4HSTA

Crystal structure of a double mutant of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hstA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hstA01
1KEHA 3L91A 1K5QA 1GKFA 4HSRA 3ML0A 1H2GA 1K5SA 4YF9A 3S8RA 2ADVA 1AI5A 4PELA 1GK9A 1FXVA 4WKUA 3JTQA 1K7DA 3JTRA 4K2GA 1JX9A 4YFAA 2AE4A 1AI7A 4WKTA 4HSTA 1OR0A 4K2FA 3SRAA 1E3AA 2WYBA 4WKVA 4YFBA 4E56A 1FXHA 1GK1A 1GK0A 1KECA 4M1JA 3SRBA 1GM9A 1PNLA 4E55A 2WYDA 1PNMA 1AJPA 4BTHA 1FM2A 1JW0A 1AJNA 1GM8A 1AJQA 1JVZA 1CP9A 1GHDA 2WYCA 4WKSA 3SRCA 2WYEA 2AE5A 4E57A 4PEMA 3K3WA 1AI4A 1AI6A 2AE3A 3L94A 1GM7A 1PNKA
chains in the Genus database with same CATH superfamily
4NQWA 2CU7A 4DGWB 4HF1A 2DA7A 2LK2A 4GO1A 3ZGKA 4F52A 3TBIA 1IJWC 4I01A 5EG0A 4WKUA 3ZQQA 3RDIA 4LB5A 3LSGA 1XG1A 3VFZA 3X2QH 4AIKA 2ACJA 2Y0MA 3ABMH 3NWTA 4KITB 4YEJA 1FXHA 1BC7C 2FBIA 3BR5A 5CVRA 3ZQ7A 2WA0A 3RPUA 2G9WA 1GLNA 3MD2A 1JUSA 4M9SA 3ZMUA 3H3VK 5EZGA 3HTSB 3IRQA 4PEMA 5E3OA 5A2QZ 3H3ZA 1EJ9A 4M3GA 3VYTB 1PP7U 1R49A 5JHFA 1FYKA 1KQ9A 1IG7A 3L2VA 2V9VA 3K4JA 2V6CA 5LFAA 2XSJC 2NNNA 4RA2A 1ITYA 2RC4A 2BY3A 5CLSA 1L0OC 4FASD 1H8AC 2Q2EB 2DPDA 3FHZA 2D1HA 1VQLI 3J80K 3SRBA 2X9DA 3FM3A 1XSXA 2JMWA 2GQQA 1H9TA 3HOXJ 1S7OA 4EJVA 2R7ZJ 1ZG5A 1KA8A 2BE5F 3S32A 3G1OA 3DTKA 3H9JA 5HS7A 1MBFA 3KP6A 2CV0A 1IRZA 1MBHA 1WI9A 2ME6A 3QP5A 3M4OJ 3LA2A 4FX0A 5ICGA 5EEGA 2B0LA 4C9YA 3C2BA 4EVIA 1IXCA 2ZFUA 4P96A 2QVOA 3BROA 2KIQA 1Z21A 1FX7A 1USSA 3TW6A 2CQQA 3OV8A 4M9XA 3GFJA 2EA2A 4L5IA 4BE0A 2FXAA 4PSXA 4ZTJA 2QYOA 3DFGA 4YFKF 2O8KA 3DPLC 1G4DA 2KHMA 3K4KA 4CH7A 2VPLA 3LL7A 1KQ0A 1A31A 5H20A 3CC4I 1G59A 2PLYA 2CUJA 1V5GA 2E19A 1LE8A 2KIFA 2W1OA 3DTIA 3LMMA 2Y0SA 3NQOA 5K1YA 2L7FP 2CGPA 3H0GJ 3WTTC 1JKQC 2DI3A 3ECHA 4DIQA 1Y6IA 1XSVA 3A2KA 2E2HJ 1UFMA 2HDCA 2PJRB 5FFZA 5M3FJ 5TRDA 5B1BH 4BS9A 3G1LA 1FBQA 1J5YA 5TISC 1JW0A 4IHYA 4IHWA 2NVQJ 4XK4A 3AG2H 1Q1HA 3WTSC 3MMYB 2Y75A 2JA5J 4UY8I 2MFZA 4BDYA 2VKDA 2ZJPF 1VQKI 2BXYA 2ADVA 1BIBA 2RQQA 1R9TJ 3BQZA 4A3BJ 3LQRA 4XRSA 4CCNA 5ED4A 1IXRC 3FISA 3UNGC 1MZBA 1G3WA 1WRJA 4RAYA 2OV7A 1V4RA 1FBUA 2XV4S 3CUQA 2EFPA 4PGGA 3VSKA 4C3IJ 5E3MA 4CCKA 2H09A 2W85A 3CCSI 5LRSA 5ILUA 2RQPA 4XLFA 5KCMA 1N75A 1I1GA 3TO7A 4ZJZA 2OF7A 3GZ6A 2KIMA 5GPCA 2CQ7A 2OA4A 1QZEA 2IXSA 2DDBA 4IHTA 5CKTA 2IEKA 4AM3A 1HDPA 1TTYA 3OIPA 2H8WA 1X2NA 1JE8A 4D1QA 1PNLA 1IUYA 4XL9A 2HEOA 3K9TA 3KEQA 4Q47A 3FF5A 3U1KA 1KQ8A 2UXXA 1XMKA 1SVOA 4FE7A 3RYPA 1R1UA 1YG2A 1QPMA 1KEHA 2K27A 3BTJA 3HKZA 5JHUA 2DFHA 1K61A 1HC8A 2DOEA 2LMDA 4LIUA 2X51A 4JX4A 5HDNA 3T8RA 4CHUA 4YFBA 3SFZA 3DXJF 2NRAC 4MLOA 4MGRA 4RM2A 5C3EJ 3P7NA 5ICEA 2ZXHA 3OOUA 2WYCA 3FXUA 1GDTA 1LPQA 3OYDA 3K10A 5DM7F 5JVTA 4FISA 2Y30A 4R1HA 4RS8A 4OU0A 3O2PE 2MLKA 3ML0A 1BR4A 1A36A 1ETQA 4D9JA 5HS8A 4LMYA 4K2EA 4ON0A 2LKPA 3EUHC 1X19A 5J4YA 1GXQA 1MD0A 2LR8A 3L2WA 4K2FA 4RGSA 2VI6A 2HKXA 3P9IA 2PMUA 4HQEA 2K9MA 4DBRA 1QHHD 2YSRA 2KJCA 1BW6A 5K7HA 5LLQA 3GTQJ 2L9RA 4CXFA 6PAXA 2V9PA 2UZKA 3BC8A 5F1RA 3WTYC 5DCMB 3Q9SA 5L3BA 4HAMA 2M34A 3QPLA 1QRYA 5HODA 4PJLA 4OAZA 3M8FA 2IGMA 2L9SA 2Q0OA 4Y33A 3BQYA 2KLOA 4DQ2A 1JGGA 1WZ2A 3EQLF 1FPQA 2A6TA 2KMUA 3KZZA 4E7LA 3HHGA 4FT8A 3DBHB 2HQNA 3BZ6A 3RI4A 2BY2A 5DS9A 4RBOA 3OYAA 2VJIA 1D1CA 2WAQN 3WU0A 4HNVA 1XS9A 5J1RA 3E3VA 1HW2A 1ZTRA 1G8XA 4XLAA 3GTKJ 1ZHFA 1I1SA 2EZLA 3CF2A 3WU1B 4IHVA 3S14J 4IZZA 3TGNA 3OSGA 4IOAF 1AOYA 1SD7A 4KIFA 2QQ8A 4EM2A 1MBKA 1Y8RB 4I0AA 5HLHA 2H27A 2YU9J 1IRFA 3UKGA 5K5QA 1Z0XA 2AXLA 1OISA 1R5ID 5BOXA 5IY5H 2MH9A 3QQAA 1IRGA 4D5CA 2DMPA 2IS4A 1U8BA 1CF7B 2RNJA 5E20A 5FRMA 1TNTA 4WKSA 1VZ0A 1W36C 2IW5A 1T33A 3ERMA 3LAJA 5GAHJ 3DBLB 2LYCA 3DKWA 3NEUA 5LEJA 2XROA 1QNTA 3VYRB 1P2FA 2JVGA 2M7AA 3S1QJ 3KYLA 2HQAA 2JUCA 1VQNI 1KU3A 4ESFA 3OYGA 3BCBA 3QOEA 4A5MA 3H9QA 5IPAA 3JCUC 4L0YB 3M8JA 3HPGA 1R58A 2MSYA 1YX5A 5EYRA 1DPUA 1W1WE 1W7PD 1ERDA 2P5VA 1KU2A 3FM5A 2W7NA 2ELJA 3F22A 1R6RA 2R7RA 2LKSA 3P5JA 1Y0UA 4CZZA 3OYBA 4C2MJ 3JRAA 1P7JA 4E70A 1E17A 5IP9J 3CCMI 1ETYA 5GPAA 2Y31A 1JT6A 1M1EB 1YIOA 2M8GX 1BW5A 2BOLA 4CSWA 1F5TA 4I0BA 2E5ZA 2W48A 3KLNA 3A01B 1E3OC 3NARA 3V8KA 2JPCA 1PUFB 3TO9A 1SANA 1OMIA 3BG3A 2CUEA 4CA0A 5D5VB 2B7EA 1MW7A 3W6VA 4B3AA 2KRHA 1AU7A 1Z67A 1HXDA 3VDXA 4ZYDA 3HL2A 4RAFA 3SQNA 3E5QA 3QYEA 1JUPA 2WWYA 5A2QK 3E7LA 3KFWX 2PMZN 5LHHA 4M72A 3WGIA 4JP0A 3KP2A 3QOPA 4NC8A 1K78A 3R61A 2NVUB 3LSJA 1G3TA 2DA6A 4NC6A 2IGOA 2XDVA 4OWRB 4QSHA 3F23A 2EV6A 2WV0A 2L9NA 2ELKA 1AHDP 3BG6A 2DCEA 2BY1A 2A5YB 1B9NA 4BQQA 3OYIA 3MKZA 1TC3C 2IS1A 1R5GA 3HEFA 2ICWG 3NRVA 1U9NA 1R4NB 3AG4H 1W5TA 3JW4A 1OQYA 4F7ZA 2PEXA 1MMSA 2UWMA 3KYCB 3M1CA 3ZMVA 1LFUP 4KMUX 2KPMA 1B8IA 2XF5A 3L1PA 1H88C 2MD5A 3MZ8A 3O6BB 1HDDC 1WJ5A 3H92A 2BGCA 2ETHA 2HFHA 2PN6A 2DT6A 4UUSB 3GYHX 1UMQA 3SZPA 4EEFG 1B6AA 2K3FA 3SZTA 4YIIA 4GRIA 4EJUA 2JVHA 3CCLI 1I3QJ 1PNMA 2XB0X 1WH7A 1RUNA 4KNYA 2L3DA 2QENA 2HYJA 4JK1X 4KIBA 5DUIA 2EBIA 2CW0F 2EPFA 3L00A 3FBIB 1VI0A 2LY9A 2NYXA 4B1RA 1U5TA 1W0TA 3DEEA 5M3MJ 3G73A 4NQWB 1X4PA 4BNCA 1MBEA 2R7TA 2P6TA 2CSOA 2LREA 4WKTA 1MDMA 2XAFA 5EG0B 4G12A 4XOPA 3HB9A 3OOPA 1OPCA 1D1BA 5BMZA 3HRMA 4M6XA 5LD2C 1VQMI 2V1UA 1HOMA 3I0TA 2KZGA 5EJCA 4BACA 5HDKA 1HA8A 2O3FA 2E1CA 3H5RA 4XN0A 5HLGA 4RGXA 4LLGF 4MQ9F 3HIFA 2VJ4A 4H4KC 4I6ZA 2L7MP 3ZPLA 1ZH5A 5L3FA 4G7OF 3TL4X 5E18F 2DMNA 1FOKA 1HKQA 3CP2A 4AYBA 3EYIA 2AQEA 1H2GA 2V7FA 4PUSA 1GK9A 1LJ9A 3U9GA 1B59A 5DTDA 5IYBJ 1ZAOA 2WADA 3HOTA 3MEXA 2DA3A 1DGRM 3HRTA 4LFUA 4XKCA 1Q1VA 1LFPA 1MMAA 3ABUA 3JAMZ 2V1DA 3D5SC 1QZZA 1SVLA 3RQ4A 2MD0A 2ME0A 2L54A 3S1RJ 4QLCU 3ZQCA 2JN6A 1D8JA 1DP3A 3L94A 2P81A 5FKOA 1T38A 4DJAA 2Y69H 4UUTA 3T8TA 4X1EA 3FXOA 2K4JA 1VTNC 2FOKA 5E8GA 1O3RA 4PJNA 5KAFC 5D4SA 3F8BA 1YRNA 1AKHA 3FX3A 2YS9A 3S16J 3GXOA 4PJJA 3WG9A 2E1NA 3ZMSA 4HLXA 4II3A 5B3SH 4A3GJ 3IV5A 4XLCA 3ROUA 1ACIA 5ICFA 4BHBA 1F36A 4WCGA 1ZR4A 2RVCA 3Q0UA 3L91A 4V2FA 3FMQA 2MG4A 2E71A 4L18B 3CJQB 1BOBA 3HXLA 2VN2A 2Z2SB 4OAYA 3IUOA 1YITI 2E2JJ 2BW3A 2LOOA 1ZR2A 4QWQA 4Y13A 3VYSB 4CYDA 1QBJA 3C3WA 4Z6YA 1LVKA 5LGNA 2UUZA 2A68F 3KPHA 2A5WA 4F92B 2WY7Q 1I39A 5D8KB 2LDUA 4ITVA 5TJJA 3LQQA 3VEPA 1ZG1A 3CZ6A 5ERIA 1MNEA 1AJNA 4HBLA 2BHZA 4AC0A 1BI0A 4YG2F 2VT2A 3P9CA 4BWCA 1V5EA 2VUMJ 1DU6A 2DODA 3B6AA 2GOMA 1NHAA 3R0AA 4L5JA 1SD6A 2WY8Q 4DYRA 4IHSA 1ZN2A 3A02A 5CYVA 1JUMA 2O03A 3CQZJ 3E6DA 1T8IA 3S2WA 3W6JB 4Z2YA 3TP3A 1T56A 4A6DA 2EIMH 2HZTA 2OPTA 4YIRX 3PIOF 5GADJ 2F5DA 4BL0B 5LHGA 1ETKA 3HOWJ 3BTCA 2A69F 3PQJA 2A61A 3ZN0A 1I3AA 4BQAA 3H5NA 2RN7A 3PNTA 3K4BA 3BR3A 1YLFA 1BOAA 2EQRA 4A2UA 2HYGD 2R7SA 4DZPA 3DCFA 5FKMA 3EYYA 2M4GA 2QLZA 2GXAA 3K70C 3CCVI 3JTQA 5E8IA 1JT0A 3BLYA 4F55A 4XRSG 1T0FC 4YRVA 5GTIC 2Y48A 4B47A 3S15J 3E6BA 2LLKA 2Z9OA 4XSXF 4B48A 4WWCA 1OCOH 2COBA 2M3AA 3CUOA 4N0BA 1AJPA 1YOVB 4DW6A 3CDLA 3HSRA 1XB4A 2E7XA 3FXLA 2QSGX 3J7AY 1VFCA 2AE5A 3M3YJ 2OUMA 3C2HA 1ZGJA 1LB2A 3GCMA 1EV7A 1K5QA 4HSRA 1FIAA 4YFXF 3RPQA 4XIDA 2JSPA 1ZK8A 3EPZA 3RCOA 2F4MB 4CYCA 3KIOA 1U5TC 5DDGA 4Y17A 1XX5A 2K9NA 4MTEA 1MMDA 2VBZA 2VOOA 1RR7A 3K6GA 5K5OA 2HKOA 1TW3A 3LSPA 3F0CA 1SMYF 1LUJB 5FLVA 2OTJI 2F4OB 1PYVA 3H0DA 3V42A 1GHDA 4D7MA 2AO9A 3GO5A 4M3DA 4E56A 5LGTA 2NVYJ 4PFPA 1IXSB 1K5SA 2HNHA 2RAEA 3JTRA 1STZA 2EIJH 4IPAA 4WKVA 3OS2A 5J8FA 1KZHA 1OKRA 2JUGA 3KP7A 2OCEA 1FSEA 2GBYA 4HX7A 2DT7B 1XTAA 4OIRF 3WG7H 3N4MA 2K40A 3DKXA 4U7BA 1RI7A 1K83J 4WXHA 3F9KA 4MEXF 2WV1A 3EUHA 1MJAA 1P92A 2A6EF 2JTVA 5K7FA 3EUKL 2VBYA 4ZDPA 3CESA 1KU9A 1ZKGA 3MQ0A 5L3EA 4EATA 1BN5A 5BQTA 1P4AA 2Y9YA 4OMYA 4PJ0C 2KISA 2H8RA 2MC3A 2DFFA 2OQRA 3CMMA 3H3UA 2V4JC 1F9NA 2X6WA 4P5OA 4RLFA 2KL4A 2RNGA 4C2TA 2M0MA 4G6TB 2D5VA 1I6HJ 2FD5A 4A0ZA 1RPWA 2WBMA 2L4MA 2DQLA 3M9AA 1IRXA 3CF5F 3K2ZA 2K85A 4LOCA 5DCFA 2YUSA 5CVJA 1J75A 1BI3A 1LEAA 1P7IA 5FD5A 4DOZA 3WGHA 4BQNA 4ZZDA 3V8LA 5E1ZB 3CMAI 2CMPA 4BJ5C 4YIFA 1Y0NA 3ESWB 5BPIA 2IA2A 2DQRA 5F0HA 4RDUA 4HQMA 4ZYEA 3KZYA 3A03A 3VODA 5LGUA 4A69C 5EEHA 1XD7A 3MCZA 1SAUA 3F8CA 2H6CA 4ZC3A 5JLWA 3GX4X 3QODA 2V79A 5DEQA 4A3CJ 4G7ZF 1IDYA 4KT5C 4UHTA 2KP6A 2IGNA 1K7DA 4LG3A 3C18A 3RYRA 2JRMA 2A07F 4UV8A 3AG3H 1X3UA 2DTZA 3S2HJ 1JHHA 1FMVA 2W82A 3QPHA 1ZREA 2L2OA 4UVAA 3GMEA 2VOPA 2ZNYA 1FMWA 4XLHA 1VQOI 1H0MA 3RTRA 3PSIA 2XGEA 1PJRA 3OR1C 1NG7A 2VQGA 3D0SA 5FLXZ 1YS7A 1LKXA 2HPIA 3J7AO 1P9QC 4B44A 1TQPA 3K1PA 5IOYA 1UG0A 2XAJA 5E1XA 2EINH 1EKEA 4XR6A 3RQIA 1POGA 1X1DA 1ETWA 4DYCA 3CC7I 2QM3A 2KDZA 3CCJI 2XGCA 2R7QA 3H9GA 1U9OA 5IOZA 2LD5A 3OSFA 3BR0A 3K2AA 4A3JJ 2B63J 1FJLA 4G94A 3OL3A 1VF9A 4S0HB 3ZR8X 3AFHA 4HLYA 1WJAA 5EEAA 3HOZJ 2DBBA 4MHGA 1D3YA 5D4RA 3SEQA 4CCLA 3JREA 2KKOA 2KRFA 2K5CA 2LY2A 4OINF 1W0UA 2FBKA 2VQLA 2ZJQF 4ZYHA 2VL8A 4RB3C 4LJZF 2VJJA 1V5FA 3TP0A 3HUGA 3HBLA 4Y15A 4MTDA 1K78B 5B5EC 1I5ZA 1P4WA 3FIWA 3FK7A 2IS2A 4N9IA 2R92J 3JAMK 3ZXSA 4U0YA 4A12A 1ZLJA 1SC7A 1P6RA 1I6XA 3F3XA 4AIDA 2E7WA 3VSLA 2QF7A 2DLLA 3MAJA 4WF2A 2FQ3A 3WODF 4X6AJ 1B8IB 2KQRA 3HGGA 4PZJA 2QSHX 1HQCA 2JPBA 3GF2A 3NAUA 4M6VA 3ZRGA 2EV0A 3ASNH 5IT9Z 3DBRB 3V8JA 1HSTA 5D8LB 1FYLA 3N97A 3KP3A 2CUZA 2EZHA 1Y1WJ 3OYNA 2GIZA 1VQ8I 3MZYA 1BA5A 2HQ5A 2L5QA 2DMQA 4G6DA 5CVVA 4EGZA 4ENKA 1XPXA 1LEBA 1N25A 4ZZLA 2X6OA 3DKYA 3RSNA 4HNTA 2EV5A 2G7HA 4LG0A 1MH3A 2LF7A 1WHUA 2FUG2 1U5TB 2DYSH 5D5WB 4M71A 3KP5A 2FX0A 4G8XA 3HC7A 1QVUA 4FHTA 1UHWA 4IXAA 2DA4A 2XGXA 2BBYA 1MDMB 2JJ7A 2ZB9A 1X1BA 2ZMEA 3H36A 3VWBA 1JVZA 1HLVA 2KIUA 3IRRA 4FETA 4KFCA 3KETA 1MNMC 2X6YA 1XMXA 2VT3A 3IP4B 4W1UA 4UV9A 3G2BA 4HA8A 2CUFA 5EZHA 2BY0A 3PO2J 4A3DJ 3DEWA 2O0YA 2E5NA 2VASA 4WXCA 4HV5A 3OYLA 1DQUA 2VODA 2AE4A 3DEUA 1Z6TA 2M8EA 2BV6A 1Z7LA 4EM1A 1YW7A 4ZYAA 5FKLA 1VNDA 3U1DA 4DNCA 5HNHA 2VE9A 2IA1A 3K4MA 1MH4A 2WTEA 2NS8A 3K1NA 4KT6A 5CJ9A 2ZFWA 1JI8A 1XCVA 1HW1A 1U2WA 1S72I 4MIMA 2WAQA 3ZQLA 3BJ6A 3L9FA 1AI6A 3S3OA 1Z91A 2R7DA 3FHNA 3H1CA 3WTVC 1S5LC 1XMAA 1WVRA 5LEKA 5F08A 4PDKA 1UELB 2CO5A 3QPSA 4U0VA 4MEYF 2IGKA 4I2OA 4MNUA 3QU3A 1O3TA 4GCVA 4UB6C 3I56I 3PJRA 1KECA 4OIOF 2ZSHB 3PFIA 4II2A 1YRNB 5E1WA 2XSDC 4CCJA 1AKHB 2VKEA 2QQ9A 2HOTA 1FOXA 2M30A 2ID3A 3Q0WA 1MKMA 3CCYA 3QPTA 1WCMJ 1TQIA 1TWCJ 2HYFA 4LB6B 2BVMA 1B9MA 3GWZA 1BI1A 4G7HF 4ZTFA 4IKFA 2GIVA 5D5UB 4CZCA 1DPRA 2EZKA 1JTXA 2F2EA 1IZ1A 5D6EA 1Z77A 5FO5A 1WJEA 2MA3A 2L0KA 5CVIA 2BW3B 1YI2I 2HR3A 3QYFA 3SXYA 2AQFA 4KN7X 4ZDLA 1IN8A 1SMTA 1SVMA 1YW9A 2IBDA 4XKBA 4B3XA 5M5XJ 1QPIA 2XPVA 2LY1A 2GLOA 2YX7A 3B02A 3I4PA 2LF8A 3TKYA 4GYIA 2R5YA 3JTHA 2X48A 5D6FA 2E60A 2XIGA 2P5LC 5KK1A 3TOBA 2ID6A 2W00A 2OBPA 3TOAA 4R8HA 4N9HA 2MBFA 4HEA2 1GVJA 4D5FA 4CUGA 2CRGA 2Z1DA 3R6SA 4I99C 4HOBA 4IX7A 4IRHA 5J40A 5ILSA 3R0JA 1G3YA 4ABZA 4BHPA 4Y7NJ 3SDBA 3FZVA 4BU2A 3V7SA 5FLMJ 1WJBA 2XPWA 2IPQX 4BGDA 3LFKA 4IQ4A 1ZGAA 2OZ6A 2M1BA 3WTXC 2P7CB 1TP4A 3ONQA 1XN7A 5LHIA 4UVCA 2OAZA 3D1NI 2L9VA 2OC6A 1YIJI 1ONVA 9ANTA 4HSTA 4E6KG 1R4MB 2FNPA 3DP7A 5HLTA 3KCCA 1HBXG 2MYSA 4YELA 2PMZA 1JKOC 3ZQFA 2E34A 5HOOA 2BYVE 3MKYB 3FMRA 1R71A 1X1AA 4RB0A 5FROA 2CV1A 5DD4A 2Z99A 3CD6I 1OCCH 1SFXA 4RMNA 3W3CA 3S1MJ 3HOSA 3ABTA 1O3SA 2COMA 4MQVA 2DA2A 1RKWA 1T0FA 2JWTA 1FC3A 3E1SA 2ESHA 3I59A 4BY7J 1L3LA 4HZFA 2R0QC 1YJ9I 1J2XA 1J09A 2XKOA 1S8NA 1N77A 3HM5A 3GTGJ 2VC1A 2OTLI 3BP8A 1F4KA 1KU7A 3SZGA 4CYCB 3LSRA 1WQ2A 2DT5A 3AAFA 2AS5F 3HSFA 3ZQHA 3K7AJ 1IV6A 4KUMA 2F6CA 2OD5A 4RAZA 4E7JA 2GXGA 2DYRH 3MZHA 1WH5A 3COAC 1GHCA 3OIOA 3BTIA 5D5XB 2ZMEC 1S7AA 3QP6A 1PNKA 3SYTA 2LKXA 5CQEA 2MLGA 3J81Z 2M7BA 2CV2A 2RDPA 2CQNA 1FXVA 3G6EI 1WFXA 1TL8A 1I27A 2DA1A 3GTPJ 3ML6A 5M5WJ 1JTYA 2WYBA 4KISA 1W7PA 4AIHA 1SD5A 2IA0A 2K4BA 4RGUA 1RZ4A 4I02A 2XRLA 3HYIA 3CDIA 4Y52J 1ON1A 2MH2A 1IGNA 2Y9ZA 2DMTA 3GLXA 2R93J 2XF6A 4J19A 1G6NA 1SD4A 1XDSA 4IHXA 3FBNB 4HYEA 1MMNA 2O5RA 1IO2A 5FLXK 2R3SA 2JK3A 2XASA 1WSUA 2PMHA 1BI2A 2F5CA 1TWFJ 4LK0F 4UVBA 3J7YJ 2HVRA 2AXTC 1UJ8A 2STWA 1ULYA 3E97A 4U0WA 2VXDA 1WJDA 5GTHC 1Z3XA 4QPOA 3JRGA 1D5YA 2GA2A 2Q8KA 5F0CA 5KHDA 1Z3YA 3JRHA 3Q5FA 5C4XJ 4RM3A 1WI3A 1EH7A 1FT9A 4LITA 3E5XA 1BJZA 2X4HA 3LWFA 1MSFC 1ZELA 3OWTA 1CGPA 4N4NB 2P5KA 3JRIA 4BJ6C 1J0RA 4JYKA 4I98B 4OIPF 3I53A 1RC9A 3E5UA 1J59A 5FD6A 3FKIJ 3AG1H 4CCMA 5BNGA 4E7ZA 5CQGA 4BKXA 1QVTA 5KAIC 1E0EA 2EFQA 1PUEE 1X4OA 5E3LA 3A1YA 5IP6A 1REPC 5CPRB 3DV8A 4M6YA 1VQ9I 1JXSA 1J7KA 2RV8A 1T39A 4IO9F 1YW8A 2P6SA 4PK4A 4U87A 4HX8A 1K4SA 4FE4A 1W5SA 3FGRA 2X1EA 3BR6A 2NS7A 2HXIA 2LG4A 1MIJA 4FX4A 2BXZA 3GTJJ 3SJMA 2R7WA 3SRAA 4WX9A 4HG2A 3ABLH 3W2VA 1R00A 3S8PA 2G0EA 4HRIA 5B1AH 2JQ7A 2BHYA 3BT9A 5IT9K 5BS6A 4IF4A 1MNDA 1X58A 4ENNA 1YJNI 1MMGA 1O4XA 1FBSA 2H94A 4EJWA 3GTMJ 1NG6A 4U88A 4V2GA 3ZQIA 3DTEA 4UUVA 4AD9A 3RIRA 2FQ4A 2VBXA 2IRFG 2M45A 2XB5A 4RAGA 3TDUC 4HX4A 5F1JA 4LIVA 3IH4A 2ISZA 3OYHA 4BY1J 1JKRC 4B09A 1JGSA 1EH6A 1VQ5I 1OYYA 3I58A 4E7IA 2O6GE 2HPMA 4KIGA 1X2MA 3JR9A 3RPUD 1K79A 5DD8A 3ECOA 1DUXC 1FTZA 1ZYRF 5HVQC 3BZCA 3H35A 1JJ8C 2AE3A 1R1VA 2WB1N 1V55H 1WWXA 2CWEA 2P7VB 2EA4A 4KA4A 2FJ1A 3GUDA 2GAUA 1BR2A 3ZOBA 1Y56A 3BR1A 2RKHA 4P55A 4BH9A 2ZXIA 4MO7A 1FYMA 2HTJA 3RKWA 3GTLJ 3C7JA 2HZDA 1YHQI 2VPRA 2QBYA 2X6XA 3HUGB 2D45A 4PCQA 2PG4A 3DPUA 1GXPA 4BE2A 4DBQA 4XLEA 2B9SA 2J5OA 2OJED 5F0FA 3WTUC 2J5PA 2DDAA 2XHKA 3RKYA 2R5ZB 1DDNA 2HS5A 3LSIA 1LDJA 1YE9A 2PI0A 3KX2A 2XAGA 3OY9A 2QWWA 1GKFA 2V6EA 2X1DA 1UB9A 1FLIA 3IH3A 3HTUA 1SAXA 1N78A 4Y3OA 4M74A 1K7AA 1E3AA 3CCEI 3BWGA 2FMYA 3K4LA 2CS3A 4E4HA 2JA6J 1T98A 4BTHA 4HW0A 2K7LA 4NHJA 5HNFA 1OFCX 3HHHA 4W97A 1RR8C 2I10A 1FNNA 1F1ZA 2KDOA 1ZRDA 3QYBA 3C1DA 1A6QA 2NNYA 4F93B 1S3JA 1WKMA 1O7LA 2X0LA 1DP7P 1TWGJ 4BXFA 4LG0B 2CW8A 1IV8A 5H2FC 3HRUA 4GFBA 1GK1A 4QPQA 5FFXA 2F48A 2OQGA 4EV0A 1ODDA 3GZNB 3OYKA 2M2EA 1W36D 2L01A 3IAS2 4RB1A 2MC4A 2ZMEB 3TO6A 4F3QA 1E3PA 3I9V2 1HF0A 1FOYA 4A3IJ 1UZCA 5AIPA 2A05A 1T6SA 1R22A 2OCCH 5FB2A 3AL0C 1RETA 4ETSA 1AWCA 3LSHA 2CQXA 4UB8C 4ENJA 3WTZA 3JRDA 2KRCA 1WGXA 2HOSA 4L9TA 2JA8J 2GM4A 2XUBA 3C2GA 5ICCA 2F5EA 4A3EJ 3S3MA 2QZ8A 3ZQGA 1TZLA 2AHQA 4OOIA 3EUAA 3IAM2 1D0XA 1B4AA 1MGTA 2O61A 3G1MA 4YFNF 3I3LA 4GXOA 4E7SA 2CYYA 2O9LA 1J9IA 3DF8A 3FXKA 2W57A 4NUBA 3L2UA 4LLNA 2WYEA 3E6MA 1MSEC 1O3QA 2V26A 3V7RA 4AVZA 2GXBA 2EIKH 5AIQA 2O7OA 3F6OA 3KLOA 2DOAA 5KVRA 1AI5A 5H6QA 3TMOA 4BBSJ 3EETA 4XICA 5GAEJ 1TWHJ 4Q4ZF 3JRBA 3F21A 1BL0A 1K6OA 3GZ5A 1SFUA 2VE8A 3K4NA 2FF4A 1HKTA 1XDUA 2FRHA 4MFEA 3REOA 2M5WA 4P9UA 1NH3A 5F6FA 3RKXA 2EFOA 2DO7A 2HOAA 2TCTA 3FWEA 2H1KA 2QKMB 3JSOA 5K5RA 2CG4A 5DM6F 3VPRA 1FY7A 5J1YA 1RNLA 3SFIA 2W84A 3MKWB 1B1BA 3IC7A 4I09A 3TEDA 1ETXA 3OYEA 1TQMA 2FA5A 4A93J 3ABKH 2KJBA 4A5NA 1NK2P 1QU3A 2ZO4A 4EQQA 1A35A 4HPQA 4M9ZA 1A5JA 2FOWA 3WE2A 3CCRI 2V1XA 3BPXA 1DGWY 4O6JA 1RKTA 3W6KB 3S2DJ 4IQJA 2TRTA 2Y0SN 1FZPB 3HPHA 4HV6A 2EWNA 5DUKA 3BG7A 3V7CA 3BCAA 4EJOA 2R7VA 5FKNA 4X0GA 2R5YB 3JRCA 4M3BA 1WJCA 5E3NA 2K3PA 1OCZH 1GUUA 3DU6A 2H1LA 3J81K 2VBWA 4WK8F 4XOTA 4AUXA 1WJFA 1MBGA 3JTGA 1U3EM 2VQCA 3I64A 4XN3A 3IKTA 3FK6A 4HF0A 1OCRH 2HDWA 3IHUA 1SFKA 1KGSA 2JT1A 1TW2A 2IP2A 3IWFA 1V3FA 2L02A 1APLC 2HU9A 1AA7A 3F72A 1D1AA 2NVXJ 3GLLA 3LA7A 3CO6C 1R5HA 4L9NA 2GWRA 2IAIA 4TV7A 1ZRCA 3K69A 2FSWA 4CO8A 1O57A 2NS0A 5J3LA 1PVEA 4JBAA 3G3ZA 2FNAA 3LSTA 1YFHA 2WYDA 2M0CA 1E3HA 4IRIA 4BAYA 1OCPA 3HOVJ 3S1NJ 4BQOA 2LP0A 1FEXA 3BOQA 2DA5A 2CW7A 4NC7A 4A6EA 5IP7J 5L3DA 1FTTA 2R5ZA 2JZYA 2DOFA 1FWZA 1OR7C 5HDGA 2PJPA 1R36A 4XRFA 5ILVA 3HZJA 5H6RA 1U0JA 2A6HF 2ZKZA 1QHGA 3I59B 2M87A 1P4XA 3ASOH 3OL4A 3Q9VA 2NOJB 1OCTC 1B72B 1YTYA 3OS1A 1TT5B 3N05A 2LBFB 1T08B 5J8CA 1VQ4I 3HOUJ 2QEXI 1FOWA 1QZYA 2UV1A 3HKZN 4AIJA 1X3ZB 2ZJ2A 4ENMA 1O7FA 3MWMA 1MJBA 3NWSA 3SHFA 1UAAA 1Z7UA 3I54A 4A3MJ 2FMLA 5LBQA 4CGZA 3PUBA 1NTCA 5EGOA 5BPDA 1HSJA 3BJOA 4KN4X 2W24A 4BEHA 3A0HC 2NOGA 4EM0B 4B4CA 1FP1D 3A0BC 3U2RA 1S6LA 2D2WA 5HLIA 3BZKA 4EMSA 1GV5A 2P4WA 2PQ8A 3BTLA 4BXUA 3SDGA 5IT3A 5K7ZA 2DJNA 3KP4A 2P8TA 2KFDA 1W7PB 3F8FA 4P1WA 4XM3A 5F27A 1YJWI 5FRNA 2DK5A 2DPUA 3I4MJ 4IL6C 2ZSIB 2ZC2A 4FCYA 2EK5A 4U7DA 2XAQA 4XONA 2ZBKA 2TDXA 2ZXWH 5GP9A 2P0WA 4BUPA 2VC0A 3BG5A 4S05A 3GFLA 3PNVA 2VONA 1HCRA 2EFNA 2VJ5A 1UG2A 4E7KA 3T1BA 2BEOA 4XBFA 4QTRA 2NVTJ 2QQAA 4RB2C 3K0LA 5M5YJ 3R60A 1KYWA 1QA6A 3S17J 2XC7A 1G3SA 1IDZA 2E1OA 3LFUA 4IJAA 4M1JA 2ADUA 4IEJA 1GM9A 2Z16A 5J4VA 3D5LA 1BR1A 2R7UA 3WGGA 2HXOA 4CICA 1IF1A 4HDUA 2N8GA 1UHSA 4WXDA 4UNOA 1UCRA 2BZTA 2L7ZA 2ESNA 2LH9A 2E2IJ 3AL0B 3K3WA 3CJRB 2Y2ZA 1OYWA 3L7WA 1RUOA 2HDDA 3Q3SA 3CTAA 5DYMA 5JLXA 2EZIA 2F5VA 2Q2EA 3FMSA 4PSWA 4GDFA 2CJJA 4J01A 3PQKA 3H5AA 1TNSA 3BDDA 4ZYGA 1RRJA 1D5VA 5L3CA 3GFMA 3DWLE 2EJRA 2STTA 3LAPA 4BBRJ 2DFEA 1MJ9A 4XKVA 1A04A 3K1MA 4P9FA 1K4TA 3WE3A 3CMYA 4KMFA 1BIAA 3ULQB 1U78A 1X3WB 3S93A 1IN7A 4A3LJ 3LSKA 3QWLA 4XKWA 1GM7A 3K70D 4A3KJ 1BBYA 2L4AA 3IL2A 2Q1ZB 4ZH4F 3TDZC 4YF9A 2QSFX 2CFOA 2XRNA 1USTA 3MVPA 3ISPA 1BM9A 2DW4A 4JQFA 4M73A 3RZDJ 4EJTA 3M1EA 5E17F 4HNUA 5EDNA 2HTSA 2JRTA 1TLHB 3G71I 1OYIA 1ENHA 2BVLA 3DLAA 2EFWA 1EF4A 4R79A 1C0WA 1F43A 4ESJA 2X1CA 1LVAA 3ZMZA 1I50J 2M4KA 4OMZA 2VQHA 3HSEA 5F64A 3KE2A 2LRDA 4RLQA 3TQNA 3OYJA 2ECCA 3S8RA 3RKQA 2HVQA 2KT0A 1JJ6C 1Y8QB 2YR2A 5FGMA 3FDYA 2PJRA 1T95A 1BJAA 4BJTA 3VOEA 1SFOJ 4BDZA 2R7FA 2K86A 4UXNA 2CFXA 3W2AA 1GT0C 1V54H 2WAFA 2E1MC 3CJTB 2R4GA 1XGMA 3Q0VA 4JX6A 1SEUA 1IW7F 2IT0A 3JSPA 2FEZA 3CUQC 2CH0A 3IH2A 3P9KA 1AI4A 4G9YA 2DTRA 1VQPI 1G2HA 1FIPA 4D7NA 2XAUA 3L2QA 2W4SA 3J80Z 2NXNB 4JX5A 2VXZA 3PFYA 2LNBA 3BY6A 4ASNA 1OR0A 5GAGJ 1CQTA 2Z33A 4KYWA 1KONA 3LOCA 2IVMA 3R4KA 1ZGWA 2O8XA 1LDDA 2K9SA 2DFIA 1X1PA 2DU9A 1FM2A 3B6CA 1GM8A 2QBYB 5IYDJ 3SRCA 1WPKA 3F8NA 2PFBA 3QU6A 4MFDA 2IJLA 5J47A 4C2UA 2R7OA 4BYYA 3PIPF 5HS9A 2F4IA 4GGGA 2E35A 3KEYA 4C3JJ 5JR3A 3K4CA 2XF7A 3FXQA 4HDVA 2JA2A 5FKKA 1B72A 3D5RC 5TGTA 2LBFA 2Z3YA 2WC2A 4H0EA 3BJAA 5LRRA 2VB6A 1S9HA 1R23A 4XSZF 3LSMA 2W25A 1LFBA 1CP9A 5CVUA 2DXIA 3CDHA 2M9HA 3O3KA 3IKVA 1LNWA 3L2RA 1BC8C 1KYZA 2DJIA 2ECBA 2JSCA 3OS0A 2GA1A 2VKHA 4AWXB 1ZRFA 1S7EA 3UR3C 4M3FA 5B66C 3OYFA 3F8MA 3V4GA 2QA4I 3TW7A 3CC2I 2X85A 3HJEA 3L09A 3PO3J 4ZDOA 3PSFA 2HWVA 4A0XA 2ZJRF 1GV2A 4OIQF 1E2XA 1IN4A 1FSHA 2E36A 2DMUA 4IVNA 4B8XA 3MKLA 4LD5A 3ERED 4E7HA 5C4JJ 1ON2A 3B73A 4PFOA 1RESA 4PELA 4IRGA 3QAHA 3QRFF 1Z9CA 3L2CA 1LQ1A 1XGOA 1Z05A 2K02A 2QKLB 3JRFA 3PL8A 3W2WA 4QIWN 5DV5A 3CLOA 3T5XA 5DCMA 4CCOA 2HQRA 3I55I 4AYBN 3PNYA 4KJZA 3KEOA 3T0YA 3F6VA 4L0ZB 3ZP5A 4E57A 3IWZA 4XMYA 3OYMA 2HI3A 2DAOA 3MN2A 4V19K 2RREA 4D0PA 1NK3P 3M7GA 3SEZA 2OZUA 4BHCA 5IYCJ 4L9JA 4NDLA 1GK0A 4BXXJ 3KYDB 1LDKB 1ORKA 1XCBA 2GOXB 3O8HA 4L5EA 2QCOA 4A3FJ 1R7JA 2K9QA 5KNLA 5JI6A 3HGYA 1VQ6I 4ANJA 4DYQA 1R1TA 1Y1VJ 2NAZA 2V9KA 1X1CA 1IC8A 4IOCF 2LSOA 2DK8A 2XPUA 1W4MA 1D0ZA 1EH8A 3DPTA 1K6YA 4FQGA 4F91B 2KZVA 2L7KA 1QGPA 2LC2A 3OIQA 2V1NA 2G7UA 4G6QA 1JX9A 2PBIA 5J1UA 4YFAA 4KDPA 4HF2A 2DN0A 3FXRA 1QO0D 4O3MA 4LLLA 1CF7A 3DU5A 4LK1F 3VB2A 4FTHA 2XKPA 2ZNZA 3CMEI 1DU0A 3FGTA 2F5FA 2FU4A 4EGYA 4BE1A 2QQBA 5C44J 3E6CC 1RIOH 2HVSA 3HDDA 1OLTA 1ZARA 5E79C 2LVSA 4Q48A 2FBHA 3G4SI 1IUFA 3BG9A 1JHFA 3CCQI 1LE8B 3GW2A 3DLLF 3GTOJ 3CP8A 1A6IA 1AI7A 4XORA 2R7XA 4JOMA 1XGNA 2EH3A 4LGWA 3GFIA 2HGCA 2K9LA 2ZXJA 3BPVA 4A0YA 3OMYA 1MBJA 2PX9A 3PUFA 3FKJA 1OJLA 3WTWC 1H89C 3U21A 4C3HJ 3OYCA 3I4NJ 4PGHA 1H9GA 2ELHA 1U6GA 1HKSA 1TT0A 3ZN1A 1S29A 1PP8F 3WHBA 4Y4RA 2ISYA 4XNFA 1Y39A 2EILH 3RZOJ 3A01A 3MFKA 5JVGF 5L3GA 2D1VA 3ZCOA 4NB5A 3M07A 4KICA 4XRMA 5EF6A 2LTPA 1PUFA 1VQ7I 3I71A 2VKVA 4O5VA 2WB1A 2YX4A 2YPRA 2GZWA 2JA7J 2RGVA 3FXJA 1Z6RA 4NBQA 1YQAA 4AU7A 2I5UA 2MABA 3HG9A 2E1MB 2MGQA 1YS6A 2YU3A 3VYUB 3J7ZI 1PDNC 2I8DA 2XAHA 4XLNF 3GBGA 1JKPC 2VIXA 3CUQB 1IN5A 3CCUI 2IS6A 2CQKA 3O8GA 4NNJA 2A3SA 3FXMA 4DZJA 1ZQ3P 1TBXA 1T2KA 2C6YA 3AKZA 2MW8A 5JFRA 3CO7C 2ZCWA 3CLQA 4I76A 2HOEA 1W5CC 4GYGA 4ESBA 1XSDA 2XGDA 1YX3A 4XLPF 1SFEA 4K2GA 5FJ8J 4L9VA 1XC5A 4AVPA 3OR2C 2LFBA 5J6XA 4J00A 1IAWA 3KZIC 2XVCA 1D8KA 3BR2A 4N4OB 4E55A 1QQIA 3DQVC 1GVDA 1AJQA 2WAEA 1OR7A 3RJPA 4XQFA 3WU2C 3I5UA 3LNQA 1EA3A 3WHCA 1U8RA 1D0YA 5F04A 4B43A 4S04A 1Z1DA 1ZLKA 5AONA 3LA3A 3CJNA 3GEZA 3S3NA 3ELKA 3ZMDA 4UUSA 2QUFA 4PJMA 5EGOB 1YO5C 4BEHB 1HW5A 3E0JB 1ZG3A 1ETOA 3ZMTA 3PM1A 2FE3A 3M8EA 1XGSA 4I7HA 4RGRA 3HOYJ 3A4CA 3GVAA 1YYVA 4CDGA 3EDPA 1UHMA 2H6BA 1IN6A 2Z5UA 2EB7A 4M3EA 1ETVA 1FP2A 2UXNA 4C30A 2OU2A 4Q5SF 2QGUA 1TWAJ 3HRSA 2VLAA
chains in the Genus database with same CATH topology
2W00A 4DGWB 3ZGKA 4DJAA 4F52A 3TBIA 4HEA2 1U0JA 4WKUA 3ZQQA 1QHGA 3OL4A 4CUGA 3LSGA 2Z1DA 4PJNA 2NOJB 3NWTA 4KITB 4IX7A 4YEJA 1FXHA 3OS1A 3N05A 2LBFB 4PJJA 2WA0A 4II3A 3SDBA 2UV1A 4BU2A 1GLNA 3MD2A 1WJBA 3NWSA 4XLCA 1UAAA 4BGDA 4PEMA 4IQ4A 3VYTB 3PUBA 3L91A 5JHFA 3ONQA 3L2VA 3CJQB 3K4JA 1BOBA 3HXLA 2Z2SB 2XSJC 5LFAA 4OAYA 3IUOA 4BEHA 2BW3A 2LOOA 2OC6A 4FASD 3VYSB 4HSTA 2Q2EB 4E6KG 1LVKA 2UUZA 3SRBA 5HLTA 2A5WA 4F92B 2MYSA 2WY7Q 4YELA 2PMZA 4ITVA 4P1WA 5HOOA 3MKYB 5FRNA 3CZ6A 4XM3A 1MNEA 1AJNA 1X1AA 5FROA 2CV1A 2ZSIB 3S32A 1V5EA 3DTKA 4RMNA 2GOMA 4XONA 3H9JA 3W3CA 2CV0A 3HOSA 2WY8Q 2P0WA 4BUPA 3E1SA 3PNVA 2VJ5A 4E7KA 4C9YA 1J09A 2ZFUA 1N77A 2XC7A 1Z21A 3LFUA 3SZGA 4M1JA 1GM9A 2Z16A 4BE0A 4BL0B 3D5LA 1BR1A 4PSXA 2R7UA 4ZTJA 2F6CA 4E7JA 3H5NA 2LH9A 3AL0B 3PNTA 3DPLC 3K4BA 2KHMA 3K4KA 4CH7A 2VPLA 3LL7A 3K3WA 3CJRB 1PNKA 3SYTA 1G59A 2CUJA 2R7SA 1V5GA 5CQEA 2W1OA 3DTIA 2M4GA 2M7BA 3K70C 2CV2A 3LMMA 2Y0SA 1FXVA 2F5VA 4PSWA 3JTQA 1WFXA 3BLYA 4F55A 1T0FC 4J01A 4YRVA 3H5AA 4DIQA 1Y6IA 4B47A 3A2KA 2WYBA 4KISA 2PJRB 3DWLE 4B48A 2M3AA 4BS9A 1AJPA 1JW0A 4XKVA 3J7AY 2XF6A 2AE5A 3MMYB 3S93A 2OUMA 3FBNB 2MFZA 3C2HA 1MMNA 3LSKA 4XKWA 2O5RA 3K70D 2VKDA 4BDYA 1GM7A 1K5QA 4HSRA 2Q1ZB 4YF9A 2ADVA 2CFOA 2JSPA 2RQQA 3EPZA 3RCOA 2HVRA 4CCNA 4JQFA 2VXDA 3UNGC 1WJDA 4HNUA 1Z3XA 4QPOA 1MMDA 5KHDA 1Z3YA 3K6GA 2OV7A 2BVLA 3DLAA 4RM3A 4R79A 3VSKA 4LITA 1PYVA 4CCKA 3H0DA 3V42A 1GHDA 2X1CA 1ZELA 3OWTA 2M4KA 4N4NB 4XLFA 2VQHA 5KCMA 4BJ6C 1N75A 2LRDA 4E56A 4RLQA 4ZJZA 3OYJA 4PFPA 1K5SA 3S8RA 2HNHA 2HVQA 4CCMA 2IXSA 4E7ZA 5CKTA 3JTRA 5CQGA 3FDYA 2PJRA 1T95A 4BJTA 3OIPA 4BDZA 4WKVA 3OS2A 4D1QA 1E0EA 1PNLA 1X4OA 3W2AA 3A1YA 2WAFA 5CPRB 4XL9A 2JUGA 2E1MC 2R4GA 2DT7B 3DKXA 4U7BA 2CH0A 1AI4A 3F9KA 4PK4A 4U87A 1KEHA 3HKZA 2XAUA 3L2QA 2W4SA 3EUKL 2X1EA 4ZDPA 2VXZA 3CESA 3PFYA 2LG4A 4EATA 4LIUA 1OR0A 2X51A 3SRAA 2R7WA 4YFBA 1KONA 4HG2A 3W2VA 3CMMA 4MLOA 3S8PA 4HRIA 2V4JC 4RM2A 2X6WA 2ZXHA 3OOUA 4P5OA 1FM2A 4RLFA 1GM8A 2KL4A 1MNDA 2RNGA 4C2TA 2WYCA 2M0MA 4G6TB 3SRCA 1MMGA 3OYDA 3K10A 4C2UA 2WBMA 2R7OA 1IRXA 1NG6A 2F4IA 3ML0A 1BR4A 3KEYA 4D9JA 3K4CA 2XF7A 3DTEA 3EUHC 2JA2A 1X19A 3D5RC 5TGTA 3L2WA 4K2FA 4LIVA 4DOZA 2LBFA 4BQNA 2K9MA 4DBRA 3OYHA 1QHHD 1S9HA 2VB6A 2CMPA 4BJ5C 3LSMA 4E7IA 2HPMA 3BC8A 1CP9A 3RPUD 2DXIA 5HVQC 4PJLA 3H35A 1SAUA 4ZC3A 4OAZA 2AE3A 3L2RA 2IGMA 2L9SA 3QODA 4Y33A 2DJIA 2KLOA 3OS0A 2A6TA 2KMUA 2VKHA 4E7LA 2KP6A 1BR2A 2IGNA 4LG3A 1K7DA 3UR3C 1Y56A 3OYFA 2ZXIA 3OYAA 2VJIA 1D1CA 1FMVA 2W82A 2L2OA 2HZDA 2X85A 2X6XA 1FMWA 4XLHA 3HUGB 3RTRA 3PSIA 4ZDOA 1PJRA 3OR1C 3PSFA 3DPUA 1NG7A 2VQGA 1G8XA 4XLAA 4DBQA 4XLEA 4BE2A 1LKXA 2HPIA 3CF2A 1P9QC 4B44A 4IZZA 1UG0A 4E7HA 4XR6A 3LSIA 1YE9A 1X1DA 3KX2A 3OY9A 1GKFA 4PFOA 2V6EA 4PELA 2X1DA 2R7QA 3H9GA 1N78A 4Y3OA 2QKLB 1E3AA 3K4LA 2CS3A 3PL8A 3W2WA 4E4HA 4BTHA 5HNFA 4CCOA 2IS4A 3OL3A 3PNYA 4KJZA 5FRMA 4WKSA 1VZ0A 3ZR8X 3AFHA 1W36C 4E57A 2KDOA 1WJAA 3QYBA 4XMYA 2LYCA 3OYMA 3VYRB 2JVGA 2M7AA 3KYLA 2HQAA 3SEQA 4F93B 2RREA 4CCLA 3OYGA 2K5CA 2LY2A 3BCBA 3SEZA 3L94A 3QOEA 2VQLA 4BXFA 3H9QA 2VL8A 2CW8A 2VJJA 3HPGA 3M8JA 1V5FA 1GK0A 1GK1A 1YX5A 4QPQA 1LDKB 1ERDA 2GOXB 3OYKA 2W7NA 1W36D 2ELJA 5KNLA 1R6RA 3IAS2 2R7RA 2MC4A 4ANJA 3OYBA 2IS2A 4F3QA 2V9KA 1X1CA 3I9V2 3ZXSA 3AL0C 1D0ZA 3LSHA 3DPTA 1K6YA 4F91B 2KZVA 2L7KA 2KRCA 3VSLA 2LC2A 3OIQA 2V1NA 2BOLA 4CSWA 3C2GA 2KQRA 3S3MA 1JX9A 2E5ZA 4YFAA 1TZLA 3EUAA 3IAM2 3ZRGA 1D0XA 4CA0A 1MW7A 3I3LA 3DU5A 4E7SA 4BE1A 2CUZA 2KRHA 4NUBA 3OYNA 3L2UA 3VDXA 2HVSA 3HL2A 2WYEA 2L5QA 1OLTA 2V26A 4AVZA 3DKYA 3RSNA 3QYEA 4HNTA 2DOAA 1AI5A 3TMOA 2FUG2 3CP8A 1AI7A 4NC8A 4XORA 3HC7A 2R7XA 4JOMA 3K4NA 2K9LA 2IGOA 2XDVA 1X1BA 4OWRB 2L9NA 3OMYA 3BG6A 2DCEA 3VWBA 3OYIA 2IS1A 4BQQA 3MKZA 2QKMB 1JVZA 3FKJA 4FETA 3U21A 3OYCA 2X6YA 3IP4B 2UWMA 1TT0A 3G2BA 3M1CA 2KPMA 4XNFA 4Y4RA 2XF5A 3MKWB 2E5NA 2VASA 3ZCOA 3OYEA 3OYLA 1WJ5A 1DQUA 2WB1A 2AE4A 1Z7LA 1QU3A 2DT6A 4ZYAA 5HNHA 4AU7A 2MABA 4HPQA 3HG9A 2E1MB 3K4MA 4KT6A 4GRIA 2JVHA 3VYUB 1PNMA 1JI8A 2I8DA 1DGWY 3GBGA 2VIXA 4IQJA 2WAQA 2IS6A 4NNJA 3FBIB 3HPHA 1AI6A 3AKZA 3S3OA 3BG7A 3BCAA 3FHNA 2R7VA 4X0GA 3DEEA 4NQWB 1UELB 1X4PA 1YX3A 1WJCA 2R7TA 4K2GA 2IGKA 2LREA 2K3PA 4WKTA 3DU6A 3OR2C 4XOPA 4J00A 4XOTA 1D1BA 3PJRA 1KECA 1WJFA 4N4OB 5LD2C 2VQCA 2ZSHB 4XN3A 4E55A 4II2A 4BACA 2HDWA 3DQVC 4CCJA 1HA8A 1SFKA 3H5RA 4XN0A 1AJQA 2WAEA 4XQFA 2VJ4A 4H4KC 1EA3A 3TL4X 2HU9A 1AA7A 1D0YA 1D1AA 3CP2A 4B43A 4AYBA 2BVMA 2AQEA 1H2GA 2V7FA 3S3NA 4ZTFA 4IKFA 4PUSA 4CZCA 1GK9A 4PJMA 1WJEA 4BEHB 2BW3B 3E0JB 2WADA 3HOTA 3QYFA 2AQFA 1DGRM 3A4CA 4XKCA 2WYDA 1LFPA 1MMAA 4ZDLA 4XKBA 4B3XA 2LY1A 3D5SC 3RQ4A 4BQOA 4C30A 2MD0A 4NC7A 2CW7A 1DP3A 2E60A 1OR7C 2VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KEH A;  3L91 A;  1K5Q A;  1GKF A;  4HSR A;  3ML0 A;  1H2G A;  1K5S A;  4YF9 A;  3S8R A;  2ADV A;  1AI5 A;  4PEL A;  1GK9 A;  1FXV A;  4WKU A;  3JTQ A;  1K7D A;  3JTR A;  4K2G A;  1JX9 A;  4YFA A;  2AE4 A;  1AI7 A;  4WKT A;  4HST A;  1OR0 A;  4K2F A;  3SRA A;  1E3A A;  2WYB A;  4WKV A;  4YFB A;  4E56 A;  1FXH A;  1GK1 A;  1GK0 A;  1KEC A;  4M1J A;  3SRB A;  1GM9 A;  1PNL A;  4E55 A;  2WYD A;  1PNM A;  1AJP A;  4BTH A;  1FM2 A;  1JW0 A;  1AJN A;  1GM8 A;  1AJQ A;  1JVZ A;  1CP9 A;  1GHD A;  2WYC A;  4WKS A;  3SRC A;  2WYE A;  2AE5 A;  4E57 A;  4PEM A;  3K3W A;  1AI4 A;  1AI6 A;  2AE3 A;  3L94 A;  1GM7 A;  1PNK A; 
#chains in the Genus database with same CATH topology
 4NQW A;  2CU7 A;  4DGW B;  4HF1 A;  2DA7 A;  2LK2 A;  4GO1 A;  3ZGK A;  4F52 A;  3TBI A;  1IJW C;  4I01 A;  5EG0 A;  4WKU A;  3ZQQ A;  3RDI A;  4LB5 A;  3LSG A;  1XG1 A;  3VFZ A;  3X2Q H;  4AIK A;  2ACJ A;  2Y0M A;  3ABM H;  3NWT A;  4KIT B;  4YEJ A;  1FXH A;  1BC7 C;  2FBI A;  3BR5 A;  5CVR A;  3ZQ7 A;  2WA0 A;  3RPU A;  2G9W A;  1GLN A;  3MD2 A;  1JUS A;  4M9S A;  3ZMU A;  3H3V K;  5EZG A;  3HTS B;  3IRQ A;  4PEM A;  5E3O A;  5A2Q Z;  3H3Z A;  1EJ9 A;  4M3G A;  3VYT B;  1PP7 U;  1R49 A;  5JHF A;  1FYK A;  1KQ9 A;  1IG7 A;  3L2V A;  2V9V A;  3K4J A;  2V6C A;  5LFA A;  2XSJ C;  2NNN A;  4RA2 A;  1ITY A;  2RC4 A;  2BY3 A;  5CLS A;  1L0O C;  4FAS D;  1H8A C;  2Q2E B;  2DPD A;  3FHZ A;  2D1H A;  1VQL I;  3J80 K;  3SRB A;  2X9D A;  3FM3 A;  1XSX A;  2JMW A;  2GQQ A;  1H9T A;  3HOX J;  1S7O A;  4EJV A;  2R7Z J;  1ZG5 A;  1KA8 A;  2BE5 F;  3S32 A;  3G1O A;  3DTK A;  3H9J A;  5HS7 A;  1MBF A;  3KP6 A;  2CV0 A;  1IRZ A;  1MBH A;  1WI9 A;  2ME6 A;  3QP5 A;  3M4O J;  3LA2 A;  4FX0 A;  5ICG A;  5EEG A;  2B0L A;  4C9Y A;  3C2B A;  4EVI A;  1IXC A;  2ZFU A;  4P96 A;  2QVO A;  3BRO A;  2KIQ A;  1Z21 A;  1FX7 A;  1USS A;  3TW6 A;  2CQQ A;  3OV8 A;  4M9X A;  3GFJ A;  2EA2 A;  4L5I A;  4BE0 A;  2FXA A;  4PSX A;  4ZTJ A;  2QYO A;  3DFG A;  4YFK F;  2O8K A;  3DPL C;  1G4D A;  2KHM A;  3K4K A;  4CH7 A;  2VPL A;  3LL7 A;  1KQ0 A;  1A31 A;  5H20 A;  3CC4 I;  1G59 A;  2PLY A;  2CUJ A;  1V5G A;  2E19 A;  1LE8 A;  2KIF A;  2W1O A;  3DTI A;  3LMM A;  2Y0S A;  3NQO A;  5K1Y A;  2L7F P;  2CGP A;  3H0G J;  3WTT C;  1JKQ C;  2DI3 A;  3ECH A;  4DIQ A;  1Y6I A;  1XSV A;  3A2K A;  2E2H J;  1UFM A;  2HDC A;  2PJR B;  5FFZ A;  5M3F J;  5TRD A;  5B1B H;  4BS9 A;  3G1L A;  1FBQ A;  1J5Y A;  5TIS C;  1JW0 A;  4IHY A;  4IHW A;  2NVQ J;  4XK4 A;  3AG2 H;  1Q1H A;  3WTS C;  3MMY B;  2Y75 A;  2JA5 J;  4UY8 I;  2MFZ A;  4BDY A;  2VKD A;  2ZJP F;  1VQK I;  2BXY A;  2ADV A;  1BIB A;  2RQQ A;  1R9T J;  3BQZ A;  4A3B J;  3LQR A;  4XRS A;  4CCN A;  5ED4 A;  1IXR C;  3FIS A;  3UNG C;  1MZB A;  1G3W A;  1WRJ A;  4RAY A;  2OV7 A;  1V4R A;  1FBU A;  2XV4 S;  3CUQ A;  2EFP A;  4PGG A;  3VSK A;  4C3I J;  5E3M A;  4CCK A;  2H09 A;  2W85 A;  3CCS I;  5LRS A;  5ILU A;  2RQP A;  4XLF A;  5KCM A;  1N75 A;  1I1G A;  3TO7 A;  4ZJZ A;  2OF7 A;  3GZ6 A;  2KIM A;  5GPC A;  2CQ7 A;  2OA4 A;  1QZE A;  2IXS A;  2DDB A;  4IHT A;  5CKT A;  2IEK A;  4AM3 A;  1HDP A;  1TTY A;  3OIP A;  2H8W A;  1X2N A;  1JE8 A;  4D1Q A;  1PNL A;  1IUY A;  4XL9 A;  2HEO A;  3K9T A;  3KEQ A;  4Q47 A;  3FF5 A;  3U1K A;  1KQ8 A;  2UXX A;  1XMK A;  1SVO A;  4FE7 A;  3RYP A;  1R1U A;  1YG2 A;  1QPM A;  1KEH A;  2K27 A;  3BTJ A;  3HKZ A;  5JHU A;  2DFH A;  1K61 A;  1HC8 A;  2DOE A;  2LMD A;  4LIU A;  2X51 A;  4JX4 A;  5HDN A;  3T8R A;  4CHU A;  4YFB A;  3SFZ A;  3DXJ F;  2NRA C;  4MLO A;  4MGR A;  4RM2 A;  5C3E J;  3P7N A;  5ICE A;  2ZXH A;  3OOU A;  2WYC A;  3FXU A;  1GDT A;  1LPQ A;  3OYD A;  3K10 A;  5DM7 F;  5JVT A;  4FIS A;  2Y30 A;  4R1H A;  4RS8 A;  4OU0 A;  3O2P E;  2MLK A;  3ML0 A;  1BR4 A;  1A36 A;  1ETQ A;  4D9J A;  5HS8 A;  4LMY A;  4K2E A;  4ON0 A;  2LKP A;  3EUH C;  1X19 A;  5J4Y A;  1GXQ A;  1MD0 A;  2LR8 A;  3L2W A;  4K2F A;  4RGS A;  2VI6 A;  2HKX A;  3P9I A;  2PMU A;  4HQE A;  2K9M A;  4DBR A;  1QHH D;  2YSR A;  2KJC A;  1BW6 A;  5K7H A;  5LLQ A;  3GTQ J;  2L9R A;  4CXF A;  6PAX A;  2V9P A;  2UZK A;  3BC8 A;  5F1R A;  3WTY C;  5DCM B;  3Q9S A;  5L3B A;  4HAM A;  2M34 A;  3QPL A;  1QRY A;  5HOD A;  4PJL A;  4OAZ A;  3M8F A;  2IGM A;  2L9S A;  2Q0O A;  4Y33 A;  3BQY A;  2KLO A;  4DQ2 A;  1JGG A;  1WZ2 A;  3EQL F;  1FPQ A;  2A6T A;  2KMU A;  3KZZ A;  4E7L A;  3HHG A;  4FT8 A;  3DBH B;  2HQN A;  3BZ6 A;  3RI4 A;  2BY2 A;  5DS9 A;  4RBO A;  3OYA A;  2VJI A;  1D1C A;  2WAQ N;  3WU0 A;  4HNV A;  1XS9 A;  5J1R A;  3E3V A;  1HW2 A;  1ZTR A;  1G8X A;  4XLA A;  3GTK J;  1ZHF A;  1I1S A;  2EZL A;  3CF2 A;  3WU1 B;  4IHV A;  3S14 J;  4IZZ A;  3TGN A;  3OSG A;  4IOA F;  1AOY A;  1SD7 A;  4KIF A;  2QQ8 A;  4EM2 A;  1MBK A;  1Y8R B;  4I0A A;  5HLH A;  2H27 A;  2YU9 J;  1IRF A;  3UKG A;  5K5Q A;  1Z0X A;  2AXL A;  1OIS A;  1R5I D;  5BOX A;  5IY5 H;  2MH9 A;  3QQA A;  1IRG A;  4D5C A;  2DMP A;  2IS4 A;  1U8B A;  1CF7 B;  2RNJ A;  5E20 A;  5FRM A;  1TNT A;  4WKS A;  1VZ0 A;  1W36 C;  2IW5 A;  1T33 A;  3ERM A;  3LAJ A;  5GAH J;  3DBL B;  2LYC A;  3DKW A;  3NEU A;  5LEJ A;  2XRO A;  1QNT A;  3VYR B;  1P2F A;  2JVG A;  2M7A A;  3S1Q J;  3KYL A;  2HQA A;  2JUC A;  1VQN I;  1KU3 A;  4ESF A;  3OYG A;  3BCB A;  3QOE A;  4A5M A;  3H9Q A;  5IPA A;  3JCU C;  4L0Y B;  3M8J A;  3HPG A;  1R58 A;  2MSY A;  1YX5 A;  5EYR A;  1DPU A;  1W1W E;  1W7P D;  1ERD A;  2P5V A;  1KU2 A;  3FM5 A;  2W7N A;  2ELJ A;  3F22 A;  1R6R A;  2R7R A;  2LKS A;  3P5J A;  1Y0U A;  4CZZ A;  3OYB A;  4C2M J;  3JRA A;  1P7J A;  4E70 A;  1E17 A;  5IP9 J;  3CCM I;  1ETY A;  5GPA A;  2Y31 A;  1JT6 A;  1M1E B;  1YIO A;  2M8G X;  1BW5 A;  2BOL A;  4CSW A;  1F5T A;  4I0B A;  2E5Z A;  2W48 A;  3KLN A;  3A01 B;  1E3O C;  3NAR A;  3V8K A;  2JPC A;  1PUF B;  3TO9 A;  1SAN A;  1OMI A;  3BG3 A;  2CUE A;  4CA0 A;  5D5V B;  2B7E A;  1MW7 A;  3W6V A;  4B3A A;  2KRH A;  1AU7 A;  1Z67 A;  1HXD A;  3VDX A;  4ZYD A;  3HL2 A;  4RAF A;  3SQN A;  3E5Q A;  3QYE A;  1JUP A;  2WWY A;  5A2Q K;  3E7L A;  3KFW X;  2PMZ N;  5LHH A;  4M72 A;  3WGI A;  4JP0 A;  3KP2 A;  3QOP A;  4NC8 A;  1K78 A;  3R61 A;  2NVU B;  3LSJ A;  1G3T A;  2DA6 A;  4NC6 A;  2IGO A;  2XDV A;  4OWR B;  4QSH A;  3F23 A;  2EV6 A;  2WV0 A;  2L9N A;  2ELK A;  1AHD P;  3BG6 A;  2DCE A;  2BY1 A;  2A5Y B;  1B9N A;  4BQQ A;  3OYI A;  3MKZ A;  1TC3 C;  2IS1 A;  1R5G A;  3HEF A;  2ICW G;  3NRV A;  1U9N A;  1R4N B;  3AG4 H;  1W5T A;  3JW4 A;  1OQY A;  4F7Z A;  2PEX A;  1MMS A;  2UWM A;  3KYC B;  3M1C A;  3ZMV A;  1LFU P;  4KMU X;  2KPM A;  1B8I A;  2XF5 A;  3L1P A;  1H88 C;  2MD5 A;  3MZ8 A;  3O6B B;  1HDD C;  1WJ5 A;  3H92 A;  2BGC A;  2ETH A;  2HFH A;  2PN6 A;  2DT6 A;  4UUS B;  3GYH X;  1UMQ A;  3SZP A;  4EEF G;  1B6A A;  2K3F A;  3SZT A;  4YII A;  4GRI A;  4EJU A;  2JVH A;  3CCL I;  1I3Q J;  1PNM A;  2XB0 X;  1WH7 A;  1RUN A;  4KNY A;  2L3D A;  2QEN A;  2HYJ A;  4JK1 X;  4KIB A;  5DUI A;  2EBI A;  2CW0 F;  2EPF A;  3L00 A;  3FBI B;  1VI0 A;  2LY9 A;  2NYX A;  4B1R A;  1U5T A;  1W0T A;  3DEE A;  5M3M J;  3G73 A;  4NQW B;  1X4P A;  4BNC A;  1MBE A;  2R7T A;  2P6T A;  2CSO A;  2LRE A;  4WKT A;  1MDM A;  2XAF A;  5EG0 B;  4G12 A;  4XOP A;  3HB9 A;  3OOP A;  1OPC A;  1D1B A;  5BMZ A;  3HRM A;  4M6X A;  5LD2 C;  1VQM I;  2V1U A;  1HOM A;  3I0T A;  2KZG A;  5EJC A;  4BAC A;  5HDK A;  1HA8 A;  2O3F A;  2E1C A;  3H5R A;  4XN0 A;  5HLG A;  4RGX A;  4LLG F;  4MQ9 F;  3HIF A;  2VJ4 A;  4H4K C;  4I6Z A;  2L7M P;  3ZPL A;  1ZH5 A;  5L3F A;  4G7O F;  3TL4 X;  5E18 F;  2DMN A;  1FOK A;  1HKQ A;  3CP2 A;  4AYB A;  3EYI A;  2AQE A;  1H2G A;  2V7F A;  4PUS A;  1GK9 A;  1LJ9 A;  3U9G A;  1B59 A;  5DTD A;  5IYB J;  1ZAO A;  2WAD A;  3HOT A;  3MEX A;  2DA3 A;  1DGR M;  3HRT A;  4LFU A;  4XKC A;  1Q1V A;  1LFP A;  1MMA A;  3ABU A;  3JAM Z;  2V1D A;  3D5S C;  1QZZ A;  1SVL A;  3RQ4 A;  2MD0 A;  2ME0 A;  2L54 A;  3S1R J;  4QLC U;  3ZQC A;  2JN6 A;  1D8J A;  1DP3 A;  3L94 A;  2P81 A;  5FKO A;  1T38 A;  4DJA A;  2Y69 H;  4UUT A;  3T8T A;  4X1E A;  3FXO A;  2K4J A;  1VTN C;  2FOK A;  5E8G A;  1O3R A;  4PJN A;  5KAF C;  5D4S A;  3F8B A;  1YRN A;  1AKH A;  3FX3 A;  2YS9 A;  3S16 J;  3GXO A;  4PJJ A;  3WG9 A;  2E1N A;  3ZMS A;  4HLX A;  4II3 A;  5B3S H;  4A3G J;  3IV5 A;  4XLC A;  3ROU A;  1ACI A;  5ICF A;  4BHB A;  1F36 A;  4WCG A;  1ZR4 A;  2RVC A;  3Q0U A;  3L91 A;  4V2F A;  3FMQ A;  2MG4 A;  2E71 A;  4L18 B;  3CJQ B;  1BOB A;  3HXL A;  2VN2 A;  2Z2S B;  4OAY A;  3IUO A;  1YIT I;  2E2J J;  2BW3 A;  2LOO A;  1ZR2 A;  4QWQ A;  4Y13 A;  3VYS B;  4CYD A;  1QBJ A;  3C3W A;  4Z6Y A;  1LVK A;  5LGN A;  2UUZ A;  2A68 F;  3KPH A;  2A5W A;  4F92 B;  2WY7 Q;  1I39 A;  5D8K B;  2LDU A;  4ITV A;  5TJJ A;  3LQQ A;  3VEP A;  1ZG1 A;  3CZ6 A;  5ERI A;  1MNE A;  1AJN A;  4HBL A;  2BHZ A;  4AC0 A;  1BI0 A;  4YG2 F;  2VT2 A;  3P9C A;  4BWC A;  1V5E A;  2VUM J;  1DU6 A;  2DOD A;  3B6A A;  2GOM A;  1NHA A;  3R0A A;  4L5J A;  1SD6 A;  2WY8 Q;  4DYR A;  4IHS A;  1ZN2 A;  3A02 A;  5CYV A;  1JUM A;  2O03 A;  3CQZ J;  3E6D A;  1T8I A;  3S2W A;  3W6J B;  4Z2Y A;  3TP3 A;  1T56 A;  4A6D A;  2EIM H;  2HZT A;  2OPT A;  4YIR X;  3PIO F;  5GAD J;  2F5D A;  4BL0 B;  5LHG A;  1ETK A;  3HOW J;  3BTC A;  2A69 F;  3PQJ A;  2A61 A;  3ZN0 A;  1I3A A;  4BQA A;  3H5N A;  2RN7 A;  3PNT A;  3K4B A;  3BR3 A;  1YLF A;  1BOA A;  2EQR A;  4A2U A;  2HYG D;  2R7S A;  4DZP A;  3DCF A;  5FKM A;  3EYY A;  2M4G A;  2QLZ A;  2GXA A;  3K70 C;  3CCV I;  3JTQ A;  5E8I A;  1JT0 A;  3BLY A;  4F55 A;  4XRS G;  1T0F C;  4YRV A;  5GTI C;  2Y48 A;  4B47 A;  3S15 J;  3E6B A;  2LLK A;  2Z9O A;  4XSX F;  4B48 A;  4WWC A;  1OCO H;  2COB A;  2M3A A;  3CUO A;  4N0B A;  1AJP A;  1YOV B;  4DW6 A;  3CDL A;  3HSR A;  1XB4 A;  2E7X A;  3FXL A;  2QSG X;  3J7A Y;  1VFC A;  2AE5 A;  3M3Y J;  2OUM A;  3C2H A;  1ZGJ A;  1LB2 A;  3GCM A;  1EV7 A;  1K5Q A;  4HSR A;  1FIA A;  4YFX F;  3RPQ A;  4XID A;  2JSP A;  1ZK8 A;  3EPZ A;  3RCO A;  2F4M B;  4CYC A;  3KIO A;  1U5T C;  5DDG A;  4Y17 A;  1XX5 A;  2K9N A;  4MTE A;  1MMD A;  2VBZ A;  2VOO A;  1RR7 A;  3K6G A;  5K5O A;  2HKO A;  1TW3 A;  3LSP A;  3F0C A;  1SMY F;  1LUJ B;  5FLV A;  2OTJ I;  2F4O B;  1PYV A;  3H0D A;  3V42 A;  1GHD A;  4D7M A;  2AO9 A;  3GO5 A;  4M3D A;  4E56 A;  5LGT A;  2NVY J;  4PFP A;  1IXS B;  1K5S A;  2HNH A;  2RAE A;  3JTR A;  1STZ A;  2EIJ H;  4IPA A;  4WKV A;  3OS2 A;  5J8F A;  1KZH A;  1OKR A;  2JUG A;  3KP7 A;  2OCE A;  1FSE A;  2GBY A;  4HX7 A;  2DT7 B;  1XTA A;  4OIR F;  3WG7 H;  3N4M A;  2K40 A;  3DKX A;  4U7B A;  1RI7 A;  1K83 J;  4WXH A;  3F9K A;  4MEX F;  2WV1 A;  3EUH A;  1MJA A;  1P92 A;  2A6E F;  2JTV A;  5K7F A;  3EUK L;  2VBY A;  4ZDP A;  3CES A;  1KU9 A;  1ZKG A;  3MQ0 A;  5L3E A;  4EAT A;  1BN5 A;  5BQT A;  1P4A A;  2Y9Y A;  4OMY A;  4PJ0 C;  2KIS A;  2H8R A;  2MC3 A;  2DFF A;  2OQR A;  3CMM A;  3H3U A;  2V4J C;  1F9N A;  2X6W A;  4P5O A;  4RLF A;  2KL4 A;  2RNG A;  4C2T A;  2M0M A;  4G6T B;  2D5V A;  1I6H J;  2FD5 A;  4A0Z A;  1RPW A;  2WBM A;  2L4M A;  2DQL A;  3M9A A;  1IRX A;  3CF5 F;  3K2Z A;  2K85 A;  4LOC A;  5DCF A;  2YUS A;  5CVJ A;  1J75 A;  1BI3 A;  1LEA A;  1P7I A;  5FD5 A;  4DOZ A;  3WGH A;  4BQN A;  4ZZD A;  3V8L A;  5E1Z B;  3CMA I;  2CMP A;  4BJ5 C;  4YIF A;  1Y0N A;  3ESW B;  5BPI A;  2IA2 A;  2DQR A;  5F0H A;  4RDU A;  4HQM A;  4ZYE A;  3KZY A;  3A03 A;  3VOD A;  5LGU A;  4A69 C;  5EEH A;  1XD7 A;  3MCZ A;  1SAU A;  3F8C A;  2H6C A;  4ZC3 A;  5JLW A;  3GX4 X;  3QOD A;  2V79 A;  5DEQ A;  4A3C J;  4G7Z F;  1IDY A;  4KT5 C;  4UHT A;  2KP6 A;  2IGN A;  1K7D A;  4LG3 A;  3C18 A;  3RYR A;  2JRM A;  2A07 F;  4UV8 A;  3AG3 H;  1X3U A;  2DTZ A;  3S2H J;  1JHH A;  1FMV A;  2W82 A;  3QPH A;  1ZRE A;  2L2O A;  4UVA A;  3GME A;  2VOP A;  2ZNY A;  1FMW A;  4XLH A;  1VQO I;  1H0M A;  3RTR A;  3PSI A;  2XGE A;  1PJR A;  3OR1 C;  1NG7 A;  2VQG A;  3D0S A;  5FLX Z;  1YS7 A;  1LKX A;  2HPI A;  3J7A O;  1P9Q C;  4B44 A;  1TQP A;  3K1P A;  5IOY A;  1UG0 A;  2XAJ A;  5E1X A;  2EIN H;  1EKE A;  4XR6 A;  3RQI A;  1POG A;  1X1D A;  1ETW A;  4DYC A;  3CC7 I;  2QM3 A;  2KDZ A;  3CCJ I;  2XGC A;  2R7Q A;  3H9G A;  1U9O A;  5IOZ A;  2LD5 A;  3OSF A;  3BR0 A;  3K2A A;  4A3J J;  2B63 J;  1FJL A;  4G94 A;  3OL3 A;  1VF9 A;  4S0H B;  3ZR8 X;  3AFH A;  4HLY A;  1WJA A;  5EEA A;  3HOZ J;  2DBB A;  4MHG A;  1D3Y A;  5D4R A;  3SEQ A;  4CCL A;  3JRE A;  2KKO A;  2KRF A;  2K5C A;  2LY2 A;  4OIN F;  1W0U A;  2FBK A;  2VQL A;  2ZJQ F;  4ZYH A;  2VL8 A;  4RB3 C;  4LJZ F;  2VJJ A;  1V5F A;  3TP0 A;  3HUG A;  3HBL A;  4Y15 A;  4MTD A;  1K78 B;  5B5E C;  1I5Z A;  1P4W A;  3FIW A;  3FK7 A;  2IS2 A;  4N9I A;  2R92 J;  3JAM K;  3ZXS A;  4U0Y A;  4A12 A;  1ZLJ A;  1SC7 A;  1P6R A;  1I6X A;  3F3X A;  4AID A;  2E7W A;  3VSL A;  2QF7 A;  2DLL A;  3MAJ A;  4WF2 A;  2FQ3 A;  3WOD F;  4X6A J;  1B8I B;  2KQR A;  3HGG A;  4PZJ A;  2QSH X;  1HQC A;  2JPB A;  3GF2 A;  3NAU A;  4M6V A;  3ZRG A;  2EV0 A;  3ASN H;  5IT9 Z;  3DBR B;  3V8J A;  1HST A;  5D8L B;  1FYL A;  3N97 A;  3KP3 A;  2CUZ A;  2EZH A;  1Y1W J;  3OYN A;  2GIZ A;  1VQ8 I;  3MZY A;  1BA5 A;  2HQ5 A;  2L5Q A;  2DMQ A;  4G6D A;  5CVV A;  4EGZ A;  4ENK A;  1XPX A;  1LEB A;  1N25 A;  4ZZL A;  2X6O A;  3DKY A;  3RSN A;  4HNT A;  2EV5 A;  2G7H A;  4LG0 A;  1MH3 A;  2LF7 A;  1WHU A;  2FUG 2;  1U5T B;  2DYS H;  5D5W B;  4M71 A;  3KP5 A;  2FX0 A;  4G8X A;  3HC7 A;  1QVU A;  4FHT A;  1UHW A;  4IXA A;  2DA4 A;  2XGX A;  2BBY A;  1MDM B;  2JJ7 A;  2ZB9 A;  1X1B A;  2ZME A;  3H36 A;  3VWB A;  1JVZ A;  1HLV A;  2KIU A;  3IRR A;  4FET A;  4KFC A;  3KET A;  1MNM C;  2X6Y A;  1XMX A;  2VT3 A;  3IP4 B;  4W1U A;  4UV9 A;  3G2B A;  4HA8 A;  2CUF A;  5EZH A;  2BY0 A;  3PO2 J;  4A3D J;  3DEW A;  2O0Y A;  2E5N A;  2VAS A;  4WXC A;  4HV5 A;  3OYL A;  1DQU A;  2VOD A;  2AE4 A;  3DEU A;  1Z6T A;  2M8E A;  2BV6 A;  1Z7L A;  4EM1 A;  1YW7 A;  4ZYA A;  5FKL A;  1VND A;  3U1D A;  4DNC A;  5HNH A;  2VE9 A;  2IA1 A;  3K4M A;  1MH4 A;  2WTE A;  2NS8 A;  3K1N A;  4KT6 A;  5CJ9 A;  2ZFW A;  1JI8 A;  1XCV A;  1HW1 A;  1U2W A;  1S72 I;  4MIM A;  2WAQ A;  3ZQL A;  3BJ6 A;  3L9F A;  1AI6 A;  3S3O A;  1Z91 A;  2R7D A;  3FHN A;  3H1C A;  3WTV C;  1S5L C;  1XMA A;  1WVR A;  5LEK A;  5F08 A;  4PDK A;  1UEL B;  2CO5 A;  3QPS A;  4U0V A;  4MEY F;  2IGK A;  4I2O A;  4MNU A;  3QU3 A;  1O3T A;  4GCV A;  4UB6 C;  3I56 I;  3PJR A;  1KEC A;  4OIO F;  2ZSH B;  3PFI A;  4II2 A;  1YRN B;  5E1W A;  2XSD C;  4CCJ A;  1AKH B;  2VKE A;  2QQ9 A;  2HOT A;  1FOX A;  2M30 A;  2ID3 A;  3Q0W A;  1MKM A;  3CCY A;  3QPT A;  1WCM J;  1TQI A;  1TWC J;  2HYF A;  4LB6 B;  2BVM A;  1B9M A;  3GWZ A;  1BI1 A;  4G7H F;  4ZTF A;  4IKF A;  2GIV A;  5D5U B;  4CZC A;  1DPR A;  2EZK A;  1JTX A;  2F2E A;  1IZ1 A;  5D6E A;  1Z77 A;  5FO5 A;  1WJE A;  2MA3 A;  2L0K A;  5CVI A;  2BW3 B;  1YI2 I;  2HR3 A;  3QYF A;  3SXY A;  2AQF A;  4KN7 X;  4ZDL A;  1IN8 A;  1SMT A;  1SVM A;  1YW9 A;  2IBD A;  4XKB A;  4B3X A;  5M5X J;  1QPI A;  2XPV A;  2LY1 A;  2GLO A;  2YX7 A;  3B02 A;  3I4P A;  2LF8 A;  3TKY A;  4GYI A;  2R5Y A;  3JTH A;  2X48 A;  5D6F A;  2E60 A;  2XIG A;  2P5L C;  5KK1 A;  3TOB A;  2ID6 A;  2W00 A;  2OBP A;  3TOA A;  4R8H A;  4N9H A;  2MBF A;  4HEA 2;  1GVJ A;  4D5F A;  4CUG A;  2CRG A;  2Z1D A;  3R6S A;  4I99 C;  4HOB A;  4IX7 A;  4IRH A;  5J40 A;  5ILS A;  3R0J A;  1G3Y A;  4ABZ A;  4BHP A;  4Y7N J;  3SDB A;  3FZV A;  4BU2 A;  3V7S A;  5FLM J;  1WJB A;  2XPW A;  2IPQ X;  4BGD A;  3LFK A;  4IQ4 A;  1ZGA A;  2OZ6 A;  2M1B A;  3WTX C;  2P7C B;  1TP4 A;  3ONQ A;  1XN7 A;  5LHI A;  4UVC A;  2OAZ A;  3D1N I;  2L9V A;  2OC6 A;  1YIJ I;  1ONV A;  9ANT A;  4HST A;  4E6K G;  1R4M B;  2FNP A;  3DP7 A;  5HLT A;  3KCC A;  1HBX G;  2MYS A;  4YEL A;  2PMZ A;  1JKO C;  3ZQF A;  2E34 A;  5HOO A;  2BYV E;  3MKY B;  3FMR A;  1R71 A;  1X1A A;  4RB0 A;  5FRO A;  2CV1 A;  5DD4 A;  2Z99 A;  3CD6 I;  1OCC H;  1SFX A;  4RMN A;  3W3C A;  3S1M J;  3HOS A;  3ABT A;  1O3S A;  2COM A;  4MQV A;  2DA2 A;  1RKW A;  1T0F A;  2JWT A;  1FC3 A;  3E1S A;  2ESH A;  3I59 A;  4BY7 J;  1L3L A;  4HZF A;  2R0Q C;  1YJ9 I;  1J2X A;  1J09 A;  2XKO A;  1S8N A;  1N77 A;  3HM5 A;  3GTG J;  2VC1 A;  2OTL I;  3BP8 A;  1F4K A;  1KU7 A;  3SZG A;  4CYC B;  3LSR A;  1WQ2 A;  2DT5 A;  3AAF A;  2AS5 F;  3HSF A;  3ZQH A;  3K7A J;  1IV6 A;  4KUM A;  2F6C A;  2OD5 A;  4RAZ A;  4E7J A;  2GXG A;  2DYR H;  3MZH A;  1WH5 A;  3COA C;  1GHC A;  3OIO A;  3BTI A;  5D5X B;  2ZME C;  1S7A A;  3QP6 A;  1PNK A;  3SYT A;  2LKX A;  5CQE A;  2MLG A;  3J81 Z;  2M7B A;  2CV2 A;  2RDP A;  2CQN A;  1FXV A;  3G6E I;  1WFX A;  1TL8 A;  1I27 A;  2DA1 A;  3GTP J;  3ML6 A;  5M5W J;  1JTY A;  2WYB A;  4KIS A;  1W7P A;  4AIH A;  1SD5 A;  2IA0 A;  2K4B A;  4RGU A;  1RZ4 A;  4I02 A;  2XRL A;  3HYI A;  3CDI A;  4Y52 J;  1ON1 A;  2MH2 A;  1IGN A;  2Y9Z A;  2DMT A;  3GLX A;  2R93 J;  2XF6 A;  4J19 A;  1G6N A;  1SD4 A;  1XDS A;  4IHX A;  3FBN B;  4HYE A;  1MMN A;  2O5R A;  1IO2 A;  5FLX K;  2R3S A;  2JK3 A;  2XAS A;  1WSU A;  2PMH A;  1BI2 A;  2F5C A;  1TWF J;  4LK0 F;  4UVB A;  3J7Y J;  2HVR A;  2AXT C;  1UJ8 A;  2STW A;  1ULY A;  3E97 A;  4U0W A;  2VXD A;  1WJD A;  5GTH C;  1Z3X A;  4QPO A;  3JRG A;  1D5Y A;  2GA2 A;  2Q8K A;  5F0C A;  5KHD A;  1Z3Y A;  3JRH A;  3Q5F A;  5C4X J;  4RM3 A;  1WI3 A;  1EH7 A;  1FT9 A;  4LIT A;  3E5X A;  1BJZ A;  2X4H A;  3LWF A;  1MSF C;  1ZEL A;  3OWT A;  1CGP A;  4N4N B;  2P5K A;  3JRI A;  4BJ6 C;  1J0R A;  4JYK A;  4I98 B;  4OIP F;  3I53 A;  1RC9 A;  3E5U A;  1J59 A;  5FD6 A;  3FKI J;  3AG1 H;  4CCM A;  5BNG A;  4E7Z A;  5CQG A;  4BKX A;  1QVT A;  5KAI C;  1E0E A;  2EFQ A;  1PUE E;  1X4O A;  5E3L A;  3A1Y A;  5IP6 A;  1REP C;  5CPR B;  3DV8 A;  4M6Y A;  1VQ9 I;  1JXS A;  1J7K A;  2RV8 A;  1T39 A;  4IO9 F;  1YW8 A;  2P6S A;  4PK4 A;  4U87 A;  4HX8 A;  1K4S A;  4FE4 A;  1W5S A;  3FGR A;  2X1E A;  3BR6 A;  2NS7 A;  2HXI A;  2LG4 A;  1MIJ A;  4FX4 A;  2BXZ A;  3GTJ J;  3SJM A;  2R7W A;  3SRA A;  4WX9 A;  4HG2 A;  3ABL H;  3W2V A;  1R00 A;  3S8P A;  2G0E A;  4HRI A;  5B1A H;  2JQ7 A;  2BHY A;  3BT9 A;  5IT9 K;  5BS6 A;  4IF4 A;  1MND A;  1X58 A;  4ENN A;  1YJN I;  1MMG A;  1O4X A;  1FBS A;  2H94 A;  4EJW A;  3GTM J;  1NG6 A;  4U88 A;  4V2G A;  3ZQI A;  3DTE A;  4UUV A;  4AD9 A;  3RIR A;  2FQ4 A;  2VBX A;  2IRF G;  2M45 A;  2XB5 A;  4RAG A;  3TDU C;  4HX4 A;  5F1J A;  4LIV A;  3IH4 A;  2ISZ A;  3OYH A;  4BY1 J;  1JKR C;  4B09 A;  1JGS A;  1EH6 A;  1VQ5 I;  1OYY A;  3I58 A;  4E7I A;  2O6G E;  2HPM A;  4KIG A;  1X2M A;  3JR9 A;  3RPU D;  1K79 A;  5DD8 A;  3ECO A;  1DUX C;  1FTZ A;  1ZYR F;  5HVQ C;  3BZC A;  3H35 A;  1JJ8 C;  2AE3 A;  1R1V A;  2WB1 N;  1V55 H;  1WWX A;  2CWE A;  2P7V B;  2EA4 A;  4KA4 A;  2FJ1 A;  3GUD A;  2GAU A;  1BR2 A;  3ZOB A;  1Y56 A;  3BR1 A;  2RKH A;  4P55 A;  4BH9 A;  2ZXI A;  4MO7 A;  1FYM A;  2HTJ A;  3RKW A;  3GTL J;  3C7J A;  2HZD A;  1YHQ I;  2VPR A;  2QBY A;  2X6X A;  3HUG B;  2D45 A;  4PCQ A;  2PG4 A;  3DPU A;  1GXP A;  4BE2 A;  4DBQ A;  4XLE A;  2B9S A;  2J5O A;  2OJE D;  5F0F A;  3WTU C;  2J5P A;  2DDA A;  2XHK A;  3RKY A;  2R5Z B;  1DDN A;  2HS5 A;  3LSI A;  1LDJ A;  1YE9 A;  2PI0 A;  3KX2 A;  2XAG A;  3OY9 A;  2QWW A;  1GKF A;  2V6E A;  2X1D A;  1UB9 A;  1FLI A;  3IH3 A;  3HTU A;  1SAX A;  1N78 A;  4Y3O A;  4M74 A;  1K7A A;  1E3A A;  3CCE I;  3BWG A;  2FMY A;  3K4L A;  2CS3 A;  4E4H A;  2JA6 J;  1T98 A;  4BTH A;  4HW0 A;  2K7L A;  4NHJ A;  5HNF A;  1OFC X;  3HHH A;  4W97 A;  1RR8 C;  2I10 A;  1FNN A;  1F1Z A;  2KDO A;  1ZRD A;  3QYB A;  3C1D A;  1A6Q A;  2NNY A;  4F93 B;  1S3J A;  1WKM A;  1O7L A;  2X0L A;  1DP7 P;  1TWG J;  4BXF A;  4LG0 B;  2CW8 A;  1IV8 A;  5H2F C;  3HRU A;  4GFB A;  1GK1 A;  4QPQ A;  5FFX A;  2F48 A;  2OQG A;  4EV0 A;  1ODD A;  3GZN B;  3OYK A;  2M2E A;  1W36 D;  2L01 A;  3IAS 2;  4RB1 A;  2MC4 A;  2ZME B;  3TO6 A;  4F3Q A;  1E3P A;  3I9V 2;  1HF0 A;  1FOY A;  4A3I J;  1UZC A;  5AIP A;  2A05 A;  1T6S A;  1R22 A;  2OCC H;  5FB2 A;  3AL0 C;  1RET A;  4ETS A;  1AWC A;  3LSH A;  2CQX A;  4UB8 C;  4ENJ A;  3WTZ A;  3JRD A;  2KRC A;  1WGX A;  2HOS A;  4L9T A;  2JA8 J;  2GM4 A;  2XUB A;  3C2G A;  5ICC A;  2F5E A;  4A3E J;  3S3M A;  2QZ8 A;  3ZQG A;  1TZL A;  2AHQ A;  4OOI A;  3EUA A;  3IAM 2;  1D0X A;  1B4A A;  1MGT A;  2O61 A;  3G1M A;  4YFN F;  3I3L A;  4GXO A;  4E7S A;  2CYY A;  2O9L A;  1J9I A;  3DF8 A;  3FXK A;  2W57 A;  4NUB A;  3L2U A;  4LLN A;  2WYE A;  3E6M A;  1MSE C;  1O3Q A;  2V26 A;  3V7R A;  4AVZ A;  2GXB A;  2EIK H;  5AIQ A;  2O7O A;  3F6O A;  3KLO A;  2DOA A;  5KVR A;  1AI5 A;  5H6Q A;  3TMO A;  4BBS J;  3EET A;  4XIC A;  5GAE J;  1TWH J;  4Q4Z F;  3JRB A;  3F21 A;  1BL0 A;  1K6O A;  3GZ5 A;  1SFU A;  2VE8 A;  3K4N A;  2FF4 A;  1HKT A;  1XDU A;  2FRH A;  4MFE A;  3REO A;  2M5W A;  4P9U A;  1NH3 A;  5F6F A;  3RKX A;  2EFO A;  2DO7 A;  2HOA A;  2TCT A;  3FWE A;  2H1K A;  2QKM B;  3JSO A;  5K5R A;  2CG4 A;  5DM6 F;  3VPR A;  1FY7 A;  5J1Y A;  1RNL A;  3SFI A;  2W84 A;  3MKW B;  1B1B A;  3IC7 A;  4I09 A;  3TED A;  1ETX A;  3OYE A;  1TQM A;  2FA5 A;  4A93 J;  3ABK H;  2KJB A;  4A5N A;  1NK2 P;  1QU3 A;  2ZO4 A;  4EQQ A;  1A35 A;  4HPQ A;  4M9Z A;  1A5J A;  2FOW A;  3WE2 A;  3CCR I;  2V1X A;  3BPX A;  1DGW Y;  4O6J A;  1RKT A;  3W6K B;  3S2D J;  4IQJ A;  2TRT A;  2Y0S N;  1FZP B;  3HPH A;  4HV6 A;  2EWN A;  5DUK A;  3BG7 A;  3V7C A;  3BCA A;  4EJO A;  2R7V A;  5FKN A;  4X0G A;  2R5Y B;  3JRC A;  4M3B A;  1WJC A;  5E3N A;  2K3P A;  1OCZ H;  1GUU A;  3DU6 A;  2H1L A;  3J81 K;  2VBW A;  4WK8 F;  4XOT A;  4AUX A;  1WJF A;  1MBG A;  3JTG A;  1U3E M;  2VQC A;  3I64 A;  4XN3 A;  3IKT A;  3FK6 A;  4HF0 A;  1OCR H;  2HDW A;  3IHU A;  1SFK A;  1KGS A;  2JT1 A;  1TW2 A;  2IP2 A;  3IWF A;  1V3F A;  2L02 A;  1APL C;  2HU9 A;  1AA7 A;  3F72 A;  1D1A A;  2NVX J;  3GLL A;  3LA7 A;  3CO6 C;  1R5H A;  4L9N A;  2GWR A;  2IAI A;  4TV7 A;  1ZRC A;  3K69 A;  2FSW A;  4CO8 A;  1O57 A;  2NS0 A;  5J3L A;  1PVE A;  4JBA A;  3G3Z A;  2FNA A;  3LST A;  1YFH A;  2WYD A;  2M0C A;  1E3H A;  4IRI A;  4BAY A;  1OCP A;  3HOV J;  3S1N J;  4BQO A;  2LP0 A;  1FEX A;  3BOQ A;  2DA5 A;  2CW7 A;  4NC7 A;  4A6E A;  5IP7 J;  5L3D A;  1FTT A;  2R5Z A;  2JZY A;  2DOF A;  1FWZ A;  1OR7 C;  5HDG A;  2PJP A;  1R36 A;  4XRF A;  5ILV A;  3HZJ A;  5H6R A;  1U0J A;  2A6H F;  2ZKZ A;  1QHG A;  3I59 B;  2M87 A;  1P4X A;  3ASO H;  3OL4 A;  3Q9V A;  2NOJ B;  1OCT C;  1B72 B;  1YTY A;  3OS1 A;  1TT5 B;  3N05 A;  2LBF B;  1T08 B;  5J8C A;  1VQ4 I;  3HOU J;  2QEX I;  1FOW A;  1QZY A;  2UV1 A;  3HKZ N;  4AIJ A;  1X3Z B;  2ZJ2 A;  4ENM A;  1O7F A;  3MWM A;  1MJB A;  3NWS A;  3SHF A;  1UAA A;  1Z7U A;  3I54 A;  4A3M J;  2FML A;  5LBQ A;  4CGZ A;  3PUB A;  1NTC A;  5EGO A;  5BPD A;  1HSJ A;  3BJO A;  4KN4 X;  2W24 A;  4BEH A;  3A0H C;  2NOG A;  4EM0 B;  4B4C A;  1FP1 D;  3A0B C;  3U2R A;  1S6L A;  2D2W A;  5HLI A;  3BZK A;  4EMS A;  1GV5 A;  2P4W A;  2PQ8 A;  3BTL A;  4BXU A;  3SDG A;  5IT3 A;  5K7Z A;  2DJN A;  3KP4 A;  2P8T A;  2KFD A;  1W7P B;  3F8F A;  4P1W A;  4XM3 A;  5F27 A;  1YJW I;  5FRN A;  2DK5 A;  2DPU A;  3I4M J;  4IL6 C;  2ZSI B;  2ZC2 A;  4FCY A;  2EK5 A;  4U7D A;  2XAQ A;  4XON A;  2ZBK A;  2TDX A;  2ZXW H;  5GP9 A;  2P0W A;  4BUP A;  2VC0 A;  3BG5 A;  4S05 A;  3GFL A;  3PNV A;  2VON A;  1HCR A;  2EFN A;  2VJ5 A;  1UG2 A;  4E7K A;  3T1B A;  2BEO A;  4XBF A;  4QTR A;  2NVT J;  2QQA A;  4RB2 C;  3K0L A;  5M5Y J;  3R60 A;  1KYW A;  1QA6 A;  3S17 J;  2XC7 A;  1G3S A;  1IDZ A;  2E1O A;  3LFU A;  4IJA A;  4M1J A;  2ADU A;  4IEJ A;  1GM9 A;  2Z16 A;  5J4V A;  3D5L A;  1BR1 A;  2R7U A;  3WGG A;  2HXO A;  4CIC A;  1IF1 A;  4HDU A;  2N8G A;  1UHS A;  4WXD A;  4UNO A;  1UCR A;  2BZT A;  2L7Z A;  2ESN A;  2LH9 A;  2E2I J;  3AL0 B;  3K3W A;  3CJR B;  2Y2Z A;  1OYW A;  3L7W A;  1RUO A;  2HDD A;  3Q3S A;  3CTA A;  5DYM A;  5JLX A;  2EZI A;  2F5V A;  2Q2E A;  3FMS A;  4PSW A;  4GDF A;  2CJJ A;  4J01 A;  3PQK A;  3H5A A;  1TNS A;  3BDD A;  4ZYG A;  1RRJ A;  1D5V A;  5L3C A;  3GFM A;  3DWL E;  2EJR A;  2STT A;  3LAP A;  4BBR J;  2DFE A;  1MJ9 A;  4XKV A;  1A04 A;  3K1M A;  4P9F A;  1K4T A;  3WE3 A;  3CMY A;  4KMF A;  1BIA A;  3ULQ B;  1U78 A;  1X3W B;  3S93 A;  1IN7 A;  4A3L J;  3LSK A;  3QWL A;  4XKW A;  1GM7 A;  3K70 D;  4A3K J;  1BBY A;  2L4A A;  3IL2 A;  2Q1Z B;  4ZH4 F;  3TDZ C;  4YF9 A;  2QSF X;  2CFO A;  2XRN A;  1UST A;  3MVP A;  3ISP A;  1BM9 A;  2DW4 A;  4JQF A;  4M73 A;  3RZD J;  4EJT A;  3M1E A;  5E17 F;  4HNU A;  5EDN A;  2HTS A;  2JRT A;  1TLH B;  3G71 I;  1OYI A;  1ENH A;  2BVL A;  3DLA A;  2EFW A;  1EF4 A;  4R79 A;  1C0W A;  1F43 A;  4ESJ A;  2X1C A;  1LVA A;  3ZMZ A;  1I50 J;  2M4K A;  4OMZ A;  2VQH A;  3HSE A;  5F64 A;  3KE2 A;  2LRD A;  4RLQ A;  3TQN A;  3OYJ A;  2ECC A;  3S8R A;  3RKQ A;  2HVQ A;  2KT0 A;  1JJ6 C;  1Y8Q B;  2YR2 A;  5FGM A;  3FDY A;  2PJR A;  1T95 A;  1BJA A;  4BJT A;  3VOE A;  1SFO J;  4BDZ A;  2R7F A;  2K86 A;  4UXN A;  2CFX A;  3W2A A;  1GT0 C;  1V54 H;  2WAF A;  2E1M C;  3CJT B;  2R4G A;  1XGM A;  3Q0V A;  4JX6 A;  1SEU A;  1IW7 F;  2IT0 A;  3JSP A;  2FEZ A;  3CUQ C;  2CH0 A;  3IH2 A;  3P9K A;  1AI4 A;  4G9Y A;  2DTR A;  1VQP I;  1G2H A;  1FIP A;  4D7N A;  2XAU A;  3L2Q A;  2W4S A;  3J80 Z;  2NXN B;  4JX5 A;  2VXZ A;  3PFY A;  2LNB A;  3BY6 A;  4ASN A;  1OR0 A;  5GAG J;  1CQT A;  2Z33 A;  4KYW A;  1KON A;  3LOC A;  2IVM A;  3R4K A;  1ZGW A;  2O8X A;  1LDD A;  2K9S A;  2DFI A;  1X1P A;  2DU9 A;  1FM2 A;  3B6C A;  1GM8 A;  2QBY B;  5IYD J;  3SRC A;  1WPK A;  3F8N A;  2PFB A;  3QU6 A;  4MFD A;  2IJL A;  5J47 A;  4C2U A;  2R7O A;  4BYY A;  3PIP F;  5HS9 A;  2F4I A;  4GGG A;  2E35 A;  3KEY A;  4C3J J;  5JR3 A;  3K4C A;  2XF7 A;  3FXQ A;  4HDV A;  2JA2 A;  5FKK A;  1B72 A;  3D5R C;  5TGT A;  2LBF A;  2Z3Y A;  2WC2 A;  4H0E A;  3BJA A;  5LRR A;  2VB6 A;  1S9H A;  1R23 A;  4XSZ F;  3LSM A;  2W25 A;  1LFB A;  1CP9 A;  5CVU A;  2DXI A;  3CDH A;  2M9H A;  3O3K A;  3IKV A;  1LNW A;  3L2R A;  1BC8 C;  1KYZ A;  2DJI A;  2ECB A;  2JSC A;  3OS0 A;  2GA1 A;  2VKH A;  4AWX B;  1ZRF A;  1S7E A;  3UR3 C;  4M3F A;  5B66 C;  3OYF A;  3F8M A;  3V4G A;  2QA4 I;  3TW7 A;  3CC2 I;  2X85 A;  3HJE A;  3L09 A;  3PO3 J;  4ZDO A;  3PSF A;  2HWV A;  4A0X A;  2ZJR F;  1GV2 A;  4OIQ F;  1E2X A;  1IN4 A;  1FSH A;  2E36 A;  2DMU A;  4IVN A;  4B8X A;  3MKL A;  4LD5 A;  3ERE D;  4E7H A;  5C4J J;  1ON2 A;  3B73 A;  4PFO A;  1RES A;  4PEL A;  4IRG A;  3QAH A;  3QRF F;  1Z9C A;  3L2C A;  1LQ1 A;  1XGO A;  1Z05 A;  2K02 A;  2QKL B;  3JRF A;  3PL8 A;  3W2W A;  4QIW N;  5DV5 A;  3CLO A;  3T5X A;  5DCM A;  4CCO A;  2HQR A;  3I55 I;  4AYB N;  3PNY A;  4KJZ A;  3KEO A;  3T0Y A;  3F6V A;  4L0Z B;  3ZP5 A;  4E57 A;  3IWZ A;  4XMY A;  3OYM A;  2HI3 A;  2DAO A;  3MN2 A;  4V19 K;  2RRE A;  4D0P A;  1NK3 P;  3M7G A;  3SEZ A;  2OZU A;  4BHC A;  5IYC J;  4L9J A;  4NDL A;  1GK0 A;  4BXX J;  3KYD B;  1LDK B;  1ORK A;  1XCB A;  2GOX B;  3O8H A;  4L5E A;  2QCO A;  4A3F J;  1R7J A;  2K9Q A;  5KNL A;  5JI6 A;  3HGY A;  1VQ6 I;  4ANJ A;  4DYQ A;  1R1T A;  1Y1V J;  2NAZ A;  2V9K A;  1X1C A;  1IC8 A;  4IOC F;  2LSO A;  2DK8 A;  2XPU A;  1W4M A;  1D0Z A;  1EH8 A;  3DPT A;  1K6Y A;  4FQG A;  4F91 B;  2KZV A;  2L7K A;  1QGP A;  2LC2 A;  3OIQ A;  2V1N A;  2G7U A;  4G6Q A;  1JX9 A;  2PBI A;  5J1U A;  4YFA A;  4KDP A;  4HF2 A;  2DN0 A;  3FXR A;  1QO0 D;  4O3M A;  4LLL A;  1CF7 A;  3DU5 A;  4LK1 F;  3VB2 A;  4FTH A;  2XKP A;  2ZNZ A;  3CME I;  1DU0 A;  3FGT A;  2F5F A;  2FU4 A;  4EGY A;  4BE1 A;  2QQB A;  5C44 J;  3E6C C;  1RIO H;  2HVS A;  3HDD A;  1OLT A;  1ZAR A;  5E79 C;  2LVS A;  4Q48 A;  2FBH A;  3G4S I;  1IUF A;  3BG9 A;  1JHF A;  3CCQ I;  1LE8 B;  3GW2 A;  3DLL F;  3GTO J;  3CP8 A;  1A6I A;  1AI7 A;  4XOR A;  2R7X A;  4JOM A;  1XGN A;  2EH3 A;  4LGW A;  3GFI A;  2HGC A;  2K9L A;  2ZXJ A;  3BPV A;  4A0Y A;  3OMY A;  1MBJ A;  2PX9 A;  3PUF A;  3FKJ A;  1OJL A;  3WTW C;  1H89 C;  3U21 A;  4C3H J;  3OYC A;  3I4N J;  4PGH A;  1H9G A;  2ELH A;  1U6G A;  1HKS A;  1TT0 A;  3ZN1 A;  1S29 A;  1PP8 F;  3WHB A;  4Y4R A;  2ISY A;  4XNF A;  1Y39 A;  2EIL H;  3RZO J;  3A01 A;  3MFK A;  5JVG F;  5L3G A;  2D1V A;  3ZCO A;  4NB5 A;  3M07 A;  4KIC A;  4XRM A;  5EF6 A;  2LTP A;  1PUF A;  1VQ7 I;  3I71 A;  2VKV A;  4O5V A;  2WB1 A;  2YX4 A;  2YPR A;  2GZW A;  2JA7 J;  2RGV A;  3FXJ A;  1Z6R A;  4NBQ A;  1YQA A;  4AU7 A;  2I5U A;  2MAB A;  3HG9 A;  2E1M B;  2MGQ A;  1YS6 A;  2YU3 A;  3VYU B;  3J7Z I;  1PDN C;  2I8D A;  2XAH A;  4XLN F;  3GBG A;  1JKP C;  2VIX A;  3CUQ B;  1IN5 A;  3CCU I;  2IS6 A;  2CQK A;  3O8G A;  4NNJ A;  2A3S A;  3FXM A;  4DZJ A;  1ZQ3 P;  1TBX A;  1T2K A;  2C6Y A;  3AKZ A;  2MW8 A;  5JFR A;  3CO7 C;  2ZCW A;  3CLQ A;  4I76 A;  2HOE A;  1W5C C;  4GYG A;  4ESB A;  1XSD A;  2XGD A;  1YX3 A;  4XLP F;  1SFE A;  4K2G A;  5FJ8 J;  4L9V A;  1XC5 A;  4AVP A;  3OR2 C;  2LFB A;  5J6X A;  4J00 A;  1IAW A;  3KZI C;  2XVC A;  1D8K A;  3BR2 A;  4N4O B;  4E55 A;  1QQI A;  3DQV C;  1GVD A;  1AJQ A;  2WAE A;  1OR7 A;  3RJP A;  4XQF A;  3WU2 C;  3I5U A;  3LNQ A;  1EA3 A;  3WHC A;  1U8R A;  1D0Y A;  5F04 A;  4B43 A;  4S04 A;  1Z1D A;  1ZLK A;  5AON A;  3LA3 A;  3CJN A;  3GEZ A;  3S3N A;  3ELK A;  3ZMD A;  4UUS A;  2QUF A;  4PJM A;  5EGO B;  1YO5 C;  4BEH B;  1HW5 A;  3E0J B;  1ZG3 A;  1ETO A;  3ZMT A;  3PM1 A;  2FE3 A;  3M8E A;  1XGS A;  4I7H A;  4RGR A;  3HOY J;  3A4C A;  3GVA A;  1YYV A;  4CDG A;  3EDP A;  1UHM A;  2H6B A;  1IN6 A;  2Z5U A;  2EB7 A;  4M3E A;  1ETV A;  1FP2 A;  2UXN A;  4C30 A;  2OU2 A;  4Q5S F;  2QGU A;  1TWA J;  3HRS A;  2VLA A; 
#chains in the Genus database with same CATH homology
 2W00 A;  4DGW B;  3ZGK A;  4DJA A;  4F52 A;  3TBI A;  4HEA 2;  1U0J A;  4WKU A;  3ZQQ A;  1QHG A;  3OL4 A;  4CUG A;  3LSG A;  2Z1D A;  4PJN A;  2NOJ B;  3NWT A;  4KIT B;  4IX7 A;  4YEJ A;  1FXH A;  3OS1 A;  3N05 A;  2LBF B;  4PJJ A;  2WA0 A;  4II3 A;  3SDB A;  2UV1 A;  4BU2 A;  1GLN A;  3MD2 A;  1WJB A;  3NWS A;  4XLC A;  1UAA A;  4BGD A;  4PEM A;  4IQ4 A;  3VYT B;  3PUB A;  3L91 A;  5JHF A;  3ONQ A;  3L2V A;  3CJQ B;  3K4J A;  1BOB A;  3HXL A;  2Z2S B;  2XSJ C;  5LFA A;  4OAY A;  3IUO A;  4BEH A;  2BW3 A;  2LOO A;  2OC6 A;  4FAS D;  3VYS B;  4HST A;  2Q2E B;  4E6K G;  1LVK A;  2UUZ A;  3SRB A;  5HLT A;  2A5W A;  4F92 B;  2MYS A;  2WY7 Q;  4YEL A;  2PMZ A;  4ITV A;  4P1W A;  5HOO A;  3MKY B;  5FRN A;  3CZ6 A;  4XM3 A;  1MNE A;  1AJN A;  1X1A A;  5FRO A;  2CV1 A;  2ZSI B;  3S32 A;  1V5E A;  3DTK A;  4RMN A;  2GOM A;  4XON A;  3H9J A;  3W3C A;  2CV0 A;  3HOS A;  2WY8 Q;  2P0W A;  4BUP A;  3E1S A;  3PNV A;  2VJ5 A;  4E7K A;  4C9Y A;  1J09 A;  2ZFU A;  1N77 A;  2XC7 A;  1Z21 A;  3LFU A;  3SZG A;  4M1J A;  1GM9 A;  2Z16 A;  4BE0 A;  4BL0 B;  3D5L A;  1BR1 A;  4PSX A;  2R7U A;  4ZTJ A;  2F6C A;  4E7J A;  3H5N A;  2LH9 A;  3AL0 B;  3PNT A;  3DPL C;  3K4B A;  2KHM A;  3K4K A;  4CH7 A;  2VPL A;  3LL7 A;  3K3W A;  3CJR B;  1PNK A;  3SYT A;  1G59 A;  2CUJ A;  2R7S A;  1V5G A;  5CQE A;  2W1O A;  3DTI A;  2M4G A;  2M7B A;  3K70 C;  2CV2 A;  3LMM A;  2Y0S A;  1FXV A;  2F5V A;  4PSW A;  3JTQ A;  1WFX A;  3BLY A;  4F55 A;  1T0F C;  4J01 A;  4YRV A;  3H5A A;  4DIQ A;  1Y6I A;  4B47 A;  3A2K A;  2WYB A;  4KIS A;  2PJR B;  3DWL E;  4B48 A;  2M3A A;  4BS9 A;  1AJP A;  1JW0 A;  4XKV A;  3J7A Y;  2XF6 A;  2AE5 A;  3MMY B;  3S93 A;  2OUM A;  3FBN B;  2MFZ A;  3C2H A;  1MMN A;  3LSK A;  4XKW A;  2O5R A;  3K70 D;  2VKD A;  4BDY A;  1GM7 A;  1K5Q A;  4HSR A;  2Q1Z B;  4YF9 A;  2ADV A;  2CFO A;  2JSP A;  2RQQ A;  3EPZ A;  3RCO A;  2HVR A;  4CCN A;  4JQF A;  2VXD A;  3UNG C;  1WJD A;  4HNU A;  1Z3X A;  4QPO A;  1MMD A;  5KHD A;  1Z3Y A;  3K6G A;  2OV7 A;  2BVL A;  3DLA A;  4RM3 A;  4R79 A;  3VSK A;  4LIT A;  1PYV A;  4CCK A;  3H0D A;  3V42 A;  1GHD A;  2X1C A;  1ZEL A;  3OWT A;  2M4K A;  4N4N B;  4XLF A;  2VQH A;  5KCM A;  4BJ6 C;  1N75 A;  2LRD A;  4E56 A;  4RLQ A;  4ZJZ A;  3OYJ A;  4PFP A;  1K5S A;  3S8R A;  2HNH A;  2HVQ A;  4CCM A;  2IXS A;  4E7Z A;  5CKT A;  3JTR A;  5CQG A;  3FDY A;  2PJR A;  1T95 A;  4BJT A;  3OIP A;  4BDZ A;  4WKV A;  3OS2 A;  4D1Q A;  1E0E A;  1PNL A;  1X4O A;  3W2A A;  3A1Y A;  2WAF A;  5CPR B;  4XL9 A;  2JUG A;  2E1M C;  2R4G A;  2DT7 B;  3DKX A;  4U7B A;  2CH0 A;  1AI4 A;  3F9K A;  4PK4 A;  4U87 A;  1KEH A;  3HKZ A;  2XAU A;  3L2Q A;  2W4S A;  3EUK L;  2X1E A;  4ZDP A;  2VXZ A;  3CES A;  3PFY A;  2LG4 A;  4EAT A;  4LIU A;  1OR0 A;  2X51 A;  3SRA A;  2R7W A;  4YFB A;  1KON A;  4HG2 A;  3W2V A;  3CMM A;  4MLO A;  3S8P A;  4HRI A;  2V4J C;  4RM2 A;  2X6W A;  2ZXH A;  3OOU A;  4P5O A;  1FM2 A;  4RLF A;  1GM8 A;  2KL4 A;  1MND A;  2RNG A;  4C2T A;  2WYC A;  2M0M A;  4G6T B;  3SRC A;  1MMG A;  3OYD A;  3K10 A;  4C2U A;  2WBM A;  2R7O A;  1IRX A;  1NG6 A;  2F4I A;  3ML0 A;  1BR4 A;  3KEY A;  4D9J A;  3K4C A;  2XF7 A;  3DTE A;  3EUH C;  2JA2 A;  1X19 A;  3D5R C;  5TGT A;  3L2W A;  4K2F A;  4LIV A;  4DOZ A;  2LBF A;  4BQN A;  2K9M A;  4DBR A;  3OYH A;  1QHH D;  1S9H A;  2VB6 A;  2CMP A;  4BJ5 C;  3LSM A;  4E7I A;  2HPM A;  3BC8 A;  1CP9 A;  3RPU D;  2DXI A;  5HVQ C;  4PJL A;  3H35 A;  1SAU A;  4ZC3 A;  4OAZ A;  2AE3 A;  3L2R A;  2IGM A;  2L9S A;  3QOD A;  4Y33 A;  2DJI A;  2KLO A;  3OS0 A;  2A6T A;  2KMU A;  2VKH A;  4E7L A;  2KP6 A;  1BR2 A;  2IGN A;  4LG3 A;  1K7D A;  3UR3 C;  1Y56 A;  3OYF A;  2ZXI A;  3OYA A;  2VJI A;  1D1C A;  1FMV A;  2W82 A;  2L2O A;  2HZD A;  2X85 A;  2X6X A;  1FMW A;  4XLH A;  3HUG B;  3RTR A;  3PSI A;  4ZDO A;  1PJR A;  3OR1 C;  3PSF A;  3DPU A;  1NG7 A;  2VQG A;  1G8X A;  4XLA A;  4DBQ A;  4XLE A;  4BE2 A;  1LKX A;  2HPI A;  3CF2 A;  1P9Q C;  4B44 A;  4IZZ A;  1UG0 A;  4E7H A;  4XR6 A;  3LSI A;  1YE9 A;  1X1D A;  3KX2 A;  3OY9 A;  1GKF A;  4PFO A;  2V6E A;  4PEL A;  2X1D A;  2R7Q A;  3H9G A;  1N78 A;  4Y3O A;  2QKL B;  1E3A A;  3K4L A;  2CS3 A;  3PL8 A;  3W2W A;  4E4H A;  4BTH A;  5HNF A;  4CCO A;  2IS4 A;  3OL3 A;  3PNY A;  4KJZ A;  5FRM A;  4WKS A;  1VZ0 A;  3ZR8 X;  3AFH A;  1W36 C;  4E57 A;  2KDO A;  1WJA A;  3QYB A;  4XMY A;  2LYC A;  3OYM A;  3VYR B;  2JVG A;  2M7A A;  3KYL A;  2HQA A;  3SEQ A;  4F93 B;  2RRE A;  4CCL A;  3OYG A;  2K5C A;  2LY2 A;  3BCB A;  3SEZ A;  3L94 A;  3QOE A;  2VQL A;  4BXF A;  3H9Q A;  2VL8 A;  2CW8 A;  2VJJ A;  3HPG A;  3M8J A;  1V5F A;  1GK0 A;  1GK1 A;  1YX5 A;  4QPQ A;  1LDK B;  1ERD A;  2GOX B;  3OYK A;  2W7N A;  1W36 D;  2ELJ A;  5KNL A;  1R6R A;  3IAS 2;  2R7R A;  2MC4 A;  4ANJ A;  3OYB A;  2IS2 A;  4F3Q A;  2V9K A;  1X1C A;  3I9V 2;  3ZXS A;  3AL0 C;  1D0Z A;  3LSH A;  3DPT A;  1K6Y A;  4F91 B;  2KZV A;  2L7K A;  2KRC A;  3VSL A;  2LC2 A;  3OIQ A;  2V1N A;  2BOL A;  4CSW A;  3C2G A;  2KQR A;  3S3M A;  1JX9 A;  2E5Z A;  4YFA A;  1TZL A;  3EUA A;  3IAM 2;  3ZRG A;  1D0X A;  4CA0 A;  1MW7 A;  3I3L A;  3DU5 A;  4E7S A;  4BE1 A;  2CUZ A;  2KRH A;  4NUB A;  3OYN A;  3L2U A;  3VDX A;  2HVS A;  3HL2 A;  2WYE A;  2L5Q A;  1OLT A;  2V26 A;  4AVZ A;  3DKY A;  3RSN A;  3QYE A;  4HNT A;  2DOA A;  1AI5 A;  3TMO A;  2FUG 2;  3CP8 A;  1AI7 A;  4NC8 A;  4XOR A;  3HC7 A;  2R7X A;  4JOM A;  3K4N A;  2K9L A;  2IGO A;  2XDV A;  1X1B A;  4OWR B;  2L9N A;  3OMY A;  3BG6 A;  2DCE A;  3VWB A;  3OYI A;  2IS1 A;  4BQQ A;  3MKZ A;  2QKM B;  1JVZ A;  3FKJ A;  4FET A;  3U21 A;  3OYC A;  2X6Y A;  3IP4 B;  2UWM A;  1TT0 A;  3G2B A;  3M1C A;  2KPM A;  4XNF A;  4Y4R A;  2XF5 A;  3MKW B;  2E5N A;  2VAS A;  3ZCO A;  3OYE A;  3OYL A;  1WJ5 A;  1DQU A;  2WB1 A;  2AE4 A;  1Z7L A;  1QU3 A;  2DT6 A;  4ZYA A;  5HNH A;  4AU7 A;  2MAB A;  4HPQ A;  3HG9 A;  2E1M B;  3K4M A;  4KT6 A;  4GRI A;  2JVH A;  3VYU B;  1PNM A;  1JI8 A;  2I8D A;  1DGW Y;  3GBG A;  2VIX A;  4IQJ A;  2WAQ A;  2IS6 A;  4NNJ A;  3FBI B;  3HPH A;  1AI6 A;  3AKZ A;  3S3O A;  3BG7 A;  3BCA A;  3FHN A;  2R7V A;  4X0G A;  3DEE A;  4NQW B;  1UEL B;  1X4P A;  1YX3 A;  1WJC A;  2R7T A;  4K2G A;  2IGK A;  2LRE A;  2K3P A;  4WKT A;  3DU6 A;  3OR2 C;  4XOP A;  4J00 A;  4XOT A;  1D1B A;  3PJR A;  1KEC A;  1WJF A;  4N4O B;  5LD2 C;  2VQC A;  2ZSH B;  4XN3 A;  4E55 A;  4II2 A;  4BAC A;  2HDW A;  3DQV C;  4CCJ A;  1HA8 A;  1SFK A;  3H5R A;  4XN0 A;  1AJQ A;  2WAE A;  4XQF A;  2VJ4 A;  4H4K C;  1EA3 A;  3TL4 X;  2HU9 A;  1AA7 A;  1D0Y A;  1D1A A;  3CP2 A;  4B43 A;  4AYB A;  2BVM A;  2AQE A;  1H2G A;  2V7F A;  3S3N A;  4ZTF A;  4IKF A;  4PUS A;  4CZC A;  1GK9 A;  4PJM A;  1WJE A;  4BEH B;  2BW3 B;  3E0J B;  2WAD A;  3HOT A;  3QYF A;  2AQF A;  1DGR M;  3A4C A;  4XKC A;  2WYD A;  1LFP A;  1MMA A;  4ZDL A;  4XKB A;  4B3X A;  2LY1 A;  3D5S C;  3RQ4 A;  4BQO A;  4C30 A;  2MD0 A;  4NC7 A;  2CW7 A;  1DP3 A;  2E60 A;  1OR7 C;  2VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...