4K2FA

Structure of pseudomonas aeruginosa pvdq bound to brd-a08522488
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-homoserine lactone acylase PvdQ
publication title Identification of Inhibitors of PvdQ, an Enzyme Involved in the Synthesis of the Siderophore Pyoverdine.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 164
sequence length 164
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2013-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4k2fA00
4HSTA 4YFBA 1E3AA 4M1JA 4WKTA 4WKUA 4YFAA 1JX9A 2AE5A 3K3WA 1JW0A 4E56A 4WKVA 1GM8A 2WYBA 4K2GA 1GK0A 1KECA 1K5QA 4HSRA 1FM2A 1AJQA 3ML0A 3S8RA 1GHDA 4YF9A 2WYEA 1GK1A 3SRAA 2ADVA 1AI4A 1AI5A 1CP9A 4K2FA 1GK9A 3SRCA 1K7DA 1PNMA 2WYCA 4PELA 3JTQA 1AI6A 1JVZA 1K5SA 3L91A 1GM9A 1OR0A 1AJNA 1H2GA 1KEHA 4PEMA 1GKFA 1AJPA 1GM7A 1FXVA 1PNLA 1FXHA 2AE3A 4WKSA 4E57A 1AI7A 3JTRA 1PNKA 2WYDA 2AE4A 3L94A 3SRBA 4BTHA 4E55A
chains in the Genus database with same CATH superfamily
4HSTA 4YFBA 1E3AA 4M1JA 4WKTA 4WKUA 4YFAA 1JX9A 2AE5A 3FGRA 3K3WA 1JW0A 4E56A 4WKVA 1GM8A 2WYBA 4BWCA 4K2GA 1GK0A 1KECA 1K5QA 4HSRA 1FM2A 1AJQA 3ML0A 3S8RA 1GHDA 4YF9A 2WYEA 1GK1A 3SRAA 2ADVA 1AI4A 1AI5A 1CP9A 4K2FA 1GK9A 3SRCA 1K7DA 1PNMA 2WYCA 4PELA 3JTQA 1AI6A 1JVZA 1K5SA 3L91A 1GM9A 1OR0A 1AJNA 1H2GA 1KEHA 3FGTA 4PEMA 1GKFA 1AJPA 1GM7A 1FXVA 1PNLA 1FXHA 2AE3A 4WKSA 4E57A 1AI7A 3JTRA 1PNKA 2WYDA 2AE4A 3L94A 3SRBA 4BTHA 4E55A
chains in the Genus database with same CATH topology
4HSTA 4YFBA 1E3AA 4M1JA 4WKTA 4WKUA 4YFAA 1JX9A 2AE5A 3K3WA 1JW0A 4E56A 4WKVA 1GM8A 2WYBA 4K2GA 1GK0A 1KECA 1K5QA 4HSRA 1FM2A 1AJQA 3ML0A 3S8RA 1GHDA 4YF9A 2WYEA 1GK1A 3SRAA 2ADVA 1AI4A 1AI5A 1CP9A 4K2FA 1GK9A 3SRCA 1K7DA 1PNMA 2WYCA 4PELA 3JTQA 1AI6A 1JVZA 1K5SA 3L91A 1GM9A 1OR0A 1AJNA 1H2GA 1KEHA 4PEMA 1GKFA 1AJPA 1GM7A 1FXVA 1PNLA 1FXHA 2AE3A 4WKSA 4E57A 1AI7A 3JTRA 1PNKA 2WYDA 2AE4A 3L94A 3SRBA 4BTHA 4E55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HST A;  4YFB A;  1E3A A;  4M1J A;  4WKT A;  4WKU A;  4YFA A;  1JX9 A;  2AE5 A;  3K3W A;  1JW0 A;  4E56 A;  4WKV A;  1GM8 A;  2WYB A;  4K2G A;  1GK0 A;  1KEC A;  1K5Q A;  4HSR A;  1FM2 A;  1AJQ A;  3ML0 A;  3S8R A;  1GHD A;  4YF9 A;  2WYE A;  1GK1 A;  3SRA A;  2ADV A;  1AI4 A;  1AI5 A;  1CP9 A;  4K2F A;  1GK9 A;  3SRC A;  1K7D A;  1PNM A;  2WYC A;  4PEL A;  3JTQ A;  1AI6 A;  1JVZ A;  1K5S A;  3L91 A;  1GM9 A;  1OR0 A;  1AJN A;  1H2G A;  1KEH A;  4PEM A;  1GKF A;  1AJP A;  1GM7 A;  1FXV A;  1PNL A;  1FXH A;  2AE3 A;  4WKS A;  4E57 A;  1AI7 A;  3JTR A;  1PNK A;  2WYD A;  2AE4 A;  3L94 A;  3SRB A;  4BTH A;  4E55 A; 
#chains in the Genus database with same CATH topology
 4HST A;  4YFB A;  1E3A A;  4M1J A;  4WKT A;  4WKU A;  4YFA A;  1JX9 A;  2AE5 A;  3FGR A;  3K3W A;  1JW0 A;  4E56 A;  4WKV A;  1GM8 A;  2WYB A;  4BWC A;  4K2G A;  1GK0 A;  1KEC A;  1K5Q A;  4HSR A;  1FM2 A;  1AJQ A;  3ML0 A;  3S8R A;  1GHD A;  4YF9 A;  2WYE A;  1GK1 A;  3SRA A;  2ADV A;  1AI4 A;  1AI5 A;  1CP9 A;  4K2F A;  1GK9 A;  3SRC A;  1K7D A;  1PNM A;  2WYC A;  4PEL A;  3JTQ A;  1AI6 A;  1JVZ A;  1K5S A;  3L91 A;  1GM9 A;  1OR0 A;  1AJN A;  1H2G A;  1KEH A;  3FGT A;  4PEM A;  1GKF A;  1AJP A;  1GM7 A;  1FXV A;  1PNL A;  1FXH A;  2AE3 A;  4WKS A;  4E57 A;  1AI7 A;  3JTR A;  1PNK A;  2WYD A;  2AE4 A;  3L94 A;  3SRB A;  4BTH A;  4E55 A; 
#chains in the Genus database with same CATH homology
 4HST A;  4YFB A;  1E3A A;  4M1J A;  4WKT A;  4WKU A;  4YFA A;  1JX9 A;  2AE5 A;  3K3W A;  1JW0 A;  4E56 A;  4WKV A;  1GM8 A;  2WYB A;  4K2G A;  1GK0 A;  1KEC A;  1K5Q A;  4HSR A;  1FM2 A;  1AJQ A;  3ML0 A;  3S8R A;  1GHD A;  4YF9 A;  2WYE A;  1GK1 A;  3SRA A;  2ADV A;  1AI4 A;  1AI5 A;  1CP9 A;  4K2F A;  1GK9 A;  3SRC A;  1K7D A;  1PNM A;  2WYC A;  4PEL A;  3JTQ A;  1AI6 A;  1JVZ A;  1K5S A;  3L91 A;  1GM9 A;  1OR0 A;  1AJN A;  1H2G A;  1KEH A;  4PEM A;  1GKF A;  1AJP A;  1GM7 A;  1FXV A;  1PNL A;  1FXH A;  2AE3 A;  4WKS A;  4E57 A;  1AI7 A;  3JTR A;  1PNK A;  2WYD A;  2AE4 A;  3L94 A;  3SRB A;  4BTH A;  4E55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...