  1FYL A;  1KZH A;  1YJ9 I;  2HPM A;  1WFX A;  1FYM A;  1ZLK A;  3GW2 A;  2L7Z A;  4J01 A;  1AJP A;  3E5X A;  2R7T A;  1OR7 C;  1J75 A;  1YW8 A;  4XKB A;  5JHF A;  2XAJ A;  4PEL A;  3PQJ A;  2A61 A;  3DQV C;  4A5N A;  1IAW A;  3K2A A;  1SFU A;  1I50 J;  1H9T A;  4C2T A;  3VB2 A;  2XRN A;  4HSR A;  2P0W A;  4AWX B;  3G71 I;  2NVX J;  2CU7 A;  4EJO A;  1Y1V J;  2E7W A;  1JE8 A;  2X0L A;  1WZ2 A;  1YOV B;  4FQG A;  3SZG A;  3JRB A;  1XGM A;  2K9M A;  3GZN B;  3RKW A;  4ABZ A;  2V6E A;  4Y33 A;  3IRQ A;  1G6N A;  3DP7 A;  2HKX A;  2GQQ A;  2H6C A;  1HDP A;  3LAP A;  4LK1 F;  1SFO J;  3S93 A;  2UWM A;  4UY8 I;  2OF7 A;  5H6R A;  1NK2 P;  2BY3 A;  1FT9 A;  1DU0 A;  2DFE A;  3L2U A;  3GTG J;  4RS8 A;  5M5W J;  2LVS A;  3S17 J;  1XN7 A;  4RM2 A;  3JAM Z;  2BXZ A;  3QPS A;  1FX7 A;  1O7L A;  3WHB A;  4ESB A;  3IHU A;  2GXB A;  2TRT A;  5D6E A;  4LG0 A;  4AID A;  1ETQ A;  3P7N A;  4RGU A;  2E2I J;  3WOD F;  1BI0 A;  4CHU A;  2LRD A;  3S32 A;  4EM0 B;  4Q48 A;  2MD5 A;  3PNY A;  2FRH A;  1ON2 A;  2FF4 A;  3I56 I;  2EBI A;  4BE1 A;  3ABK H;  5IYC J;  1K6O A;  1JTX A;  3P9I A;  2COM A;  3HIF A;  3HUG B;  3J81 Z;  1VQN I;  3BR2 A;  4RGX A;  1D0X A;  2DOA A;  3D5L A;  3WU0 A;  5DM6 F;  3OS1 A;  4OMZ A;  5KAI C;  2W7N A;  2FOK A;  3TO7 A;  2EZH A;  2IGO A;  2OQR A;  5HOO A;  5ICG A;  3ULQ B;  1OCP A;  4E7H A;  2DI3 A;  3HHH A;  3Q5F A;  3H9G A;  3ZMZ A;  1VQ5 I;  4XRF A;  3DU5 A;  2L4M A;  4BYY A;  2YS9 A;  2EIM H;  3MZY A;  5IOZ A;  2K40 A;  2RVC A;  4HRI A;  1OIS A;  2DMT A;  1TLH B;  1ZLJ A;  2NS7 A;  2R5Z A;  3CTA A;  1MD0 A;  2DLL A;  4RAY A;  1PNK A;  1JI8 A;  4GYG A;  1Z1D A;  2E19 A;  1MND A;  2G7U A;  4DZJ A;  4ZJZ A;  3E0J B;  2BE5 F;  2O0Y A;  2XPW A;  3QQA A;  4F52 A;  4RDU A;  2BY2 A;  4PJJ A;  2HTJ A;  2EFQ A;  1O57 A;  3IAS 2;  3RQ4 A;  3IWF A;  1JKQ C;  3TDU C;  5FLX Z;  2E7X A;  5LD2 C;  1SC7 A;  4Y15 A;  2L01 A;  3ZQF A;  1IDY A;  4AIK A;  4AU7 A;  3TQN A;  1EJ9 A;  4JBA A;  3ZN1 A;  3SZP A;  2QA4 I;  4UB6 C;  1K61 A;  2O03 A;  3G1M A;  4Y4R A;  3FBI B;  4J00 A;  1U9N A;  1KU9 A;  3CF5 F;  2M4K A;  3L2R A;  2W82 A;  1V4R A;  2VB6 A;  4HDU A;  3BZK A;  1X2M A;  4JX4 A;  4XNF A;  2IA2 A;  2OPT A;  3CMA I;  2I8D A;  2KT0 A;  1Z7U A;  2VI6 A;  5E20 A;  4QPQ A;  5LGT A;  2JQ7 A;  3MWM A;  4OIN F;  3HPG A;  2ZME A;  2K02 A;  2MSY A;  1EV7 A;  3GXO A;  2FBK A;  4EJW A;  2LKP A;  4L9J A;  4A69 C;  2ZFW A;  1LVK A;  2QZ8 A;  4UUT A;  5FFX A;  3BRO A;  3TL4 X;  2JA2 A;  3H3Z A;  1YO5 C;  3FM5 A;  2EIL H;  1RR7 A;  3F9K A;  4HG2 A;  4BQO A;  4CIC A;  1MH3 A;  4U0Y A;  2JA7 J;  3CME I;  1KYZ A;  4JX6 A;  1JGG A;  1W7P A;  1X1B A;  1K5Q A;  4CXF A;  2JA5 J;  4O3M A;  2RN7 A;  1ZRC A;  4U0W A;  2K86 A;  4FX4 A;  3JR9 A;  1PP7 U;  3HOT A;  2QGU A;  3JRD A;  4OMY A;  4BXU A;  3V7R A;  2DDA A;  3SEZ A;  4Y13 A;  1IXS B;  4BWC A;  4NC6 A;  2IS1 A;  1TWF J;  3F8N A;  4K2F A;  1YS7 A;  1GHC A;  1K78 B;  3JRF A;  1SVO A;  2ADV A;  4D1Q A;  4OIO F;  2OTJ I;  3AL0 C;  1JUM A;  1DPU A;  4MEX F;  5KK1 A;  1KU2 A;  2QCO A;  1I1S A;  2DT7 B;  2DW4 A;  3ECO A;  4EEF G;  2DT6 A;  3ML0 A;  2NYX A;  3IRR A;  3BG3 A;  1OR0 A;  2CFX A;  3ZQL A;  4IXA A;  2A6E F;  2DPU A;  1ZG5 A;  2I10 A;  1IXR C;  3F8M A;  1FOK A;  3A01 B;  4BXX J;  2M8G X;  3PL8 A;  5FO5 A;  5F0F A;  1KYW A;  2AXT C;  4CCN A;  1FP1 D;  2F5E A;  1Z6R A;  3ABU A;  2E5N A;  3K0L A;  2CQN A;  2MLG A;  2EQR A;  3ZQH A;  3KE2 A;  2NVQ J;  1VQ4 I;  3I5U A;  1OFC X;  3LQR A;  2VOO A;  4YFA A;  3LA3 A;  1I39 A;  1Q1H A;  2BXY A;  1GK0 A;  4EJU A;  2BV6 A;  2M7A A;  1TW3 A;  4C3I J;  1ORK A;  1O3Q A;  1BI1 A;  3LL7 A;  2KJB A;  2R5Z B;  2QWW A;  2XHK A;  4EGZ A;  1ULY A;  2EFP A;  2XV4 S;  1WKM A;  2EZI A;  1R71 A;  1S6L A;  2JPB A;  1XCV A;  2XKO A;  2IS6 A;  1BC7 C;  2STW A;  2JUC A;  1WCM J;  4F92 B;  2ZXI A;  4IHS A;  5B1B H;  1UAA A;  4AD9 A;  3SYT A;  5LGN A;  5JLW A;  4LG3 A;  2H1K A;  4ZZL A;  4BAY A;  4IL6 C;  4BBR J;  3KZY A;  3CO7 C;  3TW6 A;  2P5K A;  3GLX A;  2NAZ A;  2K3P A;  3UNG C;  5HS8 A;  1EH7 A;  1S5L C;  4LB6 B;  4CUG A;  1YFH A;  5IT9 K;  2ME0 A;  4LJZ F;  2GBY A;  2E1C A;  5ICC A;  1K6Y A;  1V55 H;  1T38 A;  4TV7 A;  3V7C A;  4X6A J;  2QLZ A;  5JFR A;  1D0Z A;  5JVT A;  2MC3 A;  3R60 A;  3TOB A;  5CPR B;  1R6R A;  2F48 A;  3FIW A;  5TGT A;  2VOD A;  2Y0M A;  3K4J A;  1J59 A;  3C1D A;  3GLL A;  5FKM A;  3BDD A;  3FWE A;  3CF2 A;  3JTR A;  3L2Q A;  3HJE A;  2VXZ A;  4BHC A;  3OYC A;  3S14 J;  2TCT A;  1W7P D;  4PCQ A;  2MFZ A;  1UZC A;  3EUA A;  3PNV A;  2O6G E;  4GCV A;  1IRX A;  2E35 A;  2YSR A;  3V7S A;  2NVU B;  4L18 B;  2TDX A;  1R1V A;  2DFI A;  1AKH A;  4HEA 2;  5EEA A;  3C2H A;  4E4H A;  1U2W A;  3DWL E;  3ZMD A;  1NH3 A;  3PUF A;  4F55 A;  2ESH A;  1W7P B;  4U88 A;  4C3H J;  3FIS A;  4HX4 A;  1N75 A;  2XF5 A;  2WYB A;  1MNE A;  1TQI A;  5M3F J;  1MMD A;  1BR1 A;  4KIF A;  2DA3 A;  3DEU A;  3IP4 B;  4OAZ A;  2OZU A;  4RAZ A;  3Q9S A;  3WE3 A;  2V4J C;  1OYY A;  3KCC A;  4H0E A;  2IXS A;  4WXH A;  2VBW A;  1Z05 A;  4MNU A;  1BR4 A;  3BOQ A;  2UUZ A;  3M1E A;  4IVN A;  4K2E A;  3TDZ C;  1RZ4 A;  2XVC A;  2DCE A;  4D7N A;  1HQC A;  1XX5 A;  3BTJ A;  4BGD A;  3J7A O;  5TIS C;  1P7I A;  2EIN H;  4XKC A;  2WYE A;  3CCJ I;  1LE8 A;  1OQY A;  2M34 A;  3K7A J;  2L02 A;  2LC2 A; 
#chains in the Genus database with same CATH homology
 3FHN A;  3ZXS A;  2KRH A;  2VL8 A;  4BXF A;  4IKF A;  2GOX B;  3CZ6 A;  5FRM A;  4PJN A;  2KZV A;  1D1A A;  1V5G A;  3K70 C;  5HLT A;  3CMM A;  2V26 A;  3PJR A;  2X6W A;  2WA0 A;  1X1A A;  4E7S A;  2AQE A;  4BDZ A;  1KEC A;  2NOJ B;  1PYV A;  2IGK A;  3OIP A;  4CA0 A;  2LY1 A;  2ZSH B;  3CJQ B;  4DJA A;  2W00 A;  3U21 A;  2WY8 Q;  3L2W A;  1OLT A;  1J09 A;  1UG0 A;  3K6G A;  2XDV A;  4BDY A;  3SEQ A;  3OIQ A;  2JVG A;  2LRE A;  3CP2 A;  4PFO A;  4FET A;  4F3Q A;  1AJQ A;  4XN3 A;  3OS0 A;  3AFH A;  3K4N A;  3OY9 A;  3MKZ A;  1KEH A;  3DKX A;  3ONQ A;  3OYE A;  4BS9 A;  4XQF A;  2PJR B;  1P9Q C;  3S3M A;  4XKV A;  2L5Q A;  5FRO A;  3HL2 A;  3ZQQ A;  3OS2 A;  1X4P A;  2L9N A;  1BR2 A;  3CES A;  4NC7 A;  2A5W A;  4Y3O A;  3H9Q A;  3QOD A;  3JTQ A;  3HC7 A;  2VAS A;  1GM7 A;  4BQN A;  4ZYA A;  5HVQ C;  3HG9 A;  2W4S A;  1WJ5 A;  4XL9 A;  5CKT A;  4WKV A;  2KL4 A;  4E7K A;  4RLF A;  3OYA A;  2VLA A;  3LSG A;  4DGW B;  4BE2 A;  3VSK A;  2XF7 A;  2UV1 A;  4KT6 A;  4XON A;  4B43 A;  3UR3 C;  4XLH A;  1LDK B;  3DU6 A;  3G2B A;  4E6K G;  2F6C A;  4OWR B;  2KP6 A;  1MW7 A;  4NQW B;  3DLA A;  3W2V A;  4BUP A;  3S3O A;  2WAE A;  1GLN A;  1PJR A;  2LBF B;  4YEL A;  4U7B A;  2VXD A;  1K7D A;  2CW8 A;  1EA3 A;  3BG7 A;  3PSI A;  4NNJ A;  3A2K A;  1BOB A;  2E60 A;  3OR2 C;  2VPL A;  2Z16 A;  3HXL A;  4FAS D;  2ZSI B;  4E7L A;  2CV0 A;  3M1C A;  3OYL A;  1QU3 A;  2X6X A;  3H9J A;  3OYD A;  2XC7 A;  3OR1 C;  4E7I A;  1AI6 A;  2E5Z A;  4P5O A;  4IX7 A;  4BJT A;  1T0F C;  2WAQ A;  4PUS A;  4C2U A;  2M7B A;  4M1J A;  1DGW Y;  2HPI A;  3SDB A;  4RM3 A;  2X6Y A;  4OAY A;  1WJB A;  2IGM A;  2CV1 A;  2IS2 A;  4N4N B;  5HNF A;  5LFA A;  1AI5 A;  2CV2 A;  3OMY A;  2KMU A;  4PSX A;  3LSH A;  1PNL A;  3FDY A;  1FXH A;  2M3A A;  4LIU A;  4ANJ A;  4RLQ A;  1D0Y A;  3DKY A;  2CW7 A;  4HST A;  2VQL A;  2Z1D A;  2Y0S A;  3QYE A;  2LG4 A;  3S8R A;  1Z21 A;  2KPM A;  2CFO A;  2WAF A;  4CCO A;  2HPM A;  1WFX A;  4J01 A;  1AJP A;  3ZCO A;  2R7T A;  2R7U A;  1OR7 C;  4DBR A;  4XKB A;  1YX3 A;  4F91 B;  1CP9 A;  1WJE A;  5JHF A;  3K10 A;  4D9J A;  4PEL A;  2R7Q A;  3DQV C;  4P1W A;  2VJ5 A;  4C2T A;  2HDW A;  4PK4 A;  4HSR A;  2P0W A;  1Z3X A;  1QHH D;  2WBM A;  2CUJ A;  3SZG A;  1T95 A;  4YF9 A;  1V5E A;  3M8J A;  5KHD A;  1G8X A;  2K9M A;  4XOT A;  2HVQ A;  3VWB A;  5CQG A;  2V6E A;  4Y33 A;  2VQC A;  3OOU A;  2MAB A;  1LFP A;  2WAD A;  4BAC A;  2F5V A;  3S93 A;  1W36 D;  4DOZ A;  2UWM A;  1UEL B;  4BL0 B;  2OC6 A;  5KCM A;  3OYI A;  3CP8 A;  3H5N A;  4PJL A;  1Z7L A;  3L2U A;  2RQQ A;  4XM3 A;  3AL0 B;  4PEM A;  1W36 C;  3K4K A;  1MMA A;  4RM2 A;  4ZTJ A;  2VKH A;  2RRE A;  1D1B A;  3KYL A;  4KIS A;  1K5S A;  1LKX A;  4XMY A;  3VYS B;  4CSW A;  2KRC A;  4XR6 A;  2LRD A;  2R4G A;  4LIT A;  3S32 A;  2X1D A;  1G59 A;  1WJA A;  2IGN A;  3PNY A;  4BE1 A;  2ZXH A;  4HNT A;  4RMN A;  3SRB A;  1FMV A;  4DIQ A;  4GRI A;  4C9Y A;  3HUG B;  3DTE A;  4BJ5 C;  2MYS A;  3J7A Y;  3IUO A;  4JOM A;  1D0X A;  2X1E A;  2DOA A;  3D5L A;  4XLE A;  3FBN B;  3ZRG A;  3OS1 A;  4XOR A;  4U87 A;  3S8P A;  2W7N A;  4K2G A;  4B3X A;  3LSM A;  2IGO A;  5HOO A;  4B44 A;  2DXI A;  1AA7 A;  3SRC A;  4E7H A;  4XOP A;  2CS3 A;  3FKJ A;  3MMY B;  3TBI A;  1D1C A;  3H9G A;  1X1D A;  4YFB A;  2ELJ A;  3DU5 A;  3SRA A;  3CJR B;  4PJM A;  2V9K A;  2HNH A;  2VQG A;  3H0D A;  4HRI A;  1TZL A;  2KHM A;  4X0G A;  4AYB A;  3K4B A;  1Z3Y A;  4F93 B;  1PNK A;  1FXV A;  1JI8 A;  1YX5 A;  3L2V A;  1SAU A;  4LIV A;  3I9V 2;  2VJ4 A;  4PFP A;  1MND A;  4ZJZ A;  3E0J B;  4II2 A;  3OYM A;  1GKF A;  4F52 A;  2WYC A;  1DGR M;  1GK1 A;  4PJJ A;  2XSJ C;  4H4K C;  3IAS 2;  3RQ4 A;  2DJI A;  3HKZ A;  4BEH A;  2R7W A;  4ZTF A;  2HVS A;  2X1C A;  2OUM A;  1X19 A;  3LSK A;  2K5C A;  2XAU A;  5LD2 C;  1JX9 A;  4AU7 A;  3K4C A;  4QPO A;  2R7S A;  4Y4R A;  4J00 A;  4E57 A;  3FBI B;  2W1O A;  2BW3 A;  3OYJ A;  2M4K A;  3MKW B;  3MD2 A;  3L2R A;  2W82 A;  2VB6 A;  4E56 A;  2R7V A;  1X1C A;  4B47 A;  2HVR A;  3E1S A;  4XNF A;  4PSW A;  2JVH A;  4G6T B;  3C2G A;  2I8D A;  2BVL A;  4QPQ A;  1AJN A;  3KEY A;  3BCB A;  2CMP A;  4XLA A;  3AKZ A;  1Y6I A;  1MMN A;  3HPG A;  4KIT B;  3OYB A;  3W2A A;  4HNU A;  2LOO A;  1JVZ A;  2AQF A;  4JQF A;  1DQU A;  3BG6 A;  4BE0 A;  1LVK A;  3PUB A;  2E1M C;  1GK9 A;  2V7F A;  3TL4 X;  2WYD A;  2JA2 A;  4XLF A;  2E1M B;  4E7Z A;  2JSP A;  4BTH A;  3F9K A;  4HG2 A;  4BQO A;  4WKS A;  4KJZ A;  3OYK A;  2FUG 2;  1X1B A;  2LYC A;  1K5Q A;  2Z2S B;  3DPL C;  2AE5 A;  3A4C A;  3EPZ A;  4ITV A;  1FM2 A;  2M4G A;  3HOT A;  2ZFU A;  3K4M A;  3QYF A;  3SEZ A;  3HPH A;  3H35 A;  3RSN A;  1N77 A;  2AE3 A;  4AVZ A;  2IS1 A;  3ZR8 X;  1S9H A;  3NWS A;  4K2F A;  2R7X A;  3PNT A;  4WKU A;  2LY2 A;  4CH7 A;  4N4O B;  1GM9 A;  2ADV A;  3QOE A;  1HA8 A;  4D1Q A;  4BU2 A;  2CH0 A;  4C30 A;  3AL0 C;  2BOL A;  2Q1Z B;  3DTI A;  4R79 A;  3OYH A;  3PSF A;  4HPQ A;  1WJC A;  2M0M A;  3BCA A;  4NUB A;  1ZEL A;  3L91 A;  2DT7 B;  2HU9 A;  1YE9 A;  2DT6 A;  3ML0 A;  3V42 A;  2VQH A;  1WJD A;  4ZDP A;  1OR0 A;  2VKD A;  4MLO A;  2LH9 A;  2VIX A;  3OL3 A;  1AI7 A;  3PL8 A;  4CCN A;  2RNG A;  4II3 A;  2E5N A;  2GOM A;  2R7O A;  3RPU D;  1GHD A;  1MMG A;  1U0J A;  4YFA A;  4E7J A;  1NG7 A;  1NG6 A;  2QKL B;  3GBG A;  1GK0 A;  2V1N A;  1N78 A;  4DBQ A;  3OYG A;  2M7A A;  3LMM A;  2MD0 A;  4CCM A;  2L7K A;  4ZDO A;  1FMW A;  3K4L A;  1JW0 A;  3OL4 A;  3LL7 A;  3N05 A;  3S3N A;  3IAM 2;  4YRV A;  1DP3 A;  3K3W A;  3OYF A;  1WJF A;  4IQJ A;  1E0E A;  3OYN A;  3BLY A;  2XF6 A;  1V5F A;  2JUG A;  3W3C A;  2IS6 A;  4CCJ A;  3ZGK A;  2PJR A;  2L2O A;  4F92 B;  2ZXI A;  2R7R A;  4BJ6 C;  3RCO A;  4BEH B;  5KNL A;  1UAA A;  5FRN A;  2KDO A;  4E55 A;  3VSL A;  3SYT A;  3L94 A;  3H5A A;  4LG3 A;  1KON A;  4BQQ A;  3NWT A;  4WKT A;  3W2W A;  2CUZ A;  2K3P A;  3UNG C;  2HZD A;  4CZC A;  4EAT A;  4IZZ A;  3D5R C;  4CUG A;  2VJI A;  2BW3 B;  1TT0 A;  1H2G A;  1K6Y A;  1E3A A;  3A1Y A;  2AE4 A;  2KLO A;  1D0Z A;  1SFK A;  2QKM B;  5CPR B;  1R6R A;  4ZDL A;  4XKW A;  5TGT A;  2KQR A;  3K4J A;  2BVM A;  3CF2 A;  3JTR A;  3L2Q A;  2L9S A;  3I3L A;  2LBF A;  2VXZ A;  3OYC A;  3LFU A;  2MFZ A;  3D5S C;  3DPT A;  3EUA A;  4ZC3 A;  3PNV A;  4YEJ A;  3EUK L;  3VYU B;  1PNM A;  1IRX A;  3OWT A;  4IQ4 A;  2X51 A;  2WB1 A;  2Q2E B;  3QYB A;  4HEA 2;  2IS4 A;  2HQA A;  3C2H A;  3DTK A;  4E4H A;  3DEE A;  1ERD A;  3DWL E;  1VZ0 A;  4F55 A;  1N75 A;  2XF5 A;  3VYT B;  2WYB A;  1MNE A;  4XN0 A;  3KX2 A;  1QHG A;  1MMD A;  4NC8 A;  1BR1 A;  1X4O A;  2VJJ A;  3VYR B;  1Y56 A;  2X85 A;  3IP4 B;  4OAZ A;  3H5R A;  3TMO A;  3VDX A;  4CCK A;  1AI4 A;  4XLC A;  5CQE A;  2V4J C;  2OV7 A;  2IXS A;  2MC4 A;  1GM8 A;  1BR4 A;  5HNH A;  3RTR A;  3HOS A;  3EUH C;  2F4I A;  3DPU A;  2PMZ A;  2A6T A;  2UUZ A;  4B48 A;  2DCE A;  3PFY A;  4CCL A;  4BGD A;  2O5R A;  2K9L A;  3MKY B;  4XKC A;  2WYE A;  3K70 D;  2WY7 Q;  3BC8 A;  3LSI A;  2LC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...