4YF9A

Structure of n-acylhomoserine lactone acylase macq
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
167
structure length
167
Chain Sequence
TYSAEIRRTTMGVPHIKAGNWGSAGYGFGYVQAQDNLCTMADSFLTYRGERSRHLGGSAQLVYNSTLGRPRNIDSDFFHRHVISDEAVDRTMAAQPAKLLQMVEGFAAGYNRYVREAKAGGSAHAACRSEAWVQPITARDVWRRIYAANLAGGYSNFAEAIANAQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein related to penicillin acylase
publication title Bifunctional quorum-quenching and antibiotic-acylase MacQ forms a 170-kDa capsule-shaped molecule containing spacer polypeptides
pubmed doi rcsb
source organism Acidovorax sp. mr-s7
molecule tags Hydrolase
total genus 54
structure length 167
sequence length 167
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4yf9A00
3JTQA 3SRBA 3L91A 1JW0A 1JX9A 4E57A 1K7DA 1KECA 4K2GA 1AI6A 1GHDA 3SRCA 1GM8A 4HSRA 4WKSA 4WKTA 1PNKA 1CP9A 2WYCA 1KEHA 2WYEA 1AI7A 4HSTA 2AE4A 4WKVA 1FXVA 1GK9A 1AJNA 1GK1A 4E55A 4BTHA 4E56A 3SRAA 4M1JA 2WYBA 1H2GA 3L94A 1AI4A 1AI5A 2AE5A 1GKFA 3K3WA 4YFAA 1AJPA 3ML0A 3S8RA 1GM9A 1PNMA 1E3AA 1K5SA 1FM2A 4WKUA 4PELA 1PNLA 4YF9A 1FXHA 2AE3A 4K2FA 2ADVA 1OR0A 4PEMA 1GK0A 3JTRA 4YFBA 1AJQA 1K5QA 1GM7A 1JVZA 2WYDA
chains in the Genus database with same CATH superfamily
3JTQA 3SRBA 3L91A 1JW0A 1JX9A 4E57A 1K7DA 1KECA 4K2GA 1AI6A 1GHDA 3FGRA 3SRCA 1GM8A 4HSRA 4WKSA 4WKTA 1PNKA 1CP9A 2WYCA 1KEHA 2WYEA 1AI7A 4HSTA 2AE4A 4WKVA 1FXVA 1GK9A 1AJNA 1GK1A 4E55A 4BTHA 4E56A 3SRAA 4BWCA 4M1JA 2WYBA 1H2GA 3L94A 1AI4A 1AI5A 2AE5A 1GKFA 3K3WA 4YFAA 1AJPA 3ML0A 3S8RA 1GM9A 1PNMA 1E3AA 1K5SA 1FM2A 4WKUA 4PELA 1PNLA 4YF9A 3FGTA 1FXHA 2AE3A 4K2FA 2ADVA 1OR0A 4PEMA 1GK0A 3JTRA 4YFBA 1AJQA 1K5QA 1GM7A 1JVZA 2WYDA
chains in the Genus database with same CATH topology
3JTQA 3SRBA 3L91A 1JW0A 1JX9A 4E57A 1K7DA 1KECA 4K2GA 1AI6A 1GHDA 3SRCA 1GM8A 4HSRA 4WKSA 4WKTA 1PNKA 1CP9A 2WYCA 1KEHA 2WYEA 1AI7A 4HSTA 2AE4A 4WKVA 1FXVA 1GK9A 1AJNA 1GK1A 4E55A 4BTHA 4E56A 3SRAA 4M1JA 2WYBA 1H2GA 3L94A 1AI4A 1AI5A 2AE5A 1GKFA 3K3WA 4YFAA 1AJPA 3ML0A 3S8RA 1GM9A 1PNMA 1E3AA 1K5SA 1FM2A 4WKUA 4PELA 1PNLA 4YF9A 1FXHA 2AE3A 4K2FA 2ADVA 1OR0A 4PEMA 1GK0A 3JTRA 4YFBA 1AJQA 1K5QA 1GM7A 1JVZA 2WYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTQ A;  3SRB A;  3L91 A;  1JW0 A;  1JX9 A;  4E57 A;  1K7D A;  1KEC A;  4K2G A;  1AI6 A;  1GHD A;  3SRC A;  1GM8 A;  4HSR A;  4WKS A;  4WKT A;  1PNK A;  1CP9 A;  2WYC A;  1KEH A;  2WYE A;  1AI7 A;  4HST A;  2AE4 A;  4WKV A;  1FXV A;  1GK9 A;  1AJN A;  1GK1 A;  4E55 A;  4BTH A;  4E56 A;  3SRA A;  4M1J A;  2WYB A;  1H2G A;  3L94 A;  1AI4 A;  1AI5 A;  2AE5 A;  1GKF A;  3K3W A;  4YFA A;  1AJP A;  3ML0 A;  3S8R A;  1GM9 A;  1PNM A;  1E3A A;  1K5S A;  1FM2 A;  4WKU A;  4PEL A;  1PNL A;  4YF9 A;  1FXH A;  2AE3 A;  4K2F A;  2ADV A;  1OR0 A;  4PEM A;  1GK0 A;  3JTR A;  4YFB A;  1AJQ A;  1K5Q A;  1GM7 A;  1JVZ A;  2WYD A; 
#chains in the Genus database with same CATH topology
 3JTQ A;  3SRB A;  3L91 A;  1JW0 A;  1JX9 A;  4E57 A;  1K7D A;  1KEC A;  4K2G A;  1AI6 A;  1GHD A;  3FGR A;  3SRC A;  1GM8 A;  4HSR A;  4WKS A;  4WKT A;  1PNK A;  1CP9 A;  2WYC A;  1KEH A;  2WYE A;  1AI7 A;  4HST A;  2AE4 A;  4WKV A;  1FXV A;  1GK9 A;  1AJN A;  1GK1 A;  4E55 A;  4BTH A;  4E56 A;  3SRA A;  4BWC A;  4M1J A;  2WYB A;  1H2G A;  3L94 A;  1AI4 A;  1AI5 A;  2AE5 A;  1GKF A;  3K3W A;  4YFA A;  1AJP A;  3ML0 A;  3S8R A;  1GM9 A;  1PNM A;  1E3A A;  1K5S A;  1FM2 A;  4WKU A;  4PEL A;  1PNL A;  4YF9 A;  3FGT A;  1FXH A;  2AE3 A;  4K2F A;  2ADV A;  1OR0 A;  4PEM A;  1GK0 A;  3JTR A;  4YFB A;  1AJQ A;  1K5Q A;  1GM7 A;  1JVZ A;  2WYD A; 
#chains in the Genus database with same CATH homology
 3JTQ A;  3SRB A;  3L91 A;  1JW0 A;  1JX9 A;  4E57 A;  1K7D A;  1KEC A;  4K2G A;  1AI6 A;  1GHD A;  3SRC A;  1GM8 A;  4HSR A;  4WKS A;  4WKT A;  1PNK A;  1CP9 A;  2WYC A;  1KEH A;  2WYE A;  1AI7 A;  4HST A;  2AE4 A;  4WKV A;  1FXV A;  1GK9 A;  1AJN A;  1GK1 A;  4E55 A;  4BTH A;  4E56 A;  3SRA A;  4M1J A;  2WYB A;  1H2G A;  3L94 A;  1AI4 A;  1AI5 A;  2AE5 A;  1GKF A;  3K3W A;  4YFA A;  1AJP A;  3ML0 A;  3S8R A;  1GM9 A;  1PNM A;  1E3A A;  1K5S A;  1FM2 A;  4WKU A;  4PEL A;  1PNL A;  4YF9 A;  1FXH A;  2AE3 A;  4K2F A;  2ADV A;  1OR0 A;  4PEM A;  1GK0 A;  3JTR A;  4YFB A;  1AJQ A;  1K5Q A;  1GM7 A;  1JVZ A;  2WYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...