4HSRA

Crystal structure of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hsrA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hsrA01
4YFBA 3K3WA 1AJNA 1AI5A 1PNLA 2ADVA 1H2GA 1GK0A 4YFAA 1PNMA 1GM8A 1JX9A 1GM7A 3S8RA 1JW0A 1GKFA 1JVZA 4E57A 2WYBA 4WKUA 1AI6A 3JTRA 4HSTA 1K7DA 4K2FA 1GK1A 3ML0A 4HSRA 1GHDA 3JTQA 1CP9A 4K2GA 4M1JA 2AE5A 3L94A 2WYCA 4PELA 1FM2A 2WYEA 1AJQA 1AI7A 4BTHA 1GK9A 1K5QA 1AI4A 1FXVA 1GM9A 1KEHA 3L91A 4WKSA 3SRBA 4E56A 2AE4A 2WYDA 1OR0A 1E3AA 1AJPA 3SRCA 4YF9A 1KECA 2AE3A 1FXHA 4WKVA 4PEMA 1K5SA 1PNKA 3SRAA 4E55A 4WKTA
chains in the Genus database with same CATH superfamily
4BHBA 4KMFA 3OL3A 4CO8A 1KU2A 3DKXA 3FK7A 2K9NA 2OAZA 4OIQF 1W7PB 4XOPA 1LEBA 2K4JA 2ME0A 4HNVA 3MD2A 3HRUA 4MEYF 3GF2A 4RGXA 2XDVA 1XTAA 2DA1A 3IRRA 5BOXA 1R6RA 1G6NA 2K9SA 2DMPA 3LA3A 2NNYA 3I0TA 5BPDA 5CVUA 3OYDA 3FHNA 4HG2A 4A0XA 3TW7A 2ZNYA 1RIOH 3DU6A 4YF9A 3ZN0A 2EZLA 5A2QZ 2PFBA 3WTTC 3ZQQA 3HOWJ 2DT7B 1YRNA 1RKWA 4EV0A 2EILH 2O5RA 2EIKH 3CUQB 2R7XA 2EH3A 2QUFA 2VASA 2CUEA 5JVTA 2ZMEB 1WWXA 2B9SA 3CC2I 2ID3A 5EEAA 4OIOF 1JVZA 3TP0A 1XS9A 4D7NA 2HPMA 1IRZA 5HODA 3BR0A 3S3OA 2DOFA 2HQRA 3KP7A 2L01A 2X9DA 2CQXA 5L3BA 3GWZA 1YX3A 1UB9A 3WTSC 3OYMA 1LFBA 1WSUA 3ZQCA 1FXHA 1X3ZB 4RMNA 2E1MB 2BY2A 4KT5C 2MH9A 3DTIA 1VQOI 2LK2A 3FX3A 1M1EB 2OZ6A 4Q47A 4AIHA 4F55A 4HNTA 2PLYA 2EV0A 1HBXG 3E5UA 3IKTA 4B09A 1SVMA 3VFZA 5HLTA 1IDZA 3C2HA 3ZR8X 1YIOA 2QQBA 3OIQA 5JHUA 2JA6J 2VE9A 4M1JA 1O3RA 2HQAA 1JKRC 1LKXA 5L3DA 3CO6C 1KYZA 1CGPA 4WKSA 1SVOA 2DFFA 1IN4A 1S72I 3EYIA 5LGTA 2ETHA 2GOXB 2HWVA 4V2GA 5IYDJ 2JVGA 2XSJC 2CGPA 4A3KJ 2FMYA 3H1CA 4C3JJ 1ZGWA 2KQRA 2LRDA 2XF6A 1XSXA 3QU3A 1PUEE 1O3QA 2DPUA 3GTMJ 3I64A 4M72A 2QKMB 3WTWC 2UXXA 3I56I 3K4BA 4WKUA 4WXDA 1MDMB 1U8BA 1DQUA 4BWCA 2IVMA 2LY9A 2GLOA 4I2OA 1QO0D 4ZYHA 1SD4A 4LFUA 3EUHA 4LMYA 3SDGA 1ITYA 1SAXA 1YHQI 2TRTA 3I4PA 1MH3A 4E7IA 1F36A 2YPRA 1W0TA 1TZLA 5E3LA 3MFKA 3ZMVA 1BOAA 2LF8A 3JCUC 2ISZA 1GXPA 3BQZA 1D0YA 2K86A 3G1MA 1GHDA 1K78A 4HDVA 4K2GA 3PL8A 3FWEA 2O9LA 3C2GA 1ETOA 2XGCA 3TO7A 5H2FC 3E1SA 3FHZA 4RAYA 3DPLC 2D1HA 4XLHA 3J81K 1VQKI 3D0SA 4CXFA 1I3AA 3QPLA 5L3CA 2B7EA 1JGGA 1W5SA 3A4CA 4LLNA 2RDPA 2STTA 3QPHA 4ZYGA 3FXJA 3UNGC 3F8MA 2VIXA 3JAMK 2EA2A 4AIDA 2M9HA 5LRSA 1JW0A 3SDBA 3JRBA 1D3YA 3ZGKA 3FXKA 2XPWA 5TGTA 5IP6A 3BDDA 3TL4X 2DI3A 4IOCF 4PDKA 1SEUA 1ZHFA 1YTYA 3MZYA 1TT5B 1S6LA 2NS0A 2MC4A 3KPHA 1E2XA 2QEXI 2BY0A 4E56A 4EATA 5HNFA 1QHHD 1A6IA 3LWFA 2E1NA 3WODF 3X2QH 2PMZA 3CDHA 2HZDA 3DTKA 3WTUC 3S1NJ 2EIMH 4YG2F 1P92A 3KZIC 3H5RA 2B63J 2RREA 4G7OF 3S8RA 1Z0XA 3MVPA 1BR4A 3RSNA 3SXYA 3PM1A 2NVQJ 2ZXHA 3LSMA 3EUKL 3S16J 1FM2A 1OJLA 5F0CA 2F4IA 2HTJA 3LA2A 4UXNA 4C3HJ 3CP8A 1FXVA 2H8RA 1B4AA 4M73A 4RGRA 5HNHA 2XROA 1BI3A 5ED4A 2IAIA 2CU7A 3I71A 3WE2A 4O5VA 1B8IA 3H5NA 2BOLA 3CLQA 2X6WA 4Y33A 5ICCA 2IRFG 4UV9A 2V1XA 4ZZLA 4NUBA 2RVCA 2GXAA 1ETVA 3DV8A 2PJRB 1KU3A 1OISA 3OYLA 2A3SA 2ID6A 1B72A 4E57A 4CYDA 4S04A 1MJ9A 1R49A 2KMUA 2LSOA 4IZZA 3EPZA 3F6VA 1LNWA 5IYBJ 3OOPA 2HQ5A 2KIQA 4KISA 1IXSB 2FJ1A 2JRTA 2LH9A 2M7AA 3K4MA 1JHHA 4KN7X 5IP9J 3HRTA 1WJFA 4BJ5C 1J2XA 4CDGA 2QBYB 1JKQC 4I0AA 2RC4A 4LLGF 1Z67A 2QQAA 3G1OA 2PI0A 1GLNA 4ESJA 4ABZA 3FGTA 4AVZA 3RKQA 1U5TB 1EKEA 1ZG5A 2HNHA 2FBIA 5B1BH 5HOOA 2H27A 1Q1HA 1UHWA 1Q1VA 1R58A 3E6CC 1GDTA 2IA0A 4HYEA 5A2QK 2VQCA 2LC2A 1AKHB 3P9CA 4XKVA 3S93A 4X0GA 3B73A 4CSWA 2GXGA 3OR1C 4XMYA 3MKLA 1PYVA 2XAFA 4I6ZA 1VFCA 1OR7C 3GZ6A 2WC2A 3CUQC 1FOXA 4PSWA 4DNCA 2RGVA 2P7VB 3HOZJ 3RIRA 2ZMEC 2H94A 2CQQA 3K2AA 1MBGA 3RDIA 2PQ8A 3O8HA 3V7RA 3PO3J 4OIRF 2K9MA 2ZFUA 1ZN2A 4Z6YA 1IW7F 2HTSA 3L2RA 4NQWA 1VQ8I 4A69C 2DQLA 3ROUA 3V4GA 4A3IJ 2P5LC 1P9QC 1S9HA 1KZHA 3OYGA 3RZOJ 4JYKA 2NRAC 1XSVA 2GQQA 2VXDA 4PZJA 1U78A 2Q1ZB 3ZCOA 2QSFX 5J4YA 4E7JA 2VE8A 2NAZA 3L9FA 3CP2A 2WY8Q 2W1OA 3K6GA 4A93J 2CS3A 4I01A 1AI6A 2FF4A 2HGCA 4PSXA 3B6AA 4Y4RA 3HHHA 5GPCA 2XAGA 3PSFA 5K7HA 4J01A 4YFNF 1OLTA 1QNTA 3IWFA 2DODA 5E8IA 4XR6A 2ZJPF 5FKOA 2X1DA 3L00A 1SFOJ 3GLXA 4PJ0C 2DJNA 1LB2A 5F27A 4CGZA 4RAGA 2ECCA 2HDDA 1BC7C 3R60A 3CESA 2H1LA 4HQEA 3M1EA 3PNVA 2K3PA 1STZA 2VI6A 5CQGA 2GXBA 4G9YA 2IS4A 1GK1A 1BI2A 1LE8B 1PP8F 4C2MJ 2DFEA 4S05A 2XPVA 3MQ0A 1U2WA 2DYSH 3E5XA 3GX4X 4PJJA 4LG0B 2MC3A 4ZTFA 1YFHA 4X1EA 5LEJA 3IAM2 1ACIA 4RB1A 4IHYA 1J59A 3WHBA 2EFNA 5FLXZ 3RJPA 1MNMC 2BZTA 1EF4A 3AG2H 3PSIA 5EG0B 3GEZA 3GTOJ 4F7ZA 2VKDA 1XGSA 3JRFA 4BHCA 2ISYA 1OYYA 4K2FA 2VJ4A 3ABUA 4PGHA 2NVYJ 4OAYA 4V19K 4KIGA 4A2UA 1P4AA 2Z99A 4LITA 1AI4A 4YELA 5EGOA 2ESNA 1O4XA 4KMUX 3N4MA 1QRYA 2XAUA 3SHFA 1YW8A 3RKXA 4Y13A 3MKYB 2L9VA 3F8NA 1TWGJ 2V6EA 2ACJA 2JA8J 3WGHA 1Z21A 5DD4A 3HOVJ 1VQ6I 1WKMA 1FT9A 5FLVA 3H3VK 4QLCU 3GCMA 3KFWX 5KNLA 4PJLA 5B1AH 1REPC 4RB3C 2XF7A 4DJAA 1H89C 4KNYA 1FJLA 1ZQ3P 4L9TA 1AI7A 3QOPA 3ZXSA 2FEZA 4YIIA 2FNAA 4DOZA 4EJTA 4HX4A 5IT9Z 1YX5A 3FXRA 3CCRI 4EJUA 3BR1A 5K1YA 3KZZA 3HL2A 1JE8A 1HW1A 4AYBN 2FU4A 4GO1A 3ZMZA 2K02A 4E7ZA 2Y0SA 1FTTA 3U21A 4C3IJ 2VT2A 3D5LA 3HGYA 1H9GA 1YITI 1H0MA 1Y39A 1K7AA 3HM5A 2BVLA 1MMNA 2AXLA 1FOWA 2WA0A 2ESHA 2V9KA 3PO2J 4BTHA 4BBSJ 2DFIA 3DBLB 1UG0A 3ABTA 2V26A 1XCVA 3O2PE 4P5OA 1TC3C 2DCEA 2LNBA 2L4AA 1WRJA 1WGXA 2DA7A 3KZYA 2FBHA 1K6YA 4UUTA 3WTZA 1S5LC 1UHSA 2IGMA 2Y2ZA 1HC8A 3V7SA 2P0WA 2BGCA 3AG3H 2QLZA 2VQHA 2I10A 1ON1A 3L1PA 1O7LA 1R1TA 2ZSHB 3I59B 4KIFA 2VL8A 1VQ9I 2K7LA 3K69A 3P9IA 4B47A 1V4RA 2LBFB 4A3EJ 2LF7A 3MCZA 2GZWA 3HC7A 3QYEA 2M0MA 1MD0A 2O7OA 2RV8A 1DPUA 3PIOF 2E5NA 4GDFA 3OYBA 4B3XA 1U5TC 3U1KA 1E3HA 2LLKA 1JUSA 2M8EA 2DMTA 2K85A 2GA1A 2MSYA 2ZCWA 1YRNB 3AG1H 1U6GA 3HG9A 3SZTA 1XDSA 3SJMA 1BN5A 2B0LA 1KEHA 4JBAA 3ASOH 3KLOA 4ENJA 1LVAA 1YS7A 1YO5C 2Z9OA 2UWMA 1KECA 4UVBA 3BG3A 2OPTA 1E3PA 2VC1A 2XGEA 3TKYA 1D1CA 4M9ZA 4BDYA 2KP6A 1KGSA 2DQRA 4HV5A 5JLWA 4IHXA 2X6XA 5FRNA 1NHAA 2AS5F 2CWEA 3S14J 1A6QA 1TP4A 4IOAF 2W25A 1GV2A 2A05A 2WYBA 5F6FA 2Z5UA 2YR2A 2Y48A 2WADA 3KYCB 2XUBA 1HDDC 2H6CA 1IN5A 5EYRA 3HSFA 4BE2A 1K4SA 4AWXB 2A5WA 1SANA 2M30A 4BNCA 4OWRB 1OKRA 1Y8QB 4D9JA 3M8JA 1F9NA 1DDNA 4N0BA 3WGGA 4E7SA 1YJNI 4WCGA 1B59A 4HX8A 3F8FA 2OQRA 1JT6A 1FP1D 3ZQLA 5FFXA 3HDDA 4P96A 3CC4I 2JWTA 3RPQA 3I9V2 1KYWA 1XB4A 2JPCA 4FQGA 4JX6A 2M2EA 3HOXJ 3FIWA 2CSOA 4G7HF 5DM6F 3P7NA 4D7MA 3H0GJ 5D5XB 2VT3A 2X1EA 3BTJA 3S1RJ 2P5KA 3O6BB 2QVOA 1RRJA 2O0YA 1ZG3A 2DTZA 3LNQA 4PUSA 2BHYA 4R1HA 4XIDA 2HOTA 3FXQA 4M6XA 5FLMJ 1YS6A 4U7DA 2XB5A 1H88C 3M3YJ 2DU9A 2LP0A 3RI4A 1HF0A 2E1OA 4BEHA 1ETKA 3PIPF 3TP3A 2MLGA 3FMRA 5DM7F 4ZYDA 3HPHA 3RYRA 2IPQX 1BJAA 4G7ZF 1LDKB 4HSTA 3BTLA 2O6GE 1RNLA 1R23A 1MBKA 2XHKA 4M6YA 4RA2A 2HPIA 4L9JA 4LJZF 3K70C 3KP4A 5FRMA 1FEXA 2WAFA 2FE3A 5FLXK 1IDYA 4CYCB 3BLYA 3ABKH 2NXNB 1GT0C 1HLVA 4R79A 2YU3A 4OMZA 5TISC 4ETSA 4IRGA 2DBBA 2QSGX 5EZHA 2HYJA 1APLC 1GM8A 1FBSA 5ILVA 3IV5A 1R71A 4PFPA 4FE7A 1W4MA 3ZP5A 2R5YA 1FY7A 3OMYA 4XN0A 2FX0A 1GXQA 4WK8F 3I4NJ 2X51A 1X3UA 3JTHA 2E71A 2OV7A 1UAAA 1N25A 2Y0SN 2R92J 3CCQI 2ECBA 2JZYA 2ZJQF 2G9WA 2MLKA 2HDCA 1L0OC 2OTLI 1OYIA 2XF5A 4LB6B 1T6SA 1TLHB 3KLNA 4KJZA 1BIBA 4IHTA 4I09A 3LQQA 2VBYA 1QZZA 2E7XA 3M8FA 1IG7A 4YFAA 4BH9A 4ENKA 1MBHA 3D5RC 1MW7A 1C0WA 1QVTA 5IOZA 3KP5A 5IT9K 5E18F 2M8GX 3GXOA 3QQAA 3L94A 3VEPA 2EFWA 2FQ4A 3BG5A 4XORA 4PJMA 3K4NA 1JTXA 5KAFC 1VQLI 1HKTA 3FKIJ 4XOTA 1W1WE 4N9HA 4BU2A 3ZQIA 3HRSA 3E97A 4EGYA 4A6DA 1Y6IA 4ZYAA 2R93J 1T0FA 3DTEA 3HOSA 4WXCA 3ZOBA 4L0ZB 4AU7A 3GFMA 4XL9A 5LRRA 2HZTA 3U9GA 5HLGA 2OU2A 5F64A 5H6QA 1OMIA 3KIOA 3S17J 1LPQA 5KCMA 3ECHA 3ZRGA 4BQQA 1W5CC 1SMYF 2FUG2 2VBWA 3H36A 5EDNA 3A01A 4XICA 3DLAA 4BGDA 1B72B 2MW8A 1E3AA 5D6EA 4E70A 3VSLA 3DEWA 2Y69H 4LGWA 4M3EA 2VBZA 1ZAOA 2L3DA 5LEKA 2X85A 2FQ3A 5D5VB 5K7ZA 2IT0A 3VOEA 2HI3A 3JRCA 2M4GA 4KYWA 1HOMA 4Q5SF 2E35A 2KRCA 1RC9A 2WWYA 4FX4A 1BW6A 3QPTA 2IGOA 2R0QC 3EDPA 3CDLA 4QPOA 4KT6A 2H6BA 2ELKA 1ORKA 1MSFC 1SAUA 1JI8A 1BL0A 2AE3A 3SZGA 5DYMA 3ULQB 2WV0A 1R5GA 5D5WB 4Y15A 3NWTA 1D0XA 1V5FA 1WVRA 4PGGA 2D45A 2JQ7A 1O3SA 4OMYA 3LMMA 4PK4A 1WCMJ 2JRMA 2JTVA 2X6OA 5M5YJ 4JOMA 4MHGA 1I39A 1GVDA 4HF0A 1MBJA 3NQOA 3OYKA 5DUKA 5DV5A 4AVPA 1KU9A 3S8PA 2RQQA 5JHFA 3FKJA 1D1BA 3A0BC 3FBNB 3PFIA 2R7TA 3TO6A 1F1ZA 2JSPA 3A03A 2W85A 3B02A 2LYCA 4W97A 1G3YA 2ICWG 4CZZA 5CJ9A 5GADJ 4NQWB 1QA6A 2TCTA 2FRHA 2A68F 2F4OB 5E1ZB 1Z3XA 2DFHA 2K9QA 1B9NA 3E5QA 5DCMB 3SYTA 4E7HA 1W0UA 2CRGA 2VQLA 3OYEA 3V7CA 2QQ8A 2YX7A 3Q9VA 1CQTA 1ERDA 1AA7A 1ULYA 1SMTA 4RGUA 4LB5A 1NG6A 2R7RA 1L3LA 2XVCA 4HEA2 2CV1A 4BS9A 1D5YA 2CW0F 1IRGA 1IN8A 2HOEA 1TL8A 4BACA 5FFZA 3S1QJ 1T56A 1H2GA 1D5VA 2DMQA 2L02A 4FHTA 4EGZA 4ZC3A 3FZVA 1R9TJ 4FETA 4MFEA 1X4PA 2LREA 1WH5A 1Y0NA 1WI9A 5DS9A 4XSXF 1YOVB 1XGNA 2XAQA 4QTRA 1MJAA 3H92A 2K4BA 1S7EA 1I27A 1R1VA 1VQ5I 1WJEA 2ME6A 2JA7J 1S7AA 4DGWB 3WTYC 1ZRFA 2KKOA 5JFRA 4BQNA 3F0CA 4P55A 4H4KC 2MGQA 4U0VA 1PUFA 1B1BA 4XLNF 3CCYA 4YRVA 3TBIA 3WU1B 3HSRA 1J09A 3A1YA 3EUHC 4HPQA 4F91B 3BC8A 4BXXJ 5E8GA 4HF1A 1U8RA 5F1JA 5FKLA 4L0YB 4C2TA 3NWSA 3OS2A 4RM3A 5HDKA 5M5WJ 2RNJA 3ASNH 5KK1A 4DIQA 3SEQA 2IS6A 2P5VA 3BZ6A 5CKTA 3P9KA 4EEFG 1MMDA 5DDGA 1O3TA 1AOYA 4GGGA 4JP0A 3WTVC 2QZ8A 4EM0B 3CO7C 4EVIA 5E3NA 1LEAA 2DYRH 2X6YA 3BTIA 4U87A 2VKHA 1YW9A 2L7FP 4BY7J 1GVJA 3TW6A 4CA0A 1NK3P 2FA5A 2OZUA 1TQMA 3KETA 3ECOA 3HPGA 2NYXA 1JGSA 3HYIA 4UHTA 4ZDLA 3HOTA 4XRSG 2Q2EB 1R5HA 4AYBA 1FIPA 1P7JA 2IA1A 3F8BA 1OR7A 2Z3YA 2HR3A 3CUQA 4XKBA 1GM9A 3IH2A 3PQKA 3TOAA 1VI0A 2GM4A 1W7PD 1OFCX 4U0YA 3J7ZI 1IO2A 2MD0A 1G3WA 1HW5A 2MBFA 4XKWA 5JLXA 3Q9SA 1R1UA 2COBA 4XRMA 4WKTA 4AM3A 3CMYA 4YFBA 1ZR4A 2F48A 2MFZA 2PBIA 5DEQA 1PNMA 3CQZJ 3F23A 1D8KA 1ZREA 1BA5A 2EK5A 3IC7A 4HSRA 5KAIC 1BW5A 1LDDA 1EA3A 2AHQA 1ETYA 2Q8KA 4IRIA 3MKWB 1YLFA 2DA3A 1TQIA 5E1WA 9ANTA 1A5JA 2LDUA 5F04A 4RLQA 3QPSA 3QRFF 1K6OA 3M07A 1W36D 5KHDA 1HW2A 4JQFA 5M5XJ 5E3MA 2V1NA 4IHSA 4AIKA 5ICFA 2FSWA 5BNGA 5D8KB 1GK0A 2IGNA 2JUGA 2M1BA 4I99C 1RR8C 3LSJA 1BR1A 2G7UA 2EBIA 4UB6C 3OS1A 1UJ8A 4QSHA 3OV8A 2CUZA 2CFXA 3KYLA 2IJLA 2BEOA 2OTJI 3PQJA 2VQGA 4RDUA 1JKPC 3PNYA 4L5EA 4BDZA 1IUFA 1NH3A 3O3KA 1ZH5A 1CF7A 6PAXA 3ZMDA 4RLFA 1POGA 1T08B 1RKTA 3FXMA 2R7FA 3DFGA 1WJBA 3NARA 1FBQA 2VJJA 1U9OA 2K5CA 3K0LA 1Z6RA 2M7BA 4IL6C 2YX4A 2BW3A 1IRXA 4OINF 5K7FA 4W1UA 2PG4A 3JTGA 3BTCA 2WTEA 3CC7I 1XMXA 2OC6A 2WB1N 3FK6A 3V8LA 4BBRJ 4ZYEA 4HLYA 3QAHA 1CP9A 5JVGF 1HA8A 2ZXWH 2MABA 1XSDA 4RS8A 3GFIA 2LFBA 2Z2SB 2LVSA 1OYWA 2DAOA 3OYAA 3SRCA 2IXSA 3WU0A 1U0JA 3BOQA 4MLOA 5J8CA 2AO9A 1FX7A 4A3MJ 3CZ6A 4IHVA 2R7QA 3S15J 5B3SH 1BI1A 1BIAA 1EJ9A 4UUSA 2XSDC 5EJCA 4ON0A 1LJ9A 4XLPF 3G6EI 3E0JB 2XRNA 3JTQA 2NOJB 1JHFA 2JPBA 2PEXA 3M4OJ 1RPWA 2E2HJ 2BBYA 3DPTA 4GCVA 2Y31A 2MG4A 4A3CJ 2W84A 1YJ9I 2OCEA 5CLSA 3GTJJ 1TWCJ 2XRLA 2XKPA 1IC8A 3FBIB 4IJAA 4AC0A 1PP7U 2K27A 1ENHA 3L2QA 4Y17A 4HRIA 4CHUA 4YFXF 3HGGA 1D1AA 3FM3A 1FPQA 2Y75A 3F21A 2PN6A 3ONQA 3U1DA 4E6KG 2KRFA 2V7FA 4LK1F 1J7KA 3FMSA 3KP2A 3BJOA 1VNDA 1WPKA 2DDAA 3VYRB 1GK9A 4NC6A 3SFZA 2O03A 2BYVE 3FF5A 1F43A 2DA5A 5BQTA 4TV7A 1SC7A 1PNKA 3Q0UA 2VN2A 2KZGA 1SD6A 3G1LA 1V54H 4UUVA 2JK3A 1I6XA 2JUCA 2VPRA 1DU0A 1DGRM 1MGTA 1MIJA 1UG2A 3OYCA 3IAS2 2F5DA 1ZG1A 2ZBKA 4IVNA 2KIMA 4FT8A 4B48A 3LAJA 3CCUI 2E36A 4RGSA 1HXDA 3IH3A 4IQ4A 1JT0A 2F5EA 2M4KA 1ODDA 3DXJF 1OCCH 3AAFA 1G4DA 2WYEA 2KRHA 2RAEA 1MH4A 4OU0A 4DZPA 3DQVC 4M9XA 4I98B 2CW7A 2NS7A 1O7FA 3TQNA 2NVTJ 3GVAA 1XPXA 2KZVA 5GAHJ 3JREA 4XN3A 3SRAA 1I5ZA 3FM5A 1P4XA 3HEFA 2VOOA 4ZTJA 2P6TA 1FZPB 1X1PA 1AI5A 3O8GA 5K5QA 2COMA 4IXAA 4I76A 2FXAA 3VB2A 1MBFA 4C2UA 5HLHA 1DPRA 1BR2A 2DOEA 3EETA 2EZIA 5H20A 4CH7A 2DDBA 2Z16A 2JJ7A 2VBXA 3DKYA 4HA8A 3K1PA 4B44A 3OOUA 2ZB9A 4J19A 2QBYA 2KDOA 4KA4A 2EINH 5D5UB 2ZXIA 2NS8A 5J3LA 4XK4A 4A3LJ 2L7KA 3W6VA 3LAPA 4RAFA 2X0LA 4IX7A 1RETA 2IA2A 2EFOA 3D5SC 4XBFA 2XGDA 3RKYA 2KIFA 4XRSA 3R0AA 3BT9A 4ASNA 4EJWA 1FOKA 4RB2C 1YG2A 3W2AA 1SFUA 1MNDA 3K1MA 4OAZA 4B4CA 2VC0A 2HKXA 1RI7A 3NAUA 3TEDA 4HOBA 4S0HB 1ETXA 1G3TA 3BPXA 4GFBA 2WAEA 4MIMA 3J7AO 2L7ZA 3H5AA 4B3AA 2CQKA 3ZQGA 5LHGA 1X19A 3KP3A 4LIVA 3MAJA 3PFYA 3RCOA 3CCLI 1Z3YA 2L7MP 1G3SA 2Y30A 1FTZA 2IS2A 1QVUA 5HLIA 1R7JA 3N97A 1VQ7I 5FD5A 1TQPA 3C18A 1WJ5A 5CVIA 2E60A 5TJJA 2FOKA 5M3MJ 2KPMA 1WI3A 2FBKA 2LKXA 3EQLF 3BCBA 3W6KB 4A0ZA 3RPUD 4IHWA 3LOCA 3DBHB 3CCMI 2ZC2A 1FNNA 1Z1DA 2TDXA 2RQPA 3GFLA 3F6OA 5C44J 5D8LB 1VQ4I 1KU7A 1DP7P 3V8KA 1BM9A 3FXLA 3KX2A 1HSTA 3QP6A 4PJNA 2V4JC 4EM2A 5E20A 2X48A 4DYRA 1FSHA 3BWGA 2YS9A 4MQVA 5FJ8J 1F5TA 4F3QA 4ZZDA 1Y1VJ 1IV8A 1EH8A 2AE5A 4B8XA 1LQ1A 5C4JJ 4II2A 3F72A 3VYSB 3T0YA 2CUFA 4EMSA 2H8WA 2A07F 2L9SA 4M3GA 3PUBA 4BJTA 3K10A 3BPVA 5F0FA 4LLLA 4DYCA 1LFUP 3JSOA 4IF4A 1V5GA 5AIPA 2V9VA 1QQIA 2IS1A 4LG0A 2VKVA 2VKEA 2KFDA 3HJEA 5HDNA 4A3FJ 1P6RA 1OPCA 2WBMA 3JW4A 3HHGA 3JSPA 4MO7A 3OSGA 2EV5A 3DEEA 3E3VA 2LKPA 3N05A 4A0YA 5EG0A 1I6HJ 2GAUA 4UB8C 2JMWA 1R4NB 3TO9A 1WFXA 3DPUA 2BY1A 3BR3A 1JUMA 4FTHA 1VQNI 1XD7A 3T5XA 3HXLA 4P9UA 3WTXC 3GW2A 1TW2A 3BJAA 1E0EA 4BKXA 2XASA 5LGNA 1S3JA 5FO5A 4DBQA 3FMQA 3JR9A 4FX0A 3G4SI 2E2JJ 3BCAA 2JVHA 2OUMA 4DQ2A 4HV6A 1SFKA 3HBLA 4O6JA 4P1WA 1N77A 1TWHJ 1QU3A 1MJBA 2XIGA 2HKOA 2L0KA 4GYIA 5L3FA 2E7WA 1ZTRA 1D0ZA 1IZ1A 4HQMA 4UVAA 3ZMUA 3KE2A 1K78B 1AHDP 4U7BA 3G71I 2DA2A 5L3GA 5HDGA 1PJRA 2E2IJ 1X1CA 3NRVA 3JTRA 3WHCA 2O61A 2ZO4A 3KP6A 5CVRA 2PMHA 2KT0A 5IT3A 1T39A 3DP7A 2STWA 1HCRA 4C9YA 2ZKZA 5J47A 3NEUA 3F9KA 3HIFA 1YYVA 1OR0A 1ZRDA 1Y56A 3ABLH 4G6DA 4WKVA 2A6HF 1PDNC 3ABMH 1HQCA 4XRFA 2P81A 1X58A 1OCTC 2WV1A 2LY2A 1MBEA 2D1VA 1SD7A 1WJCA 3R61A 2R5ZA 3VPRA 4X6AJ 2H09A 1IN7A 1NK2P 1R36A 5JI6A 4RB0A 2KL4A 1HSJA 5J4VA 5ICEA 1OCZH 4NBQA 4RM2A 4QPQA 3GTQJ 1Z7LA 3IL2A 1MMSA 4XM3A 4NDLA 3KYDB 2L9NA 3F22A 1YE9A 4MTEA 1VQMI 1I1SA 2XKOA 4BE0A 3HUGA 4K2EA 2FMLA 5K5RA 1J0RA 4CICA 5HS8A 1S7OA 5CVJA 4MQ9F 5GP9A 2R7SA 2LKSA 2K9LA 5IPAA 5LGUA 4L18B 3I59A 1ETQA 1G59A 4XNFA 1EH6A 2DN0A 2J5OA 3MWMA 4HDUA 4JX5A 3CCVI 2DW4A 3FXUA 1T95A 1B8IB 2LBFA 2DPDA 2QSHX 2FNPA 4OOIA 2F5CA 1USSA 1UCRA 1LVKA 2W4SA 5K5OA 1XDUA 4P9FA 3H9GA 4FASD 2L9RA 5GTIC 3QODA 2AXTC 1A35A 1Z05A 3Q0VA 4JX4A 2QGUA 2BV6A 2DA6A 1YIJI 3HB9A 1IGNA 1AU7A 5C3EJ 4XLEA 2V1DA 2HOSA 2W24A 5JR3A 2HDWA 2VONA 1TWFJ 1XCBA 2M45A 2UV1A 2ELHA 1RR7A 5TRDA 2WAQA 1QPIA 3C7JA 3S2HJ 4ZDOA 2KISA 3LSGA 2KJBA 3OIPA 3QU6A 1LUJB 5LLQA 3RTRA 1NG7A 5IY5H 3FGRA 2FD5A 4DZJA 5LHIA 1FC3A 4MEXF 2LY1A 5GTHC 3LSRA 2HXIA 3A02A 1BC8C 3E6BA 4U0WA 4E7KA 4CCOA 1HKQA 1IJWC 1GHCA 3M9AA 1GM7A 4EM1A 1SVLA 2ADUA 3C2BA 5DD8A 1NTCA 4HZFA 5J6XA 2R7DA 5HS9A 3CJNA 1T0FC 3IH4A 1LFPA 4NNJA 2A6EF 4QIWN 1SFXA 4M71A 1V55H 2Z1DA 1ZRCA 2VPLA 1B9MA 3OYNA 3DU5A 2DO7A 3CJRB 1OCPA 2V6CA 5FROA 1S8NA 4EJVA 2WB1A 1W5TA 1USTA 2CMPA 2G7HA 4HBLA 1MZBA 3GTGJ 2R7OA 2A6TA 3A2KA 2JSCA 3OYIA 4CCMA 1JXSA 1XN7A 2MA3A 3B6CA 2W57A 2QYOA 1OCRH 2IW5A 2DOAA 3K1NA 1CF7B 2XB0X 2EV6A 2WY7Q 3DKWA 2A5YB 2I8DA 5LD2C 1DGWY 4II3A 3ERMA 2MD5A 1Z91A 2WYCA 4WXHA 3KCCA 3LSPA 1QGPA 1R22A 2IEKA 5EZGA 3CF2A 2K3FA 2BW3B 2D5VA 2WYDA 2CQNA 5FB2A 1KA8A 4L9NA 1T33A 4LD5A 3MMYB 5GAGJ 5LFAA 2KHMA 1VQPI 1A31A 2Q0OA 2I5UA 2OBPA 4AIJA 1F4KA 1R00A 2DMNA 2CW8A 5DTDA 1OQYA 5KVRA 4CYCA 3GUDA 3UKGA 3GZ5A 4BUPA 3V42A 2IP2A 1DU6A 2DLLA 5E1XA 2VXZA 2NVUB 3VWBA 3K4CA 3BQYA 4BYYA 2XAJA 4UUSB 4IKFA 2VUMJ 4CUGA 5D6FA 2EB7A 4ESFA 4M3BA 3P5JA 4G8XA 3OS0A 2O8KA 4LG3A 2VODA 2JN6A 3HSEA 3JRIA 1V3FA 1MSEC 2UXNA 4HNUA 3KEYA 1JUPA 4MNUA 4YIRX 3LA7A 4PCQA 2VLAA 4MFDA 2L2OA 3S3NA 5J1UA 4BJ6C 2HVQA 3TDUC 3AKZA 1IXRC 4RBOA 1X2MA 4U88A 4YEJA 1W7PA 3F3XA 2M34A 4BXFA 4PFOA 3G3ZA 2GIVA 4G6QA 4BHPA 2E1CA 1R5ID 5E3OA 1XX5A 1ZLJA 2QM3A 4JK1X 4M3DA 3T8TA 3C1DA 3ZQ7A 4A5MA 3DBRB 4QWQA 1X4OA 5EGOB 3IHUA 5CYVA 3WE3A 1P4WA 5IYCJ 3ZPLA 3PJRA 1FMVA 3BG7A 3IKVA 1K7DA 3GTPJ 2ZJ2A 3OYHA 5AIQA 3H9QA 1VZ0A 1ZR2A 3W6JB 4GXOA 1WHUA 2ZMEA 2XAHA 4HAMA 4HW0A 2MYSA 5L3EA 3ZMSA 1HKSA 3GO5A 3D1NI 3OWTA 4HX7A 3DCFA 3BY6A 4EJOA 2EFPA 5HS7A 2VOPA 2XPUA 4DBRA 3K9TA 3M7GA 3RKWA 4GYGA 3Q0WA 2L5QA 1UMQA 3OR2C 5IP7J 2EQRA 4N9IA 4ENNA 2CUJA 3I54A 1LDJA 2R7UA 2QWWA 4M3FA 2EJRA 5B5EC 4Y3OA 1UFMA 3JRGA 3CCEI 4A3JJ 1XGMA 3I58A 5CQEA 4Q4ZF 1BJZA 2XC7A 3BZCA 3RYPA 2CJJA 2UUZA 2NNNA 1TNSA 1FIAA 2WAQN 1XMKA 2V9PA 3E6DA 1KQ8A 2A69F 1FYKA 3LSIA 4YIFA 3W2WA 1Z77A 3WGIA 2CH0A 2GOMA 4B1RA 2LOOA 3DEUA 2BHZA 3BR2A 2AQEA 3ZN1A 3S2WA 4A5NA 3L7WA 3A0HC 4KFCA 4ZDPA 4ESBA 4EQQA 2W00A 1FYLA 5CVVA 3Q3SA 1RZ4A 2QCOA 3S32A 2ZSIB 5DCFA 4Y52J 3FISA 4E55A 3DF8A 3WG7H 4N4OB 1MDMA 4A3BJ 3IWZA 5DUIA 2UZKA 1AJNA 3K7AJ 2ZNZA 5J1YA 2E5ZA 3WG9A 3CDIA 3L09A 5F08A 1H9TA 4BQOA 4L5IA 4M9SA 3K4KA 3OIOA 3GYHX 1J5YA 2J5PA 4G94A 3ELKA 4V2FA 1W36C 1WJAA 2PMUA 5F1RA 5EF6A 1X3WB 2QA4I 3T8RA 5BMZA 2GA2A 3L2CA 3ZMTA 1ZKGA 5DCMA 3BJ6A 2DK5A 1E17A 2E1MC 2LTPA 4A3GJ 3HTSB 1P7IA 3G2BA 3COAC 1AWCA 1R4MB 1X1AA 2QQ9A 2F2EA 2ZFWA 4BXUA 4HLXA 1A36A 3J7YJ 2NVXJ 3OL4A 1WH7A 2QKLB 5EEHA 3HKZA 5E17F 2A61A 2ZXJA 5BPIA 2OJED 1YW7A 3ML0A 1T98A 1IV6A 1I3QJ 1RESA 4M6VA 4CZCA 3J80Z 2HVRA 5ILUA 1ZGJA 4XLAA 1I50J 5FD6A 2JT1A 3J7AY 4DYQA 3M8EA 5D4SA 3SZPA 1QZYA 2M5WA 3VSKA 2CV2A 3OYJA 2BXYA 1E3OC 1WZ2A 2G0EA 2R3SA 2OA4A 3C3WA 3QOEA 5ILSA 3R6SA 4LK0F 5GPAA 4D1QA 2ZJRF 3AL0B 5FGMA 5LHHA 3CF5F 2MH2A 3K2ZA 1IAWA 3S1MJ 3EUAA 3QYFA 4KUMA 4MTDA 4A3DJ 1FOYA 3CMEI 1Y1WJ 3REOA 2KLOA 3LFUA 1B6AA 2RNGA 1OCOH 5HVQC 1GV5A 2Y9YA 2CFOA 3H3ZA 3LSKA 3I53A 3W3CA 2NOGA 1UHMA 4D5FA 5IOYA 4XQFA 1UZCA 3I55I 3BG6A 1H8AC 3ESWB 1IN6A 2CG4A 2P4WA 4G12A 2L54A 4LIUA 1SD5A 3GTLJ 4NC7A 4RAZA 1TNTA 2HYGD 2PMZN 3BP8A 1TW3A 3LQRA 4YFKF 2KDZA 3DLLF 2W82A 1QBJA 1S29A 3ZQFA 3FDYA 4AUXA 4WWCA 2D2WA 3H35A 1K61A 3UR3C 3ML6A 4BEHB 3L2WA 1RUOA 1FBUA 2EZKA 2JA2A 3ISPA 2LMDA 3HOYJ 2PJRA 1TBXA 2O3FA 3DWLE 2BE5F 5LBQA 1D8JA 1FP2A 4L9VA 3Q5FA 2DA4A 5FKMA 1ZELA 2Q2EA 3L2VA 1VF9A 2PX9A 3M1CA 1QHGA 4IPAA 3SQNA 1PVEA 3FXOA 2K40A 1FLIA 3G73A 2LG4A 4NHJA 3QP5A 4NC8A 4FCYA 1TT0A 3LSTA 3CD6I 4KIBA 3TGNA 3GZNB 1KQ0A 4UY8I 1MMGA 2F6CA 4F92B 2EFQA 3E7LA 1J75A 2P7CB 1U5TA 2F5FA 2R5YB 2YUSA 2X1CA 2OCCH 3CJQB 3LSHA 2CYYA 2JA5J 2HXOA 2HOAA 2VJIA 3RQ4A 2EIJH 1P2FA 4XLCA 2DTRA 1AKHA 1JX9A 3KEOA 4N4NB 1Y0UA 1JKOC 2P8TA 1A04A 2GWRA 3BG9A 4BL0B 3RQIA 1V5EA 3IP4B 2QENA 2L4MA 4UV8A 1FSEA 4FE4A 2DXIA 1T2KA 3S3MA 3I5UA 4XONA 4KN4X 3OY9A 2EWNA 4C30A 3MZ8A 1XC5A 3V8JA 3SRBA 3AFHA 1K4TA 3RPUA 1N75A 2R5ZB 3BZKA 2Y0MA 1FYMA 2CO5A 2IGKA 1BI0A 2YU9J 4XKCA 2GBYA 2AQFA 1ZGAA 2BVMA 4BY1J 4UNOA 4Y7NJ 1KQ9A 3I3LA 2M0CA 4IO9F 3L2UA 2R7WA 3BR6A 1MNEA 1J9IA 1YQAA 3VDXA 2R7VA 1GKFA 1BBYA 1IUYA 2CQ7A 3HUGB 4ENMA 3CCJI 3TDZC 4DW6A 5J40A 4LOCA 3LL7A 2Y9ZA 1X1DA 2BY3A 2HS5A 1AJQA 3GBGA 1N78A 1FWZA 2DMUA 1YJWI 1K5QA 3R4KA 4I02A 4I7HA 4XSZF 1MKMA 5J1RA 2F4MB 2Z33A 1EV7A 1UELB 2EZHA 3HZJA 1O57A 2EPFA 3VYUB 3S2DJ 1K5SA 2HEOA 3GTKJ 2XV4S 3CMAI 3K4LA 2KIUA 4J00A 4I0BA 4Z2YA 2ADVA 1RUNA 2DJIA 3A01B 1G8XA 3MKZA 3BROA 3PUFA 1BOBA 5E79C 1GUUA 4ZJZA 3CLOA 2N8GA 1Y8RB 3TMOA 4CCLA 1Z9CA 3PNTA 5H6RA 2RKHA 4KITB 1QPMA 1Z7UA 5FKNA 3U2RA 2VB6A 5BS6A 1I1GA 3L91A 3KEQA 3T1BA 2V1UA 3OYFA 5B66C 2V79A 1AJPA 2H1KA 3HKZN 3QWLA 2CV0A 1DUXC 4CCKA 4CCNA 2HQNA 1LE8A 2X4HA 3MEXA 1PNLA 3ZQHA 3HOUJ 4O3MA 4B43A 1XGOA 3SFIA 1YI2I 1TTYA 1JJ8C 3IUOA 4Q48A 1WJDA 2PJPA 3OSFA 4IRHA 2KJCA 2EA4A 1DP3A 5M3FJ 4HF2A 3CUOA 1K83J 5AONA 4F52A 4XLFA 2M3AA 3VYTB 3J81Z 1FMWA 4UVCA 4ITVA 1ETWA 3F8CA 2R4GA 1IRFA 4A12A 3JRDA 3IRQA 4M74A 2HFHA 3K70D 5J8FA 2QF7A 4WX9A 4BAYA 5D4RA 4H0EA 2ELJA 4NB5A 3J80K 1ZYRF 2O8XA 1MMAA 3JRAA 3MZHA 5C4XJ 3CMMA 2BXZA 3H0DA 3H9JA 3JAMZ 4ANJA 3CJTB 4MGRA 3SEZA 4FISA 5ICGA 3HTUA 1JJ6C 3RZDJ 3HRMA 2M87A 2DT6A 2AE4A 1IXCA 2GIZA 4G6TB 4E4HA 1XG1A 4AD9A 4F93B 3CCSI 3EYYA 1ZK8A 1TWAJ 2OQGA 1T38A 4WF2A 4KDPA 4BE1A 1ZLKA 3GFJA 2C6YA 2YSRA 3GLLA 5CPRB 3AL0C 2E19A 3TOBA 4IQJA 4OIPF 3LFKA 1QZEA 1WQ2A 3JRHA 1Z6TA 1U9NA 3W2VA 3MN2A 4PELA 3WU2C 2DK8A 5GAEJ 5F0HA 2XGXA 1XMAA 4D5CA 3H3UA 3AG4H 2FOWA 3R0JA 5EEGA 2R7ZJ 1T8IA 1EH7A 1U3EM 2HYFA 4E7LA 4BQAA 1K79A 1ONVA 2DT5A 5ERIA 3K3WA 3ERED 2F5VA 2HVSA 4A6EA 3I4MJ 3GMEA 2LD5A 4D0PA 4KICA 4R8HA 4CCJA 3E6MA 1HDPA 2OF7A 2W48A 2HU9A 1G2HA 2E34A 2OD5A 1X1BA 2W7NA 2RN7A 1ZARA 4IEJA 1SFEA 1ON2A 1PUFB 2P6SA 5FKKA 3K4JA 1KONA 1IF1A 3VODA 2LR8A 4L5JA 3QYBA 1X2NA 3CTAA 4ZH4F 2VJ5A 1JTYA 3BR5A 4GRIA 1VTNC 4PEMA 2IBDA
chains in the Genus database with same CATH topology
3OL3A 3CZ6A 3HC7A 3QYEA 3DKXA 2M0MA 2R7QA 2E5NA 4HNUA 3OYBA 4XOPA 3KEYA 4B3XA 3MD2A 3JTQA 2XDVA 2VLAA 3E0JB 1R6RA 2NOJB 2L2OA 3HG9A 3S3NA 4BJ6C 2HVQA 3DPTA 3OYDA 1KEHA 3AKZA 3FHNA 4HG2A 4YEJA 3DU6A 4YF9A 2UWMA 1KECA 4BXFA 4PFOA 3FBIB 3ZQQA 1D1CA 2DT7B 4BDYA 2KP6A 2O5RA 3L2QA 2R7XA 4HRIA 2VASA 2X6XA 5FRNA 1X4OA 1D1AA 1JVZA 2WYBA 3ONQA 2HPMA 3PJRA 1FMVA 3BG7A 1K7DA 4E6KG 2V7FA 3S3OA 2WADA 3OYHA 3H9QA 3VYRB 1GK9A 1VZ0A 1YX3A 4BE2A 3OYMA 2A5WA 4OWRB 2MYSA 4D9JA 3M8JA 1FXHA 1PNKA 4RMNA 2E1MB 4E7SA 3MKZA 3OWTA 3DTIA 1DGRM 4F55A 3IAS2 3I9V2 3OYCA 4HNTA 4DBRA 4B48A 5HLTA 2L5QA 3C2HA 3ZR8X 3OR2C 3OIQA 4IQ4A 2CUJA 2M4KA 4M1JA 2HQAA 2X1EA 2R7UA 1LKXA 2WYEA 2KRHA 4Y3OA 3DQVC 4WKSA 2CW7A 5CQEA 2KZVA 2XC7A 4PUSA 4XN3A 3SRAA 2GOXB 2UUZA 4ZTJA 2JVGA 2XSJC 1AI5A 4BEHA 2KQRA 2LRDA 2XF6A 3HPHA 2QKMB 4C2UA 3LSIA 3K4BA 3W2WA 4WKUA 1BR2A 1LDKB 2CH0A 2GOMA 4HSTA 2LOOA 4CH7A 2Z16A 1DQUA 2AQEA 3DKYA 4B44A 3OOUA 4ZDPA 2KDOA 2W00A 2HPIA 3S32A 3K70C 2ZSIB 5FRMA 2WAFA 2ZXIA 3BLYA 4E55A 2L7KA 4R79A 4E7IA 4N4OB 4IX7A 1TZLA 3D5SC 1AJNA 2E5ZA 1GM8A 1D0YA 4BQOA 3W2AA 3K4KA 4PFPA 1MNDA 4OAZA 1W36C 1WJAA 3OMYA 4XN0A 1GHDA 4K2GA 3PL8A 3C2GA 2X51A 2WAEA 3E1SA 2OV7A 3DPLC 4XLHA 1UAAA 3H5AA 1X19A 4LIVA 2E1MC 3PFYA 3RCOA 2XF5A 1Z3YA 3A4CA 3G2BA 4KJZA 1X1AA 2IS2A 3UNGC 2VIXA 4YFAA 3OL4A 3D5RC 2QKLB 1JW0A 3SDBA 3HKZA 1MW7A 1WJ5A 2E60A 3ZGKA 5TGTA 3TL4X 3ML0A 2KPMA 3L94A 4CZCA 2HVRA 2MC4A 3BCBA 4XLAA 4XORA 3RPUD 4EATA 5HNFA 1QHHD 3J7AY 4PJMA 4E56A 3K4NA 2PMZA 2HZDA 3DTKA 4XOTA 3VSKA 4BU2A 2CV2A 3OYJA 1Y6IA 4ZYAA 3DTEA 3HOSA 3H5RA 3KX2A 4PJNA 4AU7A 3QOEA 2V4JC 4XL9A 4D1QA 2RREA 3AL0B 3S8RA 1BR4A 3RSNA 3EUAA 3QYFA 4F3QA 5KCMA 2ZXHA 3LSMA 3ZRGA 2KLOA 4BQQA 3LFUA 2AE5A 3EUKL 2RNGA 1FM2A 2FUG2 2F4IA 5HVQC 3LSKA 2CFOA 3CP8A 1FXVA 3DLAA 4II2A 3W3CA 3VYSB 4BGDA 2L9SA 5HNHA 1E3AA 3PUBA 4BJTA 3K10A 3VSLA 4XQFA 3H5NA 2BOLA 3BG6A 2X6WA 4Y33A 1V5GA 4LIUA 2X85A 2IS1A 4NUBA 2PJRB 4NC7A 3OYLA 4E57A 2W82A 2WBMA 3FDYA 2M4GA 3H35A 2KMUA 3UR3C 2KRCA 3EPZA 4IZZA 3L2WA 4BEHB 3N05A 2IGOA 3DEEA 2JA2A 4QPOA 4KT6A 2PJRA 1JI8A 1SAUA 3DWLE 4KISA 2AE3A 3SZGA 2LH9A 3K4MA 2M7AA 1WFXA 3DPUA 1ZELA 3L2VA 1WJFA 3HXLA 4BJ5C 3M1CA 1QHGA 1D0XA 1V5FA 3NWTA 3LMMA 4PK4A 1E0EA 1GLNA 4JOMA 4DBQA 2LG4A 4AVZA 4NC8A 2HNHA 1TT0A 3OYKA 5HOOA 3BCAA 2JVHA 2OUMA 3S8PA 2RQQA 1SFKA 5JHFA 3FKJA 1D1BA 1N77A 4P1WA 1MMGA 2VQCA 1QU3A 2LC2A 2F6CA 4F92B 4XKVA 3FBNB 2R7TA 3S93A 2JSPA 4X0GA 4CSWA 3OR1C 1D0ZA 4XMYA 2LYCA 2X1CA 1PYVA 3CJQB 3LSHA 4NQWB 2VJIA 1OR7C 3RQ4A 4PSWA 4XLCA 4U7BA 1Z3XA 1JX9A 1PJRA 4N4NB 3SYTA 1X1CA 4E7HA 2VQLA 4BL0B 3JTRA 1V5EA 3IP4B 3OYEA 2K9MA 2ZFUA 1ERDA 2DXIA 3L2RA 3S3MA 1AA7A 4XONA 3OY9A 4C30A 4C9YA 3SRBA 3AFHA 3F9KA 1N75A 1NG6A 2R7RA 1OR0A 1Y56A 4HEA2 1P9QC 1S9HA 4WKVA 2IGKA 3OYGA 2CV1A 4BS9A 4XKCA 2AQFA 2BVMA 2VXDA 4BACA 2Q1ZB 3I3LA 3ZCOA 1H2GA 2LY2A 3L2UA 2R7WA 4E7JA 1MNEA 1WJCA 3VDXA 2R7VA 1GKFA 3CP2A 2WY8Q 3HUGB 4ZC3A 2W1OA 3K6GA 4FETA 2CS3A 1AI6A 1X4PA 2LREA 4PSXA 4Y4RA 2KL4A 3LL7A 4RM2A 4QPQA 1AJQA 1X1DA 3PSFA 1Z7LA 4J01A 3GBGA 1N78A 1K5QA 4XM3A 1WJEA 2L9NA 1YE9A 4DGWB 1OLTA 1UELB 3VYUB 4BQNA 4BE0A 4XR6A 1K5SA 4H4KC 2X1DA 3K4LA 4J00A 4YRVA 2R7SA 3TBIA 2K9LA 2ADVA 2DJIA 1G59A 3EUHC 1J09A 1G8XA 3A1YA 4HPQA 3BC8A 4XNFA 1BOBA 4F91B 3CESA 4ZJZA 3PNVA 3TMOA 2K3PA 4CCLA 4C2TA 3NWSA 5CQGA 2IS4A 1GK1A 1T95A 3OS2A 3PNTA 2LBFA 4RM3A 4DIQA 2W4SA 1LVKA 3SEQA 4KITB 2IS6A 3H9GA 2VB6A 5CKTA 3L91A 4FASD 4PJJA 1MMDA 3OYFA 3QODA 1AJPA 4ZTFA 2CV0A 3IAM2 4U87A 2X6YA 4CCKA 2VKHA 4CCNA 4CA0A 1PNLA 3PSIA 4XLEA 2VKDA 4B43A 3HPGA 2HDWA 3IUOA 4K2FA 4ZDLA 3HOTA 1WJDA 2UV1A 2Q2EB 2WAQA 4AYBA 2VJ4A 4ZDOA 4OAYA 3LSGA 1DP3A 4XKBA 4LITA 1AI4A 4YELA 3OIPA 1GM9A 3RTRA 1NG7A 2MD0A 2XAUA 4F52A 4XLFA 4XKWA 2M3AA 3VYTB 4WKTA 3MKYB 1FMWA 2LY1A 4YFBA 2V6EA 4ITVA 1Z21A 2MFZA 2R4GA 4CCOA 4E7KA 1PNMA 3K70D 1GM7A 5KNLA 4PJLA 2ELJA 1MMAA 2XF7A 3CMMA 4DJAA 4HSRA 3H0DA 3H9JA 1T0FC 4NNJA 1LFPA 4ANJA 1EA3A 2Z1DA 3SEZA 2VPLA 3MKWB 1AI7A 3ZXSA 2DT6A 3OYNA 4DOZA 2AE4A 3DU5A 4G6TB 1YX5A 4E4HA 3CJRB 4RLQA 5FROA 4F93B 2WB1A 3HL2A 2CMPA 1W36D 5KHDA 4JQFA 2R7OA 2A6TA 3A2KA 2V1NA 3OYIA 4CCMA 4BE1A 4E7ZA 2Y0SA 1GK0A 2IGNA 2JUGA 5CPRB 3U21A 3AL0C 2DOAA 1BR1A 2WY7Q 3D5LA 3OS1A 4IQJA 2I8DA 5LD2C 2BVLA 1DGWY 1MMNA 4II3A 2CUZA 3KYLA 2WYCA 2WA0A 3W2VA 4PELA 2V9KA 2VQGA 4BTHA 3CF2A 1UG0A 2BW3B 3PNYA 2WYDA 4BDZA 2V26A 4P5OA 2DCEA 3MMYB 5LFAA 4E7LA 2KHMA 4RLFA 1K6YA 2F5VA 2HVSA 3K3WA 1WJBA 2IGMA 2CW8A 4CCJA 2VJJA 2K5CA 2HU9A 2M7BA 2BW3A 1IRXA 1X1BA 2W7NA 2P0WA 2OC6A 4BUPA 2VQHA 3V42A 1CP9A 3K4JA 2VXZA 1KONA 3VWBA 1HA8A 3K4CA 2ZSHB 2MABA 2Z2SB 2VL8A 3QYBA 2VJ5A 3OYAA 4IKFA 4GRIA 2IXSA 4CUGA 3SRCA 1U0JA 4B47A 4PEMA 4MLOA 3OS0A 2LBFB 4LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFB A;  3K3W A;  1AJN A;  1AI5 A;  1PNL A;  2ADV A;  1H2G A;  1GK0 A;  4YFA A;  1PNM A;  1GM8 A;  1JX9 A;  1GM7 A;  3S8R A;  1JW0 A;  1GKF A;  1JVZ A;  4E57 A;  2WYB A;  4WKU A;  1AI6 A;  3JTR A;  4HST A;  1K7D A;  4K2F A;  1GK1 A;  3ML0 A;  4HSR A;  1GHD A;  3JTQ A;  1CP9 A;  4K2G A;  4M1J A;  2AE5 A;  3L94 A;  2WYC A;  4PEL A;  1FM2 A;  2WYE A;  1AJQ A;  1AI7 A;  4BTH A;  1GK9 A;  1K5Q A;  1AI4 A;  1FXV A;  1GM9 A;  1KEH A;  3L91 A;  4WKS A;  3SRB A;  4E56 A;  2AE4 A;  2WYD A;  1OR0 A;  1E3A A;  1AJP A;  3SRC A;  4YF9 A;  1KEC A;  2AE3 A;  1FXH A;  4WKV A;  4PEM A;  1K5S A;  1PNK A;  3SRA A;  4E55 A;  4WKT A; 
#chains in the Genus database with same CATH topology
 4BHB A;  4KMF A;  3OL3 A;  4CO8 A;  1KU2 A;  3DKX A;  3FK7 A;  2K9N A;  2OAZ A;  4OIQ F;  1W7P B;  4XOP A;  1LEB A;  2K4J A;  2ME0 A;  4HNV A;  3MD2 A;  3HRU A;  4MEY F;  3GF2 A;  4RGX A;  2XDV A;  1XTA A;  2DA1 A;  3IRR A;  5BOX A;  1R6R A;  1G6N A;  2K9S A;  2DMP A;  3LA3 A;  2NNY A;  3I0T A;  5BPD A;  5CVU A;  3OYD A;  3FHN A;  4HG2 A;  4A0X A;  3TW7 A;  2ZNY A;  1RIO H;  3DU6 A;  4YF9 A;  3ZN0 A;  2EZL A;  5A2Q Z;  2PFB A;  3WTT C;  3ZQQ A;  3HOW J;  2DT7 B;  1YRN A;  1RKW A;  4EV0 A;  2EIL H;  2O5R A;  2EIK H;  3CUQ B;  2R7X A;  2EH3 A;  2QUF A;  2VAS A;  2CUE A;  5JVT A;  2ZME B;  1WWX A;  2B9S A;  3CC2 I;  2ID3 A;  5EEA A;  4OIO F;  1JVZ A;  3TP0 A;  1XS9 A;  4D7N A;  2HPM A;  1IRZ A;  5HOD A;  3BR0 A;  3S3O A;  2DOF A;  2HQR A;  3KP7 A;  2L01 A;  2X9D A;  2CQX A;  5L3B A;  3GWZ A;  1YX3 A;  1UB9 A;  3WTS C;  3OYM A;  1LFB A;  1WSU A;  3ZQC A;  1FXH A;  1X3Z B;  4RMN A;  2E1M B;  2BY2 A;  4KT5 C;  2MH9 A;  3DTI A;  1VQO I;  2LK2 A;  3FX3 A;  1M1E B;  2OZ6 A;  4Q47 A;  4AIH A;  4F55 A;  4HNT A;  2PLY A;  2EV0 A;  1HBX G;  3E5U A;  3IKT A;  4B09 A;  1SVM A;  3VFZ A;  5HLT A;  1IDZ A;  3C2H A;  3ZR8 X;  1YIO A;  2QQB A;  3OIQ A;  5JHU A;  2JA6 J;  2VE9 A;  4M1J A;  1O3R A;  2HQA A;  1JKR C;  1LKX A;  5L3D A;  3CO6 C;  1KYZ A;  1CGP A;  4WKS A;  1SVO A;  2DFF A;  1IN4 A;  1S72 I;  3EYI A;  5LGT A;  2ETH A;  2GOX B;  2HWV A;  4V2G A;  5IYD J;  2JVG A;  2XSJ C;  2CGP A;  4A3K J;  2FMY A;  3H1C A;  4C3J J;  1ZGW A;  2KQR A;  2LRD A;  2XF6 A;  1XSX A;  3QU3 A;  1PUE E;  1O3Q A;  2DPU A;  3GTM J;  3I64 A;  4M72 A;  2QKM B;  3WTW C;  2UXX A;  3I56 I;  3K4B A;  4WKU A;  4WXD A;  1MDM B;  1U8B A;  1DQU A;  4BWC A;  2IVM A;  2LY9 A;  2GLO A;  4I2O A;  1QO0 D;  4ZYH A;  1SD4 A;  4LFU A;  3EUH A;  4LMY A;  3SDG A;  1ITY A;  1SAX A;  1YHQ I;  2TRT A;  3I4P A;  1MH3 A;  4E7I A;  1F36 A;  2YPR A;  1W0T A;  1TZL A;  5E3L A;  3MFK A;  3ZMV A;  1BOA A;  2LF8 A;  3JCU C;  2ISZ A;  1GXP A;  3BQZ A;  1D0Y A;  2K86 A;  3G1M A;  1GHD A;  1K78 A;  4HDV A;  4K2G A;  3PL8 A;  3FWE A;  2O9L A;  3C2G A;  1ETO A;  2XGC A;  3TO7 A;  5H2F C;  3E1S A;  3FHZ A;  4RAY A;  3DPL C;  2D1H A;  4XLH A;  3J81 K;  1VQK I;  3D0S A;  4CXF A;  1I3A A;  3QPL A;  5L3C A;  2B7E A;  1JGG A;  1W5S A;  3A4C A;  4LLN A;  2RDP A;  2STT A;  3QPH A;  4ZYG A;  3FXJ A;  3UNG C;  3F8M A;  2VIX A;  3JAM K;  2EA2 A;  4AID A;  2M9H A;  5LRS A;  1JW0 A;  3SDB A;  3JRB A;  1D3Y A;  3ZGK A;  3FXK A;  2XPW A;  5TGT A;  5IP6 A;  3BDD A;  3TL4 X;  2DI3 A;  4IOC F;  4PDK A;  1SEU A;  1ZHF A;  1YTY A;  3MZY A;  1TT5 B;  1S6L A;  2NS0 A;  2MC4 A;  3KPH A;  1E2X A;  2QEX I;  2BY0 A;  4E56 A;  4EAT A;  5HNF A;  1QHH D;  1A6I A;  3LWF A;  2E1N A;  3WOD F;  3X2Q H;  2PMZ A;  3CDH A;  2HZD A;  3DTK A;  3WTU C;  3S1N J;  2EIM H;  4YG2 F;  1P92 A;  3KZI C;  3H5R A;  2B63 J;  2RRE A;  4G7O F;  3S8R A;  1Z0X A;  3MVP A;  1BR4 A;  3RSN A;  3SXY A;  3PM1 A;  2NVQ J;  2ZXH A;  3LSM A;  3EUK L;  3S16 J;  1FM2 A;  1OJL A;  5F0C A;  2F4I A;  2HTJ A;  3LA2 A;  4UXN A;  4C3H J;  3CP8 A;  1FXV A;  2H8R A;  1B4A A;  4M73 A;  4RGR A;  5HNH A;  2XRO A;  1BI3 A;  5ED4 A;  2IAI A;  2CU7 A;  3I71 A;  3WE2 A;  4O5V A;  1B8I A;  3H5N A;  2BOL A;  3CLQ A;  2X6W A;  4Y33 A;  5ICC A;  2IRF G;  4UV9 A;  2V1X A;  4ZZL A;  4NUB A;  2RVC A;  2GXA A;  1ETV A;  3DV8 A;  2PJR B;  1KU3 A;  1OIS A;  3OYL A;  2A3S A;  2ID6 A;  1B72 A;  4E57 A;  4CYD A;  4S04 A;  1MJ9 A;  1R49 A;  2KMU A;  2LSO A;  4IZZ A;  3EPZ A;  3F6V A;  1LNW A;  5IYB J;  3OOP A;  2HQ5 A;  2KIQ A;  4KIS A;  1IXS B;  2FJ1 A;  2JRT A;  2LH9 A;  2M7A A;  3K4M A;  1JHH A;  4KN7 X;  5IP9 J;  3HRT A;  1WJF A;  4BJ5 C;  1J2X A;  4CDG A;  2QBY B;  1JKQ C;  4I0A A;  2RC4 A;  4LLG F;  1Z67 A;  2QQA A;  3G1O A;  2PI0 A;  1GLN A;  4ESJ A;  4ABZ A;  3FGT A;  4AVZ A;  3RKQ A;  1U5T B;  1EKE A;  1ZG5 A;  2HNH A;  2FBI A;  5B1B H;  5HOO A;  2H27 A;  1Q1H A;  1UHW A;  1Q1V A;  1R58 A;  3E6C C;  1GDT A;  2IA0 A;  4HYE A;  5A2Q K;  2VQC A;  2LC2 A;  1AKH B;  3P9C A;  4XKV A;  3S93 A;  4X0G A;  3B73 A;  4CSW A;  2GXG A;  3OR1 C;  4XMY A;  3MKL A;  1PYV A;  2XAF A;  4I6Z A;  1VFC A;  1OR7 C;  3GZ6 A;  2WC2 A;  3CUQ C;  1FOX A;  4PSW A;  4DNC A;  2RGV A;  2P7V B;  3HOZ J;  3RIR A;  2ZME C;  2H94 A;  2CQQ A;  3K2A A;  1MBG A;  3RDI A;  2PQ8 A;  3O8H A;  3V7R A;  3PO3 J;  4OIR F;  2K9M A;  2ZFU A;  1ZN2 A;  4Z6Y A;  1IW7 F;  2HTS A;  3L2R A;  4NQW A;  1VQ8 I;  4A69 C;  2DQL A;  3ROU A;  3V4G A;  4A3I J;  2P5L C;  1P9Q C;  1S9H A;  1KZH A;  3OYG A;  3RZO J;  4JYK A;  2NRA C;  1XSV A;  2GQQ A;  2VXD A;  4PZJ A;  1U78 A;  2Q1Z B;  3ZCO A;  2QSF X;  5J4Y A;  4E7J A;  2VE8 A;  2NAZ A;  3L9F A;  3CP2 A;  2WY8 Q;  2W1O A;  3K6G A;  4A93 J;  2CS3 A;  4I01 A;  1AI6 A;  2FF4 A;  2HGC A;  4PSX A;  3B6A A;  4Y4R A;  3HHH A;  5GPC A;  2XAG A;  3PSF A;  5K7H A;  4J01 A;  4YFN F;  1OLT A;  1QNT A;  3IWF A;  2DOD A;  5E8I A;  4XR6 A;  2ZJP F;  5FKO A;  2X1D A;  3L00 A;  1SFO J;  3GLX A;  4PJ0 C;  2DJN A;  1LB2 A;  5F27 A;  4CGZ A;  4RAG A;  2ECC A;  2HDD A;  1BC7 C;  3R60 A;  3CES A;  2H1L A;  4HQE A;  3M1E A;  3PNV A;  2K3P A;  1STZ A;  2VI6 A;  5CQG A;  2GXB A;  4G9Y A;  2IS4 A;  1GK1 A;  1BI2 A;  1LE8 B;  1PP8 F;  4C2M J;  2DFE A;  4S05 A;  2XPV A;  3MQ0 A;  1U2W A;  2DYS H;  3E5X A;  3GX4 X;  4PJJ A;  4LG0 B;  2MC3 A;  4ZTF A;  1YFH A;  4X1E A;  5LEJ A;  3IAM 2;  1ACI A;  4RB1 A;  4IHY A;  1J59 A;  3WHB A;  2EFN A;  5FLX Z;  3RJP A;  1MNM C;  2BZT A;  1EF4 A;  3AG2 H;  3PSI A;  5EG0 B;  3GEZ A;  3GTO J;  4F7Z A;  2VKD A;  1XGS A;  3JRF A;  4BHC A;  2ISY A;  1OYY A;  4K2F A;  2VJ4 A;  3ABU A;  4PGH A;  2NVY J;  4OAY A;  4V19 K;  4KIG A;  4A2U A;  1P4A A;  2Z99 A;  4LIT A;  1AI4 A;  4YEL A;  5EGO A;  2ESN A;  1O4X A;  4KMU X;  3N4M A;  1QRY A;  2XAU A;  3SHF A;  1YW8 A;  3RKX A;  4Y13 A;  3MKY B;  2L9V A;  3F8N A;  1TWG J;  2V6E A;  2ACJ A;  2JA8 J;  3WGH A;  1Z21 A;  5DD4 A;  3HOV J;  1VQ6 I;  1WKM A;  1FT9 A;  5FLV A;  3H3V K;  4QLC U;  3GCM A;  3KFW X;  5KNL A;  4PJL A;  5B1A H;  1REP C;  4RB3 C;  2XF7 A;  4DJA A;  1H89 C;  4KNY A;  1FJL A;  1ZQ3 P;  4L9T A;  1AI7 A;  3QOP A;  3ZXS A;  2FEZ A;  4YII A;  2FNA A;  4DOZ A;  4EJT A;  4HX4 A;  5IT9 Z;  1YX5 A;  3FXR A;  3CCR I;  4EJU A;  3BR1 A;  5K1Y A;  3KZZ A;  3HL2 A;  1JE8 A;  1HW1 A;  4AYB N;  2FU4 A;  4GO1 A;  3ZMZ A;  2K02 A;  4E7Z A;  2Y0S A;  1FTT A;  3U21 A;  4C3I J;  2VT2 A;  3D5L A;  3HGY A;  1H9G A;  1YIT I;  1H0M A;  1Y39 A;  1K7A A;  3HM5 A;  2BVL A;  1MMN A;  2AXL A;  1FOW A;  2WA0 A;  2ESH A;  2V9K A;  3PO2 J;  4BTH A;  4BBS J;  2DFI A;  3DBL B;  1UG0 A;  3ABT A;  2V26 A;  1XCV A;  3O2P E;  4P5O A;  1TC3 C;  2DCE A;  2LNB A;  2L4A A;  1WRJ A;  1WGX A;  2DA7 A;  3KZY A;  2FBH A;  1K6Y A;  4UUT A;  3WTZ A;  1S5L C;  1UHS A;  2IGM A;  2Y2Z A;  1HC8 A;  3V7S A;  2P0W A;  2BGC A;  3AG3 H;  2QLZ A;  2VQH A;  2I10 A;  1ON1 A;  3L1P A;  1O7L A;  1R1T A;  2ZSH B;  3I59 B;  4KIF A;  2VL8 A;  1VQ9 I;  2K7L A;  3K69 A;  3P9I A;  4B47 A;  1V4R A;  2LBF B;  4A3E J;  2LF7 A;  3MCZ A;  2GZW A;  3HC7 A;  3QYE A;  2M0M A;  1MD0 A;  2O7O A;  2RV8 A;  1DPU A;  3PIO F;  2E5N A;  4GDF A;  3OYB A;  4B3X A;  1U5T C;  3U1K A;  1E3H A;  2LLK A;  1JUS A;  2M8E A;  2DMT A;  2K85 A;  2GA1 A;  2MSY A;  2ZCW A;  1YRN B;  3AG1 H;  1U6G A;  3HG9 A;  3SZT A;  1XDS A;  3SJM A;  1BN5 A;  2B0L A;  1KEH A;  4JBA A;  3ASO H;  3KLO A;  4ENJ A;  1LVA A;  1YS7 A;  1YO5 C;  2Z9O A;  2UWM A;  1KEC A;  4UVB A;  3BG3 A;  2OPT A;  1E3P A;  2VC1 A;  2XGE A;  3TKY A;  1D1C A;  4M9Z A;  4BDY A;  2KP6 A;  1KGS A;  2DQR A;  4HV5 A;  5JLW A;  4IHX A;  2X6X A;  5FRN A;  1NHA A;  2AS5 F;  2CWE A;  3S14 J;  1A6Q A;  1TP4 A;  4IOA F;  2W25 A;  1GV2 A;  2A05 A;  2WYB A;  5F6F A;  2Z5U A;  2YR2 A;  2Y48 A;  2WAD A;  3KYC B;  2XUB A;  1HDD C;  2H6C A;  1IN5 A;  5EYR A;  3HSF A;  4BE2 A;  1K4S A;  4AWX B;  2A5W A;  1SAN A;  2M30 A;  4BNC A;  4OWR B;  1OKR A;  1Y8Q B;  4D9J A;  3M8J A;  1F9N A;  1DDN A;  4N0B A;  3WGG A;  4E7S A;  1YJN I;  4WCG A;  1B59 A;  4HX8 A;  3F8F A;  2OQR A;  1JT6 A;  1FP1 D;  3ZQL A;  5FFX A;  3HDD A;  4P96 A;  3CC4 I;  2JWT A;  3RPQ A;  3I9V 2;  1KYW A;  1XB4 A;  2JPC A;  4FQG A;  4JX6 A;  2M2E A;  3HOX J;  3FIW A;  2CSO A;  4G7H F;  5DM6 F;  3P7N A;  4D7M A;  3H0G J;  5D5X B;  2VT3 A;  2X1E A;  3BTJ A;  3S1R J;  2P5K A;  3O6B B;  2QVO A;  1RRJ A;  2O0Y A;  1ZG3 A;  2DTZ A;  3LNQ A;  4PUS A;  2BHY A;  4R1H A;  4XID A;  2HOT A;  3FXQ A;  4M6X A;  5FLM J;  1YS6 A;  4U7D A;  2XB5 A;  1H88 C;  3M3Y J;  2DU9 A;  2LP0 A;  3RI4 A;  1HF0 A;  2E1O A;  4BEH A;  1ETK A;  3PIP F;  3TP3 A;  2MLG A;  3FMR A;  5DM7 F;  4ZYD A;  3HPH A;  3RYR A;  2IPQ X;  1BJA A;  4G7Z F;  1LDK B;  4HST A;  3BTL A;  2O6G E;  1RNL A;  1R23 A;  1MBK A;  2XHK A;  4M6Y A;  4RA2 A;  2HPI A;  4L9J A;  4LJZ F;  3K70 C;  3KP4 A;  5FRM A;  1FEX A;  2WAF A;  2FE3 A;  5FLX K;  1IDY A;  4CYC B;  3BLY A;  3ABK H;  2NXN B;  1GT0 C;  1HLV A;  4R79 A;  2YU3 A;  4OMZ A;  5TIS C;  4ETS A;  4IRG A;  2DBB A;  2QSG X;  5EZH A;  2HYJ A;  1APL C;  1GM8 A;  1FBS A;  5ILV A;  3IV5 A;  1R71 A;  4PFP A;  4FE7 A;  1W4M A;  3ZP5 A;  2R5Y A;  1FY7 A;  3OMY A;  4XN0 A;  2FX0 A;  1GXQ A;  4WK8 F;  3I4N J;  2X51 A;  1X3U A;  3JTH A;  2E71 A;  2OV7 A;  1UAA A;  1N25 A;  2Y0S N;  2R92 J;  3CCQ I;  2ECB A;  2JZY A;  2ZJQ F;  2G9W A;  2MLK A;  2HDC A;  1L0O C;  2OTL I;  1OYI A;  2XF5 A;  4LB6 B;  1T6S A;  1TLH B;  3KLN A;  4KJZ A;  1BIB A;  4IHT A;  4I09 A;  3LQQ A;  2VBY A;  1QZZ A;  2E7X A;  3M8F A;  1IG7 A;  4YFA A;  4BH9 A;  4ENK A;  1MBH A;  3D5R C;  1MW7 A;  1C0W A;  1QVT A;  5IOZ A;  3KP5 A;  5IT9 K;  5E18 F;  2M8G X;  3GXO A;  3QQA A;  3L94 A;  3VEP A;  2EFW A;  2FQ4 A;  3BG5 A;  4XOR A;  4PJM A;  3K4N A;  1JTX A;  5KAF C;  1VQL I;  1HKT A;  3FKI J;  4XOT A;  1W1W E;  4N9H A;  4BU2 A;  3ZQI A;  3HRS A;  3E97 A;  4EGY A;  4A6D A;  1Y6I A;  4ZYA A;  2R93 J;  1T0F A;  3DTE A;  3HOS A;  4WXC A;  3ZOB A;  4L0Z B;  4AU7 A;  3GFM A;  4XL9 A;  5LRR A;  2HZT A;  3U9G A;  5HLG A;  2OU2 A;  5F64 A;  5H6Q A;  1OMI A;  3KIO A;  3S17 J;  1LPQ A;  5KCM A;  3ECH A;  3ZRG A;  4BQQ A;  1W5C C;  1SMY F;  2FUG 2;  2VBW A;  3H36 A;  5EDN A;  3A01 A;  4XIC A;  3DLA A;  4BGD A;  1B72 B;  2MW8 A;  1E3A A;  5D6E A;  4E70 A;  3VSL A;  3DEW A;  2Y69 H;  4LGW A;  4M3E A;  2VBZ A;  1ZAO A;  2L3D A;  5LEK A;  2X85 A;  2FQ3 A;  5D5V B;  5K7Z A;  2IT0 A;  3VOE A;  2HI3 A;  3JRC A;  2M4G A;  4KYW A;  1HOM A;  4Q5S F;  2E35 A;  2KRC A;  1RC9 A;  2WWY A;  4FX4 A;  1BW6 A;  3QPT A;  2IGO A;  2R0Q C;  3EDP A;  3CDL A;  4QPO A;  4KT6 A;  2H6B A;  2ELK A;  1ORK A;  1MSF C;  1SAU A;  1JI8 A;  1BL0 A;  2AE3 A;  3SZG A;  5DYM A;  3ULQ B;  2WV0 A;  1R5G A;  5D5W B;  4Y15 A;  3NWT A;  1D0X A;  1V5F A;  1WVR A;  4PGG A;  2D45 A;  2JQ7 A;  1O3S A;  4OMY A;  3LMM A;  4PK4 A;  1WCM J;  2JRM A;  2JTV A;  2X6O A;  5M5Y J;  4JOM A;  4MHG A;  1I39 A;  1GVD A;  4HF0 A;  1MBJ A;  3NQO A;  3OYK A;  5DUK A;  5DV5 A;  4AVP A;  1KU9 A;  3S8P A;  2RQQ A;  5JHF A;  3FKJ A;  1D1B A;  3A0B C;  3FBN B;  3PFI A;  2R7T A;  3TO6 A;  1F1Z A;  2JSP A;  3A03 A;  2W85 A;  3B02 A;  2LYC A;  4W97 A;  1G3Y A;  2ICW G;  4CZZ A;  5CJ9 A;  5GAD J;  4NQW B;  1QA6 A;  2TCT A;  2FRH A;  2A68 F;  2F4O B;  5E1Z B;  1Z3X A;  2DFH A;  2K9Q A;  1B9N A;  3E5Q A;  5DCM B;  3SYT A;  4E7H A;  1W0U A;  2CRG A;  2VQL A;  3OYE A;  3V7C A;  2QQ8 A;  2YX7 A;  3Q9V A;  1CQT A;  1ERD A;  1AA7 A;  1ULY A;  1SMT A;  4RGU A;  4LB5 A;  1NG6 A;  2R7R A;  1L3L A;  2XVC A;  4HEA 2;  2CV1 A;  4BS9 A;  1D5Y A;  2CW0 F;  1IRG A;  1IN8 A;  2HOE A;  1TL8 A;  4BAC A;  5FFZ A;  3S1Q J;  1T56 A;  1H2G A;  1D5V A;  2DMQ A;  2L02 A;  4FHT A;  4EGZ A;  4ZC3 A;  3FZV A;  1R9T J;  4FET A;  4MFE A;  1X4P A;  2LRE A;  1WH5 A;  1Y0N A;  1WI9 A;  5DS9 A;  4XSX F;  1YOV B;  1XGN A;  2XAQ A;  4QTR A;  1MJA A;  3H92 A;  2K4B A;  1S7E A;  1I27 A;  1R1V A;  1VQ5 I;  1WJE A;  2ME6 A;  2JA7 J;  1S7A A;  4DGW B;  3WTY C;  1ZRF A;  2KKO A;  5JFR A;  4BQN A;  3F0C A;  4P55 A;  4H4K C;  2MGQ A;  4U0V A;  1PUF A;  1B1B A;  4XLN F;  3CCY A;  4YRV A;  3TBI A;  3WU1 B;  3HSR A;  1J09 A;  3A1Y A;  3EUH C;  4HPQ A;  4F91 B;  3BC8 A;  4BXX J;  5E8G A;  4HF1 A;  1U8R A;  5F1J A;  5FKL A;  4L0Y B;  4C2T A;  3NWS A;  3OS2 A;  4RM3 A;  5HDK A;  5M5W J;  2RNJ A;  3ASN H;  5KK1 A;  4DIQ A;  3SEQ A;  2IS6 A;  2P5V A;  3BZ6 A;  5CKT A;  3P9K A;  4EEF G;  1MMD A;  5DDG A;  1O3T A;  1AOY A;  4GGG A;  4JP0 A;  3WTV C;  2QZ8 A;  4EM0 B;  3CO7 C;  4EVI A;  5E3N A;  1LEA A;  2DYR H;  2X6Y A;  3BTI A;  4U87 A;  2VKH A;  1YW9 A;  2L7F P;  4BY7 J;  1GVJ A;  3TW6 A;  4CA0 A;  1NK3 P;  2FA5 A;  2OZU A;  1TQM A;  3KET A;  3ECO A;  3HPG A;  2NYX A;  1JGS A;  3HYI A;  4UHT A;  4ZDL A;  3HOT A;  4XRS G;  2Q2E B;  1R5H A;  4AYB A;  1FIP A;  1P7J A;  2IA1 A;  3F8B A;  1OR7 A;  2Z3Y A;  2HR3 A;  3CUQ A;  4XKB A;  1GM9 A;  3IH2 A;  3PQK A;  3TOA A;  1VI0 A;  2GM4 A;  1W7P D;  1OFC X;  4U0Y A;  3J7Z I;  1IO2 A;  2MD0 A;  1G3W A;  1HW5 A;  2MBF A;  4XKW A;  5JLX A;  3Q9S A;  1R1U A;  2COB A;  4XRM A;  4WKT A;  4AM3 A;  3CMY A;  4YFB A;  1ZR4 A;  2F48 A;  2MFZ A;  2PBI A;  5DEQ A;  1PNM A;  3CQZ J;  3F23 A;  1D8K A;  1ZRE A;  1BA5 A;  2EK5 A;  3IC7 A;  4HSR A;  5KAI C;  1BW5 A;  1LDD A;  1EA3 A;  2AHQ A;  1ETY A;  2Q8K A;  4IRI A;  3MKW B;  1YLF A;  2DA3 A;  1TQI A;  5E1W A;  9ANT A;  1A5J A;  2LDU A;  5F04 A;  4RLQ A;  3QPS A;  3QRF F;  1K6O A;  3M07 A;  1W36 D;  5KHD A;  1HW2 A;  4JQF A;  5M5X J;  5E3M A;  2V1N A;  4IHS A;  4AIK A;  5ICF A;  2FSW A;  5BNG A;  5D8K B;  1GK0 A;  2IGN A;  2JUG A;  2M1B A;  4I99 C;  1RR8 C;  3LSJ A;  1BR1 A;  2G7U A;  2EBI A;  4UB6 C;  3OS1 A;  1UJ8 A;  4QSH A;  3OV8 A;  2CUZ A;  2CFX A;  3KYL A;  2IJL A;  2BEO A;  2OTJ I;  3PQJ A;  2VQG A;  4RDU A;  1JKP C;  3PNY A;  4L5E A;  4BDZ A;  1IUF A;  1NH3 A;  3O3K A;  1ZH5 A;  1CF7 A;  6PAX A;  3ZMD A;  4RLF A;  1POG A;  1T08 B;  1RKT A;  3FXM A;  2R7F A;  3DFG A;  1WJB A;  3NAR A;  1FBQ A;  2VJJ A;  1U9O A;  2K5C A;  3K0L A;  1Z6R A;  2M7B A;  4IL6 C;  2YX4 A;  2BW3 A;  1IRX A;  4OIN F;  5K7F A;  4W1U A;  2PG4 A;  3JTG A;  3BTC A;  2WTE A;  3CC7 I;  1XMX A;  2OC6 A;  2WB1 N;  3FK6 A;  3V8L A;  4BBR J;  4ZYE A;  4HLY A;  3QAH A;  1CP9 A;  5JVG F;  1HA8 A;  2ZXW H;  2MAB A;  1XSD A;  4RS8 A;  3GFI A;  2LFB A;  2Z2S B;  2LVS A;  1OYW A;  2DAO A;  3OYA A;  3SRC A;  2IXS A;  3WU0 A;  1U0J A;  3BOQ A;  4MLO A;  5J8C A;  2AO9 A;  1FX7 A;  4A3M J;  3CZ6 A;  4IHV A;  2R7Q A;  3S15 J;  5B3S H;  1BI1 A;  1BIA A;  1EJ9 A;  4UUS A;  2XSD C;  5EJC A;  4ON0 A;  1LJ9 A;  4XLP F;  3G6E I;  3E0J B;  2XRN A;  3JTQ A;  2NOJ B;  1JHF A;  2JPB A;  2PEX A;  3M4O J;  1RPW A;  2E2H J;  2BBY A;  3DPT A;  4GCV A;  2Y31 A;  2MG4 A;  4A3C J;  2W84 A;  1YJ9 I;  2OCE A;  5CLS A;  3GTJ J;  1TWC J;  2XRL A;  2XKP A;  1IC8 A;  3FBI B;  4IJA A;  4AC0 A;  1PP7 U;  2K27 A;  1ENH A;  3L2Q A;  4Y17 A;  4HRI A;  4CHU A;  4YFX F;  3HGG A;  1D1A A;  3FM3 A;  1FPQ A;  2Y75 A;  3F21 A;  2PN6 A;  3ONQ A;  3U1D A;  4E6K G;  2KRF A;  2V7F A;  4LK1 F;  1J7K A;  3FMS A;  3KP2 A;  3BJO A;  1VND A;  1WPK A;  2DDA A;  3VYR B;  1GK9 A;  4NC6 A;  3SFZ A;  2O03 A;  2BYV E;  3FF5 A;  1F43 A;  2DA5 A;  5BQT A;  4TV7 A;  1SC7 A;  1PNK A;  3Q0U A;  2VN2 A;  2KZG A;  1SD6 A;  3G1L A;  1V54 H;  4UUV A;  2JK3 A;  1I6X A;  2JUC A;  2VPR A;  1DU0 A;  1DGR M;  1MGT A;  1MIJ A;  1UG2 A;  3OYC A;  3IAS 2;  2F5D A;  1ZG1 A;  2ZBK A;  4IVN A;  2KIM A;  4FT8 A;  4B48 A;  3LAJ A;  3CCU I;  2E36 A;  4RGS A;  1HXD A;  3IH3 A;  4IQ4 A;  1JT0 A;  2F5E A;  2M4K A;  1ODD A;  3DXJ F;  1OCC H;  3AAF A;  1G4D A;  2WYE A;  2KRH A;  2RAE A;  1MH4 A;  4OU0 A;  4DZP A;  3DQV C;  4M9X A;  4I98 B;  2CW7 A;  2NS7 A;  1O7F A;  3TQN A;  2NVT J;  3GVA A;  1XPX A;  2KZV A;  5GAH J;  3JRE A;  4XN3 A;  3SRA A;  1I5Z A;  3FM5 A;  1P4X A;  3HEF A;  2VOO A;  4ZTJ A;  2P6T A;  1FZP B;  1X1P A;  1AI5 A;  3O8G A;  5K5Q A;  2COM A;  4IXA A;  4I76 A;  2FXA A;  3VB2 A;  1MBF A;  4C2U A;  5HLH A;  1DPR A;  1BR2 A;  2DOE A;  3EET A;  2EZI A;  5H20 A;  4CH7 A;  2DDB A;  2Z16 A;  2JJ7 A;  2VBX A;  3DKY A;  4HA8 A;  3K1P A;  4B44 A;  3OOU A;  2ZB9 A;  4J19 A;  2QBY A;  2KDO A;  4KA4 A;  2EIN H;  5D5U B;  2ZXI A;  2NS8 A;  5J3L A;  4XK4 A;  4A3L J;  2L7K A;  3W6V A;  3LAP A;  4RAF A;  2X0L A;  4IX7 A;  1RET A;  2IA2 A;  2EFO A;  3D5S C;  4XBF A;  2XGD A;  3RKY A;  2KIF A;  4XRS A;  3R0A A;  3BT9 A;  4ASN A;  4EJW A;  1FOK A;  4RB2 C;  1YG2 A;  3W2A A;  1SFU A;  1MND A;  3K1M A;  4OAZ A;  4B4C A;  2VC0 A;  2HKX A;  1RI7 A;  3NAU A;  3TED A;  4HOB A;  4S0H B;  1ETX A;  1G3T A;  3BPX A;  4GFB A;  2WAE A;  4MIM A;  3J7A O;  2L7Z A;  3H5A A;  4B3A A;  2CQK A;  3ZQG A;  5LHG A;  1X19 A;  3KP3 A;  4LIV A;  3MAJ A;  3PFY A;  3RCO A;  3CCL I;  1Z3Y A;  2L7M P;  1G3S A;  2Y30 A;  1FTZ A;  2IS2 A;  1QVU A;  5HLI A;  1R7J A;  3N97 A;  1VQ7 I;  5FD5 A;  1TQP A;  3C18 A;  1WJ5 A;  5CVI A;  2E60 A;  5TJJ A;  2FOK A;  5M3M J;  2KPM A;  1WI3 A;  2FBK A;  2LKX A;  3EQL F;  3BCB A;  3W6K B;  4A0Z A;  3RPU D;  4IHW A;  3LOC A;  3DBH B;  3CCM I;  2ZC2 A;  1FNN A;  1Z1D A;  2TDX A;  2RQP A;  3GFL A;  3F6O A;  5C44 J;  5D8L B;  1VQ4 I;  1KU7 A;  1DP7 P;  3V8K A;  1BM9 A;  3FXL A;  3KX2 A;  1HST A;  3QP6 A;  4PJN A;  2V4J C;  4EM2 A;  5E20 A;  2X48 A;  4DYR A;  1FSH A;  3BWG A;  2YS9 A;  4MQV A;  5FJ8 J;  1F5T A;  4F3Q A;  4ZZD A;  1Y1V J;  1IV8 A;  1EH8 A;  2AE5 A;  4B8X A;  1LQ1 A;  5C4J J;  4II2 A;  3F72 A;  3VYS B;  3T0Y A;  2CUF A;  4EMS A;  2H8W A;  2A07 F;  2L9S A;  4M3G A;  3PUB A;  4BJT A;  3K10 A;  3BPV A;  5F0F A;  4LLL A;  4DYC A;  1LFU P;  3JSO A;  4IF4 A;  1V5G A;  5AIP A;  2V9V A;  1QQI A;  2IS1 A;  4LG0 A;  2VKV A;  2VKE A;  2KFD A;  3HJE A;  5HDN A;  4A3F J;  1P6R A;  1OPC A;  2WBM A;  3JW4 A;  3HHG A;  3JSP A;  4MO7 A;  3OSG A;  2EV5 A;  3DEE A;  3E3V A;  2LKP A;  3N05 A;  4A0Y A;  5EG0 A;  1I6H J;  2GAU A;  4UB8 C;  2JMW A;  1R4N B;  3TO9 A;  1WFX A;  3DPU A;  2BY1 A;  3BR3 A;  1JUM A;  4FTH A;  1VQN I;  1XD7 A;  3T5X A;  3HXL A;  4P9U A;  3WTX C;  3GW2 A;  1TW2 A;  3BJA A;  1E0E A;  4BKX A;  2XAS A;  5LGN A;  1S3J A;  5FO5 A;  4DBQ A;  3FMQ A;  3JR9 A;  4FX0 A;  3G4S I;  2E2J J;  3BCA A;  2JVH A;  2OUM A;  4DQ2 A;  4HV6 A;  1SFK A;  3HBL A;  4O6J A;  4P1W A;  1N77 A;  1TWH J;  1QU3 A;  1MJB A;  2XIG A;  2HKO A;  2L0K A;  4GYI A;  5L3F A;  2E7W A;  1ZTR A;  1D0Z A;  1IZ1 A;  4HQM A;  4UVA A;  3ZMU A;  3KE2 A;  1K78 B;  1AHD P;  4U7B A;  3G71 I;  2DA2 A;  5L3G A;  5HDG A;  1PJR A;  2E2I J;  1X1C A;  3NRV A;  3JTR A;  3WHC A;  2O61 A;  2ZO4 A;  3KP6 A;  5CVR A;  2PMH A;  2KT0 A;  5IT3 A;  1T39 A;  3DP7 A;  2STW A;  1HCR A;  4C9Y A;  2ZKZ A;  5J47 A;  3NEU A;  3F9K A;  3HIF A;  1YYV A;  1OR0 A;  1ZRD A;  1Y56 A;  3ABL H;  4G6D A;  4WKV A;  2A6H F;  1PDN C;  3ABM H;  1HQC A;  4XRF A;  2P81 A;  1X58 A;  1OCT C;  2WV1 A;  2LY2 A;  1MBE A;  2D1V A;  1SD7 A;  1WJC A;  3R61 A;  2R5Z A;  3VPR A;  4X6A J;  2H09 A;  1IN7 A;  1NK2 P;  1R36 A;  5JI6 A;  4RB0 A;  2KL4 A;  1HSJ A;  5J4V A;  5ICE A;  1OCZ H;  4NBQ A;  4RM2 A;  4QPQ A;  3GTQ J;  1Z7L A;  3IL2 A;  1MMS A;  4XM3 A;  4NDL A;  3KYD B;  2L9N A;  3F22 A;  1YE9 A;  4MTE A;  1VQM I;  1I1S A;  2XKO A;  4BE0 A;  3HUG A;  4K2E A;  2FML A;  5K5R A;  1J0R A;  4CIC A;  5HS8 A;  1S7O A;  5CVJ A;  4MQ9 F;  5GP9 A;  2R7S A;  2LKS A;  2K9L A;  5IPA A;  5LGU A;  4L18 B;  3I59 A;  1ETQ A;  1G59 A;  4XNF A;  1EH6 A;  2DN0 A;  2J5O A;  3MWM A;  4HDU A;  4JX5 A;  3CCV I;  2DW4 A;  3FXU A;  1T95 A;  1B8I B;  2LBF A;  2DPD A;  2QSH X;  2FNP A;  4OOI A;  2F5C A;  1USS A;  1UCR A;  1LVK A;  2W4S A;  5K5O A;  1XDU A;  4P9F A;  3H9G A;  4FAS D;  2L9R A;  5GTI C;  3QOD A;  2AXT C;  1A35 A;  1Z05 A;  3Q0V A;  4JX4 A;  2QGU A;  2BV6 A;  2DA6 A;  1YIJ I;  3HB9 A;  1IGN A;  1AU7 A;  5C3E J;  4XLE A;  2V1D A;  2HOS A;  2W24 A;  5JR3 A;  2HDW A;  2VON A;  1TWF J;  1XCB A;  2M45 A;  2UV1 A;  2ELH A;  1RR7 A;  5TRD A;  2WAQ A;  1QPI A;  3C7J A;  3S2H J;  4ZDO A;  2KIS A;  3LSG A;  2KJB A;  3OIP A;  3QU6 A;  1LUJ B;  5LLQ A;  3RTR A;  1NG7 A;  5IY5 H;  3FGR A;  2FD5 A;  4DZJ A;  5LHI A;  1FC3 A;  4MEX F;  2LY1 A;  5GTH C;  3LSR A;  2HXI A;  3A02 A;  1BC8 C;  3E6B A;  4U0W A;  4E7K A;  4CCO A;  1HKQ A;  1IJW C;  1GHC A;  3M9A A;  1GM7 A;  4EM1 A;  1SVL A;  2ADU A;  3C2B A;  5DD8 A;  1NTC A;  4HZF A;  5J6X A;  2R7D A;  5HS9 A;  3CJN A;  1T0F C;  3IH4 A;  1LFP A;  4NNJ A;  2A6E F;  4QIW N;  1SFX A;  4M71 A;  1V55 H;  2Z1D A;  1ZRC A;  2VPL A;  1B9M A;  3OYN A;  3DU5 A;  2DO7 A;  3CJR B;  1OCP A;  2V6C A;  5FRO A;  1S8N A;  4EJV A;  2WB1 A;  1W5T A;  1UST A;  2CMP A;  2G7H A;  4HBL A;  1MZB A;  3GTG J;  2R7O A;  2A6T A;  3A2K A;  2JSC A;  3OYI A;  4CCM A;  1JXS A;  1XN7 A;  2MA3 A;  3B6C A;  2W57 A;  2QYO A;  1OCR H;  2IW5 A;  2DOA A;  3K1N A;  1CF7 B;  2XB0 X;  2EV6 A;  2WY7 Q;  3DKW A;  2A5Y B;  2I8D A;  5LD2 C;  1DGW Y;  4II3 A;  3ERM A;  2MD5 A;  1Z91 A;  2WYC A;  4WXH A;  3KCC A;  3LSP A;  1QGP A;  1R22 A;  2IEK A;  5EZG A;  3CF2 A;  2K3F A;  2BW3 B;  2D5V A;  2WYD A;  2CQN A;  5FB2 A;  1KA8 A;  4L9N A;  1T33 A;  4LD5 A;  3MMY B;  5GAG J;  5LFA A;  2KHM A;  1VQP I;  1A31 A;  2Q0O A;  2I5U A;  2OBP A;  4AIJ A;  1F4K A;  1R00 A;  2DMN A;  2CW8 A;  5DTD A;  1OQY A;  5KVR A;  4CYC A;  3GUD A;  3UKG A;  3GZ5 A;  4BUP A;  3V42 A;  2IP2 A;  1DU6 A;  2DLL A;  5E1X A;  2VXZ A;  2NVU B;  3VWB A;  3K4C A;  3BQY A;  4BYY A;  2XAJ A;  4UUS B;  4IKF A;  2VUM J;  4CUG A;  5D6F A;  2EB7 A;  4ESF A;  4M3B A;  3P5J A;  4G8X A;  3OS0 A;  2O8K A;  4LG3 A;  2VOD A;  2JN6 A;  3HSE A;  3JRI A;  1V3F A;  1MSE C;  2UXN A;  4HNU A;  3KEY A;  1JUP A;  4MNU A;  4YIR X;  3LA7 A;  4PCQ A;  2VLA A;  4MFD A;  2L2O A;  3S3N A;  5J1U A;  4BJ6 C;  2HVQ A;  3TDU C;  3AKZ A;  1IXR C;  4RBO A;  1X2M A;  4U88 A;  4YEJ A;  1W7P A;  3F3X A;  2M34 A;  4BXF A;  4PFO A;  3G3Z A;  2GIV A;  4G6Q A;  4BHP A;  2E1C A;  1R5I D;  5E3O A;  1XX5 A;  1ZLJ A;  2QM3 A;  4JK1 X;  4M3D A;  3T8T A;  3C1D A;  3ZQ7 A;  4A5M A;  3DBR B;  4QWQ A;  1X4O A;  5EGO B;  3IHU A;  5CYV A;  3WE3 A;  1P4W A;  5IYC J;  3ZPL A;  3PJR A;  1FMV A;  3BG7 A;  3IKV A;  1K7D A;  3GTP J;  2ZJ2 A;  3OYH A;  5AIQ A;  3H9Q A;  1VZ0 A;  1ZR2 A;  3W6J B;  4GXO A;  1WHU A;  2ZME A;  2XAH A;  4HAM A;  4HW0 A;  2MYS A;  5L3E A;  3ZMS A;  1HKS A;  3GO5 A;  3D1N I;  3OWT A;  4HX7 A;  3DCF A;  3BY6 A;  4EJO A;  2EFP A;  5HS7 A;  2VOP A;  2XPU A;  4DBR A;  3K9T A;  3M7G A;  3RKW A;  4GYG A;  3Q0W A;  2L5Q A;  1UMQ A;  3OR2 C;  5IP7 J;  2EQR A;  4N9I A;  4ENN A;  2CUJ A;  3I54 A;  1LDJ A;  2R7U A;  2QWW A;  4M3F A;  2EJR A;  5B5E C;  4Y3O A;  1UFM A;  3JRG A;  3CCE I;  4A3J J;  1XGM A;  3I58 A;  5CQE A;  4Q4Z F;  1BJZ A;  2XC7 A;  3BZC A;  3RYP A;  2CJJ A;  2UUZ A;  2NNN A;  1TNS A;  1FIA A;  2WAQ N;  1XMK A;  2V9P A;  3E6D A;  1KQ8 A;  2A69 F;  1FYK A;  3LSI A;  4YIF A;  3W2W A;  1Z77 A;  3WGI A;  2CH0 A;  2GOM A;  4B1R A;  2LOO A;  3DEU A;  2BHZ A;  3BR2 A;  2AQE A;  3ZN1 A;  3S2W A;  4A5N A;  3L7W A;  3A0H C;  4KFC A;  4ZDP A;  4ESB A;  4EQQ A;  2W00 A;  1FYL A;  5CVV A;  3Q3S A;  1RZ4 A;  2QCO A;  3S32 A;  2ZSI B;  5DCF A;  4Y52 J;  3FIS A;  4E55 A;  3DF8 A;  3WG7 H;  4N4O B;  1MDM A;  4A3B J;  3IWZ A;  5DUI A;  2UZK A;  1AJN A;  3K7A J;  2ZNZ A;  5J1Y A;  2E5Z A;  3WG9 A;  3CDI A;  3L09 A;  5F08 A;  1H9T A;  4BQO A;  4L5I A;  4M9S A;  3K4K A;  3OIO A;  3GYH X;  1J5Y A;  2J5P A;  4G94 A;  3ELK A;  4V2F A;  1W36 C;  1WJA A;  2PMU A;  5F1R A;  5EF6 A;  1X3W B;  2QA4 I;  3T8R A;  5BMZ A;  2GA2 A;  3L2C A;  3ZMT A;  1ZKG A;  5DCM A;  3BJ6 A;  2DK5 A;  1E17 A;  2E1M C;  2LTP A;  4A3G J;  3HTS B;  1P7I A;  3G2B A;  3COA C;  1AWC A;  1R4M B;  1X1A A;  2QQ9 A;  2F2E A;  2ZFW A;  4BXU A;  4HLX A;  1A36 A;  3J7Y J;  2NVX J;  3OL4 A;  1WH7 A;  2QKL B;  5EEH A;  3HKZ A;  5E17 F;  2A61 A;  2ZXJ A;  5BPI A;  2OJE D;  1YW7 A;  3ML0 A;  1T98 A;  1IV6 A;  1I3Q J;  1RES A;  4M6V A;  4CZC A;  3J80 Z;  2HVR A;  5ILU A;  1ZGJ A;  4XLA A;  1I50 J;  5FD6 A;  2JT1 A;  3J7A Y;  4DYQ A;  3M8E A;  5D4S A;  3SZP A;  1QZY A;  2M5W A;  3VSK A;  2CV2 A;  3OYJ A;  2BXY A;  1E3O C;  1WZ2 A;  2G0E A;  2R3S A;  2OA4 A;  3C3W A;  3QOE A;  5ILS A;  3R6S A;  4LK0 F;  5GPA A;  4D1Q A;  2ZJR F;  3AL0 B;  5FGM A;  5LHH A;  3CF5 F;  2MH2 A;  3K2Z A;  1IAW A;  3S1M J;  3EUA A;  3QYF A;  4KUM A;  4MTD A;  4A3D J;  1FOY A;  3CME I;  1Y1W J;  3REO A;  2KLO A;  3LFU A;  1B6A A;  2RNG A;  1OCO H;  5HVQ C;  1GV5 A;  2Y9Y A;  2CFO A;  3H3Z A;  3LSK A;  3I53 A;  3W3C A;  2NOG A;  1UHM A;  4D5F A;  5IOY A;  4XQF A;  1UZC A;  3I55 I;  3BG6 A;  1H8A C;  3ESW B;  1IN6 A;  2CG4 A;  2P4W A;  4G12 A;  2L54 A;  4LIU A;  1SD5 A;  3GTL J;  4NC7 A;  4RAZ A;  1TNT A;  2HYG D;  2PMZ N;  3BP8 A;  1TW3 A;  3LQR A;  4YFK F;  2KDZ A;  3DLL F;  2W82 A;  1QBJ A;  1S29 A;  3ZQF A;  3FDY A;  4AUX A;  4WWC A;  2D2W A;  3H35 A;  1K61 A;  3UR3 C;  3ML6 A;  4BEH B;  3L2W A;  1RUO A;  1FBU A;  2EZK A;  2JA2 A;  3ISP A;  2LMD A;  3HOY J;  2PJR A;  1TBX A;  2O3F A;  3DWL E;  2BE5 F;  5LBQ A;  1D8J A;  1FP2 A;  4L9V A;  3Q5F A;  2DA4 A;  5FKM A;  1ZEL A;  2Q2E A;  3L2V A;  1VF9 A;  2PX9 A;  3M1C A;  1QHG A;  4IPA A;  3SQN A;  1PVE A;  3FXO A;  2K40 A;  1FLI A;  3G73 A;  2LG4 A;  4NHJ A;  3QP5 A;  4NC8 A;  4FCY A;  1TT0 A;  3LST A;  3CD6 I;  4KIB A;  3TGN A;  3GZN B;  1KQ0 A;  4UY8 I;  1MMG A;  2F6C A;  4F92 B;  2EFQ A;  3E7L A;  1J75 A;  2P7C B;  1U5T A;  2F5F A;  2R5Y B;  2YUS A;  2X1C A;  2OCC H;  3CJQ B;  3LSH A;  2CYY A;  2JA5 J;  2HXO A;  2HOA A;  2VJI A;  3RQ4 A;  2EIJ H;  1P2F A;  4XLC A;  2DTR A;  1AKH A;  1JX9 A;  3KEO A;  4N4N B;  1Y0U A;  1JKO C;  2P8T A;  1A04 A;  2GWR A;  3BG9 A;  4BL0 B;  3RQI A;  1V5E A;  3IP4 B;  2QEN A;  2L4M A;  4UV8 A;  1FSE A;  4FE4 A;  2DXI A;  1T2K A;  3S3M A;  3I5U A;  4XON A;  4KN4 X;  3OY9 A;  2EWN A;  4C30 A;  3MZ8 A;  1XC5 A;  3V8J A;  3SRB A;  3AFH A;  1K4T A;  3RPU A;  1N75 A;  2R5Z B;  3BZK A;  2Y0M A;  1FYM A;  2CO5 A;  2IGK A;  1BI0 A;  2YU9 J;  4XKC A;  2GBY A;  2AQF A;  1ZGA A;  2BVM A;  4BY1 J;  4UNO A;  4Y7N J;  1KQ9 A;  3I3L A;  2M0C A;  4IO9 F;  3L2U A;  2R7W A;  3BR6 A;  1MNE A;  1J9I A;  1YQA A;  3VDX A;  2R7V A;  1GKF A;  1BBY A;  1IUY A;  2CQ7 A;  3HUG B;  4ENM A;  3CCJ I;  3TDZ C;  4DW6 A;  5J40 A;  4LOC A;  3LL7 A;  2Y9Z A;  1X1D A;  2BY3 A;  2HS5 A;  1AJQ A;  3GBG A;  1N78 A;  1FWZ A;  2DMU A;  1YJW I;  1K5Q A;  3R4K A;  4I02 A;  4I7H A;  4XSZ F;  1MKM A;  5J1R A;  2F4M B;  2Z33 A;  1EV7 A;  1UEL B;  2EZH A;  3HZJ A;  1O57 A;  2EPF A;  3VYU B;  3S2D J;  1K5S A;  2HEO A;  3GTK J;  2XV4 S;  3CMA I;  3K4L A;  2KIU A;  4J00 A;  4I0B A;  4Z2Y A;  2ADV A;  1RUN A;  2DJI A;  3A01 B;  1G8X A;  3MKZ A;  3BRO A;  3PUF A;  1BOB A;  5E79 C;  1GUU A;  4ZJZ A;  3CLO A;  2N8G A;  1Y8R B;  3TMO A;  4CCL A;  1Z9C A;  3PNT A;  5H6R A;  2RKH A;  4KIT B;  1QPM A;  1Z7U A;  5FKN A;  3U2R A;  2VB6 A;  5BS6 A;  1I1G A;  3L91 A;  3KEQ A;  3T1B A;  2V1U A;  3OYF A;  5B66 C;  2V79 A;  1AJP A;  2H1K A;  3HKZ N;  3QWL A;  2CV0 A;  1DUX C;  4CCK A;  4CCN A;  2HQN A;  1LE8 A;  2X4H A;  3MEX A;  1PNL A;  3ZQH A;  3HOU J;  4O3M A;  4B43 A;  1XGO A;  3SFI A;  1YI2 I;  1TTY A;  1JJ8 C;  3IUO A;  4Q48 A;  1WJD A;  2PJP A;  3OSF A;  4IRH A;  2KJC A;  2EA4 A;  1DP3 A;  5M3F J;  4HF2 A;  3CUO A;  1K83 J;  5AON A;  4F52 A;  4XLF A;  2M3A A;  3VYT B;  3J81 Z;  1FMW A;  4UVC A;  4ITV A;  1ETW A;  3F8C A;  2R4G A;  1IRF A;  4A12 A;  3JRD A;  3IRQ A;  4M74 A;  2HFH A;  3K70 D;  5J8F A;  2QF7 A;  4WX9 A;  4BAY A;  5D4R A;  4H0E A;  2ELJ A;  4NB5 A;  3J80 K;  1ZYR F;  2O8X A;  1MMA A;  3JRA A;  3MZH A;  5C4X J;  3CMM A;  2BXZ A;  3H0D A;  3H9J A;  3JAM Z;  4ANJ A;  3CJT B;  4MGR A;  3SEZ A;  4FIS A;  5ICG A;  3HTU A;  1JJ6 C;  3RZD J;  3HRM A;  2M87 A;  2DT6 A;  2AE4 A;  1IXC A;  2GIZ A;  4G6T B;  4E4H A;  1XG1 A;  4AD9 A;  4F93 B;  3CCS I;  3EYY A;  1ZK8 A;  1TWA J;  2OQG A;  1T38 A;  4WF2 A;  4KDP A;  4BE1 A;  1ZLK A;  3GFJ A;  2C6Y A;  2YSR A;  3GLL A;  5CPR B;  3AL0 C;  2E19 A;  3TOB A;  4IQJ A;  4OIP F;  3LFK A;  1QZE A;  1WQ2 A;  3JRH A;  1Z6T A;  1U9N A;  3W2V A;  3MN2 A;  4PEL A;  3WU2 C;  2DK8 A;  5GAE J;  5F0H A;  2XGX A;  1XMA A;  4D5C A;  3H3U A;  3AG4 H;  2FOW A;  3R0J A;  5EEG A;  2R7Z J;  1T8I A;  1EH7 A;  1U3E M;  2HYF A;  4E7L A;  4BQA A;  1K79 A;  1ONV A;  2DT5 A;  5ERI A;  3K3W A;  3ERE D;  2F5V A;  2HVS A;  4A6E A;  3I4M J;  3GME A;  2LD5 A;  4D0P A;  4KIC A;  4R8H A;  4CCJ A;  3E6M A;  1HDP A;  2OF7 A;  2W48 A;  2HU9 A;  1G2H A;  2E34 A;  2OD5 A;  1X1B A;  2W7N A;  2RN7 A;  1ZAR A;  4IEJ A;  1SFE A;  1ON2 A;  1PUF B;  2P6S A;  5FKK A;  3K4J A;  1KON A;  1IF1 A;  3VOD A;  2LR8 A;  4L5J A;  3QYB A;  1X2N A;  3CTA A;  4ZH4 F;  2VJ5 A;  1JTY A;  3BR5 A;  4GRI A;  1VTN C;  4PEM A;  2IBD A; 
#chains in the Genus database with same CATH homology
 3OL3 A;  3CZ6 A;  3HC7 A;  3QYE A;  3DKX A;  2M0M A;  2R7Q A;  2E5N A;  4HNU A;  3OYB A;  4XOP A;  3KEY A;  4B3X A;  3MD2 A;  3JTQ A;  2XDV A;  2VLA A;  3E0J B;  1R6R A;  2NOJ B;  2L2O A;  3HG9 A;  3S3N A;  4BJ6 C;  2HVQ A;  3DPT A;  3OYD A;  1KEH A;  3AKZ A;  3FHN A;  4HG2 A;  4YEJ A;  3DU6 A;  4YF9 A;  2UWM A;  1KEC A;  4BXF A;  4PFO A;  3FBI B;  3ZQQ A;  1D1C A;  2DT7 B;  4BDY A;  2KP6 A;  2O5R A;  3L2Q A;  2R7X A;  4HRI A;  2VAS A;  2X6X A;  5FRN A;  1X4O A;  1D1A A;  1JVZ A;  2WYB A;  3ONQ A;  2HPM A;  3PJR A;  1FMV A;  3BG7 A;  1K7D A;  4E6K G;  2V7F A;  3S3O A;  2WAD A;  3OYH A;  3H9Q A;  3VYR B;  1GK9 A;  1VZ0 A;  1YX3 A;  4BE2 A;  3OYM A;  2A5W A;  4OWR B;  2MYS A;  4D9J A;  3M8J A;  1FXH A;  1PNK A;  4RMN A;  2E1M B;  4E7S A;  3MKZ A;  3OWT A;  3DTI A;  1DGR M;  4F55 A;  3IAS 2;  3I9V 2;  3OYC A;  4HNT A;  4DBR A;  4B48 A;  5HLT A;  2L5Q A;  3C2H A;  3ZR8 X;  3OR2 C;  3OIQ A;  4IQ4 A;  2CUJ A;  2M4K A;  4M1J A;  2HQA A;  2X1E A;  2R7U A;  1LKX A;  2WYE A;  2KRH A;  4Y3O A;  3DQV C;  4WKS A;  2CW7 A;  5CQE A;  2KZV A;  2XC7 A;  4PUS A;  4XN3 A;  3SRA A;  2GOX B;  2UUZ A;  4ZTJ A;  2JVG A;  2XSJ C;  1AI5 A;  4BEH A;  2KQR A;  2LRD A;  2XF6 A;  3HPH A;  2QKM B;  4C2U A;  3LSI A;  3K4B A;  3W2W A;  4WKU A;  1BR2 A;  1LDK B;  2CH0 A;  2GOM A;  4HST A;  2LOO A;  4CH7 A;  2Z16 A;  1DQU A;  2AQE A;  3DKY A;  4B44 A;  3OOU A;  4ZDP A;  2KDO A;  2W00 A;  2HPI A;  3S32 A;  3K70 C;  2ZSI B;  5FRM A;  2WAF A;  2ZXI A;  3BLY A;  4E55 A;  2L7K A;  4R79 A;  4E7I A;  4N4O B;  4IX7 A;  1TZL A;  3D5S C;  1AJN A;  2E5Z A;  1GM8 A;  1D0Y A;  4BQO A;  3W2A A;  3K4K A;  4PFP A;  1MND A;  4OAZ A;  1W36 C;  1WJA A;  3OMY A;  4XN0 A;  1GHD A;  4K2G A;  3PL8 A;  3C2G A;  2X51 A;  2WAE A;  3E1S A;  2OV7 A;  3DPL C;  4XLH A;  1UAA A;  3H5A A;  1X19 A;  4LIV A;  2E1M C;  3PFY A;  3RCO A;  2XF5 A;  1Z3Y A;  3A4C A;  3G2B A;  4KJZ A;  1X1A A;  2IS2 A;  3UNG C;  2VIX A;  4YFA A;  3OL4 A;  3D5R C;  2QKL B;  1JW0 A;  3SDB A;  3HKZ A;  1MW7 A;  1WJ5 A;  2E60 A;  3ZGK A;  5TGT A;  3TL4 X;  3ML0 A;  2KPM A;  3L94 A;  4CZC A;  2HVR A;  2MC4 A;  3BCB A;  4XLA A;  4XOR A;  3RPU D;  4EAT A;  5HNF A;  1QHH D;  3J7A Y;  4PJM A;  4E56 A;  3K4N A;  2PMZ A;  2HZD A;  3DTK A;  4XOT A;  3VSK A;  4BU2 A;  2CV2 A;  3OYJ A;  1Y6I A;  4ZYA A;  3DTE A;  3HOS A;  3H5R A;  3KX2 A;  4PJN A;  4AU7 A;  3QOE A;  2V4J C;  4XL9 A;  4D1Q A;  2RRE A;  3AL0 B;  3S8R A;  1BR4 A;  3RSN A;  3EUA A;  3QYF A;  4F3Q A;  5KCM A;  2ZXH A;  3LSM A;  3ZRG A;  2KLO A;  4BQQ A;  3LFU A;  2AE5 A;  3EUK L;  2RNG A;  1FM2 A;  2FUG 2;  2F4I A;  5HVQ C;  3LSK A;  2CFO A;  3CP8 A;  1FXV A;  3DLA A;  4II2 A;  3W3C A;  3VYS B;  4BGD A;  2L9S A;  5HNH A;  1E3A A;  3PUB A;  4BJT A;  3K10 A;  3VSL A;  4XQF A;  3H5N A;  2BOL A;  3BG6 A;  2X6W A;  4Y33 A;  1V5G A;  4LIU A;  2X85 A;  2IS1 A;  4NUB A;  2PJR B;  4NC7 A;  3OYL A;  4E57 A;  2W82 A;  2WBM A;  3FDY A;  2M4G A;  3H35 A;  2KMU A;  3UR3 C;  2KRC A;  3EPZ A;  4IZZ A;  3L2W A;  4BEH B;  3N05 A;  2IGO A;  3DEE A;  2JA2 A;  4QPO A;  4KT6 A;  2PJR A;  1JI8 A;  1SAU A;  3DWL E;  4KIS A;  2AE3 A;  3SZG A;  2LH9 A;  3K4M A;  2M7A A;  1WFX A;  3DPU A;  1ZEL A;  3L2V A;  1WJF A;  3HXL A;  4BJ5 C;  3M1C A;  1QHG A;  1D0X A;  1V5F A;  3NWT A;  3LMM A;  4PK4 A;  1E0E A;  1GLN A;  4JOM A;  4DBQ A;  2LG4 A;  4AVZ A;  4NC8 A;  2HNH A;  1TT0 A;  3OYK A;  5HOO A;  3BCA A;  2JVH A;  2OUM A;  3S8P A;  2RQQ A;  1SFK A;  5JHF A;  3FKJ A;  1D1B A;  1N77 A;  4P1W A;  1MMG A;  2VQC A;  1QU3 A;  2LC2 A;  2F6C A;  4F92 B;  4XKV A;  3FBN B;  2R7T A;  3S93 A;  2JSP A;  4X0G A;  4CSW A;  3OR1 C;  1D0Z A;  4XMY A;  2LYC A;  2X1C A;  1PYV A;  3CJQ B;  3LSH A;  4NQW B;  2VJI A;  1OR7 C;  3RQ4 A;  4PSW A;  4XLC A;  4U7B A;  1Z3X A;  1JX9 A;  1PJR A;  4N4N B;  3SYT A;  1X1C A;  4E7H A;  2VQL A;  4BL0 B;  3JTR A;  1V5E A;  3IP4 B;  3OYE A;  2K9M A;  2ZFU A;  1ERD A;  2DXI A;  3L2R A;  3S3M A;  1AA7 A;  4XON A;  3OY9 A;  4C30 A;  4C9Y A;  3SRB A;  3AFH A;  3F9K A;  1N75 A;  1NG6 A;  2R7R A;  1OR0 A;  1Y56 A;  4HEA 2;  1P9Q C;  1S9H A;  4WKV A;  2IGK A;  3OYG A;  2CV1 A;  4BS9 A;  4XKC A;  2AQF A;  2BVM A;  2VXD A;  4BAC A;  2Q1Z B;  3I3L A;  3ZCO A;  1H2G A;  2LY2 A;  3L2U A;  2R7W A;  4E7J A;  1MNE A;  1WJC A;  3VDX A;  2R7V A;  1GKF A;  3CP2 A;  2WY8 Q;  3HUG B;  4ZC3 A;  2W1O A;  3K6G A;  4FET A;  2CS3 A;  1AI6 A;  1X4P A;  2LRE A;  4PSX A;  4Y4R A;  2KL4 A;  3LL7 A;  4RM2 A;  4QPQ A;  1AJQ A;  1X1D A;  3PSF A;  1Z7L A;  4J01 A;  3GBG A;  1N78 A;  1K5Q A;  4XM3 A;  1WJE A;  2L9N A;  1YE9 A;  4DGW B;  1OLT A;  1UEL B;  3VYU B;  4BQN A;  4BE0 A;  4XR6 A;  1K5S A;  4H4K C;  2X1D A;  3K4L A;  4J00 A;  4YRV A;  2R7S A;  3TBI A;  2K9L A;  2ADV A;  2DJI A;  1G59 A;  3EUH C;  1J09 A;  1G8X A;  3A1Y A;  4HPQ A;  3BC8 A;  4XNF A;  1BOB A;  4F91 B;  3CES A;  4ZJZ A;  3PNV A;  3TMO A;  2K3P A;  4CCL A;  4C2T A;  3NWS A;  5CQG A;  2IS4 A;  1GK1 A;  1T95 A;  3OS2 A;  3PNT A;  2LBF A;  4RM3 A;  4DIQ A;  2W4S A;  1LVK A;  3SEQ A;  4KIT B;  2IS6 A;  3H9G A;  2VB6 A;  5CKT A;  3L91 A;  4FAS D;  4PJJ A;  1MMD A;  3OYF A;  3QOD A;  1AJP A;  4ZTF A;  2CV0 A;  3IAM 2;  4U87 A;  2X6Y A;  4CCK A;  2VKH A;  4CCN A;  4CA0 A;  1PNL A;  3PSI A;  4XLE A;  2VKD A;  4B43 A;  3HPG A;  2HDW A;  3IUO A;  4K2F A;  4ZDL A;  3HOT A;  1WJD A;  2UV1 A;  2Q2E B;  2WAQ A;  4AYB A;  2VJ4 A;  4ZDO A;  4OAY A;  3LSG A;  1DP3 A;  4XKB A;  4LIT A;  1AI4 A;  4YEL A;  3OIP A;  1GM9 A;  3RTR A;  1NG7 A;  2MD0 A;  2XAU A;  4F52 A;  4XLF A;  4XKW A;  2M3A A;  3VYT B;  4WKT A;  3MKY B;  1FMW A;  2LY1 A;  4YFB A;  2V6E A;  4ITV A;  1Z21 A;  2MFZ A;  2R4G A;  4CCO A;  4E7K A;  1PNM A;  3K70 D;  1GM7 A;  5KNL A;  4PJL A;  2ELJ A;  1MMA A;  2XF7 A;  3CMM A;  4DJA A;  4HSR A;  3H0D A;  3H9J A;  1T0F C;  4NNJ A;  1LFP A;  4ANJ A;  1EA3 A;  2Z1D A;  3SEZ A;  2VPL A;  3MKW B;  1AI7 A;  3ZXS A;  2DT6 A;  3OYN A;  4DOZ A;  2AE4 A;  3DU5 A;  4G6T B;  1YX5 A;  4E4H A;  3CJR B;  4RLQ A;  5FRO A;  4F93 B;  2WB1 A;  3HL2 A;  2CMP A;  1W36 D;  5KHD A;  4JQF A;  2R7O A;  2A6T A;  3A2K A;  2V1N A;  3OYI A;  4CCM A;  4BE1 A;  4E7Z A;  2Y0S A;  1GK0 A;  2IGN A;  2JUG A;  5CPR B;  3U21 A;  3AL0 C;  2DOA A;  1BR1 A;  2WY7 Q;  3D5L A;  3OS1 A;  4IQJ A;  2I8D A;  5LD2 C;  2BVL A;  1DGW Y;  1MMN A;  4II3 A;  2CUZ A;  3KYL A;  2WYC A;  2WA0 A;  3W2V A;  4PEL A;  2V9K A;  2VQG A;  4BTH A;  3CF2 A;  1UG0 A;  2BW3 B;  3PNY A;  2WYD A;  4BDZ A;  2V26 A;  4P5O A;  2DCE A;  3MMY B;  5LFA A;  4E7L A;  2KHM A;  4RLF A;  1K6Y A;  2F5V A;  2HVS A;  3K3W A;  1WJB A;  2IGM A;  2CW8 A;  4CCJ A;  2VJJ A;  2K5C A;  2HU9 A;  2M7B A;  2BW3 A;  1IRX A;  1X1B A;  2W7N A;  2P0W A;  2OC6 A;  4BUP A;  2VQH A;  3V42 A;  1CP9 A;  3K4J A;  2VXZ A;  1KON A;  3VWB A;  1HA8 A;  3K4C A;  2ZSH B;  2MAB A;  2Z2S B;  2VL8 A;  3QYB A;  2VJ5 A;  3OYA A;  4IKF A;  4GRI A;  2IXS A;  4CUG A;  3SRC A;  1U0J A;  4B47 A;  4PEM A;  4MLO A;  3OS0 A;  2LBF B;  4LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...