4HSTA

Crystal structure of a double mutant of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hstA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hstA01
1GM8A 4BTHA 1AI7A 1GK0A 2AE4A 3K3WA 4K2GA 1FXHA 1OR0A 4WKTA 4WKSA 1H2GA 1AJNA 1K5QA 4WKVA 1PNMA 3S8RA 3SRBA 1AI6A 1AI5A 4E56A 1KEHA 1FM2A 2WYDA 4E55A 3SRCA 3JTQA 1AJPA 1PNLA 2AE3A 2WYEA 3L94A 1K7DA 3ML0A 4YFBA 3SRAA 2WYCA 1AI4A 1PNKA 1GM7A 2ADVA 4YF9A 4E57A 4HSTA 3L91A 4PEMA 4HSRA 4PELA 1GK1A 1CP9A 1JX9A 1GK9A 2AE5A 1AJQA 1GHDA 4WKUA 1KECA 2WYBA 1GKFA 1JW0A 4M1JA 3JTRA 1FXVA 4K2FA 4YFAA 1GM9A 1JVZA 1E3AA 1K5SA
chains in the Genus database with same CATH superfamily
5IT9K 3FM5A 2CQ7A 3BLYA 3CO7C 1WJ5A 2OZUA 4LFUA 4OWRB 3SRBA 3HOZJ 4A6EA 3S93A 2OUMA 3EUHC 4NUBA 4MHGA 3WE2A 2P5LC 4Y3OA 3CD6I 3CJQB 1BW6A 1U5TC 4D5FA 3CP2A 3JW4A 4F7ZA 4A3EJ 1X4PA 5J40A 2NNYA 3ABKH 1OCRH 4BEHB 1Y8QB 3BTIA 2D1VA 2N8GA 1YS6A 1G59A 4BJ6C 3NAUA 1QU3A 3A0HC 3WTXC 3I53A 3ERED 2W25A 1G3YA 2VODA 2VBZA 2HXOA 3CCQI 3BG6A 5EZHA 3MVPA 3G1LA 4NC6A 5F1RA 1U2WA 1YQAA 3SHFA 5DD8A 2X85A 2D45A 1AKHA 3ECHA 1OCZH 4YIRX 5HLIA 3IV5A 2EFOA 1ITYA 4CICA 5FKKA 1RKWA 1T56A 2XAFA 1PUEE 1ORKA 2FQ4A 2XF5A 1D5VA 3OOUA 2BYVE 3ZN1A 2CW8A 5CKTA 1R1TA 2K02A 3G3ZA 2IS2A 3A1YA 4RLQA 2LDUA 5M3FJ 4E7ZA 2FMLA 2VB6A 3LSHA 4XLNF 2PJRB 2L9SA 3IKVA 4B44A 4EV0A 2KISA 3OMYA 1UAAA 2ISZA 2EIJH 3MD2A 2LF7A 1P4WA 2H27A 2HR3A 3BTCA 2X1CA 3W6VA 1X1PA 1T6SA 1AWCA 1TQIA 4KN4X 4RGRA 1HSTA 2F6CA 2R92J 4RB3C 4RAYA 3RQIA 3WTZA 3N97A 1IJWC 4AIJA 2PMUA 5F0CA 5FRMA 5L3CA 3JAMK 1PP8F 5CQEA 1O4XA 4YF9A 1R1UA 1N75A 2HPIA 1S9HA 5IY5H 4OAZA 2HEOA 3W2AA 1LNWA 4EJWA 3T8TA 2ETHA 2BOLA 2MC3A 1VQ6I 1ZG3A 4JOMA 3QAHA 3F8BA 3ZMUA 3OYLA 1STZA 2DJIA 2DOFA 3WU0A 4BXXJ 2A61A 1QVUA 2FXAA 3PIPF 1FX7A 4GXOA 1IXCA 4IO9F 2V6EA 3K2ZA 2L01A 1TP4A 4DYRA 2HDWA 2XAGA 3EUHA 3MZYA 1BA5A 2HQAA 4AYBN 1U5TA 3AL0B 3PFIA 1YX5A 4M74A 2CV2A 4HOBA 1SFUA 4KMFA 1P9QC 2LC2A 1W5SA 2P5VA 3D5LA 5H6RA 5ICFA 3ZN0A 1R71A 4P1WA 2HOTA 3AKZA 2LMDA 4C3HJ 2DFEA 2CUZA 5JLXA 4BXFA 1ZTRA 3L2QA 1VQ5I 4CDGA 1REPC 3BR6A 4XLAA 1FMWA 2CW0F 3P9IA 1WH5A 5DYMA 1MMDA 4XLPF 3BOQA 2M34A 2EIMH 2LD5A 1FY7A 4C3JJ 5ED4A 2CV1A 2VKDA 1JUPA 4UNOA 3T0YA 3SZGA 1IC8A 1LFPA 3MKZA 5A2QZ 4EJTA 4RAGA 5KVRA 1KQ0A 4XN3A 4C2UA 2A6TA 2VASA 1JW0A 1KU9A 1X1BA 1HLVA 3R0AA 1MZBA 1PYVA 1XMAA 3BC8A 4WXDA 1FYLA 4K2GA 3VFZA 1U8RA 1AKHB 1K5QA 2F4MB 1TT0A 3K7AJ 3MMYB 2X48A 4YFXF 2QVOA 1TNSA 3WTSC 3K1NA 2MG4A 3IAS2 2FU4A 2AO9A 3B6CA 5E3NA 2BXZA 5EYRA 4ZYDA 4BACA 2JA6J 3DEEA 4C2MJ 2EA2A 3CZ6A 5HLTA 4LMYA 3JSOA 1HDPA 4PGHA 1NHAA 4HEA2 1NG7A 5AONA 2OF7A 4EGYA 3LAJA 2LR8A 3RKWA 1ZARA 1SD7A 1G3SA 3K4JA 2DA2A 5CYVA 1V5GA 4EATA 3IAM2 5DUKA 4HAMA 3F21A 1ERDA 1ZAOA 1AJPA 4OMZA 1YJ9I 3V8KA 5FLXZ 2FF4A 5CQGA 1WI9A 1EJ9A 2ZSHB 3F23A 4ENKA 1JUMA 2PMHA 3L2RA 5LRSA 3EYYA 3RQ4A 2KT0A 2L4AA 2GM4A 1DP3A 1LFBA 2L3DA 2AE4A 1KGSA 2L9RA 4ZYEA 3VWBA 4D5CA 4NDLA 1OR7C 2DA6A 3PFYA 2DA7A 3P5JA 2FOKA 2OC6A 2Z99A 5J6XA 1L3LA 2HVSA 4E7LA 5FKOA 2BE5F 2PI0A 3KEOA 2DYRH 2EZLA 1N77A 2G9WA 3HKZN 1E3AA 3K9TA 5J4VA 1P2FA 4M6VA 5J8CA 1JHHA 3BZKA 4BBSJ 1U5TB 2GOMA 1T8IA 1K7AA 2HOSA 4KIGA 1W7PA 4B47A 4J00A 4E7JA 4IKFA 2R7DA 1WQ2A 2FQ3A 1PNLA 2Q8KA 4I99C 2OQRA 4M71A 2WAFA 1NK2P 2CQNA 3FBIB 4PEMA 2FNAA 2XGCA 1FOXA 1RC9A 4O6JA 2MC4A 4HW0A 1YE9A 2KFDA 1OQYA 3EPZA 1QZZA 1KYZA 3BCAA 1Z67A 3ZQIA 4KUMA 1R23A 2K40A 2DO7A 2UV1A 1I27A 4HQEA 1NH3A 1DP7P 4E7IA 2EWNA 2NS8A 1UHSA 4BHBA 3GXOA 4OU0A 2KDZA 3S3OA 3HOXJ 1ETVA 2MD0A 2ZNYA 3WHBA 1MD0A 1JGSA 2HZTA 5FD6A 4LK1F 5IYCJ 1A5JA 2ID3A 2NOJB 3RCOA 4BXUA 3CCEI 4HX4A 4ENJA 3OL4A 3BZ6A 2KLOA 5KHDA 3L09A 3COAC 1H9TA 2VOPA 1JGGA 1ZH5A 4M3EA 1ZKGA 3B02A 1ZN2A 2GWRA 1I5ZA 1WJDA 2VKHA 2RN7A 1HW5A 1T95A 2YUSA 1SANA 1M1EB 2XGEA 3QOPA 2DMNA 4ZYHA 4NB5A 5DTDA 1E17A 1SAXA 2Y0SA 1BI1A 4RGXA 2LF8A 4UY8I 3GTMJ 4HDVA 2AE3A 2WYEA 4XICA 2FSWA 3QODA 2BBYA 3ECOA 3I58A 4F55A 2CFOA 1BIAA 2EA4A 1ZG5A 3LSKA 2E5NA 3JRIA 2RVCA 2H1LA 2DI3A 3H5RA 3Q9SA 5TRDA 4B3XA 1H0MA 2EINH 2EFNA 2X1DA 4BQAA 9ANTA 1PP7U 1Z0XA 1ZHFA 3HOYJ 4WKSA 3LSRA 4ZYGA 3AG2H 1X3WB 2NVQJ 3ZCOA 3PNYA 4KMUX 4BWCA 1ZG1A 2NVYJ 5L3BA 2JVHA 4OMYA 1T2KA 1OR7A 2Y0MA 4AIKA 1T38A 1H89C 3FF5A 4ETSA 1NTCA 3CUOA 2QKLB 4PSXA 1FIAA 2X6XA 2KKOA 3ML6A 2H1KA 5IP7J 2LBFA 1OCTC 3BT9A 4BH9A 5BMZA 1HKTA 5LFAA 2WAEA 4KT6A 4Q47A 3I9V2 2NYXA 1ZR2A 3MWMA 3ZQHA 3KEYA 3OV8A 1FOKA 1H2GA 1Y0NA 3GWZA 4B3AA 5D8KB 1VQPI 3I3LA 4MQ9F 2ZNZA 1T33A 1XPXA 3T8RA 4UUVA 2XPVA 3LSPA 3E6CC 3ABUA 1OYWA 3DWLE 3TW7A 3K1MA 1Y0UA 3HPGA 4PCQA 3SRAA 4Q48A 4D0PA 3HRTA 1D1AA 3M3YJ 1GV5A 1MKMA 1GM9A 2HDDA 2QQ8A 1YG2A 4E7HA 2BY3A 1UG2A 4IOCF 2BXYA 2LKSA 4MEYF 1W7PB 4I76A 3H3UA 1ZLKA 2HQ5A 2CV0A 2E1CA 5KAIC 2Z5UA 3BQYA 2W4SA 4BTHA 2NS0A 3QOEA 2ELHA 1RR8C 4E7KA 4L5EA 1B72A 1VQNI 1P7JA 3FWEA 5HOOA 1QZYA 2Z3YA 3HOUJ 4LG3A 3FK7A 1JKQC 3S1QJ 2JRTA 2DMUA 2HGCA 3V42A 2HTJA 2K3FA 3MAJA 3R4KA 3VODA 4PGGA 3PSIA 3CQZJ 5IP9J 2CGPA 2KZGA 2O0YA 2V79A 5FKMA 3KLNA 2WV1A 3ROUA 5EEHA 4PK4A 2HNHA 2VBWA 5F0HA 2QQBA 3ZMVA 1FPQA 1Y56A 3MN2A 3TL4X 5E3LA 3F8MA 1BI3A 4PUSA 4N4OB 5E3MA 1IRXA 4I09A 2DPDA 1GUUA 3I71A 4NNJA 2DQLA 2W1OA 1V55H 1JKRC 3RTRA 3CCMI 3M8EA 4PSWA 4F3QA 2LREA 2EFWA 3BWGA 4QSHA 5F08A 1SC7A 2HVRA 4N0BA 1D8JA 1I39A 4CA0A 2M45A 3HPHA 2ZFWA 1OCOH 2VJ4A 5L3DA 5DV5A 1P6RA 1OYYA 3IWZA 3OSFA 3RI4A 1VQ7I 1Z6TA 4HF1A 1X2MA 3BJAA 2VBYA 2HQRA 3I5UA 4V19K 1WPKA 3D0SA 5LGTA 4PZJA 4N4NB 1YTYA 2DBBA 2QYOA 4I7HA 1SFEA 4EM0B 4XLHA 1HA8A 2XAQA 3Q0UA 1PJRA 4BJTA 1JJ8C 1EKEA 5AIQA 2CS3A 5E8GA 1LDJA 5BPDA 5GPAA 5HLHA 4GRIA 1BOAA 1D3YA 2IJLA 1X3ZB 4UV9A 4CHUA 1UELB 2HFHA 4DZPA 2Z1DA 4L5JA 3PO2J 2FD5A 1EA3A 3JR9A 3PSFA 3BROA 3R60A 4FETA 1K6OA 3NWSA 3WTWC 2RV8A 4LK0F 1OFCX 3GW2A 2BEOA 4BQOA 3F72A 5M5YJ 1F36A 2F4IA 2RNGA 2LY2A 1K6YA 1XD7A 3JRAA 5KNLA 2M1BA 3VYSB 4NC7A 5FGMA 4BHPA 3BR2A 3BR5A 3JTHA 5AIPA 4KDPA 5GAEJ 2QWWA 4A6DA 3FXLA 2LBFB 2XGXA 4AWXB 1U6GA 1IXSB 3OYIA 2IW5A 2WADA 4P96A 3M8JA 3BR1A 3S1RJ 2IXSA 1JKPC 4WKUA 4FTHA 1RETA 5CJ9A 1V54H 3CDHA 2ZB9A 4ENNA 1ZGAA 3ZGKA 2R5YA 2XRLA 5CVUA 3OY9A 1RI7A 5IOYA 1DU6A 4UV8A 5LEKA 5JFRA 1JTYA 3DU6A 5DCMB 5J1RA 3W2VA 5HVQC 5LLQA 1KQ8A 1DGRM 1GT0C 1HC8A 3TBIA 2NVTJ 1MMNA 2XF6A 4EGZA 2EB7A 3U1KA 4HF0A 2V9VA 3N05A 5H6QA 1DU0A 2CQQA 3ZR8X 2MLKA 1HQCA 5IYDJ 4L0YB 1LEAA 2FUG2 4B43A 2IS4A 1B72B 1J5YA 2WYBA 4ON0A 3IKTA 2VUMJ 4UB8C 1ULYA 4N9HA 4Q4ZF 4IXAA 2R7QA 3S3NA 4KICA 4BL0B 3O8GA 4WXHA 3A0BC 2EFPA 2OJED 3BDDA 4G94A 4E7SA 1IN8A 2E34A 4F91B 2L7MP 3HHHA 5ICEA 1TW2A 2OAZA 3DKXA 2XDVA 4A3MJ 3WG7H 4HX8A 1JJ6C 2ADUA 4IF4A 1B9NA 3DKWA 2VE9A 3RIRA 1LUJB 1WJEA 3BTLA 1BN5A 2R7OA 5FROA 4BHCA 2OU2A 4LG0A 5JVGF 4YFAA 3KYLA 4BY1J 3MEXA 2L4MA 2JA2A 3HUGA 5BQTA 4Y33A 2ZBKA 3CLOA 2O6GE 3S8RA 3LA2A 3K4CA 2K3PA 4FE4A 2OD5A 4XK4A 4DOZA 1EH7A 4DBQA 2L7KA 2K9NA 1Q1VA 1SVMA 4XSXF 3G6EI 3Q9VA 3JTGA 1B8IA 1UFMA 4II2A 1UHWA 5F0FA 3KFWX 1SMYF 1XGSA 2CH0A 3J80Z 4IJAA 2Z16A 2VKVA 2CW7A 3VPRA 4I6ZA 2K9QA 3O3KA 2Z2SB 1W7PD 3SXYA 2OZ6A 4LLGF 1ETQA 2ICWG 4HNVA 5CPRB 2GOXB 2HI3A 2JJ7A 1V3FA 3A01A 2QBYB 2HKOA 2VOOA 4B4CA 5D5VB 1U3EM 2R7WA 1GXPA 4FX0A 2M2EA 4WCGA 1S72I 2QGUA 1IV6A 1YRNA 4RM2A 3EYIA 3KPHA 3OIOA 5E3OA 1SD5A 1FC3A 3K1PA 3ZQQA 2YSRA 1JX9A 4A93J 2G7HA 1J2XA 2DFHA 2A6HF 5DS9A 3HDDA 1YIJI 2JMWA 2XUBA 3HIFA 2EZIA 2K9LA 4EJUA 1VQ9I 4YFBA 1Z6RA 4M3FA 2VJ5A 1DUXC 4KN7X 3PQJA 2G7UA 5EGOA 4N9IA 2EZKA 4HA8A 1FNNA 1X1DA 1QRYA 3H0GJ 3BJ6A 2HDCA 2HXIA 1AOYA 2R4GA 4LIUA 5HS7A 3KP7A 1G4DA 1X19A 2CSOA 4ASNA 1V5EA 2L7FP 2UWMA 1JTXA 4CYDA 3K4MA 2L9NA 2R5YB 2KZVA 3WTYC 4FISA 4U0WA 2M5WA 1QO0D 1YI2I 1UG0A 2M0CA 1TWFJ 3O2PE 3GZ5A 1I6HJ 2NOGA 4AIHA 1PDNC 5H2FC 2CG4A 2HQNA 1AJNA 2ECBA 2IPQX 4M9XA 4U0YA 1DPUA 1E3HA 2WAQN 2O5RA 4P55A 4X0GA 1UMQA 4V2FA 5E1ZB 2XROA 2PMZN 1USSA 3CF5F 1D0ZA 4MQVA 4ZYAA 2K86A 1D1CA 4WF2A 1J75A 3Q0VA 2DFFA 3OYBA 1ZRDA 3NRVA 3B73A 1OLTA 1MH3A 1BW5A 4M1JA 4JX4A 5ILUA 2CQKA 4Y52J 3L7WA 5K1YA 2K5CA 3U2RA 2ZXHA 3GEZA 1YOVB 4UVAA 5ICGA 3BQZA 2XHKA 4MGRA 1MSFC 3RPUA 3H9QA 5B1BH 3T1BA 3ML0A 4YFNF 3E0JB 3RDIA 2I5UA 4LG0B 2A6EF 3Q0WA 2DDBA 3KP3A 5FO5A 2RQPA 3Q3SA 3M9AA 3VB2A 4CO8A 1CGPA 5GP9A 2Y9ZA 3GX4X 1YJNI 3DTKA 3L2VA 1TBXA 4C3IJ 3SQNA 4RMNA 2JUCA 2M30A 4W1UA 3WG9A 1W5CC 1WJCA 2W82A 5LGNA 4E57A 3BR0A 2OTLI 4G7HF 1LDDA 1IRFA 2BV6A 3F22A 1B8IB 1MJAA 1MBJA 1RKTA 4A5NA 4BY7J 3HRSA 1LKXA 3KX2A 3ZPLA 1YW9A 4FASD 2KIUA 4AIDA 2ELKA 1J09A 4KNYA 4BNCA 1GVDA 2X4HA 2X51A 2GBYA 4LD5A 4BE2A 1J59A 4QPOA 2E1MC 4PELA 3S2HJ 2LYCA 5EEGA 4XIDA 4OIOF 1LE8A 1YYVA 2FE3A 3A01B 1R00A 2IGNA 3U9GA 4HX7A 1DGWY 4BQQA 1AU7A 1YRNB 1R5HA 4EVIA 1YX3A 4BU2A 4A0XA 4K2EA 3F8FA 3HYIA 4II3A 4MTEA 4U88A 2DJNA 3CCJI 4CCOA 2DAOA 3CF2A 1VQMI 3HM5A 1IN6A 4BAYA 2CFXA 1RNLA 2QKMB 4KJZA 2KRFA 2Y69H 3MCZA 1BBYA 2ZMEC 4XOPA 4CZZA 5ILVA 2CUFA 2R7UA 3OIPA 3C2GA 1P4XA 4O3MA 5EGOB 2XC7A 2VN2A 4M3GA 5B66C 1MDMA 2ELJA 2JPBA 4S0HB 2QLZA 3J81Z 1GHCA 2TCTA 4CZCA 3SFIA 1VQKI 2K27A 5D5XB 2JSCA 2F5VA 3LFKA 2W84A 3JREA 3GTLJ 4MFEA 3MKLA 2OPTA 3C2HA 1G3WA 4CCKA 2HPMA 2JT1A 1S7EA 1ZQ3P 2QUFA 3J7YJ 4F92B 2YU9J 1MNDA 2XSDC 3GVAA 3AG1H 1GK9A 1ETKA 3VSKA 2F2EA 2WC2A 2EQRA 1UZCA 4DZJA 5DDGA 1IZ1A 1TWGJ 2XSJC 2E1NA 2KJCA 1LVKA 3QYBA 1LEBA 4CH7A 2ZSIB 1YO5C 4XKWA 3MFKA 2CU7A 3IHUA 3BG7A 2HYFA 4ZTFA 4B8XA 3BG3A 5K5RA 1JE8A 2ZJ2A 3JRGA 3CCUI 2LY9A 1YJWI 3CUQC 2K4BA 1VTNC 1ACIA 3OYCA 3IL2A 2V1NA 2WB1N 1B9MA 1XGMA 4W97A 5TISC 5GPCA 4Y4RA 3F9KA 4I0BA 4Z2YA 2E5ZA 4WX9A 3I4MJ 1HOMA 3LMMA 2EV0A 4ESFA 5L3FA 5LHIA 1KEHA 5L3EA 3S32A 5K5QA 2E60A 4IVNA 5LEJA 4G6DA 3FGRA 5L3GA 1JHFA 4AU7A 4RB0A 4MNUA 2MSYA 5EZGA 4RM3A 3LAPA 4WWCA 2NRAC 2ECCA 3SJMA 3PL8A 5GTIC 4ZC3A 1GK1A 4A3FJ 1HXDA 1S8NA 5M5XJ 1LB2A 4XQFA 3OS2A 2HKXA 3JTRA 2OV7A 2LOOA 4GYIA 5F64A 4XN0A 1SAUA 3ISPA 4OAYA 1VFCA 3IP4B 5IT9Z 2YR2A 3DTEA 3LSMA 1ON1A 2J5OA 2Y75A 1OCPA 3FBNB 1D1BA 4L9TA 4P9FA 2MFZA 3EUKL 2DPUA 1LDKB 3DCFA 4CCNA 1XG1A 2V4JC 5D4SA 2ZMEA 2GAUA 4ZDOA 2DT5A 2FMYA 1ZREA 3HOWJ 2Q2EA 2R7XA 3Q5FA 2HWVA 4EM2A 4HF2A 3JSPA 3K69A 3H9GA 4G6QA 5FKNA 1HBXG 4M9ZA 2WY7Q 4CCLA 4XL9A 1AI7A 1SVOA 5J4YA 5CVJA 2HU9A 2AQEA 1K79A 2VXZA 3BP8A 2R5ZA 5EG0A 2MGQA 2DOEA 2IGMA 3KCCA 2E2JJ 2VQCA 1XCVA 2XF7A 3ZQLA 1C0WA 3E5UA 1X58A 1KYWA 4XMYA 1L0OC 1P7IA 4XRMA 1R1VA 2IEKA 2JZYA 3G71I 2LY1A 1BR1A 4WK8F 2GXAA 2CQXA 4FQGA 1TW3A 2Y31A 5HNFA 3GFIA 3CMYA 3LWFA 2PBIA 3GTJJ 4KA4A 4CGZA 1MW7A 2F5DA 3HOTA 5JI6A 4OIQF 5K7FA 4G7ZF 4E56A 2XAUA 3L9FA 2CYYA 4BBRJ 2A07F 1F4KA 3DBLB 1RUOA 4OINF 2ESHA 5BNGA 3J7AY 4FT8A 5FD5A 5D5WB 1D5YA 5E20A 3LOCA 2PN6A 5CVVA 3TP3A 4HSTA 1J0RA 3CDLA 4IPAA 2FBHA 4UXNA 2V1XA 3CUQA 4MO7A 5DEQA 1DQUA 2XAHA 1IDYA 3DLAA 4RAZA 4RA2A 4R1HA 3U21A 2BVLA 5IYBJ 4J01A 1FJLA 3W2WA 2DYSH 3ZQCA 3JAMZ 3B6AA 1VZ0A 5IOZA 3GZ6A 1GM8A 2DT7B 5M5WJ 4WKTA 3O6BB 4YFKF 2M3AA 2VPLA 3FXRA 4YEJA 2QQAA 3M7GA 3WODF 4BUPA 3S14J 3KP6A 1FYMA 3TOAA 3QU3A 3VOEA 2BY2A 1FZPB 1MBEA 2P0WA 4MLOA 3DEUA 3IH4A 1FMVA 4PDKA 4UVCA 2HS5A 5CLSA 2ZJQF 3DLLF 2PEXA 2O9LA 2DK5A 3TO9A 5J1UA 3PJRA 5HDGA 1XSVA 5DM7F 1FLIA 2O8XA 3CCYA 1YIOA 2HYJA 5GTHC 4X6AJ 3AG3H 1FP2A 1ODDA 3LA3A 1T08B 1WFXA 2E1MB 3HSEA 1Y1VJ 4CSWA 1FP1D 2DA5A 3QYEA 4XBFA 2NS7A 3RZDJ 5BPIA 4ABZA 1UB9A 2HOEA 2M4GA 3IRQA 3KYCB 2F5CA 2IGKA 3D5RC 3RSNA 3W6JB 4IRIA 2E1OA 1JXSA 3QRFF 1B59A 2ZJRF 1D8KA 2ACJA 3DXJF 4DNCA 3GTQJ 4QWQA 1T0FC 2FX0A 2P4WA 3UR3C 2R7ZJ 2CJJA 1IN7A 2ZMEB 3DTIA 3KE2A 4DGWB 1XDSA 3W6KB 1FEXA 2QM3A 4I02A 5GAHJ 1MH4A 2LTPA 4Y17A 4IHSA 1D0YA 2AQFA 3HRUA 4IEJA 4DYQA 5FKLA 5K7HA 2GIZA 1BC8C 2M9HA 2K9SA 1A31A 1OKRA 2NVXJ 4LLNA 3I56I 3HHGA 5EG0B 5FJ8J 2R7VA 1MGTA 5F1JA 2RQQA 4RAFA 4EJVA 3RPUD 1JUSA 3OYHA 5E1XA 1B1BA 1XB4A 3I54A 1Y1WJ 3QP6A 1MBHA 2DQRA 1FTTA 1SD6A 2L0KA 3HOVJ 4FX4A 2RC4A 4XNFA 2V26A 3CJRB 2IP2A 2YU3A 5E1WA 3OWTA 2E2IJ 4A3CJ 4AYBA 3OYNA 1SEUA 1PNKA 2ADVA 1E0EA 1JKOC 2JTVA 3DPTA 2MA3A 2GIVA 5FFXA 2M8GX 1AJQA 4ZH4F 1IRGA 2QSFX 3F3XA 4L9NA 4JP0A 2EPFA 2EILH 5EF6A 2GA2A 1FBUA 1W36C 1VNDA 2VQGA 2WTEA 1BL0A 2DW4A 2IT0A 2RDPA 3RKQA 3LSJA 1OCCH 4GCVA 3FK6A 4LGWA 4XKVA 4U0VA 1Z91A 4MIMA 2P6TA 4QPQA 3UKGA 2FEZA 1ZGJA 4XONA 4IRHA 1EF4A 5M3MJ 3CUQB 1P4AA 4A3LJ 4OOIA 3H35A 2QQ9A 1CF7A 1NK3P 3DPLC 4A3GJ 2VE8A 2MH9A 2FBIA 4UB6C 1XTAA 3FM3A 1MSEC 1APLC 2P8TA 4PJLA 1GLNA 2OBPA 4KIBA 3TDZC 3CESA 3ERMA 1A6QA 1TNTA 4RS8A 4RDUA 1TZLA 3H0DA 1XMXA 5HS8A 5K5OA 2FBKA 3GCMA 1XSDA 2PJPA 1T39A 2DLLA 1KU2A 2OA4A 3VYRB 1G6NA 2WYDA 3CMAI 3SRCA 2MBFA 2C6YA 2VC1A 1BI2A 4AVZA 4NQWA 3JRDA 4LIVA 4M9SA 1S6LA 3QPTA 2EK5A 4BE1A 5D8LB 2XGDA 3HSRA 1FOYA 4DYCA 2CO5A 1O3SA 2HYGD 4GO1A 4O5VA 3CMEI 5H20A 1MNEA 3TKYA 4BEHA 1ETWA 4BJ5C 1F43A 2M7AA 3FXJA 2V6CA 1W1WE 3V4GA 1GK0A 4ESJA 5D5UB 2ME6A 5BOXA 1T0FA 3BG5A 1A35A 3K0LA 5HS9A 2JPCA 4EEFG 3E1SA 1X1AA 1XS9A 5CVRA 2WYCA 4YRVA 1K4TA 1V4RA 3C7JA 5A2QK 2L5QA 3DBHB 4PJ0C 4L9VA 2H6BA 2VJIA 1ONVA 2IGOA 3SDGA 2X0LA 4QTRA 1H9GA 2O03A 3ZXSA 4LB6B 3A4CA 1W5TA 2W85A 2V1UA 1R5GA 5ERIA 5B1AH 1PNMA 1WHUA 2KHMA 3GUDA 5DUIA 3CTAA 3VEPA 1Z77A 4MFDA 3QQAA 2ID6A 1TWHJ 1BJAA 2XASA 2NAZA 4UVBA 1AI4A 2V1DA 3FMSA 1AHDP 2J5PA 4PJNA 2IRFG 4IHTA 4S05A 4LLLA 4Y15A 2QSGX 1WRJA 4QLCU 1LQ1A 5IPAA 3E3VA 3LSTA 1TWCJ 2ZXWH 3IC7A 5JHUA 1GXQA 4EJOA 4HV6A 1MMSA 3HKZA 3TGNA 1F1ZA 4HZFA 2B9SA 3G1MA 2BW3A 1YITI 3GBGA 3LL7A 3NARA 2DMPA 2MYSA 4ZDPA 3ABMH 3DQVC 2H09A 2D5VA 3KEQA 6PAXA 5FLXK 4YG2F 2DODA 4E70A 2VONA 3H5NA 2LKXA 1WJFA 2L02A 3D5SC 4JX6A 3H3VK 4DW6A 2ZO4A 2JA7J 3BTJA 4HPQA 1I3QJ 1QZEA 3C2BA 5FLVA 3E6BA 5HNHA 2WA0A 4HBLA 4A69C 2D1HA 3H9JA 3RKYA 5ICCA 1RPWA 1IRZA 1E3PA 2LP0A 3ABLH 3FMQA 3L1PA 2MW8A 1CF7B 3SZTA 3K4KA 3HEFA 4XORA 2Q0OA 2EBIA 1Z1DA 3VDXA 4HLYA 4C2TA 4PJJA 2O61A 3CC2I 2JA8J 3L2WA 2HTSA 4GYGA 3V7RA 4A3KJ 1A04A 4Q5SF 3SZPA 3CJNA 1K4SA 1RUNA 1OMIA 2A69F 4HSRA 4G6TB 1IDZA 2WV0A 3KYDB 4CUGA 4BDZA 3J7AO 4EM1A 3HGYA 1PVEA 2X9DA 1JT0A 3HL2A 4IHYA 3CCVI 3BG9A 4OIRF 1XC5A 4NQWB 2DK8A 2BGCA 1Y39A 3WTUC 1A6IA 2W24A 2Y0SN 5D6FA 2YX4A 1ZLJA 3HB9A 3R0JA 2GXBA 5BS6A 1XSXA 2BHZA 4D7NA 1DDNA 1HCRA 2Z9OA 3C3WA 2NXNB 3CDIA 3ASNH 4UUSA 2JSPA 4WXCA 3BPVA 3RYPA 2DTRA 1WJAA 2A05A 1Z7LA 3FKJA 1FT9A 1XN7A 1J9IA 2YPRA 4L18B 2XKOA 1E2XA 1AI5A 3GTKJ 5D6EA 2ZXJA 1IV8A 1ETXA 1OYIA 1SFXA 1G3TA 2E36A 2RGVA 3OS1A 4KISA 4G8XA 3TQNA 4LOCA 1U78A 4IQJA 1U9OA 3TO7A 1ETOA 2DOAA 3DFGA 3QWLA 1S5LC 3BR3A 3R61A 1IO2A 1JVZA 4CYCA 3K4NA 3S17J 4MEXF 1YW7A 1EV7A 3OOPA 3HTSB 2LVSA 3QYFA 2JWTA 1R4NB 2Q1ZB 4U87A 4I2OA 1Z05A 5FB2A 3ZP5A 3DBRB 1E3OC 3E5QA 2FRHA 1A36A 1I1GA 4I98B 3KP4A 4G9YA 3MKYB 1HSJA 3HUGB 1YFHA 1R22A 1VI0A 2BW3B 1O3QA 5IT3A 3OSGA 1WJBA 2R7FA 1USTA 3RYRA 4RB1A 3FKIJ 2KRCA 2UUZA 3S2WA 1O7FA 5E18F 3P9CA 3M4OJ 2KIQA 4R8HA 2OCEA 2X6WA 4IQ4A 3CC7I 2X1EA 3IH2A 2L2OA 3KP5A 3PQKA 3S15J 4F52A 3E97A 3JRBA 2CWEA 3PIOF 4BQNA 3IWFA 3ZMTA 1O3TA 3G2BA 1WSUA 5E17F 3PO3J 1FSEA 3DP7A 2MH2A 1SMTA 3FDYA 5F04A 1FBQA 2KRHA 1Y6IA 3ULQB 3L00A 4CCMA 1KU3A 1KQ9A 2ESNA 3RKXA 1XCBA 3S1NJ 3O8HA 5KK1A 1TT5B 1TWAJ 2F4OB 3WHCA 3PUBA 4JX5A 1OISA 3K70C 3H3ZA 2PLYA 5JLWA 2VKEA 3K2AA 1QQIA 3BPXA 2VC0A 1B6AA 1XDUA 4XRSA 2JQ7A 1FM2A 2PX9A 3JTQA 3OR2C 4Y7NJ 3K6GA 4I0AA 3OYKA 1K61A 4D9JA 4KIFA 4A3DJ 2XPWA 5J8FA 2EV6A 3JCUC 1QBJA 3C18A 1MMAA 2KP6A 3ELKA 1F9NA 2M87A 2QF7A 1HDDC 1KECA 4ZJZA 1ZYRF 2M8EA 4A3BJ 2DA3A 3L2CA 1WGXA 2OQGA 3BCBA 1W0UA 5E8IA 1IN5A 2DDAA 2QCOA 4RGUA 3KLOA 4B1RA 1VQ8I 4UUSB 1UJ8A 3HRMA 3L94A 4DJAA 3CP8A 3E5XA 2P5KA 4C30A 1N25A 2KIMA 1R6RA 2DMTA 1CQTA 4BE0A 3ABTA 1CP9A 3E6MA 4EMSA 4HNUA 2UXNA 3N4MA 5LHHA 2GXGA 1K83J 1D0XA 2DN0A 3F8CA 4KYWA 4YELA 4E55A 3CO6C 4P9UA 5TJJA 1OR0A 4A3JJ 3ZMZA 1B4AA 1V5FA 3GTGJ 3OYAA 2FA5A 4HYEA 4RB2C 2PG4A 5F27A 5EJCA 2AXLA 2XB5A 4CYCB 3M1EA 3LA7A 2KQRA 2VL8A 4KFCA 2R93J 2LSOA 3CJTB 5ILSA 4AD9A 2DT6A 3M8FA 2RREA 3I64A 1FXVA 4HDUA 3VYTB 3S16J 2P7CB 3V7CA 1YW8A 3FHNA 2M7BA 2COBA 3TMOA 3LQRA 3GFMA 1H88C 3I55I 3DEWA 1DPRA 3ZRGA 4ZTJA 2KDOA 2L54A 3V8LA 3P7NA 2E35A 3UNGC 2BY1A 4M3BA 1RESA 4LB5A 2IS6A 4XLCA 3SFZA 1GV2A 3PM1A 2P7VB 3FIWA 4V2GA 3HC7A 1BR2A 1S29A 2JVGA 4K2FA 4RGSA 3HZJA 2Y48A 1MBGA 2TRTA 4RBOA 1O7LA 3G4SI 2LFBA 4XOTA 2ZC2A 2LKPA 4FE7A 1Z3XA 2LNBA 3T5XA 2FNPA 2RNJA 3EQLF 5DCFA 3TOBA 4BGDA 2A3SA 5LGUA 2XB0X 1K7DA 1LE8B 3VYUB 2AHQA 2LH9A 2WY8Q 3ESWB 4AUXA 1GM7A 5CVIA 2ZFUA 1S3JA 3L2UA 2DMQA 4A12A 2DXIA 1QHHD 3IRRA 2P6SA 3OS0A 1QA6A 4F93B 3KETA 3S3MA 5B5EC 1U0JA 3LSIA 2EIKH 1Q1HA 1TL8A 1VQ4I 1Z21A 1R36A 3K10A 5JHFA 3G1OA 4HLXA 3V8JA 5E79C 3AAFA 1I3AA 1YHQI 2BY0A 4A0YA 3E6DA 1SVLA 4DIQA 2F5FA 3FMRA 1OPCA 1PUFA 3KIOA 3LSGA 1MDMB 2B7EA 3C1DA 3GFJA 3FZVA 4L0ZB 5FLMJ 1SFKA 1TLHB 1I6XA 1X1CA 4PJMA 4CXFA 1MBFA 3LNQA 1W0TA 5LRRA 2CRGA 1O57A 2EZHA 3A02A 1W36D 4ZZDA 3SDBA 1UCRA 2FJ1A 1KZHA 3TO6A 2K4JA 1Z7UA 1LPQA 2F5EA 4BS9A 3H36A 2D2WA 3CMMA 1MIJA 1ZR4A 2XIGA 1IF1A 4M72A 4PFOA 2H6CA 2VBXA 4CCJA 2F48A 1IGNA 2KL4A 3GTOJ 3RZOJ 1FYKA 2EFQA 4IHVA 2L7ZA 4FHTA 3FXOA 3RJPA 4BKXA 2E7XA 2TDXA 3QP5A 2AE5A 4G12A 1HKQA 1QHGA 1LVAA 2VLAA 1O3RA 1GHDA 2IA1A 1HKSA 1FOWA 3PNTA 3F6VA 2X6OA 2XKPA 2RAEA 1P92A 3J7ZI 4H0EA 3I4NJ 2GQQA 2W57A 2COMA 3SEQA 2R7RA 2MLGA 1AI6A 1WI3A 4C9YA 2A5WA 4AVPA 3DPUA 1Z9CA 2DU9A 3X2QH 5JR3A 2PFBA 3AG4H 2A5YB 2A68F 3LQQA 3TEDA 1VF9A 3QPLA 2GA1A 1IW7F 2FOWA 3J80K 4KITB 2MD5A 3EDPA 3F8NA 4HV5A 2G0EA 1RRJA 3I59A 2X6YA 2IBDA 3WGIA 3OYMA 4H4KC 3CCLI 2QENA 2WBMA 1R58A 1IUYA 1U8BA 1R5ID 3ASOH 1Z3YA 4AC0A 2ZXIA 3SYTA 2E19A 2P81A 4UHTA 4XLEA 1HW2A 2I8DA 2WAQA 3DV8A 3KP2A 4JQFA 2O7OA 1BM9A 3D1NI 2QEXI 2PMZA 2XRNA 5IP6A 2YS9A 3SEZA 4GFBA 3A2KA 3HTUA 3EUAA 4M73A 1BOBA 3GTPJ 3PUFA 1MJ9A 3WU2C 2IAIA 2CUJA 3OR1C 2JRMA 3HOSA 3HSFA 4S04A 1WVRA 5C44J 2LK2A 4EQQA 3ZQGA 5D4RA 2ZJPF 3GO5A 3K4LA 3WGGA 5HDKA 2ZKZA 3CLQA 1IUFA 4M3DA 3AFHA 3ZMSA 1QVTA 1X3UA 5K7ZA 1TQPA 1QPMA 1LFUP 1BIBA 1AA7A 2JK3A 4XKCA 2M0MA 1WKMA 2R0QC 5DCMA 2Q2EB 3F0CA 3ZOBA 5HLGA 4NHJA 1WWXA 1K78A 4TV7A 2R7TA 2ME0A 2OCCH 1JI8A 3ONQA 2HVQA 2E7WA 3FXUA 1TC3C 2QSHX 2R5ZB 5C3EJ 1ZGWA 3ZQ7A 1GVJA 1YLFA 4L9JA 5LBQA 2GLOA 4NC8A 3BJOA 1PUFB 3QPHA 2CUEA 1VQOI 2ISYA 2LRDA 2H8WA 1BR4A 1IAWA 2Y9YA 2DTZA 2Y2ZA 2AS5F 3DF8A 4E6KG 1X4OA 4NBQA 2H8RA 4M6YA 4YIFA 1H8AC 4IZZA 1FSHA 2V9PA 2XV4S 4OIPF 5EDNA 1XGNA 5J47A 3M07A 1GDTA 3S2DJ 3TP0A 3VSLA 4A5MA 4U7DA 3U1DA 2VT3A 4ANJA 1R9TJ 2W00A 3JRCA 1HF0A 3S1MJ 3GZNB 4IRGA 4L5IA 3NQOA 3WTVC 3G73A 2IS1A 2KPMA 2STTA 1BC7C 2O8KA 2QA4I 3HJEA 2EH3A 5HDNA 4DQ2A 5C4XJ 2V9KA 2CMPA 4R79A 4M6XA 3NEUA 4KT5C 1ETYA 2LG4A 2NNNA 4XM3A 3CC4I 1F5TA 2I10A 4A0ZA 4FCYA 3GYHX 2K85A 3V7SA 1ZRCA 2JN6A 3ZQFA 3OYJA 2KMUA 2BZTA 2XAJA 1G2HA 5TGTA 3GLXA 3JRHA 4D1QA 4IHXA 3CCSI 4I01A 1FIPA 2EJRA 2M4KA 4XRSG 1RR7A 5GAGJ 3KZZA 2EV5A 3CCRI 2W7NA 2YX7A 3K3WA 1LJ9A 1FXHA 2Z33A 5LD2C 2VI6A 3FX3A 2GZWA 1WH7A 2MABA 3H1CA 4XLFA 1EH6A 3FXMA 3FXQA 4E4HA 3I59B 3NWTA 3R6SA 3MZHA 4ESBA 4JYKA 4QIWN 2B63J 4JBAA 2QBYA 5HODA 4PFPA 3WTTC 2JUGA 3GFLA 3QPSA 1JT6A 2DCEA 3TW6A 5GADJ 5EEAA 5C4JJ 3BY6A 3AL0C 5J1YA 2V7FA 1IXRC 1RZ4A 2QZ8A 1ZRFA 1T98A 3I0TA 1RIOH 3F6OA 2JA5J 3HG9A 4HG2A 1S7AA 2PQ8A 2E2HJ 2XVCA 2O3FA 4P5OA 2KIFA 1ZELA 1UHMA 2RKHA 1I1SA 3GLLA 2NVUB 2VPRA 2BHYA 2UXXA 2HZDA 1BJZA 5J3LA 4DBRA 3FHZA 1ZK8A 3DKYA 3OIQA 1I50J 2WB1A 1MBKA 3M1CA 3MQ0A 4LJZF 4A2UA 2VQHA 3OYEA 3J81K 5F6FA 4LITA 1K5SA 2ZCWA 1KONA 1U9NA 1QGPA 4MTDA 3IH3A 4HNTA 4WKVA 3K4BA 1OJLA 1VQLI 2IA2A 1XMKA 4B09A 3REOA 1J7KA 1K78B 4Z6YA 1X2NA 2B0LA 1BI0A 3WU1B 4ITVA 4IX7A 4AM3A 2LLKA 2PJRA 3HGGA 1MMGA 1YS7A 4XKBA 5FRNA 4RLFA 2OTJI 3JRFA 1SFOJ 2K7LA 1MJBA 3DU5A 1S7OA 3OYGA 3QU6A 3EETA 3GMEA 2AXTC 1TQMA 3GF2A 3IUOA 3MKWB 5FFZA 4HRIA 3FXKA 3FISA 4D7MA 3H92A 4X1EA 2DA1A 2W48A 1MNMC 3HBLA 2BVMA 1ENHA 4JK1X 3FGTA 2DA4A 3PNVA 3HXLA 1WCMJ 1XGOA 2STWA 2L9VA 3WGHA 2R3SA 4A3IJ 5KCMA 1NG6A 4Y13A 4BDYA 1R4MB 1WZ2A 4XR6A 2IVMA 4GDFA 2KJBA 2E71A 3BZCA 3WE3A 1ON2A 1R7JA 3OYDA 1FBSA 4G7OF 3L91A 4IL6C 1HW1A 3I4PA 3KZIC 3K70D 1GKFA 2IA0A 4B48A 2HOAA 1EH8A 3ZMDA 4ZDLA 1Y8RB 1POGA 4IOAF 1IG7A 2VT2A 4J19A 3OL3A 2VIXA 4XRFA 4XSZF 4ENMA 2VXDA 3KZYA 2VQLA 3MZ8A 2WWYA 1QPIA 2XPUA 3E7LA 5KAFC 1FWZA 4UUTA 1W4MA 3A03A 3TDUC 4BYYA 5LHGA 4U7BA 3H5AA 2K9MA 4HQMA 4YIIA 2Y30A 3P9KA 1KA8A 3S8PA 1R49A 3LFUA 2DFIA 4IHWA 1N78A 2VJJA 1QNTA 3W3CA 3OYFA 1XX5A 1SD4A 1TTYA 2UZKA 2R7SA 4GGGA 1IN4A 5DM6F 1FTZA 4ZZLA 1G8XA 5B3SH 5JVTA 2H94A 3RPQA 1KU7A 5DD4A
chains in the Genus database with same CATH topology
3BLYA 3BCBA 1WJ5A 1MW7A 3HOTA 4OWRB 3SRBA 4N4NB 4E56A 2XAUA 3S93A 2OUMA 4XLHA 3EUHC 4NUBA 1HA8A 1PJRA 4Y3OA 4BJTA 3CJQB 3J7AY 3L94A 4DJAA 2CS3A 3CP8A 3CP2A 1X4PA 4C30A 1R6RA 4GRIA 4BE0A 4HSTA 4BEHB 1CP9A 1UELB 4HNUA 2Z1DA 1G59A 1EA3A 1DQUA 4BJ6C 3DLAA 3PSFA 4FETA 3U21A 4J01A 3NWSA 2BVLA 1QU3A 1GM9A 3W2WA 1D0XA 1VZ0A 1GM8A 4BQOA 2DT7B 4YELA 4WKTA 4E55A 1OR0A 2M3AA 2F4IA 2RNGA 2LY2A 2VPLA 1K6YA 3BG6A 4YEJA 1V5FA 5KNLA 3VYSB 3OYAA 4BUPA 4NC7A 2X85A 2LBFB 2P0WA 4MLOA 2KQRA 2VL8A 3OYIA 1FMVA 2WADA 2XF5A 3M8JA 3OOUA 2CW8A 2DT6A 2IXSA 5CKTA 4WKUA 2RREA 2IS2A 1FXVA 3A1YA 3PJRA 4RLQA 3VYTB 3ZGKA 4E7ZA 2VB6A 3LSHA 3OY9A 3FHNA 2M7BA 2PJRB 3TMOA 2L9SA 3DU6A 3W2VA 5HVQC 4B44A 3OMYA 3ZRGA 1UAAA 1DGRM 4ZTJA 3MD2A 3TBIA 1WFXA 2KDOA 2E1MB 4CSWA 1MMNA 2XF6A 3UNGC 2X1CA 3QYEA 3N05A 2IS6A 4XLCA 2M4GA 3ZR8X 2F6CA 2FUG2 4B43A 2IS4A 3HC7A 2WYBA 2IGKA 1BR2A 3D5RC 2JVGA 3RSNA 5FRMA 3S3NA 4K2FA 2R7QA 4BL0B 5CQEA 4E7SA 4YF9A 1T0FC 1N75A 2HPIA 4XOTA 4F91B 1S9HA 3UR3C 4OAZA 3W2AA 1Z3XA 4BGDA 3DTIA 4DGWB 1K7DA 2BOLA 3VYUB 2LH9A 2WY8Q 3DKXA 2XDVA 1GM7A 4JOMA 1D0YA 3L2UA 2ZFUA 2AQFA 2DXIA 1QHHD 3OYLA 1WJEA 3OS0A 2R7OA 5FROA 4F93B 2DJIA 3S3MA 4YFAA 1U0JA 3LSIA 2R7VA 3KYLA 1Z21A 2JA2A 2RQQA 3K10A 5JHFA 3RPUD 4Y33A 3OYHA 3S8RA 2V6EA 3K4CA 2K3PA 4DIQA 4XNFA 2V26A 2HDWA 3CJRB 4DOZA 4DBQA 2L7KA 3OWTA 3LSGA 2HQAA 3AL0B 4AYBA 3OYNA 1PNKA 1YX5A 2ADVA 4II2A 1SFKA 2CV2A 1X1CA 4PJMA 1E0EA 2CH0A 3DPTA 2Z16A 1P9QC 2LC2A 3D5LA 2CW7A 1W36D 1AJQA 4P1WA 3SDBA 3AKZA 2Z2SB 2CUZA 4BXFA 1W36C 2VQGA 4BS9A 3L2QA 5CPRB 2GOXB 1FMWA 4XLAA 3CMMA 4XKVA 1MMDA 4QPQA 4PFOA 4XONA 2R7WA 4CCJA 2CV1A 2VKDA 2KL4A 4RM2A 3H35A 3SZGA 1LFPA 3DPLC 3MKZA 3ZQQA 1JX9A 2AE5A 1QHGA 4XN3A 2VLAA 1GHDA 4C2UA 2A6TA 2VASA 1GLNA 4PJLA 1JW0A 3PNTA 1X1BA 2K9LA 3CESA 4YFBA 3H0DA 1TZLA 2VJ5A 1PYVA 3BC8A 4K2GA 1K5QA 2R7RA 3SEQA 1AI6A 1TT0A 3MMYB 1X1DA 4C9YA 2A5WA 3VYRB 2WYDA 3SRCA 2R4GA 3DPUA 4LIUA 3IAS2 1X19A 4AVZA 1V5EA 2UWMA 4LIVA 4BACA 3DEEA 3K4MA 2L9NA 2KZVA 5HLTA 3CZ6A 4KITB 4BE1A 4HEA2 1NG7A 1UG0A 2X6YA 3OYMA 1MNEA 4H4KC 4BEHA 4BJ5C 2M7AA 1GK0A 2WBMA 1AJNA 3K4JA 1V5GA 1Z3YA 4EATA 3IAM2 2ZXIA 3SYTA 1ERDA 4XLEA 1AJPA 2I8DA 2WAQA 3E1SA 2O5RA 4JQFA 4X0GA 1X1AA 2WYCA 4YRVA 2PMZA 5CQGA 1D0ZA 4ZYAA 3SEZA 3A2KA 2L5QA 1D1CA 3EUAA 1BOBA 2ZSHB 2VJIA 2IGOA 2CUJA 3OR1C 3HOSA 3OYBA 4M1JA 3L2RA 1OLTA 3RQ4A 3ZXSA 3A4CA 1DP3A 3K4LA 2AE4A 2K5CA 3AFHA 1PNMA 2KHMA 2ZXHA 3VWBA 3H9QA 1OR7C 3ML0A 1AA7A 3PFYA 3E0JB 4XKCA 2M0MA 1AI4A 2OC6A 2Q2EB 2HVSA 4E7LA 4PJNA 2R7TA 1JI8A 3DTKA 3ONQA 2HVQA 3L2VA 4RMNA 1N77A 1WJCA 2W82A 3HKZA 1E3AA 4E57A 4NC8A 2BW3A 2LRDA 1BR4A 2GOMA 3GBGA 3LL7A 2MYSA 4E7JA 4B47A 4IKFA 4J00A 1LKXA 3DQVC 4ZDPA 3KX2A 4E6KG 1PNLA 1X4OA 4FASD 1J09A 3H5NA 2WAFA 1WJFA 3D5SC 4IZZA 2X51A 4BE2A 3FBIB 4QPOA 4PEMA 2E1MC 4PELA 2LYCA 2MC4A 1YE9A 3EPZA 3VSLA 4HPQA 3BCAA 5HNHA 2WA0A 2IGNA 4ANJA 2W00A 2UV1A 2IS1A 3H9JA 4E7IA 1DGWY 4BQQA 2KPMA 1YX3A 4BU2A 3K4KA 3S3OA 4II3A 4XORA 2V9KA 2CMPA 2MD0A 3VDXA 4R79A 4PJJA 4C2TA 4CCOA 3L2WA 3CF2A 4XM3A 2LG4A 2NOJB 4KJZA 2QKMB 3RCOA 3OL4A 4XOPA 2R7UA 2KLOA 5KHDA 4HSRA 3OIPA 3C2GA 3OYJA 2KMUA 2XC7A 4G6TB 5TGTA 4BDZA 2ELJA 4CUGA 4D1QA 1WJDA 2VKHA 2M4KA 3HL2A 1T95A 4CZCA 2W7NA 3K3WA 1FXHA 4NQWB 5LD2C 4XLFA 2MABA 2F5VA 2Y0SA 2AE3A 2WYEA 4E4HA 3QODA 3NWTA 4F55A 2CFOA 3C2HA 4CCKA 4PFPA 2HPMA 2JUGA 2DCEA 3LSKA 2E5NA 4F92B 1MNDA 1GK9A 2JSPA 3H5RA 3AL0C 2V7FA 3VSKA 4B3XA 2X1DA 1WJAA 1Z7LA 3FKJA 3HG9A 4HG2A 4WKSA 3ZCOA 1AI5A 2XSJC 3PNYA 4P5OA 1LVKA 3QYBA 1ZELA 4CH7A 2ZSIB 4XKWA 3OS1A 4KISA 2JVHA 3BG7A 4ZTFA 4IQJA 2HZDA 4DBRA 3DKYA 2DOAA 3OIQA 2QKLB 4PSXA 2X6XA 3OYCA 2V1NA 2WB1A 3M1CA 2LBFA 2VQHA 4Y4RA 3OYEA 1JVZA 3F9KA 4LITA 1K5SA 3K4NA 2WAEA 4KT6A 5LFAA 3I9V2 2E5ZA 1KONA 3KEYA 1H2GA 3QYFA 4HNTA 3K4BA 4WKVA 3LMMA 3I3LA 1KEHA 3S32A 2Q1ZB 4U87A 2E60A 3DWLE 4ITVA 3HPGA 3SRAA 4IX7A 2PJRA 4AU7A 1MMGA 5FRNA 4XKBA 1D1AA 4RLFA 4RM3A 1GK1A 3PL8A 4ZC3A 3MKYB 3HUGB 3DU5A 3OYGA 2BW3B 4XQFA 4E7HA 3OS2A 3JTRA 1WJBA 2OV7A 2LOOA 3IUOA 3MKWB 2CV0A 4HRIA 4XN0A 1SAUA 4OAYA 3IP4B 2W4SA 4BTHA 2BVMA 2KRCA 2UUZA 3DTEA 3LSMA 3QOEA 3PNVA 3HXLA 4E7KA 5HOOA 5KCMA 2X6WA 1NG6A 3FBNB 2X1EA 4IQ4A 4LG3A 1D1BA 2L2OA 4BDYA 4F52A 2MFZA 4XR6A 3EUKL 1LDKB 3V42A 4BQNA 3OYDA 3G2BA 3PSIA 4CCNA 3L91A 2V4JC 3FDYA 2KRHA 1Y6IA 4CCMA 4ZDOA 3K70D 4PK4A 2HNHA 1GKFA 4B48A 2R7XA 4ZDLA 1Y56A 3PUBA 3TL4X 3K70C 3H9GA 3OL3A 2VIXA 4PUSA 1AI7A 4CCLA 2WY7Q 4XL9A 2VXDA 4N4OB 2HU9A 2AQEA 2VXZA 1IRXA 2VQLA 1FM2A 2IGMA 3JTQA 4NNJA 2W1OA 2VQCA 2XF7A 3OR2C 3RTRA 4PSWA 4F3QA 3H5AA 2LREA 3K6GA 2K9MA 4U7BA 4XMYA 3OYKA 4D9JA 2HVRA 3S8PA 4CA0A 3LFUA 1N78A 3HPHA 2VJJA 3OYFA 3W3CA 2VJ4A 1MMAA 2KP6A 2LY1A 2R7SA 1BR1A 1KECA 1G8XA 4ZJZA 5HNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM8 A;  4BTH A;  1AI7 A;  1GK0 A;  2AE4 A;  3K3W A;  4K2G A;  1FXH A;  1OR0 A;  4WKT A;  4WKS A;  1H2G A;  1AJN A;  1K5Q A;  4WKV A;  1PNM A;  3S8R A;  3SRB A;  1AI6 A;  1AI5 A;  4E56 A;  1KEH A;  1FM2 A;  2WYD A;  4E55 A;  3SRC A;  3JTQ A;  1AJP A;  1PNL A;  2AE3 A;  2WYE A;  3L94 A;  1K7D A;  3ML0 A;  4YFB A;  3SRA A;  2WYC A;  1AI4 A;  1PNK A;  1GM7 A;  2ADV A;  4YF9 A;  4E57 A;  4HST A;  3L91 A;  4PEM A;  4HSR A;  4PEL A;  1GK1 A;  1CP9 A;  1JX9 A;  1GK9 A;  2AE5 A;  1AJQ A;  1GHD A;  4WKU A;  1KEC A;  2WYB A;  1GKF A;  1JW0 A;  4M1J A;  3JTR A;  1FXV A;  4K2F A;  4YFA A;  1GM9 A;  1JVZ A;  1E3A A;  1K5S A; 
#chains in the Genus database with same CATH topology
 5IT9 K;  3FM5 A;  2CQ7 A;  3BLY A;  3CO7 C;  1WJ5 A;  2OZU A;  4LFU A;  4OWR B;  3SRB A;  3HOZ J;  4A6E A;  3S93 A;  2OUM A;  3EUH C;  4NUB A;  4MHG A;  3WE2 A;  2P5L C;  4Y3O A;  3CD6 I;  3CJQ B;  1BW6 A;  1U5T C;  4D5F A;  3CP2 A;  3JW4 A;  4F7Z A;  4A3E J;  1X4P A;  5J40 A;  2NNY A;  3ABK H;  1OCR H;  4BEH B;  1Y8Q B;  3BTI A;  2D1V A;  2N8G A;  1YS6 A;  1G59 A;  4BJ6 C;  3NAU A;  1QU3 A;  3A0H C;  3WTX C;  3I53 A;  3ERE D;  2W25 A;  1G3Y A;  2VOD A;  2VBZ A;  2HXO A;  3CCQ I;  3BG6 A;  5EZH A;  3MVP A;  3G1L A;  4NC6 A;  5F1R A;  1U2W A;  1YQA A;  3SHF A;  5DD8 A;  2X85 A;  2D45 A;  1AKH A;  3ECH A;  1OCZ H;  4YIR X;  5HLI A;  3IV5 A;  2EFO A;  1ITY A;  4CIC A;  5FKK A;  1RKW A;  1T56 A;  2XAF A;  1PUE E;  1ORK A;  2FQ4 A;  2XF5 A;  1D5V A;  3OOU A;  2BYV E;  3ZN1 A;  2CW8 A;  5CKT A;  1R1T A;  2K02 A;  3G3Z A;  2IS2 A;  3A1Y A;  4RLQ A;  2LDU A;  5M3F J;  4E7Z A;  2FML A;  2VB6 A;  3LSH A;  4XLN F;  2PJR B;  2L9S A;  3IKV A;  4B44 A;  4EV0 A;  2KIS A;  3OMY A;  1UAA A;  2ISZ A;  2EIJ H;  3MD2 A;  2LF7 A;  1P4W A;  2H27 A;  2HR3 A;  3BTC A;  2X1C A;  3W6V A;  1X1P A;  1T6S A;  1AWC A;  1TQI A;  4KN4 X;  4RGR A;  1HST A;  2F6C A;  2R92 J;  4RB3 C;  4RAY A;  3RQI A;  3WTZ A;  3N97 A;  1IJW C;  4AIJ A;  2PMU A;  5F0C A;  5FRM A;  5L3C A;  3JAM K;  1PP8 F;  5CQE A;  1O4X A;  4YF9 A;  1R1U A;  1N75 A;  2HPI A;  1S9H A;  5IY5 H;  4OAZ A;  2HEO A;  3W2A A;  1LNW A;  4EJW A;  3T8T A;  2ETH A;  2BOL A;  2MC3 A;  1VQ6 I;  1ZG3 A;  4JOM A;  3QAH A;  3F8B A;  3ZMU A;  3OYL A;  1STZ A;  2DJI A;  2DOF A;  3WU0 A;  4BXX J;  2A61 A;  1QVU A;  2FXA A;  3PIP F;  1FX7 A;  4GXO A;  1IXC A;  4IO9 F;  2V6E A;  3K2Z A;  2L01 A;  1TP4 A;  4DYR A;  2HDW A;  2XAG A;  3EUH A;  3MZY A;  1BA5 A;  2HQA A;  4AYB N;  1U5T A;  3AL0 B;  3PFI A;  1YX5 A;  4M74 A;  2CV2 A;  4HOB A;  1SFU A;  4KMF A;  1P9Q C;  2LC2 A;  1W5S A;  2P5V A;  3D5L A;  5H6R A;  5ICF A;  3ZN0 A;  1R71 A;  4P1W A;  2HOT A;  3AKZ A;  2LMD A;  4C3H J;  2DFE A;  2CUZ A;  5JLX A;  4BXF A;  1ZTR A;  3L2Q A;  1VQ5 I;  4CDG A;  1REP C;  3BR6 A;  4XLA A;  1FMW A;  2CW0 F;  3P9I A;  1WH5 A;  5DYM A;  1MMD A;  4XLP F;  3BOQ A;  2M34 A;  2EIM H;  2LD5 A;  1FY7 A;  4C3J J;  5ED4 A;  2CV1 A;  2VKD A;  1JUP A;  4UNO A;  3T0Y A;  3SZG A;  1IC8 A;  1LFP A;  3MKZ A;  5A2Q Z;  4EJT A;  4RAG A;  5KVR A;  1KQ0 A;  4XN3 A;  4C2U A;  2A6T A;  2VAS A;  1JW0 A;  1KU9 A;  1X1B A;  1HLV A;  3R0A A;  1MZB A;  1PYV A;  1XMA A;  3BC8 A;  4WXD A;  1FYL A;  4K2G A;  3VFZ A;  1U8R A;  1AKH B;  1K5Q A;  2F4M B;  1TT0 A;  3K7A J;  3MMY B;  2X48 A;  4YFX F;  2QVO A;  1TNS A;  3WTS C;  3K1N A;  2MG4 A;  3IAS 2;  2FU4 A;  2AO9 A;  3B6C A;  5E3N A;  2BXZ A;  5EYR A;  4ZYD A;  4BAC A;  2JA6 J;  3DEE A;  4C2M J;  2EA2 A;  3CZ6 A;  5HLT A;  4LMY A;  3JSO A;  1HDP A;  4PGH A;  1NHA A;  4HEA 2;  1NG7 A;  5AON A;  2OF7 A;  4EGY A;  3LAJ A;  2LR8 A;  3RKW A;  1ZAR A;  1SD7 A;  1G3S A;  3K4J A;  2DA2 A;  5CYV A;  1V5G A;  4EAT A;  3IAM 2;  5DUK A;  4HAM A;  3F21 A;  1ERD A;  1ZAO A;  1AJP A;  4OMZ A;  1YJ9 I;  3V8K A;  5FLX Z;  2FF4 A;  5CQG A;  1WI9 A;  1EJ9 A;  2ZSH B;  3F23 A;  4ENK A;  1JUM A;  2PMH A;  3L2R A;  5LRS A;  3EYY A;  3RQ4 A;  2KT0 A;  2L4A A;  2GM4 A;  1DP3 A;  1LFB A;  2L3D A;  2AE4 A;  1KGS A;  2L9R A;  4ZYE A;  3VWB A;  4D5C A;  4NDL A;  1OR7 C;  2DA6 A;  3PFY A;  2DA7 A;  3P5J A;  2FOK A;  2OC6 A;  2Z99 A;  5J6X A;  1L3L A;  2HVS A;  4E7L A;  5FKO A;  2BE5 F;  2PI0 A;  3KEO A;  2DYR H;  2EZL A;  1N77 A;  2G9W A;  3HKZ N;  1E3A A;  3K9T A;  5J4V A;  1P2F A;  4M6V A;  5J8C A;  1JHH A;  3BZK A;  4BBS J;  1U5T B;  2GOM A;  1T8I A;  1K7A A;  2HOS A;  4KIG A;  1W7P A;  4B47 A;  4J00 A;  4E7J A;  4IKF A;  2R7D A;  1WQ2 A;  2FQ3 A;  1PNL A;  2Q8K A;  4I99 C;  2OQR A;  4M71 A;  2WAF A;  1NK2 P;  2CQN A;  3FBI B;  4PEM A;  2FNA A;  2XGC A;  1FOX A;  1RC9 A;  4O6J A;  2MC4 A;  4HW0 A;  1YE9 A;  2KFD A;  1OQY A;  3EPZ A;  1QZZ A;  1KYZ A;  3BCA A;  1Z67 A;  3ZQI A;  4KUM A;  1R23 A;  2K40 A;  2DO7 A;  2UV1 A;  1I27 A;  4HQE A;  1NH3 A;  1DP7 P;  4E7I A;  2EWN A;  2NS8 A;  1UHS A;  4BHB A;  3GXO A;  4OU0 A;  2KDZ A;  3S3O A;  3HOX J;  1ETV A;  2MD0 A;  2ZNY A;  3WHB A;  1MD0 A;  1JGS A;  2HZT A;  5FD6 A;  4LK1 F;  5IYC J;  1A5J A;  2ID3 A;  2NOJ B;  3RCO A;  4BXU A;  3CCE I;  4HX4 A;  4ENJ A;  3OL4 A;  3BZ6 A;  2KLO A;  5KHD A;  3L09 A;  3COA C;  1H9T A;  2VOP A;  1JGG A;  1ZH5 A;  4M3E A;  1ZKG A;  3B02 A;  1ZN2 A;  2GWR A;  1I5Z A;  1WJD A;  2VKH A;  2RN7 A;  1HW5 A;  1T95 A;  2YUS A;  1SAN A;  1M1E B;  2XGE A;  3QOP A;  2DMN A;  4ZYH A;  4NB5 A;  5DTD A;  1E17 A;  1SAX A;  2Y0S A;  1BI1 A;  4RGX A;  2LF8 A;  4UY8 I;  3GTM J;  4HDV A;  2AE3 A;  2WYE A;  4XIC A;  2FSW A;  3QOD A;  2BBY A;  3ECO A;  3I58 A;  4F55 A;  2CFO A;  1BIA A;  2EA4 A;  1ZG5 A;  3LSK A;  2E5N A;  3JRI A;  2RVC A;  2H1L A;  2DI3 A;  3H5R A;  3Q9S A;  5TRD A;  4B3X A;  1H0M A;  2EIN H;  2EFN A;  2X1D A;  4BQA A;  9ANT A;  1PP7 U;  1Z0X A;  1ZHF A;  3HOY J;  4WKS A;  3LSR A;  4ZYG A;  3AG2 H;  1X3W B;  2NVQ J;  3ZCO A;  3PNY A;  4KMU X;  4BWC A;  1ZG1 A;  2NVY J;  5L3B A;  2JVH A;  4OMY A;  1T2K A;  1OR7 A;  2Y0M A;  4AIK A;  1T38 A;  1H89 C;  3FF5 A;  4ETS A;  1NTC A;  3CUO A;  2QKL B;  4PSX A;  1FIA A;  2X6X A;  2KKO A;  3ML6 A;  2H1K A;  5IP7 J;  2LBF A;  1OCT C;  3BT9 A;  4BH9 A;  5BMZ A;  1HKT A;  5LFA A;  2WAE A;  4KT6 A;  4Q47 A;  3I9V 2;  2NYX A;  1ZR2 A;  3MWM A;  3ZQH A;  3KEY A;  3OV8 A;  1FOK A;  1H2G A;  1Y0N A;  3GWZ A;  4B3A A;  5D8K B;  1VQP I;  3I3L A;  4MQ9 F;  2ZNZ A;  1T33 A;  1XPX A;  3T8R A;  4UUV A;  2XPV A;  3LSP A;  3E6C C;  3ABU A;  1OYW A;  3DWL E;  3TW7 A;  3K1M A;  1Y0U A;  3HPG A;  4PCQ A;  3SRA A;  4Q48 A;  4D0P A;  3HRT A;  1D1A A;  3M3Y J;  1GV5 A;  1MKM A;  1GM9 A;  2HDD A;  2QQ8 A;  1YG2 A;  4E7H A;  2BY3 A;  1UG2 A;  4IOC F;  2BXY A;  2LKS A;  4MEY F;  1W7P B;  4I76 A;  3H3U A;  1ZLK A;  2HQ5 A;  2CV0 A;  2E1C A;  5KAI C;  2Z5U A;  3BQY A;  2W4S A;  4BTH A;  2NS0 A;  3QOE A;  2ELH A;  1RR8 C;  4E7K A;  4L5E A;  1B72 A;  1VQN I;  1P7J A;  3FWE A;  5HOO A;  1QZY A;  2Z3Y A;  3HOU J;  4LG3 A;  3FK7 A;  1JKQ C;  3S1Q J;  2JRT A;  2DMU A;  2HGC A;  3V42 A;  2HTJ A;  2K3F A;  3MAJ A;  3R4K A;  3VOD A;  4PGG A;  3PSI A;  3CQZ J;  5IP9 J;  2CGP A;  2KZG A;  2O0Y A;  2V79 A;  5FKM A;  3KLN A;  2WV1 A;  3ROU A;  5EEH A;  4PK4 A;  2HNH A;  2VBW A;  5F0H A;  2QQB A;  3ZMV A;  1FPQ A;  1Y56 A;  3MN2 A;  3TL4 X;  5E3L A;  3F8M A;  1BI3 A;  4PUS A;  4N4O B;  5E3M A;  1IRX A;  4I09 A;  2DPD A;  1GUU A;  3I71 A;  4NNJ A;  2DQL A;  2W1O A;  1V55 H;  1JKR C;  3RTR A;  3CCM I;  3M8E A;  4PSW A;  4F3Q A;  2LRE A;  2EFW A;  3BWG A;  4QSH A;  5F08 A;  1SC7 A;  2HVR A;  4N0B A;  1D8J A;  1I39 A;  4CA0 A;  2M45 A;  3HPH A;  2ZFW A;  1OCO H;  2VJ4 A;  5L3D A;  5DV5 A;  1P6R A;  1OYY A;  3IWZ A;  3OSF A;  3RI4 A;  1VQ7 I;  1Z6T A;  4HF1 A;  1X2M A;  3BJA A;  2VBY A;  2HQR A;  3I5U A;  4V19 K;  1WPK A;  3D0S A;  5LGT A;  4PZJ A;  4N4N B;  1YTY A;  2DBB A;  2QYO A;  4I7H A;  1SFE A;  4EM0 B;  4XLH A;  1HA8 A;  2XAQ A;  3Q0U A;  1PJR A;  4BJT A;  1JJ8 C;  1EKE A;  5AIQ A;  2CS3 A;  5E8G A;  1LDJ A;  5BPD A;  5GPA A;  5HLH A;  4GRI A;  1BOA A;  1D3Y A;  2IJL A;  1X3Z B;  4UV9 A;  4CHU A;  1UEL B;  2HFH A;  4DZP A;  2Z1D A;  4L5J A;  3PO2 J;  2FD5 A;  1EA3 A;  3JR9 A;  3PSF A;  3BRO A;  3R60 A;  4FET A;  1K6O A;  3NWS A;  3WTW C;  2RV8 A;  4LK0 F;  1OFC X;  3GW2 A;  2BEO A;  4BQO A;  3F72 A;  5M5Y J;  1F36 A;  2F4I A;  2RNG A;  2LY2 A;  1K6Y A;  1XD7 A;  3JRA A;  5KNL A;  2M1B A;  3VYS B;  4NC7 A;  5FGM A;  4BHP A;  3BR2 A;  3BR5 A;  3JTH A;  5AIP A;  4KDP A;  5GAE J;  2QWW A;  4A6D A;  3FXL A;  2LBF B;  2XGX A;  4AWX B;  1U6G A;  1IXS B;  3OYI A;  2IW5 A;  2WAD A;  4P96 A;  3M8J A;  3BR1 A;  3S1R J;  2IXS A;  1JKP C;  4WKU A;  4FTH A;  1RET A;  5CJ9 A;  1V54 H;  3CDH A;  2ZB9 A;  4ENN A;  1ZGA A;  3ZGK A;  2R5Y A;  2XRL A;  5CVU A;  3OY9 A;  1RI7 A;  5IOY A;  1DU6 A;  4UV8 A;  5LEK A;  5JFR A;  1JTY A;  3DU6 A;  5DCM B;  5J1R A;  3W2V A;  5HVQ C;  5LLQ A;  1KQ8 A;  1DGR M;  1GT0 C;  1HC8 A;  3TBI A;  2NVT J;  1MMN A;  2XF6 A;  4EGZ A;  2EB7 A;  3U1K A;  4HF0 A;  2V9V A;  3N05 A;  5H6Q A;  1DU0 A;  2CQQ A;  3ZR8 X;  2MLK A;  1HQC A;  5IYD J;  4L0Y B;  1LEA A;  2FUG 2;  4B43 A;  2IS4 A;  1B72 B;  1J5Y A;  2WYB A;  4ON0 A;  3IKT A;  2VUM J;  4UB8 C;  1ULY A;  4N9H A;  4Q4Z F;  4IXA A;  2R7Q A;  3S3N A;  4KIC A;  4BL0 B;  3O8G A;  4WXH A;  3A0B C;  2EFP A;  2OJE D;  3BDD A;  4G94 A;  4E7S A;  1IN8 A;  2E34 A;  4F91 B;  2L7M P;  3HHH A;  5ICE A;  1TW2 A;  2OAZ A;  3DKX A;  2XDV A;  4A3M J;  3WG7 H;  4HX8 A;  1JJ6 C;  2ADU A;  4IF4 A;  1B9N A;  3DKW A;  2VE9 A;  3RIR A;  1LUJ B;  1WJE A;  3BTL A;  1BN5 A;  2R7O A;  5FRO A;  4BHC A;  2OU2 A;  4LG0 A;  5JVG F;  4YFA A;  3KYL A;  4BY1 J;  3MEX A;  2L4M A;  2JA2 A;  3HUG A;  5BQT A;  4Y33 A;  2ZBK A;  3CLO A;  2O6G E;  3S8R A;  3LA2 A;  3K4C A;  2K3P A;  4FE4 A;  2OD5 A;  4XK4 A;  4DOZ A;  1EH7 A;  4DBQ A;  2L7K A;  2K9N A;  1Q1V A;  1SVM A;  4XSX F;  3G6E I;  3Q9V A;  3JTG A;  1B8I A;  1UFM A;  4II2 A;  1UHW A;  5F0F A;  3KFW X;  1SMY F;  1XGS A;  2CH0 A;  3J80 Z;  4IJA A;  2Z16 A;  2VKV A;  2CW7 A;  3VPR A;  4I6Z A;  2K9Q A;  3O3K A;  2Z2S B;  1W7P D;  3SXY A;  2OZ6 A;  4LLG F;  1ETQ A;  2ICW G;  4HNV A;  5CPR B;  2GOX B;  2HI3 A;  2JJ7 A;  1V3F A;  3A01 A;  2QBY B;  2HKO A;  2VOO A;  4B4C A;  5D5V B;  1U3E M;  2R7W A;  1GXP A;  4FX0 A;  2M2E A;  4WCG A;  1S72 I;  2QGU A;  1IV6 A;  1YRN A;  4RM2 A;  3EYI A;  3KPH A;  3OIO A;  5E3O A;  1SD5 A;  1FC3 A;  3K1P A;  3ZQQ A;  2YSR A;  1JX9 A;  4A93 J;  2G7H A;  1J2X A;  2DFH A;  2A6H F;  5DS9 A;  3HDD A;  1YIJ I;  2JMW A;  2XUB A;  3HIF A;  2EZI A;  2K9L A;  4EJU A;  1VQ9 I;  4YFB A;  1Z6R A;  4M3F A;  2VJ5 A;  1DUX C;  4KN7 X;  3PQJ A;  2G7U A;  5EGO A;  4N9I A;  2EZK A;  4HA8 A;  1FNN A;  1X1D A;  1QRY A;  3H0G J;  3BJ6 A;  2HDC A;  2HXI A;  1AOY A;  2R4G A;  4LIU A;  5HS7 A;  3KP7 A;  1G4D A;  1X19 A;  2CSO A;  4ASN A;  1V5E A;  2L7F P;  2UWM A;  1JTX A;  4CYD A;  3K4M A;  2L9N A;  2R5Y B;  2KZV A;  3WTY C;  4FIS A;  4U0W A;  2M5W A;  1QO0 D;  1YI2 I;  1UG0 A;  2M0C A;  1TWF J;  3O2P E;  3GZ5 A;  1I6H J;  2NOG A;  4AIH A;  1PDN C;  5H2F C;  2CG4 A;  2HQN A;  1AJN A;  2ECB A;  2IPQ X;  4M9X A;  4U0Y A;  1DPU A;  1E3H A;  2WAQ N;  2O5R A;  4P55 A;  4X0G A;  1UMQ A;  4V2F A;  5E1Z B;  2XRO A;  2PMZ N;  1USS A;  3CF5 F;  1D0Z A;  4MQV A;  4ZYA A;  2K86 A;  1D1C A;  4WF2 A;  1J75 A;  3Q0V A;  2DFF A;  3OYB A;  1ZRD A;  3NRV A;  3B73 A;  1OLT A;  1MH3 A;  1BW5 A;  4M1J A;  4JX4 A;  5ILU A;  2CQK A;  4Y52 J;  3L7W A;  5K1Y A;  2K5C A;  3U2R A;  2ZXH A;  3GEZ A;  1YOV B;  4UVA A;  5ICG A;  3BQZ A;  2XHK A;  4MGR A;  1MSF C;  3RPU A;  3H9Q A;  5B1B H;  3T1B A;  3ML0 A;  4YFN F;  3E0J B;  3RDI A;  2I5U A;  4LG0 B;  2A6E F;  3Q0W A;  2DDB A;  3KP3 A;  5FO5 A;  2RQP A;  3Q3S A;  3M9A A;  3VB2 A;  4CO8 A;  1CGP A;  5GP9 A;  2Y9Z A;  3GX4 X;  1YJN I;  3DTK A;  3L2V A;  1TBX A;  4C3I J;  3SQN A;  4RMN A;  2JUC A;  2M30 A;  4W1U A;  3WG9 A;  1W5C C;  1WJC A;  2W82 A;  5LGN A;  4E57 A;  3BR0 A;  2OTL I;  4G7H F;  1LDD A;  1IRF A;  2BV6 A;  3F22 A;  1B8I B;  1MJA A;  1MBJ A;  1RKT A;  4A5N A;  4BY7 J;  3HRS A;  1LKX A;  3KX2 A;  3ZPL A;  1YW9 A;  4FAS D;  2KIU A;  4AID A;  2ELK A;  1J09 A;  4KNY A;  4BNC A;  1GVD A;  2X4H A;  2X51 A;  2GBY A;  4LD5 A;  4BE2 A;  1J59 A;  4QPO A;  2E1M C;  4PEL A;  3S2H J;  2LYC A;  5EEG A;  4XID A;  4OIO F;  1LE8 A;  1YYV A;  2FE3 A;  3A01 B;  1R00 A;  2IGN A;  3U9G A;  4HX7 A;  1DGW Y;  4BQQ A;  1AU7 A;  1YRN B;  1R5H A;  4EVI A;  1YX3 A;  4BU2 A;  4A0X A;  4K2E A;  3F8F A;  3HYI A;  4II3 A;  4MTE A;  4U88 A;  2DJN A;  3CCJ I;  4CCO A;  2DAO A;  3CF2 A;  1VQM I;  3HM5 A;  1IN6 A;  4BAY A;  2CFX A;  1RNL A;  2QKM B;  4KJZ A;  2KRF A;  2Y69 H;  3MCZ A;  1BBY A;  2ZME C;  4XOP A;  4CZZ A;  5ILV A;  2CUF A;  2R7U A;  3OIP A;  3C2G A;  1P4X A;  4O3M A;  5EGO B;  2XC7 A;  2VN2 A;  4M3G A;  5B66 C;  1MDM A;  2ELJ A;  2JPB A;  4S0H B;  2QLZ A;  3J81 Z;  1GHC A;  2TCT A;  4CZC A;  3SFI A;  1VQK I;  2K27 A;  5D5X B;  2JSC A;  2F5V A;  3LFK A;  2W84 A;  3JRE A;  3GTL J;  4MFE A;  3MKL A;  2OPT A;  3C2H A;  1G3W A;  4CCK A;  2HPM A;  2JT1 A;  1S7E A;  1ZQ3 P;  2QUF A;  3J7Y J;  4F92 B;  2YU9 J;  1MND A;  2XSD C;  3GVA A;  3AG1 H;  1GK9 A;  1ETK A;  3VSK A;  2F2E A;  2WC2 A;  2EQR A;  1UZC A;  4DZJ A;  5DDG A;  1IZ1 A;  1TWG J;  2XSJ C;  2E1N A;  2KJC A;  1LVK A;  3QYB A;  1LEB A;  4CH7 A;  2ZSI B;  1YO5 C;  4XKW A;  3MFK A;  2CU7 A;  3IHU A;  3BG7 A;  2HYF A;  4ZTF A;  4B8X A;  3BG3 A;  5K5R A;  1JE8 A;  2ZJ2 A;  3JRG A;  3CCU I;  2LY9 A;  1YJW I;  3CUQ C;  2K4B A;  1VTN C;  1ACI A;  3OYC A;  3IL2 A;  2V1N A;  2WB1 N;  1B9M A;  1XGM A;  4W97 A;  5TIS C;  5GPC A;  4Y4R A;  3F9K A;  4I0B A;  4Z2Y A;  2E5Z A;  4WX9 A;  3I4M J;  1HOM A;  3LMM A;  2EV0 A;  4ESF A;  5L3F A;  5LHI A;  1KEH A;  5L3E A;  3S32 A;  5K5Q A;  2E60 A;  4IVN A;  5LEJ A;  4G6D A;  3FGR A;  5L3G A;  1JHF A;  4AU7 A;  4RB0 A;  4MNU A;  2MSY A;  5EZG A;  4RM3 A;  3LAP A;  4WWC A;  2NRA C;  2ECC A;  3SJM A;  3PL8 A;  5GTI C;  4ZC3 A;  1GK1 A;  4A3F J;  1HXD A;  1S8N A;  5M5X J;  1LB2 A;  4XQF A;  3OS2 A;  2HKX A;  3JTR A;  2OV7 A;  2LOO A;  4GYI A;  5F64 A;  4XN0 A;  1SAU A;  3ISP A;  4OAY A;  1VFC A;  3IP4 B;  5IT9 Z;  2YR2 A;  3DTE A;  3LSM A;  1ON1 A;  2J5O A;  2Y75 A;  1OCP A;  3FBN B;  1D1B A;  4L9T A;  4P9F A;  2MFZ A;  3EUK L;  2DPU A;  1LDK B;  3DCF A;  4CCN A;  1XG1 A;  2V4J C;  5D4S A;  2ZME A;  2GAU A;  4ZDO A;  2DT5 A;  2FMY A;  1ZRE A;  3HOW J;  2Q2E A;  2R7X A;  3Q5F A;  2HWV A;  4EM2 A;  4HF2 A;  3JSP A;  3K69 A;  3H9G A;  4G6Q A;  5FKN A;  1HBX G;  4M9Z A;  2WY7 Q;  4CCL A;  4XL9 A;  1AI7 A;  1SVO A;  5J4Y A;  5CVJ A;  2HU9 A;  2AQE A;  1K79 A;  2VXZ A;  3BP8 A;  2R5Z A;  5EG0 A;  2MGQ A;  2DOE A;  2IGM A;  3KCC A;  2E2J J;  2VQC A;  1XCV A;  2XF7 A;  3ZQL A;  1C0W A;  3E5U A;  1X58 A;  1KYW A;  4XMY A;  1L0O C;  1P7I A;  4XRM A;  1R1V A;  2IEK A;  2JZY A;  3G71 I;  2LY1 A;  1BR1 A;  4WK8 F;  2GXA A;  2CQX A;  4FQG A;  1TW3 A;  2Y31 A;  5HNF A;  3GFI A;  3CMY A;  3LWF A;  2PBI A;  3GTJ J;  4KA4 A;  4CGZ A;  1MW7 A;  2F5D A;  3HOT A;  5JI6 A;  4OIQ F;  5K7F A;  4G7Z F;  4E56 A;  2XAU A;  3L9F A;  2CYY A;  4BBR J;  2A07 F;  1F4K A;  3DBL B;  1RUO A;  4OIN F;  2ESH A;  5BNG A;  3J7A Y;  4FT8 A;  5FD5 A;  5D5W B;  1D5Y A;  5E20 A;  3LOC A;  2PN6 A;  5CVV A;  3TP3 A;  4HST A;  1J0R A;  3CDL A;  4IPA A;  2FBH A;  4UXN A;  2V1X A;  3CUQ A;  4MO7 A;  5DEQ A;  1DQU A;  2XAH A;  1IDY A;  3DLA A;  4RAZ A;  4RA2 A;  4R1H A;  3U21 A;  2BVL A;  5IYB J;  4J01 A;  1FJL A;  3W2W A;  2DYS H;  3ZQC A;  3JAM Z;  3B6A A;  1VZ0 A;  5IOZ A;  3GZ6 A;  1GM8 A;  2DT7 B;  5M5W J;  4WKT A;  3O6B B;  4YFK F;  2M3A A;  2VPL A;  3FXR A;  4YEJ A;  2QQA A;  3M7G A;  3WOD F;  4BUP A;  3S14 J;  3KP6 A;  1FYM A;  3TOA A;  3QU3 A;  3VOE A;  2BY2 A;  1FZP B;  1MBE A;  2P0W A;  4MLO A;  3DEU A;  3IH4 A;  1FMV A;  4PDK A;  4UVC A;  2HS5 A;  5CLS A;  2ZJQ F;  3DLL F;  2PEX A;  2O9L A;  2DK5 A;  3TO9 A;  5J1U A;  3PJR A;  5HDG A;  1XSV A;  5DM7 F;  1FLI A;  2O8X A;  3CCY A;  1YIO A;  2HYJ A;  5GTH C;  4X6A J;  3AG3 H;  1FP2 A;  1ODD A;  3LA3 A;  1T08 B;  1WFX A;  2E1M B;  3HSE A;  1Y1V J;  4CSW A;  1FP1 D;  2DA5 A;  3QYE A;  4XBF A;  2NS7 A;  3RZD J;  5BPI A;  4ABZ A;  1UB9 A;  2HOE A;  2M4G A;  3IRQ A;  3KYC B;  2F5C A;  2IGK A;  3D5R C;  3RSN A;  3W6J B;  4IRI A;  2E1O A;  1JXS A;  3QRF F;  1B59 A;  2ZJR F;  1D8K A;  2ACJ A;  3DXJ F;  4DNC A;  3GTQ J;  4QWQ A;  1T0F C;  2FX0 A;  2P4W A;  3UR3 C;  2R7Z J;  2CJJ A;  1IN7 A;  2ZME B;  3DTI A;  3KE2 A;  4DGW B;  1XDS A;  3W6K B;  1FEX A;  2QM3 A;  4I02 A;  5GAH J;  1MH4 A;  2LTP A;  4Y17 A;  4IHS A;  1D0Y A;  2AQF A;  3HRU A;  4IEJ A;  4DYQ A;  5FKL A;  5K7H A;  2GIZ A;  1BC8 C;  2M9H A;  2K9S A;  1A31 A;  1OKR A;  2NVX J;  4LLN A;  3I56 I;  3HHG A;  5EG0 B;  5FJ8 J;  2R7V A;  1MGT A;  5F1J A;  2RQQ A;  4RAF A;  4EJV A;  3RPU D;  1JUS A;  3OYH A;  5E1X A;  1B1B A;  1XB4 A;  3I54 A;  1Y1W J;  3QP6 A;  1MBH A;  2DQR A;  1FTT A;  1SD6 A;  2L0K A;  3HOV J;  4FX4 A;  2RC4 A;  4XNF A;  2V26 A;  3CJR B;  2IP2 A;  2YU3 A;  5E1W A;  3OWT A;  2E2I J;  4A3C J;  4AYB A;  3OYN A;  1SEU A;  1PNK A;  2ADV A;  1E0E A;  1JKO C;  2JTV A;  3DPT A;  2MA3 A;  2GIV A;  5FFX A;  2M8G X;  1AJQ A;  4ZH4 F;  1IRG A;  2QSF X;  3F3X A;  4L9N A;  4JP0 A;  2EPF A;  2EIL H;  5EF6 A;  2GA2 A;  1FBU A;  1W36 C;  1VND A;  2VQG A;  2WTE A;  1BL0 A;  2DW4 A;  2IT0 A;  2RDP A;  3RKQ A;  3LSJ A;  1OCC H;  4GCV A;  3FK6 A;  4LGW A;  4XKV A;  4U0V A;  1Z91 A;  4MIM A;  2P6T A;  4QPQ A;  3UKG A;  2FEZ A;  1ZGJ A;  4XON A;  4IRH A;  1EF4 A;  5M3M J;  3CUQ B;  1P4A A;  4A3L J;  4OOI A;  3H35 A;  2QQ9 A;  1CF7 A;  1NK3 P;  3DPL C;  4A3G J;  2VE8 A;  2MH9 A;  2FBI A;  4UB6 C;  1XTA A;  3FM3 A;  1MSE C;  1APL C;  2P8T A;  4PJL A;  1GLN A;  2OBP A;  4KIB A;  3TDZ C;  3CES A;  3ERM A;  1A6Q A;  1TNT A;  4RS8 A;  4RDU A;  1TZL A;  3H0D A;  1XMX A;  5HS8 A;  5K5O A;  2FBK A;  3GCM A;  1XSD A;  2PJP A;  1T39 A;  2DLL A;  1KU2 A;  2OA4 A;  3VYR B;  1G6N A;  2WYD A;  3CMA I;  3SRC A;  2MBF A;  2C6Y A;  2VC1 A;  1BI2 A;  4AVZ A;  4NQW A;  3JRD A;  4LIV A;  4M9S A;  1S6L A;  3QPT A;  2EK5 A;  4BE1 A;  5D8L B;  2XGD A;  3HSR A;  1FOY A;  4DYC A;  2CO5 A;  1O3S A;  2HYG D;  4GO1 A;  4O5V A;  3CME I;  5H20 A;  1MNE A;  3TKY A;  4BEH A;  1ETW A;  4BJ5 C;  1F43 A;  2M7A A;  3FXJ A;  2V6C A;  1W1W E;  3V4G A;  1GK0 A;  4ESJ A;  5D5U B;  2ME6 A;  5BOX A;  1T0F A;  3BG5 A;  1A35 A;  3K0L A;  5HS9 A;  2JPC A;  4EEF G;  3E1S A;  1X1A A;  1XS9 A;  5CVR A;  2WYC A;  4YRV A;  1K4T A;  1V4R A;  3C7J A;  5A2Q K;  2L5Q A;  3DBH B;  4PJ0 C;  4L9V A;  2H6B A;  2VJI A;  1ONV A;  2IGO A;  3SDG A;  2X0L A;  4QTR A;  1H9G A;  2O03 A;  3ZXS A;  4LB6 B;  3A4C A;  1W5T A;  2W85 A;  2V1U A;  1R5G A;  5ERI A;  5B1A H;  1PNM A;  1WHU A;  2KHM A;  3GUD A;  5DUI A;  3CTA A;  3VEP A;  1Z77 A;  4MFD A;  3QQA A;  2ID6 A;  1TWH J;  1BJA A;  2XAS A;  2NAZ A;  4UVB A;  1AI4 A;  2V1D A;  3FMS A;  1AHD P;  2J5P A;  4PJN A;  2IRF G;  4IHT A;  4S05 A;  4LLL A;  4Y15 A;  2QSG X;  1WRJ A;  4QLC U;  1LQ1 A;  5IPA A;  3E3V A;  3LST A;  1TWC J;  2ZXW H;  3IC7 A;  5JHU A;  1GXQ A;  4EJO A;  4HV6 A;  1MMS A;  3HKZ A;  3TGN A;  1F1Z A;  4HZF A;  2B9S A;  3G1M A;  2BW3 A;  1YIT I;  3GBG A;  3LL7 A;  3NAR A;  2DMP A;  2MYS A;  4ZDP A;  3ABM H;  3DQV C;  2H09 A;  2D5V A;  3KEQ A;  6PAX A;  5FLX K;  4YG2 F;  2DOD A;  4E70 A;  2VON A;  3H5N A;  2LKX A;  1WJF A;  2L02 A;  3D5S C;  4JX6 A;  3H3V K;  4DW6 A;  2ZO4 A;  2JA7 J;  3BTJ A;  4HPQ A;  1I3Q J;  1QZE A;  3C2B A;  5FLV A;  3E6B A;  5HNH A;  2WA0 A;  4HBL A;  4A69 C;  2D1H A;  3H9J A;  3RKY A;  5ICC A;  1RPW A;  1IRZ A;  1E3P A;  2LP0 A;  3ABL H;  3FMQ A;  3L1P A;  2MW8 A;  1CF7 B;  3SZT A;  3K4K A;  3HEF A;  4XOR A;  2Q0O A;  2EBI A;  1Z1D A;  3VDX A;  4HLY A;  4C2T A;  4PJJ A;  2O61 A;  3CC2 I;  2JA8 J;  3L2W A;  2HTS A;  4GYG A;  3V7R A;  4A3K J;  1A04 A;  4Q5S F;  3SZP A;  3CJN A;  1K4S A;  1RUN A;  1OMI A;  2A69 F;  4HSR A;  4G6T B;  1IDZ A;  2WV0 A;  3KYD B;  4CUG A;  4BDZ A;  3J7A O;  4EM1 A;  3HGY A;  1PVE A;  2X9D A;  1JT0 A;  3HL2 A;  4IHY A;  3CCV I;  3BG9 A;  4OIR F;  1XC5 A;  4NQW B;  2DK8 A;  2BGC A;  1Y39 A;  3WTU C;  1A6I A;  2W24 A;  2Y0S N;  5D6F A;  2YX4 A;  1ZLJ A;  3HB9 A;  3R0J A;  2GXB A;  5BS6 A;  1XSX A;  2BHZ A;  4D7N A;  1DDN A;  1HCR A;  2Z9O A;  3C3W A;  2NXN B;  3CDI A;  3ASN H;  4UUS A;  2JSP A;  4WXC A;  3BPV A;  3RYP A;  2DTR A;  1WJA A;  2A05 A;  1Z7L A;  3FKJ A;  1FT9 A;  1XN7 A;  1J9I A;  2YPR A;  4L18 B;  2XKO A;  1E2X A;  1AI5 A;  3GTK J;  5D6E A;  2ZXJ A;  1IV8 A;  1ETX A;  1OYI A;  1SFX A;  1G3T A;  2E36 A;  2RGV A;  3OS1 A;  4KIS A;  4G8X A;  3TQN A;  4LOC A;  1U78 A;  4IQJ A;  1U9O A;  3TO7 A;  1ETO A;  2DOA A;  3DFG A;  3QWL A;  1S5L C;  3BR3 A;  3R61 A;  1IO2 A;  1JVZ A;  4CYC A;  3K4N A;  3S17 J;  4MEX F;  1YW7 A;  1EV7 A;  3OOP A;  3HTS B;  2LVS A;  3QYF A;  2JWT A;  1R4N B;  2Q1Z B;  4U87 A;  4I2O A;  1Z05 A;  5FB2 A;  3ZP5 A;  3DBR B;  1E3O C;  3E5Q A;  2FRH A;  1A36 A;  1I1G A;  4I98 B;  3KP4 A;  4G9Y A;  3MKY B;  1HSJ A;  3HUG B;  1YFH A;  1R22 A;  1VI0 A;  2BW3 B;  1O3Q A;  5IT3 A;  3OSG A;  1WJB A;  2R7F A;  1UST A;  3RYR A;  4RB1 A;  3FKI J;  2KRC A;  2UUZ A;  3S2W A;  1O7F A;  5E18 F;  3P9C A;  3M4O J;  2KIQ A;  4R8H A;  2OCE A;  2X6W A;  4IQ4 A;  3CC7 I;  2X1E A;  3IH2 A;  2L2O A;  3KP5 A;  3PQK A;  3S15 J;  4F52 A;  3E97 A;  3JRB A;  2CWE A;  3PIO F;  4BQN A;  3IWF A;  3ZMT A;  1O3T A;  3G2B A;  1WSU A;  5E17 F;  3PO3 J;  1FSE A;  3DP7 A;  2MH2 A;  1SMT A;  3FDY A;  5F04 A;  1FBQ A;  2KRH A;  1Y6I A;  3ULQ B;  3L00 A;  4CCM A;  1KU3 A;  1KQ9 A;  2ESN A;  3RKX A;  1XCB A;  3S1N J;  3O8H A;  5KK1 A;  1TT5 B;  1TWA J;  2F4O B;  3WHC A;  3PUB A;  4JX5 A;  1OIS A;  3K70 C;  3H3Z A;  2PLY A;  5JLW A;  2VKE A;  3K2A A;  1QQI A;  3BPX A;  2VC0 A;  1B6A A;  1XDU A;  4XRS A;  2JQ7 A;  1FM2 A;  2PX9 A;  3JTQ A;  3OR2 C;  4Y7N J;  3K6G A;  4I0A A;  3OYK A;  1K61 A;  4D9J A;  4KIF A;  4A3D J;  2XPW A;  5J8F A;  2EV6 A;  3JCU C;  1QBJ A;  3C18 A;  1MMA A;  2KP6 A;  3ELK A;  1F9N A;  2M87 A;  2QF7 A;  1HDD C;  1KEC A;  4ZJZ A;  1ZYR F;  2M8E A;  4A3B J;  2DA3 A;  3L2C A;  1WGX A;  2OQG A;  3BCB A;  1W0U A;  5E8I A;  1IN5 A;  2DDA A;  2QCO A;  4RGU A;  3KLO A;  4B1R A;  1VQ8 I;  4UUS B;  1UJ8 A;  3HRM A;  3L94 A;  4DJA A;  3CP8 A;  3E5X A;  2P5K A;  4C30 A;  1N25 A;  2KIM A;  1R6R A;  2DMT A;  1CQT A;  4BE0 A;  3ABT A;  1CP9 A;  3E6M A;  4EMS A;  4HNU A;  2UXN A;  3N4M A;  5LHH A;  2GXG A;  1K83 J;  1D0X A;  2DN0 A;  3F8C A;  4KYW A;  4YEL A;  4E55 A;  3CO6 C;  4P9U A;  5TJJ A;  1OR0 A;  4A3J J;  3ZMZ A;  1B4A A;  1V5F A;  3GTG J;  3OYA A;  2FA5 A;  4HYE A;  4RB2 C;  2PG4 A;  5F27 A;  5EJC A;  2AXL A;  2XB5 A;  4CYC B;  3M1E A;  3LA7 A;  2KQR A;  2VL8 A;  4KFC A;  2R93 J;  2LSO A;  3CJT B;  5ILS A;  4AD9 A;  2DT6 A;  3M8F A;  2RRE A;  3I64 A;  1FXV A;  4HDU A;  3VYT B;  3S16 J;  2P7C B;  3V7C A;  1YW8 A;  3FHN A;  2M7B A;  2COB A;  3TMO A;  3LQR A;  3GFM A;  1H88 C;  3I55 I;  3DEW A;  1DPR A;  3ZRG A;  4ZTJ A;  2KDO A;  2L54 A;  3V8L A;  3P7N A;  2E35 A;  3UNG C;  2BY1 A;  4M3B A;  1RES A;  4LB5 A;  2IS6 A;  4XLC A;  3SFZ A;  1GV2 A;  3PM1 A;  2P7V B;  3FIW A;  4V2G A;  3HC7 A;  1BR2 A;  1S29 A;  2JVG A;  4K2F A;  4RGS A;  3HZJ A;  2Y48 A;  1MBG A;  2TRT A;  4RBO A;  1O7L A;  3G4S I;  2LFB A;  4XOT A;  2ZC2 A;  2LKP A;  4FE7 A;  1Z3X A;  2LNB A;  3T5X A;  2FNP A;  2RNJ A;  3EQL F;  5DCF A;  3TOB A;  4BGD A;  2A3S A;  5LGU A;  2XB0 X;  1K7D A;  1LE8 B;  3VYU B;  2AHQ A;  2LH9 A;  2WY8 Q;  3ESW B;  4AUX A;  1GM7 A;  5CVI A;  2ZFU A;  1S3J A;  3L2U A;  2DMQ A;  4A12 A;  2DXI A;  1QHH D;  3IRR A;  2P6S A;  3OS0 A;  1QA6 A;  4F93 B;  3KET A;  3S3M A;  5B5E C;  1U0J A;  3LSI A;  2EIK H;  1Q1H A;  1TL8 A;  1VQ4 I;  1Z21 A;  1R36 A;  3K10 A;  5JHF A;  3G1O A;  4HLX A;  3V8J A;  5E79 C;  3AAF A;  1I3A A;  1YHQ I;  2BY0 A;  4A0Y A;  3E6D A;  1SVL A;  4DIQ A;  2F5F A;  3FMR A;  1OPC A;  1PUF A;  3KIO A;  3LSG A;  1MDM B;  2B7E A;  3C1D A;  3GFJ A;  3FZV A;  4L0Z B;  5FLM J;  1SFK A;  1TLH B;  1I6X A;  1X1C A;  4PJM A;  4CXF A;  1MBF A;  3LNQ A;  1W0T A;  5LRR A;  2CRG A;  1O57 A;  2EZH A;  3A02 A;  1W36 D;  4ZZD A;  3SDB A;  1UCR A;  2FJ1 A;  1KZH A;  3TO6 A;  2K4J A;  1Z7U A;  1LPQ A;  2F5E A;  4BS9 A;  3H36 A;  2D2W A;  3CMM A;  1MIJ A;  1ZR4 A;  2XIG A;  1IF1 A;  4M72 A;  4PFO A;  2H6C A;  2VBX A;  4CCJ A;  2F48 A;  1IGN A;  2KL4 A;  3GTO J;  3RZO J;  1FYK A;  2EFQ A;  4IHV A;  2L7Z A;  4FHT A;  3FXO A;  3RJP A;  4BKX A;  2E7X A;  2TDX A;  3QP5 A;  2AE5 A;  4G12 A;  1HKQ A;  1QHG A;  1LVA A;  2VLA A;  1O3R A;  1GHD A;  2IA1 A;  1HKS A;  1FOW A;  3PNT A;  3F6V A;  2X6O A;  2XKP A;  2RAE A;  1P92 A;  3J7Z I;  4H0E A;  3I4N J;  2GQQ A;  2W57 A;  2COM A;  3SEQ A;  2R7R A;  2MLG A;  1AI6 A;  1WI3 A;  4C9Y A;  2A5W A;  4AVP A;  3DPU A;  1Z9C A;  2DU9 A;  3X2Q H;  5JR3 A;  2PFB A;  3AG4 H;  2A5Y B;  2A68 F;  3LQQ A;  3TED A;  1VF9 A;  3QPL A;  2GA1 A;  1IW7 F;  2FOW A;  3J80 K;  4KIT B;  2MD5 A;  3EDP A;  3F8N A;  4HV5 A;  2G0E A;  1RRJ A;  3I59 A;  2X6Y A;  2IBD A;  3WGI A;  3OYM A;  4H4K C;  3CCL I;  2QEN A;  2WBM A;  1R58 A;  1IUY A;  1U8B A;  1R5I D;  3ASO H;  1Z3Y A;  4AC0 A;  2ZXI A;  3SYT A;  2E19 A;  2P81 A;  4UHT A;  4XLE A;  1HW2 A;  2I8D A;  2WAQ A;  3DV8 A;  3KP2 A;  4JQF A;  2O7O A;  1BM9 A;  3D1N I;  2QEX I;  2PMZ A;  2XRN A;  5IP6 A;  2YS9 A;  3SEZ A;  4GFB A;  3A2K A;  3HTU A;  3EUA A;  4M73 A;  1BOB A;  3GTP J;  3PUF A;  1MJ9 A;  3WU2 C;  2IAI A;  2CUJ A;  3OR1 C;  2JRM A;  3HOS A;  3HSF A;  4S04 A;  1WVR A;  5C44 J;  2LK2 A;  4EQQ A;  3ZQG A;  5D4R A;  2ZJP F;  3GO5 A;  3K4L A;  3WGG A;  5HDK A;  2ZKZ A;  3CLQ A;  1IUF A;  4M3D A;  3AFH A;  3ZMS A;  1QVT A;  1X3U A;  5K7Z A;  1TQP A;  1QPM A;  1LFU P;  1BIB A;  1AA7 A;  2JK3 A;  4XKC A;  2M0M A;  1WKM A;  2R0Q C;  5DCM A;  2Q2E B;  3F0C A;  3ZOB A;  5HLG A;  4NHJ A;  1WWX A;  1K78 A;  4TV7 A;  2R7T A;  2ME0 A;  2OCC H;  1JI8 A;  3ONQ A;  2HVQ A;  2E7W A;  3FXU A;  1TC3 C;  2QSH X;  2R5Z B;  5C3E J;  1ZGW A;  3ZQ7 A;  1GVJ A;  1YLF A;  4L9J A;  5LBQ A;  2GLO A;  4NC8 A;  3BJO A;  1PUF B;  3QPH A;  2CUE A;  1VQO I;  2ISY A;  2LRD A;  2H8W A;  1BR4 A;  1IAW A;  2Y9Y A;  2DTZ A;  2Y2Z A;  2AS5 F;  3DF8 A;  4E6K G;  1X4O A;  4NBQ A;  2H8R A;  4M6Y A;  4YIF A;  1H8A C;  4IZZ A;  1FSH A;  2V9P A;  2XV4 S;  4OIP F;  5EDN A;  1XGN A;  5J47 A;  3M07 A;  1GDT A;  3S2D J;  3TP0 A;  3VSL A;  4A5M A;  4U7D A;  3U1D A;  2VT3 A;  4ANJ A;  1R9T J;  2W00 A;  3JRC A;  1HF0 A;  3S1M J;  3GZN B;  4IRG A;  4L5I A;  3NQO A;  3WTV C;  3G73 A;  2IS1 A;  2KPM A;  2STT A;  1BC7 C;  2O8K A;  2QA4 I;  3HJE A;  2EH3 A;  5HDN A;  4DQ2 A;  5C4X J;  2V9K A;  2CMP A;  4R79 A;  4M6X A;  3NEU A;  4KT5 C;  1ETY A;  2LG4 A;  2NNN A;  4XM3 A;  3CC4 I;  1F5T A;  2I10 A;  4A0Z A;  4FCY A;  3GYH X;  2K85 A;  3V7S A;  1ZRC A;  2JN6 A;  3ZQF A;  3OYJ A;  2KMU A;  2BZT A;  2XAJ A;  1G2H A;  5TGT A;  3GLX A;  3JRH A;  4D1Q A;  4IHX A;  3CCS I;  4I01 A;  1FIP A;  2EJR A;  2M4K A;  4XRS G;  1RR7 A;  5GAG J;  3KZZ A;  2EV5 A;  3CCR I;  2W7N A;  2YX7 A;  3K3W A;  1LJ9 A;  1FXH A;  2Z33 A;  5LD2 C;  2VI6 A;  3FX3 A;  2GZW A;  1WH7 A;  2MAB A;  3H1C A;  4XLF A;  1EH6 A;  3FXM A;  3FXQ A;  4E4H A;  3I59 B;  3NWT A;  3R6S A;  3MZH A;  4ESB A;  4JYK A;  4QIW N;  2B63 J;  4JBA A;  2QBY A;  5HOD A;  4PFP A;  3WTT C;  2JUG A;  3GFL A;  3QPS A;  1JT6 A;  2DCE A;  3TW6 A;  5GAD J;  5EEA A;  5C4J J;  3BY6 A;  3AL0 C;  5J1Y A;  2V7F A;  1IXR C;  1RZ4 A;  2QZ8 A;  1ZRF A;  1T98 A;  3I0T A;  1RIO H;  3F6O A;  2JA5 J;  3HG9 A;  4HG2 A;  1S7A A;  2PQ8 A;  2E2H J;  2XVC A;  2O3F A;  4P5O A;  2KIF A;  1ZEL A;  1UHM A;  2RKH A;  1I1S A;  3GLL A;  2NVU B;  2VPR A;  2BHY A;  2UXX A;  2HZD A;  1BJZ A;  5J3L A;  4DBR A;  3FHZ A;  1ZK8 A;  3DKY A;  3OIQ A;  1I50 J;  2WB1 A;  1MBK A;  3M1C A;  3MQ0 A;  4LJZ F;  4A2U A;  2VQH A;  3OYE A;  3J81 K;  5F6F A;  4LIT A;  1K5S A;  2ZCW A;  1KON A;  1U9N A;  1QGP A;  4MTD A;  3IH3 A;  4HNT A;  4WKV A;  3K4B A;  1OJL A;  1VQL I;  2IA2 A;  1XMK A;  4B09 A;  3REO A;  1J7K A;  1K78 B;  4Z6Y A;  1X2N A;  2B0L A;  1BI0 A;  3WU1 B;  4ITV A;  4IX7 A;  4AM3 A;  2LLK A;  2PJR A;  3HGG A;  1MMG A;  1YS7 A;  4XKB A;  5FRN A;  4RLF A;  2OTJ I;  3JRF A;  1SFO J;  2K7L A;  1MJB A;  3DU5 A;  1S7O A;  3OYG A;  3QU6 A;  3EET A;  3GME A;  2AXT C;  1TQM A;  3GF2 A;  3IUO A;  3MKW B;  5FFZ A;  4HRI A;  3FXK A;  3FIS A;  4D7M A;  3H92 A;  4X1E A;  2DA1 A;  2W48 A;  1MNM C;  3HBL A;  2BVM A;  1ENH A;  4JK1 X;  3FGT A;  2DA4 A;  3PNV A;  3HXL A;  1WCM J;  1XGO A;  2STW A;  2L9V A;  3WGH A;  2R3S A;  4A3I J;  5KCM A;  1NG6 A;  4Y13 A;  4BDY A;  1R4M B;  1WZ2 A;  4XR6 A;  2IVM A;  4GDF A;  2KJB A;  2E71 A;  3BZC A;  3WE3 A;  1ON2 A;  1R7J A;  3OYD A;  1FBS A;  4G7O F;  3L91 A;  4IL6 C;  1HW1 A;  3I4P A;  3KZI C;  3K70 D;  1GKF A;  2IA0 A;  4B48 A;  2HOA A;  1EH8 A;  3ZMD A;  4ZDL A;  1Y8R B;  1POG A;  4IOA F;  1IG7 A;  2VT2 A;  4J19 A;  3OL3 A;  2VIX A;  4XRF A;  4XSZ F;  4ENM A;  2VXD A;  3KZY A;  2VQL A;  3MZ8 A;  2WWY A;  1QPI A;  2XPU A;  3E7L A;  5KAF C;  1FWZ A;  4UUT A;  1W4M A;  3A03 A;  3TDU C;  4BYY A;  5LHG A;  4U7B A;  3H5A A;  2K9M A;  4HQM A;  4YII A;  2Y30 A;  3P9K A;  1KA8 A;  3S8P A;  1R49 A;  3LFU A;  2DFI A;  4IHW A;  1N78 A;  2VJJ A;  1QNT A;  3W3C A;  3OYF A;  1XX5 A;  1SD4 A;  1TTY A;  2UZK A;  2R7S A;  4GGG A;  1IN4 A;  5DM6 F;  1FTZ A;  4ZZL A;  1G8X A;  5B3S H;  5JVT A;  2H94 A;  3RPQ A;  1KU7 A;  5DD4 A; 
#chains in the Genus database with same CATH homology
 3BLY A;  3BCB A;  1WJ5 A;  1MW7 A;  3HOT A;  4OWR B;  3SRB A;  4N4N B;  4E56 A;  2XAU A;  3S93 A;  2OUM A;  4XLH A;  3EUH C;  4NUB A;  1HA8 A;  1PJR A;  4Y3O A;  4BJT A;  3CJQ B;  3J7A Y;  3L94 A;  4DJA A;  2CS3 A;  3CP8 A;  3CP2 A;  1X4P A;  4C30 A;  1R6R A;  4GRI A;  4BE0 A;  4HST A;  4BEH B;  1CP9 A;  1UEL B;  4HNU A;  2Z1D A;  1G59 A;  1EA3 A;  1DQU A;  4BJ6 C;  3DLA A;  3PSF A;  4FET A;  3U21 A;  4J01 A;  3NWS A;  2BVL A;  1QU3 A;  1GM9 A;  3W2W A;  1D0X A;  1VZ0 A;  1GM8 A;  4BQO A;  2DT7 B;  4YEL A;  4WKT A;  4E55 A;  1OR0 A;  2M3A A;  2F4I A;  2RNG A;  2LY2 A;  2VPL A;  1K6Y A;  3BG6 A;  4YEJ A;  1V5F A;  5KNL A;  3VYS B;  3OYA A;  4BUP A;  4NC7 A;  2X85 A;  2LBF B;  2P0W A;  4MLO A;  2KQR A;  2VL8 A;  3OYI A;  1FMV A;  2WAD A;  2XF5 A;  3M8J A;  3OOU A;  2CW8 A;  2DT6 A;  2IXS A;  5CKT A;  4WKU A;  2RRE A;  2IS2 A;  1FXV A;  3A1Y A;  3PJR A;  4RLQ A;  3VYT B;  3ZGK A;  4E7Z A;  2VB6 A;  3LSH A;  3OY9 A;  3FHN A;  2M7B A;  2PJR B;  3TMO A;  2L9S A;  3DU6 A;  3W2V A;  5HVQ C;  4B44 A;  3OMY A;  3ZRG A;  1UAA A;  1DGR M;  4ZTJ A;  3MD2 A;  3TBI A;  1WFX A;  2KDO A;  2E1M B;  4CSW A;  1MMN A;  2XF6 A;  3UNG C;  2X1C A;  3QYE A;  3N05 A;  2IS6 A;  4XLC A;  2M4G A;  3ZR8 X;  2F6C A;  2FUG 2;  4B43 A;  2IS4 A;  3HC7 A;  2WYB A;  2IGK A;  1BR2 A;  3D5R C;  2JVG A;  3RSN A;  5FRM A;  3S3N A;  4K2F A;  2R7Q A;  4BL0 B;  5CQE A;  4E7S A;  4YF9 A;  1T0F C;  1N75 A;  2HPI A;  4XOT A;  4F91 B;  1S9H A;  3UR3 C;  4OAZ A;  3W2A A;  1Z3X A;  4BGD A;  3DTI A;  4DGW B;  1K7D A;  2BOL A;  3VYU B;  2LH9 A;  2WY8 Q;  3DKX A;  2XDV A;  1GM7 A;  4JOM A;  1D0Y A;  3L2U A;  2ZFU A;  2AQF A;  2DXI A;  1QHH D;  3OYL A;  1WJE A;  3OS0 A;  2R7O A;  5FRO A;  4F93 B;  2DJI A;  3S3M A;  4YFA A;  1U0J A;  3LSI A;  2R7V A;  3KYL A;  1Z21 A;  2JA2 A;  2RQQ A;  3K10 A;  5JHF A;  3RPU D;  4Y33 A;  3OYH A;  3S8R A;  2V6E A;  3K4C A;  2K3P A;  4DIQ A;  4XNF A;  2V26 A;  2HDW A;  3CJR B;  4DOZ A;  4DBQ A;  2L7K A;  3OWT A;  3LSG A;  2HQA A;  3AL0 B;  4AYB A;  3OYN A;  1PNK A;  1YX5 A;  2ADV A;  4II2 A;  1SFK A;  2CV2 A;  1X1C A;  4PJM A;  1E0E A;  2CH0 A;  3DPT A;  2Z16 A;  1P9Q C;  2LC2 A;  3D5L A;  2CW7 A;  1W36 D;  1AJQ A;  4P1W A;  3SDB A;  3AKZ A;  2Z2S B;  2CUZ A;  4BXF A;  1W36 C;  2VQG A;  4BS9 A;  3L2Q A;  5CPR B;  2GOX B;  1FMW A;  4XLA A;  3CMM A;  4XKV A;  1MMD A;  4QPQ A;  4PFO A;  4XON A;  2R7W A;  4CCJ A;  2CV1 A;  2VKD A;  2KL4 A;  4RM2 A;  3H35 A;  3SZG A;  1LFP A;  3DPL C;  3MKZ A;  3ZQQ A;  1JX9 A;  2AE5 A;  1QHG A;  4XN3 A;  2VLA A;  1GHD A;  4C2U A;  2A6T A;  2VAS A;  1GLN A;  4PJL A;  1JW0 A;  3PNT A;  1X1B A;  2K9L A;  3CES A;  4YFB A;  3H0D A;  1TZL A;  2VJ5 A;  1PYV A;  3BC8 A;  4K2G A;  1K5Q A;  2R7R A;  3SEQ A;  1AI6 A;  1TT0 A;  3MMY B;  1X1D A;  4C9Y A;  2A5W A;  3VYR B;  2WYD A;  3SRC A;  2R4G A;  3DPU A;  4LIU A;  3IAS 2;  1X19 A;  4AVZ A;  1V5E A;  2UWM A;  4LIV A;  4BAC A;  3DEE A;  3K4M A;  2L9N A;  2KZV A;  5HLT A;  3CZ6 A;  4KIT B;  4BE1 A;  4HEA 2;  1NG7 A;  1UG0 A;  2X6Y A;  3OYM A;  1MNE A;  4H4K C;  4BEH A;  4BJ5 C;  2M7A A;  1GK0 A;  2WBM A;  1AJN A;  3K4J A;  1V5G A;  1Z3Y A;  4EAT A;  3IAM 2;  2ZXI A;  3SYT A;  1ERD A;  4XLE A;  1AJP A;  2I8D A;  2WAQ A;  3E1S A;  2O5R A;  4JQF A;  4X0G A;  1X1A A;  2WYC A;  4YRV A;  2PMZ A;  5CQG A;  1D0Z A;  4ZYA A;  3SEZ A;  3A2K A;  2L5Q A;  1D1C A;  3EUA A;  1BOB A;  2ZSH B;  2VJI A;  2IGO A;  2CUJ A;  3OR1 C;  3HOS A;  3OYB A;  4M1J A;  3L2R A;  1OLT A;  3RQ4 A;  3ZXS A;  3A4C A;  1DP3 A;  3K4L A;  2AE4 A;  2K5C A;  3AFH A;  1PNM A;  2KHM A;  2ZXH A;  3VWB A;  3H9Q A;  1OR7 C;  3ML0 A;  1AA7 A;  3PFY A;  3E0J B;  4XKC A;  2M0M A;  1AI4 A;  2OC6 A;  2Q2E B;  2HVS A;  4E7L A;  4PJN A;  2R7T A;  1JI8 A;  3DTK A;  3ONQ A;  2HVQ A;  3L2V A;  4RMN A;  1N77 A;  1WJC A;  2W82 A;  3HKZ A;  1E3A A;  4E57 A;  4NC8 A;  2BW3 A;  2LRD A;  1BR4 A;  2GOM A;  3GBG A;  3LL7 A;  2MYS A;  4E7J A;  4B47 A;  4IKF A;  4J00 A;  1LKX A;  3DQV C;  4ZDP A;  3KX2 A;  4E6K G;  1PNL A;  1X4O A;  4FAS D;  1J09 A;  3H5N A;  2WAF A;  1WJF A;  3D5S C;  4IZZ A;  2X51 A;  4BE2 A;  3FBI B;  4QPO A;  4PEM A;  2E1M C;  4PEL A;  2LYC A;  2MC4 A;  1YE9 A;  3EPZ A;  3VSL A;  4HPQ A;  3BCA A;  5HNH A;  2WA0 A;  2IGN A;  4ANJ A;  2W00 A;  2UV1 A;  2IS1 A;  3H9J A;  4E7I A;  1DGW Y;  4BQQ A;  2KPM A;  1YX3 A;  4BU2 A;  3K4K A;  3S3O A;  4II3 A;  4XOR A;  2V9K A;  2CMP A;  2MD0 A;  3VDX A;  4R79 A;  4PJJ A;  4C2T A;  4CCO A;  3L2W A;  3CF2 A;  4XM3 A;  2LG4 A;  2NOJ B;  4KJZ A;  2QKM B;  3RCO A;  3OL4 A;  4XOP A;  2R7U A;  2KLO A;  5KHD A;  4HSR A;  3OIP A;  3C2G A;  3OYJ A;  2KMU A;  2XC7 A;  4G6T B;  5TGT A;  4BDZ A;  2ELJ A;  4CUG A;  4D1Q A;  1WJD A;  2VKH A;  2M4K A;  3HL2 A;  1T95 A;  4CZC A;  2W7N A;  3K3W A;  1FXH A;  4NQW B;  5LD2 C;  4XLF A;  2MAB A;  2F5V A;  2Y0S A;  2AE3 A;  2WYE A;  4E4H A;  3QOD A;  3NWT A;  4F55 A;  2CFO A;  3C2H A;  4CCK A;  4PFP A;  2HPM A;  2JUG A;  2DCE A;  3LSK A;  2E5N A;  4F92 B;  1MND A;  1GK9 A;  2JSP A;  3H5R A;  3AL0 C;  2V7F A;  3VSK A;  4B3X A;  2X1D A;  1WJA A;  1Z7L A;  3FKJ A;  3HG9 A;  4HG2 A;  4WKS A;  3ZCO A;  1AI5 A;  2XSJ C;  3PNY A;  4P5O A;  1LVK A;  3QYB A;  1ZEL A;  4CH7 A;  2ZSI B;  4XKW A;  3OS1 A;  4KIS A;  2JVH A;  3BG7 A;  4ZTF A;  4IQJ A;  2HZD A;  4DBR A;  3DKY A;  2DOA A;  3OIQ A;  2QKL B;  4PSX A;  2X6X A;  3OYC A;  2V1N A;  2WB1 A;  3M1C A;  2LBF A;  2VQH A;  4Y4R A;  3OYE A;  1JVZ A;  3F9K A;  4LIT A;  1K5S A;  3K4N A;  2WAE A;  4KT6 A;  5LFA A;  3I9V 2;  2E5Z A;  1KON A;  3KEY A;  1H2G A;  3QYF A;  4HNT A;  3K4B A;  4WKV A;  3LMM A;  3I3L A;  1KEH A;  3S32 A;  2Q1Z B;  4U87 A;  2E60 A;  3DWL E;  4ITV A;  3HPG A;  3SRA A;  4IX7 A;  2PJR A;  4AU7 A;  1MMG A;  5FRN A;  4XKB A;  1D1A A;  4RLF A;  4RM3 A;  1GK1 A;  3PL8 A;  4ZC3 A;  3MKY B;  3HUG B;  3DU5 A;  3OYG A;  2BW3 B;  4XQF A;  4E7H A;  3OS2 A;  3JTR A;  1WJB A;  2OV7 A;  2LOO A;  3IUO A;  3MKW B;  2CV0 A;  4HRI A;  4XN0 A;  1SAU A;  4OAY A;  3IP4 B;  2W4S A;  4BTH A;  2BVM A;  2KRC A;  2UUZ A;  3DTE A;  3LSM A;  3QOE A;  3PNV A;  3HXL A;  4E7K A;  5HOO A;  5KCM A;  2X6W A;  1NG6 A;  3FBN B;  2X1E A;  4IQ4 A;  4LG3 A;  1D1B A;  2L2O A;  4BDY A;  4F52 A;  2MFZ A;  4XR6 A;  3EUK L;  1LDK B;  3V42 A;  4BQN A;  3OYD A;  3G2B A;  3PSI A;  4CCN A;  3L91 A;  2V4J C;  3FDY A;  2KRH A;  1Y6I A;  4CCM A;  4ZDO A;  3K70 D;  4PK4 A;  2HNH A;  1GKF A;  4B48 A;  2R7X A;  4ZDL A;  1Y56 A;  3PUB A;  3TL4 X;  3K70 C;  3H9G A;  3OL3 A;  2VIX A;  4PUS A;  1AI7 A;  4CCL A;  2WY7 Q;  4XL9 A;  2VXD A;  4N4O B;  2HU9 A;  2AQE A;  2VXZ A;  1IRX A;  2VQL A;  1FM2 A;  2IGM A;  3JTQ A;  4NNJ A;  2W1O A;  2VQC A;  2XF7 A;  3OR2 C;  3RTR A;  4PSW A;  4F3Q A;  3H5A A;  2LRE A;  3K6G A;  2K9M A;  4U7B A;  4XMY A;  3OYK A;  4D9J A;  2HVR A;  3S8P A;  4CA0 A;  3LFU A;  1N78 A;  3HPH A;  2VJJ A;  3OYF A;  3W3C A;  2VJ4 A;  1MMA A;  2KP6 A;  2LY1 A;  2R7S A;  1BR1 A;  1KEC A;  1G8X A;  4ZJZ A;  5HNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...