4HSRA

Crystal structure of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
b'AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hsrA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hsrA01
1FXVA 2AE5A 3SRBA 1AJQA 1GKFA 3L94A 3ML0A 1GK1A 4E55A 3L91A 1AI5A 1GM8A 4WKVA 1JVZA 1AI4A 4BTHA 1GM9A 1JX9A 2WYBA 4YF9A 3SRCA 1AJPA 1PNKA 4K2GA 2WYDA 3JTRA 1GK9A 2ADVA 4WKSA 1PNMA 4E57A 4E56A 1JW0A 3S8RA 4M1JA 1E3AA 3SRAA 1AJNA 4K2FA 1AI7A 1FXHA 1GHDA 1FM2A 1KECA 3JTQA 1CP9A 4WKTA 4YFAA 1K5QA 3K3WA 1H2GA 2AE4A 2AE3A 4PEMA 1AI6A 1GM7A 1K5SA 2WYCA 4HSRA 2WYEA 4YFBA 1GK0A 4HSTA 4WKUA 1PNLA 4PELA 1OR0A 1K7DA 1KEHA
chains in the Genus database with same CATH superfamily
5ERIA 2XB5A 3DKWA 5E18F 1VQLI 2X6WA 3HC7A 4E7ZA 4AIJA 4ENJA 3WTYC 1JKOC 1Y1WJ 3A02A 1SMTA 3T5XA 4EQQA 2A6TA 4XL9A 2EIJH 2JWTA 2IGNA 1B59A 2DOEA 2R5ZA 2YU3A 1UZCA 2YX7A 1OYIA 3AG2H 5HS7A 2M3AA 4HF0A 3OS0A 4YFBA 2DT6A 5BQTA 2JRMA 2TCTA 4F55A 5EG0B 3LFKA 1E3OC 2IRFG 5FD5A 4M9XA 5DUIA 1QGPA 2XF7A 2CFOA 3KFWX 3ZMUA 1BIBA 1SFXA 1WJFA 3HL2A 4U7DA 1SC7A 2IT0A 4MHGA 2ELKA 4MQVA 1U0JA 2BV6A 5H6QA 1X58A 3KE2A 4LFUA 4EVIA 1YYVA 4II2A 4KJZA 1LFPA 3MZHA 1B72B 2QA4I 1MZBA 2EK5A 5EJCA 5DCMB 2X51A 2VKVA 1E3HA 2LY9A 3FXJA 3LSTA 4FE7A 4D7NA 3MKZA 3K70D 1NG6A 1FM2A 2IBDA 3ZN0A 1FOXA 1H2GA 1P7JA 3CCSI 5K5OA 3X2QH 5F0FA 2CUJA 1BOBA 4RS8A 5J8FA 2M0MA 2LG4A 1CGPA 2CRGA 5L3CA 3EDPA 3ZMDA 2BGCA 1XMXA 2A3SA 4OU0A 3GZ6A 1JE8A 1P4XA 2WA0A 2XF5A 4R79A 1DPUA 5E79C 1E3PA 3O2PE 2QKLB 4MO7A 2Y9YA 3TO9A 3JTRA 3NARA 2CSOA 5LHIA 3BT9A 2DN0A 2LOOA 2RNGA 1MNDA 3IUOA 3RI4A 3GBGA 1JHFA 3VB2A 3CO7C 5KCMA 2H94A 1GV2A 5D8LB 2CV0A 2HTJA 3B6AA 2E2IJ 1SVOA 2IS4A 4HBLA 4AD9A 1OYWA 3JR9A 4PGHA 4KT5C 2QSGX 3BZCA 3DEWA 2XAJA 2R7WA 4AIHA 2WYBA 3F0CA 2IS6A 1TT0A 3OR2C 2LK2A 2C6YA 1WJBA 1ITYA 4L9VA 2E2JJ 2WAQA 2FMLA 4M3BA 3DTKA 1QPMA 3GFLA 1B8IA 3G3ZA 4FASD 3TP0A 3NQOA 2JVHA 2PX9A 1FT9A 4F3QA 4HX7A 4GCVA 1BW6A 4M3FA 5GP9A 2R93J 4Q48A 2JSPA 1QO0D 4ZZDA 1TQIA 3V7RA 1F1ZA 2J5PA 5D4SA 3L2VA 3JTGA 2LD5A 1Z7UA 5HDKA 9ANTA 3C1DA 2VC0A 1E17A 2VC1A 2HYFA 4F92B 1BI3A 3A03A 2DW4A 2K3PA 4B1RA 1VQOI 4YFAA 5B1AH 3R61A 5JLXA 4FT8A 3S15J 1W36C 4LK1F 3Q0UA 1R23A 3IP4B 1XG1A 3OY9A 3ZMVA 3GO5A 2HDCA 4B8XA 2M4KA 1JGSA 3K4LA 2VJ4A 3S3MA 4RDUA 3W2VA 3CMAI 3ZPLA 3EUAA 2ZJQF 2A61A 1X3ZB 1XMAA 5HLGA 3OOPA 1ZGAA 2ZJRF 5DEQA 4A0YA 2ZCWA 3BOQA 1B9NA 2CJJA 1OCCH 2GZWA 3BROA 5E20A 1YJ9I 2X48A 5H6RA 5JLWA 1S29A 4PSXA 3K4KA 2FMYA 4UB8C 4BL0B 2EZHA 2ZXHA 1Z9CA 1RZ4A 3DCFA 4WWCA 1VNDA 1BR1A 1GT0C 3ZMTA 4LITA 5FO5A 2A6HF 3JCUC 2H8WA 4N9HA 5F08A 2ZSIB 3I4NJ 2R7VA 2ADUA 2LVSA 4HG2A 1BJAA 1ETKA 2W82A 3PSFA 3GTGJ 4Q47A 2VQHA 4GDFA 4XNFA 2FQ3A 3SFIA 5IYBJ 3TW6A 3F8MA 1SD4A 4PGGA 1IZ1A 3CUQC 2UUZA 1A5JA 4IHSA 1T95A 4XRFA 3OL3A 2HTSA 2PQ8A 3L91A 2ESNA 2EFWA 1G4DA 1QZZA 2ID3A 1S3JA 3J81Z 3FKJA 1OR7A 4EM0B 2VPLA 5E3OA 1IJWC 1H89C 3R0AA 3CF2A 1WVRA 1IUFA 1GLNA 1QRYA 3N4MA 1Z3YA 2XGDA 3CJNA 5TISC 1G3YA 3CCUI 2W4SA 5M3MJ 4P55A 1Z1DA 1W5SA 2X4HA 1HBXG 1D0XA 1WHUA 2XPUA 3F6VA 2HWVA 3RZOJ 4K2EA 4FHTA 3HBLA 4A2UA 2QWWA 3T0YA 3H92A 3ROUA 3EPZA 3WU2C 1MBKA 3RQ4A 2MD0A 2ADVA 2RVCA 5DUKA 3D5RC 2HPIA 3O6BB 4ZYEA 1AJNA 1TWGJ 4L5EA 3SRAA 4E70A 4YFNF 4RB0A 1R5HA 3T1BA 2HDDA 4FX4A 4YELA 5FLMJ 3FKIJ 4YEJA 3CLOA 4D5CA 1SMYF 2IAIA 5FKLA 4CCNA 3JRHA 1X3UA 4IHVA 2H09A 2Z16A 1M1EB 3E3VA 4N0BA 1GK1A 1QQIA 1KU2A 1XDSA 2ECBA 2EFOA 4BQOA 3OIOA 2MLGA 4J19A 3AL0C 3PFYA 3AG4H 1JUPA 5EG0A 1T0FC 4Y15A 3WU1B 2MYSA 2ZXWH 1RESA 1TLHB 4LG3A 1MNMC 2L9SA 5EF6A 1A6QA 2WB1A 5H20A 2ISZA 1WWXA 2MABA 1B72A 4KNYA 5HDNA 1HDDC 3CCMI 3I56I 4I2OA 2DT7B 2KPMA 3ISPA 4C3HJ 1YQAA 3LOCA 1MIJA 5D5VB 2GOMA 1BR4A 2QSHX 2JUCA 1AI4A 1ZK8A 3LSRA 2MW8A 1H0MA 3HOYJ 2DCEA 4I76A 3WG9A 4K2GA 4PFOA 4X0GA 1FBQA 1KA8A 3LA3A 3NWSA 1BL0A 5TGTA 5E1WA 1LE8B 5FKMA 3OSGA 1HOMA 2O0YA 1D0YA 4QWQA 1TC3C 3BPXA 3DBHB 3FGTA 3KP5A 1S8NA 1U6GA 2CFXA 3G1OA 3K0LA 4EMSA 1GUUA 1VQMI 4I99C 3KYLA 3VPRA 2X1EA 2VN2A 4OINF 2HQRA 3OOUA 2X6YA 1D8JA 1E2XA 1FX7A 4U88A 1D1AA 1W0UA 3W2WA 1H9GA 1CF7B 4UUTA 2F6CA 4UNOA 1BBYA 3T8TA 3K4MA 1YRNA 2YPRA 1R71A 4P5OA 2R3SA 1WPKA 3Q0WA 1D3YA 3BC8A 4ZTJA 2HPMA 2BHYA 5KHDA 3CMEI 5DM7F 2RQQA 1YS7A 1XDUA 1X1CA 2TDXA 1TL8A 4GRIA 4XLPF 3COAC 2ZMEA 2VT2A 2HQAA 3D1NI 5D6EA 1B6AA 2RDPA 4G6DA 3KZZA 3CCJI 3M7GA 5CKTA 4B48A 5EEAA 3F6OA 3DP7A 3ONQA 4DZPA 3GTMJ 3KP4A 4D7MA 2DTRA 4KYWA 2CMPA 2CUFA 1QU3A 5DDGA 3K10A 3H9JA 5IY5H 3AKZA 5L3EA 3QPTA 4WKTA 1P7IA 2AO9A 4ASNA 1DP3A 5GAHJ 2F5EA 4LLNA 3KEYA 3G2BA 3VWBA 3JRDA 2O61A 4F91B 3FXOA 4LMYA 3EUHA 2QBYA 4C9YA 3K2AA 1XD7A 2H1KA 1R1VA 3L2RA 3MN2A 2V9VA 1UJ8A 4HDUA 1XCVA 3LSHA 4IZZA 2I5UA 2ZJ2A 3UNGC 1WJ5A 1GDTA 5AONA 4LB6B 1IN7A 4IQJA 2FSWA 1TQPA 3HRSA 2KKOA 3FM5A 1H88C 1JI8A 1SD6A 5JVTA 2O8XA 2KL4A 1FC3A 1VQNI 1YE9A 2DO7A 1U8BA 3VDXA 4XN3A 1XSVA 1LDKB 1YG2A 2R7DA 4C2UA 1Z21A 4BH9A 2EJRA 3PUBA 2FBHA 1A31A 2R7UA 3C3WA 3DXJF 2WAFA 2DQRA 1I1GA 3LQQA 4Y52J 2ZKZA 1RR8C 2JZYA 2L5QA 1V5FA 2I8DA 5D5XB 4C3JJ 4FX0A 4AU7A 3DBRB 5F0HA 3ECHA 3M8FA 1PVEA 3QU3A 5HLIA 2L0KA 3GLLA 4BY7J 4QLCU 4BDZA 3LA7A 4ENMA 3FDYA 4RLFA 1FPQA 1YW8A 3ELKA 2CW8A 3WGGA 1ETYA 3ECOA 5J3LA 3M3YJ 3VYRB 2N8GA 1A36A 2P4WA 3E6CC 3KYCB 2MH9A 3L2CA 4JP0A 2ELHA 1BC8C 1S7AA 3OYIA 1RKTA 4ZYDA 4E57A 2QSFX 5L3BA 2FBKA 3ZP5A 1ZG5A 3I55I 1DPRA 2JN6A 2BXZA 2L01A 5E1ZB 4NC8A 4EGZA 1X2NA 4R1HA 2EFPA 3WTXC 3OYKA 4A3LJ 3K4JA 2Z1DA 2AQEA 3GLXA 3FMSA 1Z6RA 1VQKI 2DLLA 3V8KA 3FXMA 4CSWA 2EH3A 2RAEA 4PJNA 4A12A 2JPCA 5E8GA 3DF8A 4GXOA 3HUGA 4MFDA 3WTUC 3OYEA 3AAFA 5LRSA 1K78B 4EJTA 4BXFA 1KU7A 2FNPA 2Z99A 3GTJJ 3K69A 4KT6A 4KISA 4V2GA 2IS1A 2NVUB 1NHAA 2ZNYA 1YW7A 4DBRA 5J1YA 2CW7A 4MIMA 1BR2A 5LGTA 2QQBA 3J7ZI 3K9TA 2Y2ZA 1FP1D 5CLSA 2CQKA 5EGOA 1T33A 2H8RA 1PP7U 3BCAA 2QGUA 2W84A 1VQ7I 4P96A 4BHBA 4V2FA 3DU5A 1D5VA 4DZJA 1Z77A 1ZGJA 4J01A 2LKPA 1GVJA 1LEBA 2LLKA 4NB5A 5FJ8J 1O3QA 3VYTB 4B3AA 2VOOA 2HXIA 4EATA 4KN7X 5M5XJ 5DV5A 3H3ZA 4RAZA 2X9DA 1ZARA 5D5UB 1HKTA 5LD2C 2H1LA 4BXUA 2CH0A 3S1RJ 1FMWA 4CHUA 3DLAA 2KP6A 3PNTA 4JYKA 1R49A 3U1KA 4IXAA 3FK6A 2PMZA 4WKUA 5BPDA 3IRRA 1GVDA 3L2QA 3DFGA 1VI0A 3TDUC 3DKYA 1HC8A 3I4MJ 3OYFA 5C44J 2WWYA 4A3IJ 4JX5A 1RRJA 1PUFB 3BTLA 5DTDA 3BY6A 4L0YB 3CDIA 1YITI 2O3FA 4RB3C 2LKXA 1WJCA 2EZIA 4OIRF 3R4KA 2DAOA 5F1RA 1PYVA 2B7EA 3JRGA 2VE9A 4ZYAA 3LSMA 5HS8A 4RB2C 2BEOA 4PDKA 1LNWA 1F4KA 3S2HJ 1GK0A 2V6EA 2K9QA 1QHHD 3HTUA 2M34A 1OR0A 2ZNZA 3MZ8A 3S32A 3V8JA 2VT3A 1XGNA 3C2BA 5J47A 3F23A 1LE8A 1X19A 2KT0A 3VEPA 3H35A 5J4VA 2LTPA 4YFKF 4UUSB 2DMPA 3S2DJ 3W6KB 3LSGA 1J9IA 1YX3A 3BJOA 2Q1ZB 3JW4A 2R5YB 2DDAA 3V7CA 1JT0A 2ME0A 2XAUA 4I09A 1TBXA 3EYIA 2MFZA 4G12A 3HOXJ 1JKPC 5JHFA 2W24A 5L3DA 4BWCA 3ABUA 3MCZA 5IP6A 1MMGA 1HQCA 1LVAA 3BG5A 4BQQA 4IRGA 5IYCJ 2BY3A 3EYYA 1JTYA 2TRTA 5CPRB 2LBFA 2LRDA 3CESA 4II3A 1EF4A 1OJLA 3O8GA 3LSPA 3BJ6A 3JSOA 3HSEA 3T8RA 5ICCA 2ME6A 1U78A 2JA6J 3K1MA 1RUNA 3HOWJ 4Y3OA 2BYVE 3E6MA 1ZRDA 1XX5A 2CG4A 2X0LA 5D8KB 2O8KA 3BQYA 2V1NA 2H6BA 2HKXA 5EEGA 4DBQA 2K7LA 4M73A 2XAFA 2L7FP 2HR3A 1O7LA 2FE3A 2JA2A 3C18A 1IRGA 4HOBA 4AC0A 2GQQA 2GA1A 1HW2A 1TT5B 2KDZA 4ZH4F 1IN6A 5F6FA 2P8TA 4KMFA 1S5LC 3QRFF 4ZZLA 2DA4A 3E5XA 3GEZA 2DBBA 1ETXA 1R6RA 1OFCX 2DQLA 5CVJA 3OYAA 5B66C 2EPFA 1UELB 2M87A 3E6DA 4E7JA 1MDMB 4RAYA 2AXTC 2RQPA 1ON2A 3BR2A 1AKHA 1W5TA 2L4AA 1QA6A 2HYGD 3BG3A 3HJEA 3MVPA 1T6SA 3S2WA 1JTXA 3CUQB 4MEYF 5C4JJ 4KFCA 5KK1A 1YJNI 2XIGA 3VYSB 2QEXI 4BJ5C 3TOBA 1GXPA 4L9TA 1Q1HA 1UHSA 1V5GA 1Z0XA 2Y69H 5F0CA 2WADA 2VJ5A 4CICA 4X1EA 2LMDA 1BW5A 1Z7LA 4KIFA 4RGRA 4ETSA 3QYEA 3SDGA 4YRVA 3BZ6A 2M1BA 4OMZA 2Z33A 1K79A 4XICA 3TW7A 1RKWA 5B3SH 2P7CB 1GM7A 1OYYA 4CDGA 4P1WA 4E7KA 2UXNA 5AIPA 1DU0A 1UAAA 1ETOA 2Q2EB 1NH3A 4WX9A 3DWLE 3QAHA 3D0SA 3J80K 3PSIA 2F4IA 3HOUJ 4KN4X 1TNSA 3SRCA 2XGXA 3I71A 2EV0A 1I39A 4I0AA 3OYJA 1ZG1A 2NAZA 2OD5A 2QCOA 5J8CA 5D6FA 2YX4A 3CC4I 2DOFA 1T38A 1O3TA 3TKYA 1N77A 3ESWB 3DPTA 2M45A 1G59A 1Y0UA 4M9SA 3TQNA 2PG4A 2I10A 1OLTA 2DT5A 2BBYA 3M1EA 2XKOA 2J5OA 3QODA 3LAPA 3P9CA 4I0BA 3D5SC 1G2HA 2V1UA 2ZC2A 3JSPA 4NDLA 4U0VA 1JKRC 4G7HF 2CW0F 2DA1A 1STZA 3IV5A 3ABLH 4IQ4A 1DQUA 1MBEA 3HIFA 1TWCJ 4HA8A 4Z6YA 4L9NA 1DGRM 1G6NA 4ZDPA 3AL0B 4NC6A 2DFEA 3ZQGA 2STWA 2DJNA 3WHBA 2CS3A 3PFIA 3Q5FA 1C0WA 1K78A 1FZPB 4BS9A 2UXXA 4Y7NJ 1RI7A 2L2OA 3SQNA 2CQNA 5HS9A 2PEXA 4RBOA 2NOJB 1FOYA 3HPGA 2D45A 3WGIA 1HF0A 1QVTA 3MAJA 2GIVA 1KEHA 2LH9A 2RN7A 2NVXJ 3FIWA 2OF7A 1GM8A 4IHTA 3BCBA 5ILSA 1REPC 3LMMA 3F3XA 1JUMA 2WYDA 4XLAA 3JREA 5LRRA 2DMNA 1XSDA 1PP8F 2DYRH 1IO2A 3KIOA 4PSWA 3A0HC 2VJIA 3FXUA 3ZN1A 1JKQC 2NVYJ 4A6EA 2VKDA 3LSKA 3SFZA 2P6TA 4HLXA 1KZHA 5L3FA 3P9KA 3IH2A 5ICEA 3WG7H 1VF9A 1H8AC 3D5LA 2M5WA 3CMMA 2GLOA 3TBIA 2B63J 3CP8A 4HX8A 2X1DA 3WTZA 2WV1A 3U2RA 4UVAA 1K83J 2WAQN 1RR7A 4C2TA 2W57A 3FGRA 1KYZA 2GBYA 5TJJA 4XONA 1PUFA 3I59B 1TWAJ 1H9TA 1T2KA 4CCLA 2OV7A 1ZTRA 2JJ7A 4B47A 4XSZF 5TRDA 2K9MA 5CQEA 4A3EJ 2DPUA 2DFHA 3M1CA 3MQ0A 4D0PA 2L9VA 1FSHA 1R58A 1IRZA 4HX4A 3R60A 4L9JA 5HOOA 3H9GA 2MC3A 3GZ5A 2XF6A 4XRSG 1J5YA 1IW7F 1FNNA 3S8RA 4CO8A 4OAZA 2LR8A 5E8IA 1ZLKA 2GXGA 2XKPA 3FF5A 1B4AA 1Z3XA 5A2QK 4UUSA 2P5KA 1NK3P 1OCPA 1WQ2A 4HPQA 3K70C 1AI6A 1ZYRF 1MMDA 2RC4A 2WBMA 1LVKA 4MLOA 4HSTA 5GAEJ 3RKXA 3GMEA 2B9SA 1HA8A 3F8CA 3H0DA 5CJ9A 1X1BA 1S72I 1Q1VA 2WV0A 4XR6A 4YIRX 4A3KJ 3HEFA 4IVNA 3VSLA 4A3JJ 3QYBA 3E1SA 2HS5A 1I3QJ 1JX9A 5DD4A 2V9KA 3ERED 1R4MB 4B3XA 2CWEA 4BBSJ 4M3DA 2VBXA 4NQWB 1FLIA 1D1CA 3PQJA 5M5YJ 2VBYA 3O8HA 3ZMZA 3FXKA 1K4SA 4M1JA 2UV1A 2UWMA 1AI7A 3J7AO 2XAQA 4PK4A 4XKBA 3WE3A 3CJRB 3KX2A 2KQRA 1U9OA 2KRFA 3I64A 4AVZA 1ON1A 2AE5A 4CYDA 1L3LA 5K7ZA 5GAGJ 3JRFA 4M3GA 4RM2A 2Y48A 1T98A 2DA5A 5HDGA 2JQ7A 1MJ9A 1IRXA 2IJLA 2HU9A 1LPQA 2K4JA 2XPVA 3BTJA 1FIAA 4BGDA 3CJQB 1XCBA 5BOXA 1WJEA 2F48A 4H4KC 1FYMA 5J4YA 2O03A 4A69C 1MJAA 3PJRA 1KU9A 4RM3A 5F64A 1WJDA 2FOWA 2LF8A 5FFZA 4A3GJ 4G8XA 3C2HA 5LLQA 3KP7A 2KZVA 4BJ6C 1BN5A 4H0EA 4WXHA 2H27A 5FLXK 1HSJA 2L7MP 5DD8A 3AFHA 2E60A 3CDLA 4XLNF 3U1DA 1VZ0A 5HLHA 1FYLA 3CUQA 1ETQA 5CYVA 2Q0OA 1GK9A 2VXDA 5E1XA 1ZH5A 4ENKA 4CCKA 4M6XA 4OMYA 3FHNA 3Q0VA 4CGZA 3SHFA 1KYWA 5D4RA 3NWTA 2OZ6A 2V1DA 1KQ8A 1XTAA 4PJMA 2YSRA 1K5QA 3HB9A 2A05A 2WYCA 2HQ5A 5JHUA 1V54H 3L7WA 3P9IA 1IN8A 3A2KA 1SFUA 3ZQLA 3CCQI 5DCMA 1W7PB 1SVMA 2CV1A 3E5QA 2PFBA 2IXSA 2ZJPF 6PAXA 4GYGA 2NYXA 1X3WB 1K7AA 3KEQA 3MKLA 1RNLA 2DK8A 2ZFUA 3LNQA 2IP2A 3GVAA 1PNMA 3PM1A 1SFKA 2Q2EA 5KAFC 2L02A 4S0HB 2QQ9A 2VB6A 3RKYA 2DJIA 2HZTA 2X6OA 4YFXF 1ZAOA 1UFMA 3ABTA 5IP7J 4XKCA 2DPDA 2G9WA 4UVCA 1IV8A 5EZGA 4ANJA 2OUMA 5BNGA 2LY1A 2HDWA 4FTHA 4BXXJ 3OSFA 3ZRGA 1OCZH 1JJ8C 1W4MA 2FUG2 2W85A 1I1SA 5LHHA 2WB1N 4ON0A 3IKVA 4BQNA 1FEXA 2R7RA 4LOCA 3RKQA 1O57A 2EZLA 2K5CA 4U0WA 4DW6A 3UR3C 3MEXA 4AUXA 1KU3A 1T0FA 3U9GA 2GWRA 1DU6A 2FU4A 1R22A 4WF2A 1UMQA 3GTPJ 3S1MJ 2KIQA 4C30A 4IHWA 2VXZA 3PQKA 3NRVA 4S04A 5M5WJ 2KRCA 3MWMA 1J7KA 3CCEI 5ILVA 4LB5A 1FIPA 1Y1VJ 4I7HA 1Z05A 3RDIA 4A0XA 3HOVJ 2Y0MA 5LHGA 3F8FA 1YFHA 3VODA 2HXOA 1EH7A 3DEEA 1MW7A 4HRIA 1LDJA 2BY2A 4E7HA 4A3BJ 2K4BA 3N05A 1BJZA 2DK5A 1B1BA 1R1UA 2P81A 2NS7A 5IT9K 5FROA 3SRBA 4I6ZA 3E97A 4FETA 1UB9A 2WTEA 3GTKJ 1GM9A 4CCMA 1XGSA 1MGTA 3OYBA 3WHCA 3LSIA 2XPWA 2LC2A 3G73A 1DUXC 3H5AA 1S7OA 2FOKA 2COBA 3H3UA 1SAXA 5E17F 3JTHA 4XMYA 3G1LA 3SXYA 2BZTA 1E0EA 2DOAA 3K3WA 1ODDA 4AWXB 4YIIA 2XC7A 1YX5A 3TO7A 3PNYA 5CVVA 4IF4A 3MZYA 1OCOH 1DGWY 3RZDJ 3H36A 2WY8Q 2ZB9A 4QSHA 2R5ZB 1ZR4A 2D5VA 3AG3H 1ZHFA 4RAFA 2XB0X 3GTOJ 4IO9F 1HCRA 3HKZA 1YLFA 4MGRA 1G8XA 3K1PA 3MFKA 2OCCH 3CDHA 3IWFA 5C4XJ 1EKEA 2DMTA 5ICFA 5GPAA 3FXLA 2OCEA 4HAMA 1FWZA 3CC2I 3S93A 4C2MJ 1GHDA 2X1CA 1X1DA 1O7FA 1YJWI 2Z2SB 4JQFA 2WYEA 5ICGA 3LA2A 2QZ8A 3MD2A 3ABMH 3HG9A 1PNLA 3GUDA 3HPHA 2JPBA 1IG7A 1P9QC 1UG2A 2L3DA 3FISA 2CGPA 2VBZA 2YU9J 2W48A 3HRUA 4UB6C 4A5NA 3PL8A 1UHMA 1K4TA 4WKVA 3J80Z 1ENHA 3BG6A 3IKTA 4KDPA 4A5MA 4RAGA 2OA4A 4XSXF 1MNEA 1QHGA 3FZVA 4EJOA 1SEUA 2D2WA 3OYHA 2GAUA 4E7LA 2DDBA 2CU7A 5K7HA 3HYIA 2COMA 1HW1A 2K3FA 3KP6A 2HOTA 2NS0A 4NQWA 2VJJA 1MSEC 1WI3A 3CCVI 4L5JA 3HKZN 3BG9A 3V42A 3R0JA 3H5RA 2G7UA 1R1TA 3HZJA 4CZZA 1KQ0A 4Y4RA 3HRMA 2K02A 4KITB 2FD5A 4BHPA 4OIQF 2LREA 1OPCA 2LDUA 4IEJA 5IP9J 4ESBA 1B9MA 1Y6IA 4IL6C 4BQAA 1QZYA 1BIAA 1D5YA 3K4BA 2A07F 2KFDA 5DYMA 3WTSC 1APLC 1N75A 2HI3A 2H6CA 1EH6A 3ABKH 4P9FA 1QNTA 3FHZA 2HVSA 3HGGA 2E19A 2BHZA 3U21A 5LGNA 2VPRA 1AWCA 3ZQFA 2Y0SA 2QYOA 2R0QC 3CMYA 4XM3A 3PIOF 4FCYA 1B8IB 4YF9A 4M71A 5FRNA 5GPCA 2EA2A 2HKOA 3M4OJ 2EIKH 2YS9A 3F8BA 3RPUA 4DNCA 3V4GA 3A4CA 5J40A 4I01A 2P7VB 4LGWA 4LIUA 1HW5A 4PUSA 3OR1C 5GTIC 2KIFA 2R92J 2QKMB 3DLLF 3H5NA 4L0ZB 2GXBA 2F2EA 3I9V2 1T39A 2FF4A 3S16J 4AM3A 3A01B 5CVRA 1WGXA 2MBFA 1ZG3A 3CCYA 4JOMA 1IXSB 4ESJA 2LKSA 4XRSA 1R5ID 2OPTA 1XC5A 4ABZA 4D9JA 2E7XA 2IA2A 3SEQA 1W7PA 4U0YA 3JRAA 4F93B 1MMNA 2OAZA 3WU0A 4GFBA 5DM6F 4M9ZA 3J7YJ 2RKHA 5C3EJ 3JRIA 1FP2A 2BVMA 3I3LA 3ZQHA 1VQPI 3HDDA 3QOPA 2KMUA 5D5WB 1FMVA 2WAEA 1TW2A 1I6XA 5FKKA 1LJ9A 5K5QA 3WTVC 4WK8F 1R4NB 2P5VA 4HV5A 2XSDC 1DDNA 3CF5F 5BPIA 1WRJA 2QVOA 3WTWC 4HF1A 1J09A 4DYCA 1AJPA 3GYHX 2E1OA 3BR6A 5KVRA 3GTQJ 3QOEA 5L3GA 1OCTC 3MKYB 2EINH 1CF7A 1ZREA 4M74A 2PBIA 4G7ZF 2PMZN 2OBPA 4BYYA 4KIBA 3GFIA 4QIWN 4MNUA 2NNYA 2ZSHB 2NNNA 2XUBA 5FD6A 4WCGA 5JI6A 5IOYA 2KIUA 4LK0F 5B5EC 2DXIA 2XGEA 1PUEE 2AQFA 2V26A 4FE4A 4DOZA 3UKGA 2DA3A 4BHCA 1V5EA 2FBIA 2EV5A 2CV2A 3BTCA 1ETWA 2VUMJ 2JT1A 1R36A 2VKEA 3K1NA 3QPHA 2F4OB 4ITVA 5E3MA 2BY0A 2EA4A 2ZXIA 3FXRA 3HHHA 3OYMA 2IGOA 5GADJ 4EJUA 2V4JC 3TEDA 4A0ZA 2VE8A 2EQRA 4RGUA 1IN5A 1BM9A 3CLQA 1JXSA 1ZKGA 4KUMA 4AIDA 2VODA 3H9QA 3GFMA 1W0TA 4OIPF 4O5VA 3SDBA 2PMUA 1IN4A 2K27A 1YS6A 1X4OA 2L54A 2RV8A 5J1UA 1FOKA 2E36A 2O5RA 3HOZJ 3ASNH 3HOSA 1S7EA 2VOPA 4XOTA 4V19K 1E3AA 2E35A 2HNHA 2NXNB 3LAJA 3S17J 2JA5J 1KONA 1AA7A 5KNLA 3G71I 5E3NA 4PZJA 1P2FA 1UCRA 1I6HJ 5EDNA 2HVQA 1EH8A 2IGKA 1W36D 1TW3A 2MH2A 2ECCA 2M4GA 1R7JA 2A68F 2D1HA 1NK2P 3L94A 1FOWA 5FLXZ 3L9FA 4OOIA 3RQIA 3KLOA 3DTEA 4IOCF 2GIZA 1QPIA 2OZUA 5IT3A 2XDVA 4RLQA 3OS2A 2F5FA 4KIGA 1WH7A 1IDZA 2ZXJA 3MKWB 2DYSH 3L09A 2ACJA 2XAHA 2IEKA 4U87A 4R8HA 1MH4A 3SEZA 3TDZC 2E34A 1BI2A 4D5FA 5HNHA 2R7ZJ 1K7DA 3KYDB 3QWLA 3B02A 4IX7A 2Z9OA 4BAYA 4BDYA 1RUOA 3RJPA 2EWNA 1U5TB 3FMQA 3CUOA 2MLKA 4CH7A 2R7QA 1AI5A 4ESFA 3B6CA 2M9HA 1O3SA 2DA7A 2XVCA 3ZQIA 4N9IA 2KZGA 4EM1A 4DYRA 3S1NJ 2IA0A 4Y13A 1IC8A 3I5UA 2NVTJ 2CYYA 1WH5A 2FXAA 3RYPA 4HZFA 3M07A 2Y9ZA 1MBFA 5AIQA 1XGMA 4ZYHA 5FFXA 4DQ2A 1QBJA 1MBGA 3OYLA 2PLYA 2QENA 2V1XA 2HQNA 5J6XA 3PIPF 1ZLJA 2R7SA 3I54A 1LDDA 5BMZA 2EB7A 2E7WA 3S1QJ 1A6IA 3KZIC 2DFFA 1LFUP 4G6QA 2ZO4A 1TQMA 3BR1A 4BUPA 3GZNB 1SFOJ 3BZKA 3P5JA 1W5CC 3L2WA 4O6JA 1T8IA 4CYCB 3EETA 1YRNB 1G3SA 2PMHA 2VQCA 4PCQA 2A5YB 2M8EA 5JR3A 1W1WE 3FXQA 5HVQC 3E6BA 3BQZA 5KAIC 2ID6A 1UG0A 2V6CA 2IVMA 2MG4A 4DGWB 4AVPA 3NAUA 4XLCA 4YG2F 4MQ9F 2ZMEB 4XRMA 3S3OA 4A93J 3OIQA 4M72A 4UXNA 1JW0A 3R6SA 2FJ1A 1UHWA 3I4PA 2EBIA 1JUSA 3CD6I 2QUFA 3K7AJ 3BPVA 3Q9VA 2XHKA 3GF2A 5IYDJ 2M7BA 1WI9A 4XLFA 2XRNA 1HXDA 1WJAA 5IT9Z 1VQ9I 2W7NA 2E5ZA 2Y30A 3KCCA 3OWTA 1U3EM 2GOXB 2L7ZA 2EZKA 2BXYA 2OTJI 1ZRCA 1BA5A 4GYIA 5LGUA 4EGYA 1SD7A 2EFQA 4NBQA 3CQZJ 4WXDA 3FX3A 2ZFWA 2WC2A 5JFRA 1WFXA 4M6YA 3A01A 3TO6A 1USTA 2OQRA 2QBYB 4GO1A 1TTYA 3M8JA 2V9PA 5LEKA 3L2UA 1FJLA 3JAMK 4I02A 2LP0A 3A1YA 5FKNA 1OR7C 1LKXA 1USSA 5IOZA 3QPSA 2DFIA 2VASA 3VYUB 1P4AA 4HQEA 2KIMA 4DYQA 5ED4A 4D1QA 3WODF 4NHJA 3IL2A 1T08B 1P4WA 1P92A 2B0LA 3K4CA 2OC6A 2XAGA 5FGMA 1NTCA 1ACIA 4PJ0C 4OAYA 3RCOA 2VLAA 4BKXA 4BNCA 2QLZA 3BR0A 3QQAA 3IWZA 4LJZF 1IUYA 1MMAA 3OMYA 3OYDA 2R5YA 1DP7P 3H3VK 1MJBA 4RGXA 2WY7Q 1EV7A 1FXVA 2OTLI 3ZQ7A 2GM4A 2O9LA 4A3CJ 3IAM2 1S6LA 4PJJA 1GHCA 2JSCA 2PJPA 3ZQQA 5DCFA 2AHQA 3EUKL 3TP3A 1S9HA 1VQ5I 2L7KA 2ETHA 3BLYA 5FLVA 3GW2A 1D1BA 3CCLI 2OU2A 3HSRA 4FQGA 1J2XA 2E1NA 2IGMA 1XN7A 2JA7J 2CQQA 1X4PA 4A3FJ 1IGNA 1XSXA 3DV8A 3HGYA 3G1MA 1XS9A 3ML0A 4EV0A 1A04A 3ZCOA 1XGOA 3BP8A 2BVLA 3F72A 1U5TC 4B4CA 4YIFA 4EEFG 4ZJZA 2PN6A 1F43A 3Q9SA 4XK4A 3JRCA 2BW3B 1FTTA 1OQYA 3SYTA 2M7AA 3FK7A 5LBQA 3HUGB 1MBJA 3I58A 5B1BH 4DIQA 5J1RA 4MEXF 3IH3A 4IRHA 3TL4X 1JJ6C 2F5CA 1X2MA 3W6JB 5EGOB 4ENNA 1MDMA 4ZTFA 1RPWA 1I3AA 4LIVA 4AYBA 4L18B 2W25A 3OV8A 4B44A 3FM3A 3HSFA 3QPLA 5IPAA 1WCMJ 2E1MB 1FY7A 4KA4A 2P5LC 3OYNA 1FBSA 3BTIA 1FSEA 3HM5A 1YHQI 1Y39A 4QPOA 3HXLA 2MA3A 2LF7A 4TV7A 2O6GE 2JVGA 1I50J 3SJMA 4G94A 2VL8A 4NC7A 4AIKA 5HLTA 2BOLA 2DODA 3OS1A 4U7BA 1AOYA 4NUBA 3WE2A 2HVRA 3QP6A 4HYEA 2AS5F 1ZR2A 1ERDA 3GXOA 4I98B 1SFEA 5CQGA 1HLVA 2PJRB 4E4HA 3ZGKA 4IKFA 4OIOF 2ICWG 1V4RA 4BE1A 2JK3A 5EZHA 2ZMEC 2LFBA 3F9KA 3ZR8X 4F52A 1PDNC 2KLOA 3J7AY 4JX6A 2HOEA 4Z2YA 4JK1X 1IXRC 3BWGA 4B43A 1U5TA 2BE5F 4LLLA 2VQLA 2QM3A 1FXHA 2YR2A 2FQ4A 1R00A 2QQ8A 3Q3SA 4B09A 2D1VA 2K9LA 5F04A 4HQMA 1AHDP 4E6KG 3G4SI 3DPUA 1QZEA 4ZC3A 4AYBN 4G6TB 3KPHA 1VQ6I 3ULQB 3RPUD 2CQXA 3QU6A 2CQ7A 1BI0A 4UVBA 2F5DA 2QQAA 3A0BC 1ULYA 1JVZA 1WSUA 3H1CA 5EYRA 3VFZA 1Y8QB 2XGCA 4KMUX 3GWZA 2V79A 3CO6C 1JT6A 2IA1A 4WXCA 4LLGF 4WKSA 3OYCA 3GTLJ 2Y75A 4HDVA 4XOPA 3M9AA 3DKXA 3S14J 1GV5A 3CP2A 3EQLF 2KDOA 3I53A 2E1CA 2R7XA 3EUHC 2NVQJ 1KECA 3JTQA 1IV6A 3PO2J 2EILH 2K86A 1LEAA 3BG7A 4PELA 1G3WA 5F27A 4UUVA 5JVGF 4UY8I 1RC9A 1W7PD 2JUGA 2L9RA 1I5ZA 4LG0B 2Z3YA 1GXQA 4CYCA 2HGCA 4W1UA 2XV4S 5K7FA 3SZPA 1QVUA 4A6DA 4ZDOA 4IHYA 1N25A 2LBFB 1K6OA 1LQ1A 1MMSA 1YOVB 3GX4X 5LEJA 1MKMA 1ETVA 4IHXA 1EJ9A 1HSTA 3HRTA 4XKWA 1MSFC 1A35A 1XB4A 2XRLA 2Q8KA 3VSKA 2A5WA 4G7OF 1OMIA 1OISA 4HF2A 4MTDA 1SVLA 3LQRA 2JMWA 3DPLC 2UZKA 2KHMA 3FBIB 4Q5SF 1NG7A 5BS6A 3WGHA 5HODA 4EM2A 1K61A 1R9TJ 1X1PA 1LB2A 1D0ZA 3W2AA 1PNKA 1Z6TA 1VFCA 4BEHB 2FX0A 2GXAA 3MMYB 4HEA2 4MFEA 3P7NA 2DA2A 4N4OB 2KRHA 4RGSA 4BBRJ 4JX4A 4XQFA 4QTRA 1SANA 2DI3A 1POGA 3CZ6A 2ZBKA 1KGSA 1ZRFA 4A3DJ 2VKHA 2AE4A 2RREA 1YTYA 1TWHJ 4A3MJ 1ZELA 3S8PA 5GTHC 4UV9A 1ZGWA 5K5RA 2K9SA 4HNUA 1T56A 2FNAA 5ILUA 2G0EA 2PI0A 3KLNA 3I59A 4RMNA 4BACA 1L0OC 2LSOA 3QYFA 2M2EA 2DTZA 3BR5A 5EEHA 3RTRA 1AKHB 1IRFA 4CCOA 4IRIA 1ONVA 3F21A 1YW9A 1TWFJ 2Y31A 1RETA 3K4NA 2HOSA 3TGNA 3PUFA 3RSNA 1CP9A 3E0JB 2LY2A 4XIDA 4XKVA 2Z5UA 2MC4A 2RGVA 4HNTA 1LUJB 2XROA 2R7TA 3RPQA 5FRMA 4E7IA 2HEOA 3OIPA 3KP2A 2GA2A 4RA2A 1YI2I 3ZMSA 1N78A 3LSJA 3K2ZA 2MSYA 3RYRA 3F22A 1CQTA 4HLYA 3LWFA 2VIXA 3DQVC 4PFPA 4XORA 2NRAC 3V8LA 2E1MC 4BU2A 4DJAA 1SD5A 2X6XA 1YIJI 3E5UA 4K2FA 1TZLA 2W1OA 4Q4ZF 3ZXSA 2EIMH 1Y8RB 3M8EA 4HW0A 4BJTA 2AE3A 1IXCA 4CZCA 3DU6A 1G3TA 2K40A 2E71A 2ISYA 5CVUA 1MD0A 1OKRA 4CXFA 2QF7A 1Z91A 2M0CA 4ZYGA 3E7LA 3RIRA 3BR3A 2O7OA 2KJBA 2M8GX 3ASOH 3KETA 3FBNB 3J81K 3JRBA 2CO5A 4FISA 3S3NA 4E56A 2DMQA 2R7FA 2LNBA 1JHHA 2FRHA 2X85A 3KP3A 1PJRA 5K1YA 2FEZA 4PJLA 1EA3A 3K6GA 2HYJA 4HSRA 4HV6A 4KICA 4GGGA 2P0WA 2YUSA 3AG1H 2BW3A 1XPXA 1JGGA 5FKOA 3BJAA 1Y0NA 2ESHA 2G7HA 3SZGA 2XSJC 1I27A 4ZDLA 4BE2A 3WTTC 2A6EF 1ORKA 4QPQA 3N97A 3PNVA 4P9UA 4XLHA 4JBAA 4F7ZA 3CC7I 4BTHA 3IHUA 2P6SA 1FYKA 3ML6A 1YIOA 2M30A 1K6YA 3F8NA 2OJED 3IC7A 3LFUA 2DMUA 2A69F 1WKMA 1ZN2A 3CJTB 2R7OA 3O3KA 3QP5A 4EJVA 5M3FJ 3I0TA 4CCJA 2KISA 2DU9A 1V3FA 2IW5A 1BOAA 3B73A 3GCMA 2STTA 1OCRH 2EFNA 1GKFA 1F5TA 1XMKA 3LL7A 1BC7C 2F5VA 4LD5A 5CVIA 3TMOA 3ZOBA 1O4XA 4E7SA 2V7FA 2E2HJ 3CCRI 4G9YA 2K9NA 3OL4A 1VQ4I 3HOTA 4L5IA 1YO5C 2L9NA 3DBLB 5E3LA 3W3CA 4NNJA 3FWEA 2PJRA 3NEUA 1Z67A 3C7JA 2ELJA 5H2FC 3L00A 2HZDA 2OQGA 2E5NA 2L4MA 3JAMZ 3ZQCA 1RIOH 1F36A 1MBHA 3H0GJ 2HFHA 1LFBA 2Y0SN 1HKQA 1AJQA 2XASA 2RNJA 5FB2A 4BE0A 3DEUA 2IS2A 3CTAA 2BY1A 3KZYA 4CUGA 3DTIA 2DA6A 1D8KA 4W97A 4XN0A 4C3IJ 1ZQ3P 5A2QZ 1VQ8I 1J59A 4M6VA 4PEMA 3V7SA 1TP4A 5LFAA 2K85A 5DS9A 4UV8A 3IAS2 2JA8J 1P6RA 4IOAF 4RB1A 3BDDA 4UHTA 1V55H 4MTEA 1BI1A 4XLEA 4HNVA 4E55A 5F1JA 1FTZA 2F4MB 1WZ2A 2CUEA 4N4NB 1VTNC 1IAWA 1U9NA 3W6VA 3L1PA 1Y56A 2LYCA 1TNTA 2VONA 2VBWA 2HOAA 2IPQX 4BY1J 1SAUA 4LG0A 1J0RA 3OYGA 3HTSB 2JRTA 4OWRB 2AXLA 2VI6A 2KJCA 3REOA 1K5SA 4Y33A 2R4GA 4X6AJ 1R5GA 3TOAA 4S05A 3FMRA 2MD5A 3GFJA 4EJWA 3IH4A 1IDYA 1MH3A 3VOEA 1IF1A 5HNFA 1O3RA 2W00A 4J00A 4O3MA 4IJAA 3KEOA 1X1AA 2JTVA 1J75A 4XBFA 2EV6A 2FA5A 2VQGA 1HKSA 3HHGA 3ERMA 3SZTA 2MGQA 2NOGA 1F9NA 3PO3J 1FBUA 1KQ9A 1U8RA 3C2GA 4IPAA 4Y17A 3G6EI 3IRQA 4M3EA 1U2WA 3RKWA 1HDPA 2CUZA 4CA0A 1AU7A 4BEHA 2NS8A
chains in the Genus database with same CATH topology
4PJNA 2VASA 3VYUB 4ANJA 2OUMA 4D1QA 3OYEA 2LY1A 2HDWA 4BXFA 2X6WA 2IS1A 3HC7A 4KISA 4KT6A 4E7ZA 3ZRGA 2FUG2 3K4CA 2A6TA 2OC6A 4XL9A 4DBRA 2CW7A 1BR2A 4OAYA 2IGNA 3RCOA 2VLAA 4BQNA 2R7RA 3BCAA 2M3AA 2K5CA 1MMAA 3UR3C 3OS0A 3OMYA 4YFBA 2DT6A 3OYDA 3DU5A 4F55A 4C30A 4J01A 2VXZA 2WY7Q 1FXVA 2XF7A 2CFOA 3IAM2 3VYTB 4PJJA 2KRCA 4EATA 3ZQQA 1WJFA 3HL2A 3EUKL 1U0JA 1S9HA 2L7KA 4II2A 4KJZA 5LD2C 1LFPA 3BLYA 2CH0A 1FMWA 1D1BA 3DLAA 2X51A 2KP6A 3PNTA 3DEEA 3MKZA 1FM2A 3K70D 1NG6A 1MW7A 4HRIA 1H2GA 2IGMA 4E7HA 2CUJA 1BOBA 2PMZA 3N05A 2M0MA 2LG4A 4WKUA 1X4PA 3L2QA 3DKYA 5FROA 3SRBA 3ML0A 3OYFA 4FETA 2WA0A 3ZCOA 2XF5A 4R79A 2BVLA 1GM9A 4CCMA 4ZJZA 2QKLB 3OYBA 3LSIA 1WJCA 3JTRA 2BW3B 2LC2A 3SYTA 2M7AA 3H5AA 2LOOA 1PYVA 2RNGA 1MNDA 3HUGB 1E0EA 3IUOA 4XMYA 4ZYAA 2DOAA 3GBGA 3LSMA 4DIQA 3K3WA 2XC7A 1GK0A 1YX5A 2V6EA 5KCMA 1QHHD 3PNYA 2CV0A 3TL4X 1OR0A 3S32A 2IS4A 1DGWY 2WY8Q 1X19A 4ZTFA 3H35A 4LIVA 4AYBA 4B44A 2R7WA 3LSGA 3HKZA 1YX3A 2WYBA 1G8XA 2Q1ZB 1TT0A 2E1MB 2IS6A 3OR2C 2XAUA 3OYNA 2MFZA 5JHFA 1WJBA 4QPOA 3HXLA 1GHDA 1MMGA 3S93A 2WAQA 2X1CA 1X1DA 4BQQA 2JVGA 2Z2SB 4JQFA 2VL8A 2WYEA 3DTKA 4NC7A 5CPRB 4FASD 5HLTA 2BOLA 2LBFA 2LRDA 3OS1A 3CESA 2JVHA 3MD2A 3HG9A 4II3A 4U7BA 3HPHA 1PNLA 4F3QA 4NUBA 1P9QC 2HVRA 3PL8A 2JSPA 1ERDA 4WKVA 5CQGA 4IKFA 3BG6A 2PJRB 4E4HA 4Y3OA 3ZGKA 3L2VA 4BE1A 3F9KA 3ZR8X 4F52A 2KLOA 1MNEA 1QHGA 3J7AY 3OYHA 2V1NA 4B43A 4E7LA 4DBQA 2VQLA 1FXHA 4F92B 2K3PA 4YFAA 2K9LA 2JA2A 4E6KG 2VJJA 3DPUA 4ZC3A 4G6TB 1W36C 3RPUD 3IP4B 3V42A 3OY9A 3H5RA 1JVZA 2M4KA 3K4LA 1R6RA 4Y4RA 2VJ4A 3S3MA 3W2VA 3EUAA 4KITB 3OYAA 4WKSA 3OYCA 2LREA 4XOPA 1UELB 3DKXA 4E7JA 1Y6IA 3CP2A 2KDOA 2R7XA 3EUHC 1KECA 3JTQA 3K4BA 1N75A 3BG7A 4PELA 2HVSA 4PSXA 3K4KA 2JUGA 4BL0B 3U21A 3VYSB 2ZXHA 4BJ5C 2Y0SA 4ZDOA 4XM3A 1V5GA 2LBFB 4YF9A 5FRNA 1BR1A 2WADA 2VJ5A 1Z7LA 4LITA 3QYEA 4XKWA 3A4CA 4YRVA 2ZSIB 3VSKA 2A5WA 2R7VA 4HG2A 4LIUA 2W82A 3PSFA 1GM7A 2VQHA 4XNFA 4PUSA 3OR1C 4P1WA 4E7KA 3DPLC 2QKMB 2UUZA 3H5NA 1UAAA 1T95A 2KHMA 3I9V2 2Q2EB 3FBIB 3OL3A 3DWLE 1NG7A 3L91A 4JOMA 3PSIA 2F4IA 4D9JA 3FKJA 1D0ZA 3SRCA 3W2AA 2VPLA 1PNKA 3OYJA 4BEHB 3SEQA 3MMYB 4HEA2 4N4OB 3CF2A 1GLNA 2KRHA 4F93B 1MMNA 1Z3YA 4XQFA 1N77A 3CZ6A 2VKHA 2AE4A 2BVMA 2RREA 3DPTA 3I3LA 2W4SA 1G59A 1ZELA 1OLTA 3S8PA 3QODA 2KMUA 1D0XA 3D5SC 1FMVA 4HNUA 2WAEA 4RMNA 4BACA 4IQ4A 3QYFA 1DQUA 3AL0B 3RTRA 4ZDPA 1DGRM 3EPZA 4CCOA 1J09A 1AJPA 3RQ4A 2MD0A 2ADVA 2CS3A 3QOEA 3D5RC 2HPIA 4BS9A 3K4NA 3MKYB 1AJNA 3SRAA 3RSNA 1CP9A 3E0JB 2L2OA 2LY2A 4XKVA 2MC4A 4HNTA 4YELA 4YEJA 2ZSHB 2NOJB 3HPGA 2R7TA 5FRMA 4E7IA 3OIPA 4CCNA 2DXIA 1KEHA 2LH9A 2AQFA 2V26A 2Z16A 4DOZA 1N78A 1V5EA 1GK1A 2CV2A 1GM8A 4BQOA 3BCBA 3LMMA 2VIXA 3DQVC 3AL0C 3PFYA 4PFPA 4XORA 1T0FC 2E1MC 2WYDA 4XLAA 4BU2A 4DJAA 2MYSA 4ITVA 4PSWA 2ZXIA 3OYMA 2X6XA 4LG3A 2L9SA 2IGOA 2VJIA 2WB1A 4K2FA 1TZLA 2W1OA 3ZXSA 4BJTA 2V4JC 2VKDA 2AE3A 4CZCA 3LSKA 3DU6A 2MABA 2DT7B 3H9QA 2KPMA 2GOMA 1BR4A 1AI4A 3SDBA 3D5LA 3CMMA 3FBNB 3TBIA 1X4OA 3CP8A 2X1DA 2DCEA 2O5RA 4K2GA 4PFOA 4X0GA 3S3NA 4E56A 3HOSA 3NWSA 4C2TA 4XOTA 2X85A 2HNHA 1E3AA 5TGTA 1PJRA 1KONA 1AA7A 4XONA 1D0YA 4PJLA 5KNLA 1EA3A 3K6GA 4CCLA 2OV7A 4HSRA 2HVQA 3KYLA 4B47A 2P0WA 2K9MA 2BW3A 2X1EA 2IGKA 5CQEA 3OOUA 1W36D 2X6YA 3M1CA 2M4GA 1D1AA 3SZGA 2XSJC 4ZDLA 4BE2A 3W2WA 3L94A 2F6CA 4QPQA 3PNVA 3K4MA 5HOOA 4XLHA 3DTEA 3H9GA 4BTHA 2XF6A 4P5OA 2XDVA 3BC8A 3S8RA 4RLQA 4ZTJA 2HPMA 1K6YA 4OAZA 5KHDA 3OS2A 1Z3XA 2RQQA 3LFUA 4HPQA 3MKWB 1X1CA 2R7OA 3K70C 4GRIA 4CCJA 1AI6A 1MMDA 2WBMA 1LVKA 4MLOA 4HSTA 4U87A 3SEZA 5HNHA 2HQAA 1K7DA 1HA8A 3H0DA 4IX7A 1X1BA 4BDYA 4XR6A 1GKFA 3VSLA 5CKTA 3LL7A 4CH7A 2F5VA 2R7QA 4B48A 3TMOA 3QYBA 3E1SA 1AI5A 4E7SA 2V7FA 1JX9A 3ONQA 2V9KA 4B3XA 4NQWB 3OL4A 1D1CA 2CMPA 3HOTA 1QU3A 3K10A 2L9NA 4M1JA 3H9JA 2UV1A 2UWMA 3AKZA 1AI7A 3W3CA 4NNJA 2PJRA 4WKTA 4PK4A 4XKBA 1DP3A 2ELJA 3CJRB 3KX2A 2HZDA 2E5NA 2KQRA 4AVZA 3KEYA 3G2BA 3VWBA 3OYLA 4F91B 2AE5A 2R7SA 1AJQA 4C9YA 4BE0A 3L2RA 2IS2A 3LSHA 4RM2A 4IZZA 4BUPA 1IRXA 3UNGC 1WJ5A 2HU9A 4CUGA 3L2WA 3DTIA 4XN0A 4BGDA 4IQJA 1JI8A 3CJQB 4PEMA 1WJEA 4H4KC 5LFAA 2KL4A 1YE9A 2VQCA 3VDXA 3IAS2 4XN3A 1LDKB 5HVQC 3PJRA 4RM3A 1UG0A 1WJDA 4C2UA 3C2HA 1Z21A 4XLEA 2KZVA 3PUBA 4BJ6C 4DGWB 4XLCA 2R7UA 4E55A 4N4NB 2WAFA 3AFHA 2E60A 3S3OA 1VZ0A 1Y56A 3OIQA 2LYCA 1GK9A 2VXDA 2L5QA 1JW0A 4CCKA 1SAUA 1V5FA 3FHNA 2I8DA 4AU7A 3NWTA 3OYGA 4PJMA 4OWRB 1K5QA 1K5SA 2WYCA 4Y33A 2M7BA 2R4GA 4XLFA 4BDZA 3A2KA 1WJAA 3FDYA 4RLFA 2CW8A 2W7NA 2E5ZA 3VYRB 3OWTA 2CV1A 5HNFA 2GOXB 2W00A 2IXSA 4J00A 1X1AA 2VQGA 3OYIA 2ZFUA 1PNMA 4E57A 1SFKA 1WFXA 3C2GA 2VB6A 4NC8A 3M8JA 2DJIA 3L2UA 3OYKA 3K4JA 2Z1DA 2AQEA 2CUZA 4XKCA 4CA0A 4BEHA 4CSWA 3A1YA 1OR7C 1LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXV A;  2AE5 A;  3SRB A;  1AJQ A;  1GKF A;  3L94 A;  3ML0 A;  1GK1 A;  4E55 A;  3L91 A;  1AI5 A;  1GM8 A;  4WKV A;  1JVZ A;  1AI4 A;  4BTH A;  1GM9 A;  1JX9 A;  2WYB A;  4YF9 A;  3SRC A;  1AJP A;  1PNK A;  4K2G A;  2WYD A;  3JTR A;  1GK9 A;  2ADV A;  4WKS A;  1PNM A;  4E57 A;  4E56 A;  1JW0 A;  3S8R A;  4M1J A;  1E3A A;  3SRA A;  1AJN A;  4K2F A;  1AI7 A;  1FXH A;  1GHD A;  1FM2 A;  1KEC A;  3JTQ A;  1CP9 A;  4WKT A;  4YFA A;  1K5Q A;  3K3W A;  1H2G A;  2AE4 A;  2AE3 A;  4PEM A;  1AI6 A;  1GM7 A;  1K5S A;  2WYC A;  4HSR A;  2WYE A;  4YFB A;  1GK0 A;  4HST A;  4WKU A;  1PNL A;  4PEL A;  1OR0 A;  1K7D A;  1KEH A; 
#chains in the Genus database with same CATH topology
 5ERI A;  2XB5 A;  3DKW A;  5E18 F;  1VQL I;  2X6W A;  3HC7 A;  4E7Z A;  4AIJ A;  4ENJ A;  3WTY C;  1JKO C;  1Y1W J;  3A02 A;  1SMT A;  3T5X A;  4EQQ A;  2A6T A;  4XL9 A;  2EIJ H;  2JWT A;  2IGN A;  1B59 A;  2DOE A;  2R5Z A;  2YU3 A;  1UZC A;  2YX7 A;  1OYI A;  3AG2 H;  5HS7 A;  2M3A A;  4HF0 A;  3OS0 A;  4YFB A;  2DT6 A;  5BQT A;  2JRM A;  2TCT A;  4F55 A;  5EG0 B;  3LFK A;  1E3O C;  2IRF G;  5FD5 A;  4M9X A;  5DUI A;  1QGP A;  2XF7 A;  2CFO A;  3KFW X;  3ZMU A;  1BIB A;  1SFX A;  1WJF A;  3HL2 A;  4U7D A;  1SC7 A;  2IT0 A;  4MHG A;  2ELK A;  4MQV A;  1U0J A;  2BV6 A;  5H6Q A;  1X58 A;  3KE2 A;  4LFU A;  4EVI A;  1YYV A;  4II2 A;  4KJZ A;  1LFP A;  3MZH A;  1B72 B;  2QA4 I;  1MZB A;  2EK5 A;  5EJC A;  5DCM B;  2X51 A;  2VKV A;  1E3H A;  2LY9 A;  3FXJ A;  3LST A;  4FE7 A;  4D7N A;  3MKZ A;  3K70 D;  1NG6 A;  1FM2 A;  2IBD A;  3ZN0 A;  1FOX A;  1H2G A;  1P7J A;  3CCS I;  5K5O A;  3X2Q H;  5F0F A;  2CUJ A;  1BOB A;  4RS8 A;  5J8F A;  2M0M A;  2LG4 A;  1CGP A;  2CRG A;  5L3C A;  3EDP A;  3ZMD A;  2BGC A;  1XMX A;  2A3S A;  4OU0 A;  3GZ6 A;  1JE8 A;  1P4X A;  2WA0 A;  2XF5 A;  4R79 A;  1DPU A;  5E79 C;  1E3P A;  3O2P E;  2QKL B;  4MO7 A;  2Y9Y A;  3TO9 A;  3JTR A;  3NAR A;  2CSO A;  5LHI A;  3BT9 A;  2DN0 A;  2LOO A;  2RNG A;  1MND A;  3IUO A;  3RI4 A;  3GBG A;  1JHF A;  3VB2 A;  3CO7 C;  5KCM A;  2H94 A;  1GV2 A;  5D8L B;  2CV0 A;  2HTJ A;  3B6A A;  2E2I J;  1SVO A;  2IS4 A;  4HBL A;  4AD9 A;  1OYW A;  3JR9 A;  4PGH A;  4KT5 C;  2QSG X;  3BZC A;  3DEW A;  2XAJ A;  2R7W A;  4AIH A;  2WYB A;  3F0C A;  2IS6 A;  1TT0 A;  3OR2 C;  2LK2 A;  2C6Y A;  1WJB A;  1ITY A;  4L9V A;  2E2J J;  2WAQ A;  2FML A;  4M3B A;  3DTK A;  1QPM A;  3GFL A;  1B8I A;  3G3Z A;  4FAS D;  3TP0 A;  3NQO A;  2JVH A;  2PX9 A;  1FT9 A;  4F3Q A;  4HX7 A;  4GCV A;  1BW6 A;  4M3F A;  5GP9 A;  2R93 J;  4Q48 A;  2JSP A;  1QO0 D;  4ZZD A;  1TQI A;  3V7R A;  1F1Z A;  2J5P A;  5D4S A;  3L2V A;  3JTG A;  2LD5 A;  1Z7U A;  5HDK A;  9ANT A;  3C1D A;  2VC0 A;  1E17 A;  2VC1 A;  2HYF A;  4F92 B;  1BI3 A;  3A03 A;  2DW4 A;  2K3P A;  4B1R A;  1VQO I;  4YFA A;  5B1A H;  3R61 A;  5JLX A;  4FT8 A;  3S15 J;  1W36 C;  4LK1 F;  3Q0U A;  1R23 A;  3IP4 B;  1XG1 A;  3OY9 A;  3ZMV A;  3GO5 A;  2HDC A;  4B8X A;  2M4K A;  1JGS A;  3K4L A;  2VJ4 A;  3S3M A;  4RDU A;  3W2V A;  3CMA I;  3ZPL A;  3EUA A;  2ZJQ F;  2A61 A;  1X3Z B;  1XMA A;  5HLG A;  3OOP A;  1ZGA A;  2ZJR F;  5DEQ A;  4A0Y A;  2ZCW A;  3BOQ A;  1B9N A;  2CJJ A;  1OCC H;  2GZW A;  3BRO A;  5E20 A;  1YJ9 I;  2X48 A;  5H6R A;  5JLW A;  1S29 A;  4PSX A;  3K4K A;  2FMY A;  4UB8 C;  4BL0 B;  2EZH A;  2ZXH A;  1Z9C A;  1RZ4 A;  3DCF A;  4WWC A;  1VND A;  1BR1 A;  1GT0 C;  3ZMT A;  4LIT A;  5FO5 A;  2A6H F;  3JCU C;  2H8W A;  4N9H A;  5F08 A;  2ZSI B;  3I4N J;  2R7V A;  2ADU A;  2LVS A;  4HG2 A;  1BJA A;  1ETK A;  2W82 A;  3PSF A;  3GTG J;  4Q47 A;  2VQH A;  4GDF A;  4XNF A;  2FQ3 A;  3SFI A;  5IYB J;  3TW6 A;  3F8M A;  1SD4 A;  4PGG A;  1IZ1 A;  3CUQ C;  2UUZ A;  1A5J A;  4IHS A;  1T95 A;  4XRF A;  3OL3 A;  2HTS A;  2PQ8 A;  3L91 A;  2ESN A;  2EFW A;  1G4D A;  1QZZ A;  2ID3 A;  1S3J A;  3J81 Z;  3FKJ A;  1OR7 A;  4EM0 B;  2VPL A;  5E3O A;  1IJW C;  1H89 C;  3R0A A;  3CF2 A;  1WVR A;  1IUF A;  1GLN A;  1QRY A;  3N4M A;  1Z3Y A;  2XGD A;  3CJN A;  5TIS C;  1G3Y A;  3CCU I;  2W4S A;  5M3M J;  4P55 A;  1Z1D A;  1W5S A;  2X4H A;  1HBX G;  1D0X A;  1WHU A;  2XPU A;  3F6V A;  2HWV A;  3RZO J;  4K2E A;  4FHT A;  3HBL A;  4A2U A;  2QWW A;  3T0Y A;  3H92 A;  3ROU A;  3EPZ A;  3WU2 C;  1MBK A;  3RQ4 A;  2MD0 A;  2ADV A;  2RVC A;  5DUK A;  3D5R C;  2HPI A;  3O6B B;  4ZYE A;  1AJN A;  1TWG J;  4L5E A;  3SRA A;  4E70 A;  4YFN F;  4RB0 A;  1R5H A;  3T1B A;  2HDD A;  4FX4 A;  4YEL A;  5FLM J;  3FKI J;  4YEJ A;  3CLO A;  4D5C A;  1SMY F;  2IAI A;  5FKL A;  4CCN A;  3JRH A;  1X3U A;  4IHV A;  2H09 A;  2Z16 A;  1M1E B;  3E3V A;  4N0B A;  1GK1 A;  1QQI A;  1KU2 A;  1XDS A;  2ECB A;  2EFO A;  4BQO A;  3OIO A;  2MLG A;  4J19 A;  3AL0 C;  3PFY A;  3AG4 H;  1JUP A;  5EG0 A;  1T0F C;  4Y15 A;  3WU1 B;  2MYS A;  2ZXW H;  1RES A;  1TLH B;  4LG3 A;  1MNM C;  2L9S A;  5EF6 A;  1A6Q A;  2WB1 A;  5H20 A;  2ISZ A;  1WWX A;  2MAB A;  1B72 A;  4KNY A;  5HDN A;  1HDD C;  3CCM I;  3I56 I;  4I2O A;  2DT7 B;  2KPM A;  3ISP A;  4C3H J;  1YQA A;  3LOC A;  1MIJ A;  5D5V B;  2GOM A;  1BR4 A;  2QSH X;  2JUC A;  1AI4 A;  1ZK8 A;  3LSR A;  2MW8 A;  1H0M A;  3HOY J;  2DCE A;  4I76 A;  3WG9 A;  4K2G A;  4PFO A;  4X0G A;  1FBQ A;  1KA8 A;  3LA3 A;  3NWS A;  1BL0 A;  5TGT A;  5E1W A;  1LE8 B;  5FKM A;  3OSG A;  1HOM A;  2O0Y A;  1D0Y A;  4QWQ A;  1TC3 C;  3BPX A;  3DBH B;  3FGT A;  3KP5 A;  1S8N A;  1U6G A;  2CFX A;  3G1O A;  3K0L A;  4EMS A;  1GUU A;  1VQM I;  4I99 C;  3KYL A;  3VPR A;  2X1E A;  2VN2 A;  4OIN F;  2HQR A;  3OOU A;  2X6Y A;  1D8J A;  1E2X A;  1FX7 A;  4U88 A;  1D1A A;  1W0U A;  3W2W A;  1H9G A;  1CF7 B;  4UUT A;  2F6C A;  4UNO A;  1BBY A;  3T8T A;  3K4M A;  1YRN A;  2YPR A;  1R71 A;  4P5O A;  2R3S A;  1WPK A;  3Q0W A;  1D3Y A;  3BC8 A;  4ZTJ A;  2HPM A;  2BHY A;  5KHD A;  3CME I;  5DM7 F;  2RQQ A;  1YS7 A;  1XDU A;  1X1C A;  2TDX A;  1TL8 A;  4GRI A;  4XLP F;  3COA C;  2ZME A;  2VT2 A;  2HQA A;  3D1N I;  5D6E A;  1B6A A;  2RDP A;  4G6D A;  3KZZ A;  3CCJ I;  3M7G A;  5CKT A;  4B48 A;  5EEA A;  3F6O A;  3DP7 A;  3ONQ A;  4DZP A;  3GTM J;  3KP4 A;  4D7M A;  2DTR A;  4KYW A;  2CMP A;  2CUF A;  1QU3 A;  5DDG A;  3K10 A;  3H9J A;  5IY5 H;  3AKZ A;  5L3E A;  3QPT A;  4WKT A;  1P7I A;  2AO9 A;  4ASN A;  1DP3 A;  5GAH J;  2F5E A;  4LLN A;  3KEY A;  3G2B A;  3VWB A;  3JRD A;  2O61 A;  4F91 B;  3FXO A;  4LMY A;  3EUH A;  2QBY A;  4C9Y A;  3K2A A;  1XD7 A;  2H1K A;  1R1V A;  3L2R A;  3MN2 A;  2V9V A;  1UJ8 A;  4HDU A;  1XCV A;  3LSH A;  4IZZ A;  2I5U A;  2ZJ2 A;  3UNG C;  1WJ5 A;  1GDT A;  5AON A;  4LB6 B;  1IN7 A;  4IQJ A;  2FSW A;  1TQP A;  3HRS A;  2KKO A;  3FM5 A;  1H88 C;  1JI8 A;  1SD6 A;  5JVT A;  2O8X A;  2KL4 A;  1FC3 A;  1VQN I;  1YE9 A;  2DO7 A;  1U8B A;  3VDX A;  4XN3 A;  1XSV A;  1LDK B;  1YG2 A;  2R7D A;  4C2U A;  1Z21 A;  4BH9 A;  2EJR A;  3PUB A;  2FBH A;  1A31 A;  2R7U A;  3C3W A;  3DXJ F;  2WAF A;  2DQR A;  1I1G A;  3LQQ A;  4Y52 J;  2ZKZ A;  1RR8 C;  2JZY A;  2L5Q A;  1V5F A;  2I8D A;  5D5X B;  4C3J J;  4FX0 A;  4AU7 A;  3DBR B;  5F0H A;  3ECH A;  3M8F A;  1PVE A;  3QU3 A;  5HLI A;  2L0K A;  3GLL A;  4BY7 J;  4QLC U;  4BDZ A;  3LA7 A;  4ENM A;  3FDY A;  4RLF A;  1FPQ A;  1YW8 A;  3ELK A;  2CW8 A;  3WGG A;  1ETY A;  3ECO A;  5J3L A;  3M3Y J;  3VYR B;  2N8G A;  1A36 A;  2P4W A;  3E6C C;  3KYC B;  2MH9 A;  3L2C A;  4JP0 A;  2ELH A;  1BC8 C;  1S7A A;  3OYI A;  1RKT A;  4ZYD A;  4E57 A;  2QSF X;  5L3B A;  2FBK A;  3ZP5 A;  1ZG5 A;  3I55 I;  1DPR A;  2JN6 A;  2BXZ A;  2L01 A;  5E1Z B;  4NC8 A;  4EGZ A;  1X2N A;  4R1H A;  2EFP A;  3WTX C;  3OYK A;  4A3L J;  3K4J A;  2Z1D A;  2AQE A;  3GLX A;  3FMS A;  1Z6R A;  1VQK I;  2DLL A;  3V8K A;  3FXM A;  4CSW A;  2EH3 A;  2RAE A;  4PJN A;  4A12 A;  2JPC A;  5E8G A;  3DF8 A;  4GXO A;  3HUG A;  4MFD A;  3WTU C;  3OYE A;  3AAF A;  5LRS A;  1K78 B;  4EJT A;  4BXF A;  1KU7 A;  2FNP A;  2Z99 A;  3GTJ J;  3K69 A;  4KT6 A;  4KIS A;  4V2G A;  2IS1 A;  2NVU B;  1NHA A;  2ZNY A;  1YW7 A;  4DBR A;  5J1Y A;  2CW7 A;  4MIM A;  1BR2 A;  5LGT A;  2QQB A;  3J7Z I;  3K9T A;  2Y2Z A;  1FP1 D;  5CLS A;  2CQK A;  5EGO A;  1T33 A;  2H8R A;  1PP7 U;  3BCA A;  2QGU A;  2W84 A;  1VQ7 I;  4P96 A;  4BHB A;  4V2F A;  3DU5 A;  1D5V A;  4DZJ A;  1Z77 A;  1ZGJ A;  4J01 A;  2LKP A;  1GVJ A;  1LEB A;  2LLK A;  4NB5 A;  5FJ8 J;  1O3Q A;  3VYT B;  4B3A A;  2VOO A;  2HXI A;  4EAT A;  4KN7 X;  5M5X J;  5DV5 A;  3H3Z A;  4RAZ A;  2X9D A;  1ZAR A;  5D5U B;  1HKT A;  5LD2 C;  2H1L A;  4BXU A;  2CH0 A;  3S1R J;  1FMW A;  4CHU A;  3DLA A;  2KP6 A;  3PNT A;  4JYK A;  1R49 A;  3U1K A;  4IXA A;  3FK6 A;  2PMZ A;  4WKU A;  5BPD A;  3IRR A;  1GVD A;  3L2Q A;  3DFG A;  1VI0 A;  3TDU C;  3DKY A;  1HC8 A;  3I4M J;  3OYF A;  5C44 J;  2WWY A;  4A3I J;  4JX5 A;  1RRJ A;  1PUF B;  3BTL A;  5DTD A;  3BY6 A;  4L0Y B;  3CDI A;  1YIT I;  2O3F A;  4RB3 C;  2LKX A;  1WJC A;  2EZI A;  4OIR F;  3R4K A;  2DAO A;  5F1R A;  1PYV A;  2B7E A;  3JRG A;  2VE9 A;  4ZYA A;  3LSM A;  5HS8 A;  4RB2 C;  2BEO A;  4PDK A;  1LNW A;  1F4K A;  3S2H J;  1GK0 A;  2V6E A;  2K9Q A;  1QHH D;  3HTU A;  2M34 A;  1OR0 A;  2ZNZ A;  3MZ8 A;  3S32 A;  3V8J A;  2VT3 A;  1XGN A;  3C2B A;  5J47 A;  3F23 A;  1LE8 A;  1X19 A;  2KT0 A;  3VEP A;  3H35 A;  5J4V A;  2LTP A;  4YFK F;  4UUS B;  2DMP A;  3S2D J;  3W6K B;  3LSG A;  1J9I A;  1YX3 A;  3BJO A;  2Q1Z B;  3JW4 A;  2R5Y B;  2DDA A;  3V7C A;  1JT0 A;  2ME0 A;  2XAU A;  4I09 A;  1TBX A;  3EYI A;  2MFZ A;  4G12 A;  3HOX J;  1JKP C;  5JHF A;  2W24 A;  5L3D A;  4BWC A;  3ABU A;  3MCZ A;  5IP6 A;  1MMG A;  1HQC A;  1LVA A;  3BG5 A;  4BQQ A;  4IRG A;  5IYC J;  2BY3 A;  3EYY A;  1JTY A;  2TRT A;  5CPR B;  2LBF A;  2LRD A;  3CES A;  4II3 A;  1EF4 A;  1OJL A;  3O8G A;  3LSP A;  3BJ6 A;  3JSO A;  3HSE A;  3T8R A;  5ICC A;  2ME6 A;  1U78 A;  2JA6 J;  3K1M A;  1RUN A;  3HOW J;  4Y3O A;  2BYV E;  3E6M A;  1ZRD A;  1XX5 A;  2CG4 A;  2X0L A;  5D8K B;  2O8K A;  3BQY A;  2V1N A;  2H6B A;  2HKX A;  5EEG A;  4DBQ A;  2K7L A;  4M73 A;  2XAF A;  2L7F P;  2HR3 A;  1O7L A;  2FE3 A;  2JA2 A;  3C18 A;  1IRG A;  4HOB A;  4AC0 A;  2GQQ A;  2GA1 A;  1HW2 A;  1TT5 B;  2KDZ A;  4ZH4 F;  1IN6 A;  5F6F A;  2P8T A;  4KMF A;  1S5L C;  3QRF F;  4ZZL A;  2DA4 A;  3E5X A;  3GEZ A;  2DBB A;  1ETX A;  1R6R A;  1OFC X;  2DQL A;  5CVJ A;  3OYA A;  5B66 C;  2EPF A;  1UEL B;  2M87 A;  3E6D A;  4E7J A;  1MDM B;  4RAY A;  2AXT C;  2RQP A;  1ON2 A;  3BR2 A;  1AKH A;  1W5T A;  2L4A A;  1QA6 A;  2HYG D;  3BG3 A;  3HJE A;  3MVP A;  1T6S A;  3S2W A;  1JTX A;  3CUQ B;  4MEY F;  5C4J J;  4KFC A;  5KK1 A;  1YJN I;  2XIG A;  3VYS B;  2QEX I;  4BJ5 C;  3TOB A;  1GXP A;  4L9T A;  1Q1H A;  1UHS A;  1V5G A;  1Z0X A;  2Y69 H;  5F0C A;  2WAD A;  2VJ5 A;  4CIC A;  4X1E A;  2LMD A;  1BW5 A;  1Z7L A;  4KIF A;  4RGR A;  4ETS A;  3QYE A;  3SDG A;  4YRV A;  3BZ6 A;  2M1B A;  4OMZ A;  2Z33 A;  1K79 A;  4XIC A;  3TW7 A;  1RKW A;  5B3S H;  2P7C B;  1GM7 A;  1OYY A;  4CDG A;  4P1W A;  4E7K A;  2UXN A;  5AIP A;  1DU0 A;  1UAA A;  1ETO A;  2Q2E B;  1NH3 A;  4WX9 A;  3DWL E;  3QAH A;  3D0S A;  3J80 K;  3PSI A;  2F4I A;  3HOU J;  4KN4 X;  1TNS A;  3SRC A;  2XGX A;  3I71 A;  2EV0 A;  1I39 A;  4I0A A;  3OYJ A;  1ZG1 A;  2NAZ A;  2OD5 A;  2QCO A;  5J8C A;  5D6F A;  2YX4 A;  3CC4 I;  2DOF A;  1T38 A;  1O3T A;  3TKY A;  1N77 A;  3ESW B;  3DPT A;  2M45 A;  1G59 A;  1Y0U A;  4M9S A;  3TQN A;  2PG4 A;  2I10 A;  1OLT A;  2DT5 A;  2BBY A;  3M1E A;  2XKO A;  2J5O A;  3QOD A;  3LAP A;  3P9C A;  4I0B A;  3D5S C;  1G2H A;  2V1U A;  2ZC2 A;  3JSP A;  4NDL A;  4U0V A;  1JKR C;  4G7H F;  2CW0 F;  2DA1 A;  1STZ A;  3IV5 A;  3ABL H;  4IQ4 A;  1DQU A;  1MBE A;  3HIF A;  1TWC J;  4HA8 A;  4Z6Y A;  4L9N A;  1DGR M;  1G6N A;  4ZDP A;  3AL0 B;  4NC6 A;  2DFE A;  3ZQG A;  2STW A;  2DJN A;  3WHB A;  2CS3 A;  3PFI A;  3Q5F A;  1C0W A;  1K78 A;  1FZP B;  4BS9 A;  2UXX A;  4Y7N J;  1RI7 A;  2L2O A;  3SQN A;  2CQN A;  5HS9 A;  2PEX A;  4RBO A;  2NOJ B;  1FOY A;  3HPG A;  2D45 A;  3WGI A;  1HF0 A;  1QVT A;  3MAJ A;  2GIV A;  1KEH A;  2LH9 A;  2RN7 A;  2NVX J;  3FIW A;  2OF7 A;  1GM8 A;  4IHT A;  3BCB A;  5ILS A;  1REP C;  3LMM A;  3F3X A;  1JUM A;  2WYD A;  4XLA A;  3JRE A;  5LRR A;  2DMN A;  1XSD A;  1PP8 F;  2DYR H;  1IO2 A;  3KIO A;  4PSW A;  3A0H C;  2VJI A;  3FXU A;  3ZN1 A;  1JKQ C;  2NVY J;  4A6E A;  2VKD A;  3LSK A;  3SFZ A;  2P6T A;  4HLX A;  1KZH A;  5L3F A;  3P9K A;  3IH2 A;  5ICE A;  3WG7 H;  1VF9 A;  1H8A C;  3D5L A;  2M5W A;  3CMM A;  2GLO A;  3TBI A;  2B63 J;  3CP8 A;  4HX8 A;  2X1D A;  3WTZ A;  2WV1 A;  3U2R A;  4UVA A;  1K83 J;  2WAQ N;  1RR7 A;  4C2T A;  2W57 A;  3FGR A;  1KYZ A;  2GBY A;  5TJJ A;  4XON A;  1PUF A;  3I59 B;  1TWA J;  1H9T A;  1T2K A;  4CCL A;  2OV7 A;  1ZTR A;  2JJ7 A;  4B47 A;  4XSZ F;  5TRD A;  2K9M A;  5CQE A;  4A3E J;  2DPU A;  2DFH A;  3M1C A;  3MQ0 A;  4D0P A;  2L9V A;  1FSH A;  1R58 A;  1IRZ A;  4HX4 A;  3R60 A;  4L9J A;  5HOO A;  3H9G A;  2MC3 A;  3GZ5 A;  2XF6 A;  4XRS G;  1J5Y A;  1IW7 F;  1FNN A;  3S8R A;  4CO8 A;  4OAZ A;  2LR8 A;  5E8I A;  1ZLK A;  2GXG A;  2XKP A;  3FF5 A;  1B4A A;  1Z3X A;  5A2Q K;  4UUS A;  2P5K A;  1NK3 P;  1OCP A;  1WQ2 A;  4HPQ A;  3K70 C;  1AI6 A;  1ZYR F;  1MMD A;  2RC4 A;  2WBM A;  1LVK A;  4MLO A;  4HST A;  5GAE J;  3RKX A;  3GME A;  2B9S A;  1HA8 A;  3F8C A;  3H0D A;  5CJ9 A;  1X1B A;  1S72 I;  1Q1V A;  2WV0 A;  4XR6 A;  4YIR X;  4A3K J;  3HEF A;  4IVN A;  3VSL A;  4A3J J;  3QYB A;  3E1S A;  2HS5 A;  1I3Q J;  1JX9 A;  5DD4 A;  2V9K A;  3ERE D;  1R4M B;  4B3X A;  2CWE A;  4BBS J;  4M3D A;  2VBX A;  4NQW B;  1FLI A;  1D1C A;  3PQJ A;  5M5Y J;  2VBY A;  3O8H A;  3ZMZ A;  3FXK A;  1K4S A;  4M1J A;  2UV1 A;  2UWM A;  1AI7 A;  3J7A O;  2XAQ A;  4PK4 A;  4XKB A;  3WE3 A;  3CJR B;  3KX2 A;  2KQR A;  1U9O A;  2KRF A;  3I64 A;  4AVZ A;  1ON1 A;  2AE5 A;  4CYD A;  1L3L A;  5K7Z A;  5GAG J;  3JRF A;  4M3G A;  4RM2 A;  2Y48 A;  1T98 A;  2DA5 A;  5HDG A;  2JQ7 A;  1MJ9 A;  1IRX A;  2IJL A;  2HU9 A;  1LPQ A;  2K4J A;  2XPV A;  3BTJ A;  1FIA A;  4BGD A;  3CJQ B;  1XCB A;  5BOX A;  1WJE A;  2F48 A;  4H4K C;  1FYM A;  5J4Y A;  2O03 A;  4A69 C;  1MJA A;  3PJR A;  1KU9 A;  4RM3 A;  5F64 A;  1WJD A;  2FOW A;  2LF8 A;  5FFZ A;  4A3G J;  4G8X A;  3C2H A;  5LLQ A;  3KP7 A;  2KZV A;  4BJ6 C;  1BN5 A;  4H0E A;  4WXH A;  2H27 A;  5FLX K;  1HSJ A;  2L7M P;  5DD8 A;  3AFH A;  2E60 A;  3CDL A;  4XLN F;  3U1D A;  1VZ0 A;  5HLH A;  1FYL A;  3CUQ A;  1ETQ A;  5CYV A;  2Q0O A;  1GK9 A;  2VXD A;  5E1X A;  1ZH5 A;  4ENK A;  4CCK A;  4M6X A;  4OMY A;  3FHN A;  3Q0V A;  4CGZ A;  3SHF A;  1KYW A;  5D4R A;  3NWT A;  2OZ6 A;  2V1D A;  1KQ8 A;  1XTA A;  4PJM A;  2YSR A;  1K5Q A;  3HB9 A;  2A05 A;  2WYC A;  2HQ5 A;  5JHU A;  1V54 H;  3L7W A;  3P9I A;  1IN8 A;  3A2K A;  1SFU A;  3ZQL A;  3CCQ I;  5DCM A;  1W7P B;  1SVM A;  2CV1 A;  3E5Q A;  2PFB A;  2IXS A;  2ZJP F;  6PAX A;  4GYG A;  2NYX A;  1X3W B;  1K7A A;  3KEQ A;  3MKL A;  1RNL A;  2DK8 A;  2ZFU A;  3LNQ A;  2IP2 A;  3GVA A;  1PNM A;  3PM1 A;  1SFK A;  2Q2E A;  5KAF C;  2L02 A;  4S0H B;  2QQ9 A;  2VB6 A;  3RKY A;  2DJI A;  2HZT A;  2X6O A;  4YFX F;  1ZAO A;  1UFM A;  3ABT A;  5IP7 J;  4XKC A;  2DPD A;  2G9W A;  4UVC A;  1IV8 A;  5EZG A;  4ANJ A;  2OUM A;  5BNG A;  2LY1 A;  2HDW A;  4FTH A;  4BXX J;  3OSF A;  3ZRG A;  1OCZ H;  1JJ8 C;  1W4M A;  2FUG 2;  2W85 A;  1I1S A;  5LHH A;  2WB1 N;  4ON0 A;  3IKV A;  4BQN A;  1FEX A;  2R7R A;  4LOC A;  3RKQ A;  1O57 A;  2EZL A;  2K5C A;  4U0W A;  4DW6 A;  3UR3 C;  3MEX A;  4AUX A;  1KU3 A;  1T0F A;  3U9G A;  2GWR A;  1DU6 A;  2FU4 A;  1R22 A;  4WF2 A;  1UMQ A;  3GTP J;  3S1M J;  2KIQ A;  4C30 A;  4IHW A;  2VXZ A;  3PQK A;  3NRV A;  4S04 A;  5M5W J;  2KRC A;  3MWM A;  1J7K A;  3CCE I;  5ILV A;  4LB5 A;  1FIP A;  1Y1V J;  4I7H A;  1Z05 A;  3RDI A;  4A0X A;  3HOV J;  2Y0M A;  5LHG A;  3F8F A;  1YFH A;  3VOD A;  2HXO A;  1EH7 A;  3DEE A;  1MW7 A;  4HRI A;  1LDJ A;  2BY2 A;  4E7H A;  4A3B J;  2K4B A;  3N05 A;  1BJZ A;  2DK5 A;  1B1B A;  1R1U A;  2P81 A;  2NS7 A;  5IT9 K;  5FRO A;  3SRB A;  4I6Z A;  3E97 A;  4FET A;  1UB9 A;  2WTE A;  3GTK J;  1GM9 A;  4CCM A;  1XGS A;  1MGT A;  3OYB A;  3WHC A;  3LSI A;  2XPW A;  2LC2 A;  3G73 A;  1DUX C;  3H5A A;  1S7O A;  2FOK A;  2COB A;  3H3U A;  1SAX A;  5E17 F;  3JTH A;  4XMY A;  3G1L A;  3SXY A;  2BZT A;  1E0E A;  2DOA A;  3K3W A;  1ODD A;  4AWX B;  4YII A;  2XC7 A;  1YX5 A;  3TO7 A;  3PNY A;  5CVV A;  4IF4 A;  3MZY A;  1OCO H;  1DGW Y;  3RZD J;  3H36 A;  2WY8 Q;  2ZB9 A;  4QSH A;  2R5Z B;  1ZR4 A;  2D5V A;  3AG3 H;  1ZHF A;  4RAF A;  2XB0 X;  3GTO J;  4IO9 F;  1HCR A;  3HKZ A;  1YLF A;  4MGR A;  1G8X A;  3K1P A;  3MFK A;  2OCC H;  3CDH A;  3IWF A;  5C4X J;  1EKE A;  2DMT A;  5ICF A;  5GPA A;  3FXL A;  2OCE A;  4HAM A;  1FWZ A;  3CC2 I;  3S93 A;  4C2M J;  1GHD A;  2X1C A;  1X1D A;  1O7F A;  1YJW I;  2Z2S B;  4JQF A;  2WYE A;  5ICG A;  3LA2 A;  2QZ8 A;  3MD2 A;  3ABM H;  3HG9 A;  1PNL A;  3GUD A;  3HPH A;  2JPB A;  1IG7 A;  1P9Q C;  1UG2 A;  2L3D A;  3FIS A;  2CGP A;  2VBZ A;  2YU9 J;  2W48 A;  3HRU A;  4UB6 C;  4A5N A;  3PL8 A;  1UHM A;  1K4T A;  4WKV A;  3J80 Z;  1ENH A;  3BG6 A;  3IKT A;  4KDP A;  4A5M A;  4RAG A;  2OA4 A;  4XSX F;  1MNE A;  1QHG A;  3FZV A;  4EJO A;  1SEU A;  2D2W A;  3OYH A;  2GAU A;  4E7L A;  2DDB A;  2CU7 A;  5K7H A;  3HYI A;  2COM A;  1HW1 A;  2K3F A;  3KP6 A;  2HOT A;  2NS0 A;  4NQW A;  2VJJ A;  1MSE C;  1WI3 A;  3CCV I;  4L5J A;  3HKZ N;  3BG9 A;  3V42 A;  3R0J A;  3H5R A;  2G7U A;  1R1T A;  3HZJ A;  4CZZ A;  1KQ0 A;  4Y4R A;  3HRM A;  2K02 A;  4KIT B;  2FD5 A;  4BHP A;  4OIQ F;  2LRE A;  1OPC A;  2LDU A;  4IEJ A;  5IP9 J;  4ESB A;  1B9M A;  1Y6I A;  4IL6 C;  4BQA A;  1QZY A;  1BIA A;  1D5Y A;  3K4B A;  2A07 F;  2KFD A;  5DYM A;  3WTS C;  1APL C;  1N75 A;  2HI3 A;  2H6C A;  1EH6 A;  3ABK H;  4P9F A;  1QNT A;  3FHZ A;  2HVS A;  3HGG A;  2E19 A;  2BHZ A;  3U21 A;  5LGN A;  2VPR A;  1AWC A;  3ZQF A;  2Y0S A;  2QYO A;  2R0Q C;  3CMY A;  4XM3 A;  3PIO F;  4FCY A;  1B8I B;  4YF9 A;  4M71 A;  5FRN A;  5GPC A;  2EA2 A;  2HKO A;  3M4O J;  2EIK H;  2YS9 A;  3F8B A;  3RPU A;  4DNC A;  3V4G A;  3A4C A;  5J40 A;  4I01 A;  2P7V B;  4LGW A;  4LIU A;  1HW5 A;  4PUS A;  3OR1 C;  5GTI C;  2KIF A;  2R92 J;  2QKM B;  3DLL F;  3H5N A;  4L0Z B;  2GXB A;  2F2E A;  3I9V 2;  1T39 A;  2FF4 A;  3S16 J;  4AM3 A;  3A01 B;  5CVR A;  1WGX A;  2MBF A;  1ZG3 A;  3CCY A;  4JOM A;  1IXS B;  4ESJ A;  2LKS A;  4XRS A;  1R5I D;  2OPT A;  1XC5 A;  4ABZ A;  4D9J A;  2E7X A;  2IA2 A;  3SEQ A;  1W7P A;  4U0Y A;  3JRA A;  4F93 B;  1MMN A;  2OAZ A;  3WU0 A;  4GFB A;  5DM6 F;  4M9Z A;  3J7Y J;  2RKH A;  5C3E J;  3JRI A;  1FP2 A;  2BVM A;  3I3L A;  3ZQH A;  1VQP I;  3HDD A;  3QOP A;  2KMU A;  5D5W B;  1FMV A;  2WAE A;  1TW2 A;  1I6X A;  5FKK A;  1LJ9 A;  5K5Q A;  3WTV C;  4WK8 F;  1R4N B;  2P5V A;  4HV5 A;  2XSD C;  1DDN A;  3CF5 F;  5BPI A;  1WRJ A;  2QVO A;  3WTW C;  4HF1 A;  1J09 A;  4DYC A;  1AJP A;  3GYH X;  2E1O A;  3BR6 A;  5KVR A;  3GTQ J;  3QOE A;  5L3G A;  1OCT C;  3MKY B;  2EIN H;  1CF7 A;  1ZRE A;  4M74 A;  2PBI A;  4G7Z F;  2PMZ N;  2OBP A;  4BYY A;  4KIB A;  3GFI A;  4QIW N;  4MNU A;  2NNY A;  2ZSH B;  2NNN A;  2XUB A;  5FD6 A;  4WCG A;  5JI6 A;  5IOY A;  2KIU A;  4LK0 F;  5B5E C;  2DXI A;  2XGE A;  1PUE E;  2AQF A;  2V26 A;  4FE4 A;  4DOZ A;  3UKG A;  2DA3 A;  4BHC A;  1V5E A;  2FBI A;  2EV5 A;  2CV2 A;  3BTC A;  1ETW A;  2VUM J;  2JT1 A;  1R36 A;  2VKE A;  3K1N A;  3QPH A;  2F4O B;  4ITV A;  5E3M A;  2BY0 A;  2EA4 A;  2ZXI A;  3FXR A;  3HHH A;  3OYM A;  2IGO A;  5GAD J;  4EJU A;  2V4J C;  3TED A;  4A0Z A;  2VE8 A;  2EQR A;  4RGU A;  1IN5 A;  1BM9 A;  3CLQ A;  1JXS A;  1ZKG A;  4KUM A;  4AID A;  2VOD A;  3H9Q A;  3GFM A;  1W0T A;  4OIP F;  4O5V A;  3SDB A;  2PMU A;  1IN4 A;  2K27 A;  1YS6 A;  1X4O A;  2L54 A;  2RV8 A;  5J1U A;  1FOK A;  2E36 A;  2O5R A;  3HOZ J;  3ASN H;  3HOS A;  1S7E A;  2VOP A;  4XOT A;  4V19 K;  1E3A A;  2E35 A;  2HNH A;  2NXN B;  3LAJ A;  3S17 J;  2JA5 J;  1KON A;  1AA7 A;  5KNL A;  3G71 I;  5E3N A;  4PZJ A;  1P2F A;  1UCR A;  1I6H J;  5EDN A;  2HVQ A;  1EH8 A;  2IGK A;  1W36 D;  1TW3 A;  2MH2 A;  2ECC A;  2M4G A;  1R7J A;  2A68 F;  2D1H A;  1NK2 P;  3L94 A;  1FOW A;  5FLX Z;  3L9F A;  4OOI A;  3RQI A;  3KLO A;  3DTE A;  4IOC F;  2GIZ A;  1QPI A;  2OZU A;  5IT3 A;  2XDV A;  4RLQ A;  3OS2 A;  2F5F A;  4KIG A;  1WH7 A;  1IDZ A;  2ZXJ A;  3MKW B;  2DYS H;  3L09 A;  2ACJ A;  2XAH A;  2IEK A;  4U87 A;  4R8H A;  1MH4 A;  3SEZ A;  3TDZ C;  2E34 A;  1BI2 A;  4D5F A;  5HNH A;  2R7Z J;  1K7D A;  3KYD B;  3QWL A;  3B02 A;  4IX7 A;  2Z9O A;  4BAY A;  4BDY A;  1RUO A;  3RJP A;  2EWN A;  1U5T B;  3FMQ A;  3CUO A;  2MLK A;  4CH7 A;  2R7Q A;  1AI5 A;  4ESF A;  3B6C A;  2M9H A;  1O3S A;  2DA7 A;  2XVC A;  3ZQI A;  4N9I A;  2KZG A;  4EM1 A;  4DYR A;  3S1N J;  2IA0 A;  4Y13 A;  1IC8 A;  3I5U A;  2NVT J;  2CYY A;  1WH5 A;  2FXA A;  3RYP A;  4HZF A;  3M07 A;  2Y9Z A;  1MBF A;  5AIQ A;  1XGM A;  4ZYH A;  5FFX A;  4DQ2 A;  1QBJ A;  1MBG A;  3OYL A;  2PLY A;  2QEN A;  2V1X A;  2HQN A;  5J6X A;  3PIP F;  1ZLJ A;  2R7S A;  3I54 A;  1LDD A;  5BMZ A;  2EB7 A;  2E7W A;  3S1Q J;  1A6I A;  3KZI C;  2DFF A;  1LFU P;  4G6Q A;  2ZO4 A;  1TQM A;  3BR1 A;  4BUP A;  3GZN B;  1SFO J;  3BZK A;  3P5J A;  1W5C C;  3L2W A;  4O6J A;  1T8I A;  4CYC B;  3EET A;  1YRN B;  1G3S A;  2PMH A;  2VQC A;  4PCQ A;  2A5Y B;  2M8E A;  5JR3 A;  1W1W E;  3FXQ A;  5HVQ C;  3E6B A;  3BQZ A;  5KAI C;  2ID6 A;  1UG0 A;  2V6C A;  2IVM A;  2MG4 A;  4DGW B;  4AVP A;  3NAU A;  4XLC A;  4YG2 F;  4MQ9 F;  2ZME B;  4XRM A;  3S3O A;  4A93 J;  3OIQ A;  4M72 A;  4UXN A;  1JW0 A;  3R6S A;  2FJ1 A;  1UHW A;  3I4P A;  2EBI A;  1JUS A;  3CD6 I;  2QUF A;  3K7A J;  3BPV A;  3Q9V A;  2XHK A;  3GF2 A;  5IYD J;  2M7B A;  1WI9 A;  4XLF A;  2XRN A;  1HXD A;  1WJA A;  5IT9 Z;  1VQ9 I;  2W7N A;  2E5Z A;  2Y30 A;  3KCC A;  3OWT A;  1U3E M;  2GOX B;  2L7Z A;  2EZK A;  2BXY A;  2OTJ I;  1ZRC A;  1BA5 A;  4GYI A;  5LGU A;  4EGY A;  1SD7 A;  2EFQ A;  4NBQ A;  3CQZ J;  4WXD A;  3FX3 A;  2ZFW A;  2WC2 A;  5JFR A;  1WFX A;  4M6Y A;  3A01 A;  3TO6 A;  1UST A;  2OQR A;  2QBY B;  4GO1 A;  1TTY A;  3M8J A;  2V9P A;  5LEK A;  3L2U A;  1FJL A;  3JAM K;  4I02 A;  2LP0 A;  3A1Y A;  5FKN A;  1OR7 C;  1LKX A;  1USS A;  5IOZ A;  3QPS A;  2DFI A;  2VAS A;  3VYU B;  1P4A A;  4HQE A;  2KIM A;  4DYQ A;  5ED4 A;  4D1Q A;  3WOD F;  4NHJ A;  3IL2 A;  1T08 B;  1P4W A;  1P92 A;  2B0L A;  3K4C A;  2OC6 A;  2XAG A;  5FGM A;  1NTC A;  1ACI A;  4PJ0 C;  4OAY A;  3RCO A;  2VLA A;  4BKX A;  4BNC A;  2QLZ A;  3BR0 A;  3QQA A;  3IWZ A;  4LJZ F;  1IUY A;  1MMA A;  3OMY A;  3OYD A;  2R5Y A;  1DP7 P;  3H3V K;  1MJB A;  4RGX A;  2WY7 Q;  1EV7 A;  1FXV A;  2OTL I;  3ZQ7 A;  2GM4 A;  2O9L A;  4A3C J;  3IAM 2;  1S6L A;  4PJJ A;  1GHC A;  2JSC A;  2PJP A;  3ZQQ A;  5DCF A;  2AHQ A;  3EUK L;  3TP3 A;  1S9H A;  1VQ5 I;  2L7K A;  2ETH A;  3BLY A;  5FLV A;  3GW2 A;  1D1B A;  3CCL I;  2OU2 A;  3HSR A;  4FQG A;  1J2X A;  2E1N A;  2IGM A;  1XN7 A;  2JA7 J;  2CQQ A;  1X4P A;  4A3F J;  1IGN A;  1XSX A;  3DV8 A;  3HGY A;  3G1M A;  1XS9 A;  3ML0 A;  4EV0 A;  1A04 A;  3ZCO A;  1XGO A;  3BP8 A;  2BVL A;  3F72 A;  1U5T C;  4B4C A;  4YIF A;  4EEF G;  4ZJZ A;  2PN6 A;  1F43 A;  3Q9S A;  4XK4 A;  3JRC A;  2BW3 B;  1FTT A;  1OQY A;  3SYT A;  2M7A A;  3FK7 A;  5LBQ A;  3HUG B;  1MBJ A;  3I58 A;  5B1B H;  4DIQ A;  5J1R A;  4MEX F;  3IH3 A;  4IRH A;  3TL4 X;  1JJ6 C;  2F5C A;  1X2M A;  3W6J B;  5EGO B;  4ENN A;  1MDM A;  4ZTF A;  1RPW A;  1I3A A;  4LIV A;  4AYB A;  4L18 B;  2W25 A;  3OV8 A;  4B44 A;  3FM3 A;  3HSF A;  3QPL A;  5IPA A;  1WCM J;  2E1M B;  1FY7 A;  4KA4 A;  2P5L C;  3OYN A;  1FBS A;  3BTI A;  1FSE A;  3HM5 A;  1YHQ I;  1Y39 A;  4QPO A;  3HXL A;  2MA3 A;  2LF7 A;  4TV7 A;  2O6G E;  2JVG A;  1I50 J;  3SJM A;  4G94 A;  2VL8 A;  4NC7 A;  4AIK A;  5HLT A;  2BOL A;  2DOD A;  3OS1 A;  4U7B A;  1AOY A;  4NUB A;  3WE2 A;  2HVR A;  3QP6 A;  4HYE A;  2AS5 F;  1ZR2 A;  1ERD A;  3GXO A;  4I98 B;  1SFE A;  5CQG A;  1HLV A;  2PJR B;  4E4H A;  3ZGK A;  4IKF A;  4OIO F;  2ICW G;  1V4R A;  4BE1 A;  2JK3 A;  5EZH A;  2ZME C;  2LFB A;  3F9K A;  3ZR8 X;  4F52 A;  1PDN C;  2KLO A;  3J7A Y;  4JX6 A;  2HOE A;  4Z2Y A;  4JK1 X;  1IXR C;  3BWG A;  4B43 A;  1U5T A;  2BE5 F;  4LLL A;  2VQL A;  2QM3 A;  1FXH A;  2YR2 A;  2FQ4 A;  1R00 A;  2QQ8 A;  3Q3S A;  4B09 A;  2D1V A;  2K9L A;  5F04 A;  4HQM A;  1AHD P;  4E6K G;  3G4S I;  3DPU A;  1QZE A;  4ZC3 A;  4AYB N;  4G6T B;  3KPH A;  1VQ6 I;  3ULQ B;  3RPU D;  2CQX A;  3QU6 A;  2CQ7 A;  1BI0 A;  4UVB A;  2F5D A;  2QQA A;  3A0B C;  1ULY A;  1JVZ A;  1WSU A;  3H1C A;  5EYR A;  3VFZ A;  1Y8Q B;  2XGC A;  4KMU X;  3GWZ A;  2V79 A;  3CO6 C;  1JT6 A;  2IA1 A;  4WXC A;  4LLG F;  4WKS A;  3OYC A;  3GTL J;  2Y75 A;  4HDV A;  4XOP A;  3M9A A;  3DKX A;  3S14 J;  1GV5 A;  3CP2 A;  3EQL F;  2KDO A;  3I53 A;  2E1C A;  2R7X A;  3EUH C;  2NVQ J;  1KEC A;  3JTQ A;  1IV6 A;  3PO2 J;  2EIL H;  2K86 A;  1LEA A;  3BG7 A;  4PEL A;  1G3W A;  5F27 A;  4UUV A;  5JVG F;  4UY8 I;  1RC9 A;  1W7P D;  2JUG A;  2L9R A;  1I5Z A;  4LG0 B;  2Z3Y A;  1GXQ A;  4CYC A;  2HGC A;  4W1U A;  2XV4 S;  5K7F A;  3SZP A;  1QVU A;  4A6D A;  4ZDO A;  4IHY A;  1N25 A;  2LBF B;  1K6O A;  1LQ1 A;  1MMS A;  1YOV B;  3GX4 X;  5LEJ A;  1MKM A;  1ETV A;  4IHX A;  1EJ9 A;  1HST A;  3HRT A;  4XKW A;  1MSF C;  1A35 A;  1XB4 A;  2XRL A;  2Q8K A;  3VSK A;  2A5W A;  4G7O F;  1OMI A;  1OIS A;  4HF2 A;  4MTD A;  1SVL A;  3LQR A;  2JMW A;  3DPL C;  2UZK A;  2KHM A;  3FBI B;  4Q5S F;  1NG7 A;  5BS6 A;  3WGH A;  5HOD A;  4EM2 A;  1K61 A;  1R9T J;  1X1P A;  1LB2 A;  1D0Z A;  3W2A A;  1PNK A;  1Z6T A;  1VFC A;  4BEH B;  2FX0 A;  2GXA A;  3MMY B;  4HEA 2;  4MFE A;  3P7N A;  2DA2 A;  4N4O B;  2KRH A;  4RGS A;  4BBR J;  4JX4 A;  4XQF A;  4QTR A;  1SAN A;  2DI3 A;  1POG A;  3CZ6 A;  2ZBK A;  1KGS A;  1ZRF A;  4A3D J;  2VKH A;  2AE4 A;  2RRE A;  1YTY A;  1TWH J;  4A3M J;  1ZEL A;  3S8P A;  5GTH C;  4UV9 A;  1ZGW A;  5K5R A;  2K9S A;  4HNU A;  1T56 A;  2FNA A;  5ILU A;  2G0E A;  2PI0 A;  3KLN A;  3I59 A;  4RMN A;  4BAC A;  1L0O C;  2LSO A;  3QYF A;  2M2E A;  2DTZ A;  3BR5 A;  5EEH A;  3RTR A;  1AKH B;  1IRF A;  4CCO A;  4IRI A;  1ONV A;  3F21 A;  1YW9 A;  1TWF J;  2Y31 A;  1RET A;  3K4N A;  2HOS A;  3TGN A;  3PUF A;  3RSN A;  1CP9 A;  3E0J B;  2LY2 A;  4XID A;  4XKV A;  2Z5U A;  2MC4 A;  2RGV A;  4HNT A;  1LUJ B;  2XRO A;  2R7T A;  3RPQ A;  5FRM A;  4E7I A;  2HEO A;  3OIP A;  3KP2 A;  2GA2 A;  4RA2 A;  1YI2 I;  3ZMS A;  1N78 A;  3LSJ A;  3K2Z A;  2MSY A;  3RYR A;  3F22 A;  1CQT A;  4HLY A;  3LWF A;  2VIX A;  3DQV C;  4PFP A;  4XOR A;  2NRA C;  3V8L A;  2E1M C;  4BU2 A;  4DJA A;  1SD5 A;  2X6X A;  1YIJ I;  3E5U A;  4K2F A;  1TZL A;  2W1O A;  4Q4Z F;  3ZXS A;  2EIM H;  1Y8R B;  3M8E A;  4HW0 A;  4BJT A;  2AE3 A;  1IXC A;  4CZC A;  3DU6 A;  1G3T A;  2K40 A;  2E71 A;  2ISY A;  5CVU A;  1MD0 A;  1OKR A;  4CXF A;  2QF7 A;  1Z91 A;  2M0C A;  4ZYG A;  3E7L A;  3RIR A;  3BR3 A;  2O7O A;  2KJB A;  2M8G X;  3ASO H;  3KET A;  3FBN B;  3J81 K;  3JRB A;  2CO5 A;  4FIS A;  3S3N A;  4E56 A;  2DMQ A;  2R7F A;  2LNB A;  1JHH A;  2FRH A;  2X85 A;  3KP3 A;  1PJR A;  5K1Y A;  2FEZ A;  4PJL A;  1EA3 A;  3K6G A;  2HYJ A;  4HSR A;  4HV6 A;  4KIC A;  4GGG A;  2P0W A;  2YUS A;  3AG1 H;  2BW3 A;  1XPX A;  1JGG A;  5FKO A;  3BJA A;  1Y0N A;  2ESH A;  2G7H A;  3SZG A;  2XSJ C;  1I27 A;  4ZDL A;  4BE2 A;  3WTT C;  2A6E F;  1ORK A;  4QPQ A;  3N97 A;  3PNV A;  4P9U A;  4XLH A;  4JBA A;  4F7Z A;  3CC7 I;  4BTH A;  3IHU A;  2P6S A;  1FYK A;  3ML6 A;  1YIO A;  2M30 A;  1K6Y A;  3F8N A;  2OJE D;  3IC7 A;  3LFU A;  2DMU A;  2A69 F;  1WKM A;  1ZN2 A;  3CJT B;  2R7O A;  3O3K A;  3QP5 A;  4EJV A;  5M3F J;  3I0T A;  4CCJ A;  2KIS A;  2DU9 A;  1V3F A;  2IW5 A;  1BOA A;  3B73 A;  3GCM A;  2STT A;  1OCR H;  2EFN A;  1GKF A;  1F5T A;  1XMK A;  3LL7 A;  1BC7 C;  2F5V A;  4LD5 A;  5CVI A;  3TMO A;  3ZOB A;  1O4X A;  4E7S A;  2V7F A;  2E2H J;  3CCR I;  4G9Y A;  2K9N A;  3OL4 A;  1VQ4 I;  3HOT A;  4L5I A;  1YO5 C;  2L9N A;  3DBL B;  5E3L A;  3W3C A;  4NNJ A;  3FWE A;  2PJR A;  3NEU A;  1Z67 A;  3C7J A;  2ELJ A;  5H2F C;  3L00 A;  2HZD A;  2OQG A;  2E5N A;  2L4M A;  3JAM Z;  3ZQC A;  1RIO H;  1F36 A;  1MBH A;  3H0G J;  2HFH A;  1LFB A;  2Y0S N;  1HKQ A;  1AJQ A;  2XAS A;  2RNJ A;  5FB2 A;  4BE0 A;  3DEU A;  2IS2 A;  3CTA A;  2BY1 A;  3KZY A;  4CUG A;  3DTI A;  2DA6 A;  1D8K A;  4W97 A;  4XN0 A;  4C3I J;  1ZQ3 P;  5A2Q Z;  1VQ8 I;  1J59 A;  4M6V A;  4PEM A;  3V7S A;  1TP4 A;  5LFA A;  2K85 A;  5DS9 A;  4UV8 A;  3IAS 2;  2JA8 J;  1P6R A;  4IOA F;  4RB1 A;  3BDD A;  4UHT A;  1V55 H;  4MTE A;  1BI1 A;  4XLE A;  4HNV A;  4E55 A;  5F1J A;  1FTZ A;  2F4M B;  1WZ2 A;  2CUE A;  4N4N B;  1VTN C;  1IAW A;  1U9N A;  3W6V A;  3L1P A;  1Y56 A;  2LYC A;  1TNT A;  2VON A;  2VBW A;  2HOA A;  2IPQ X;  4BY1 J;  1SAU A;  4LG0 A;  1J0R A;  3OYG A;  3HTS B;  2JRT A;  4OWR B;  2AXL A;  2VI6 A;  2KJC A;  3REO A;  1K5S A;  4Y33 A;  2R4G A;  4X6A J;  1R5G A;  3TOA A;  4S05 A;  3FMR A;  2MD5 A;  3GFJ A;  4EJW A;  3IH4 A;  1IDY A;  1MH3 A;  3VOE A;  1IF1 A;  5HNF A;  1O3R A;  2W00 A;  4J00 A;  4O3M A;  4IJA A;  3KEO A;  1X1A A;  2JTV A;  1J75 A;  4XBF A;  2EV6 A;  2FA5 A;  2VQG A;  1HKS A;  3HHG A;  3ERM A;  3SZT A;  2MGQ A;  2NOG A;  1F9N A;  3PO3 J;  1FBU A;  1KQ9 A;  1U8R A;  3C2G A;  4IPA A;  4Y17 A;  3G6E I;  3IRQ A;  4M3E A;  1U2W A;  3RKW A;  1HDP A;  2CUZ A;  4CA0 A;  1AU7 A;  4BEH A;  2NS8 A; 
#chains in the Genus database with same CATH homology
 4PJN A;  2VAS A;  3VYU B;  4ANJ A;  2OUM A;  4D1Q A;  3OYE A;  2LY1 A;  2HDW A;  4BXF A;  2X6W A;  2IS1 A;  3HC7 A;  4KIS A;  4KT6 A;  4E7Z A;  3ZRG A;  2FUG 2;  3K4C A;  2A6T A;  2OC6 A;  4XL9 A;  4DBR A;  2CW7 A;  1BR2 A;  4OAY A;  2IGN A;  3RCO A;  2VLA A;  4BQN A;  2R7R A;  3BCA A;  2M3A A;  2K5C A;  1MMA A;  3UR3 C;  3OS0 A;  3OMY A;  4YFB A;  2DT6 A;  3OYD A;  3DU5 A;  4F55 A;  4C30 A;  4J01 A;  2VXZ A;  2WY7 Q;  1FXV A;  2XF7 A;  2CFO A;  3IAM 2;  3VYT B;  4PJJ A;  2KRC A;  4EAT A;  3ZQQ A;  1WJF A;  3HL2 A;  3EUK L;  1U0J A;  1S9H A;  2L7K A;  4II2 A;  4KJZ A;  5LD2 C;  1LFP A;  3BLY A;  2CH0 A;  1FMW A;  1D1B A;  3DLA A;  2X51 A;  2KP6 A;  3PNT A;  3DEE A;  3MKZ A;  1FM2 A;  3K70 D;  1NG6 A;  1MW7 A;  4HRI A;  1H2G A;  2IGM A;  4E7H A;  2CUJ A;  1BOB A;  2PMZ A;  3N05 A;  2M0M A;  2LG4 A;  4WKU A;  1X4P A;  3L2Q A;  3DKY A;  5FRO A;  3SRB A;  3ML0 A;  3OYF A;  4FET A;  2WA0 A;  3ZCO A;  2XF5 A;  4R79 A;  2BVL A;  1GM9 A;  4CCM A;  4ZJZ A;  2QKL B;  3OYB A;  3LSI A;  1WJC A;  3JTR A;  2BW3 B;  2LC2 A;  3SYT A;  2M7A A;  3H5A A;  2LOO A;  1PYV A;  2RNG A;  1MND A;  3HUG B;  1E0E A;  3IUO A;  4XMY A;  4ZYA A;  2DOA A;  3GBG A;  3LSM A;  4DIQ A;  3K3W A;  2XC7 A;  1GK0 A;  1YX5 A;  2V6E A;  5KCM A;  1QHH D;  3PNY A;  2CV0 A;  3TL4 X;  1OR0 A;  3S32 A;  2IS4 A;  1DGW Y;  2WY8 Q;  1X19 A;  4ZTF A;  3H35 A;  4LIV A;  4AYB A;  4B44 A;  2R7W A;  3LSG A;  3HKZ A;  1YX3 A;  2WYB A;  1G8X A;  2Q1Z B;  1TT0 A;  2E1M B;  2IS6 A;  3OR2 C;  2XAU A;  3OYN A;  2MFZ A;  5JHF A;  1WJB A;  4QPO A;  3HXL A;  1GHD A;  1MMG A;  3S93 A;  2WAQ A;  2X1C A;  1X1D A;  4BQQ A;  2JVG A;  2Z2S B;  4JQF A;  2VL8 A;  2WYE A;  3DTK A;  4NC7 A;  5CPR B;  4FAS D;  5HLT A;  2BOL A;  2LBF A;  2LRD A;  3OS1 A;  3CES A;  2JVH A;  3MD2 A;  3HG9 A;  4II3 A;  4U7B A;  3HPH A;  1PNL A;  4F3Q A;  4NUB A;  1P9Q C;  2HVR A;  3PL8 A;  2JSP A;  1ERD A;  4WKV A;  5CQG A;  4IKF A;  3BG6 A;  2PJR B;  4E4H A;  4Y3O A;  3ZGK A;  3L2V A;  4BE1 A;  3F9K A;  3ZR8 X;  4F52 A;  2KLO A;  1MNE A;  1QHG A;  3J7A Y;  3OYH A;  2V1N A;  4B43 A;  4E7L A;  4DBQ A;  2VQL A;  1FXH A;  4F92 B;  2K3P A;  4YFA A;  2K9L A;  2JA2 A;  4E6K G;  2VJJ A;  3DPU A;  4ZC3 A;  4G6T B;  1W36 C;  3RPU D;  3IP4 B;  3V42 A;  3OY9 A;  3H5R A;  1JVZ A;  2M4K A;  3K4L A;  1R6R A;  4Y4R A;  2VJ4 A;  3S3M A;  3W2V A;  3EUA A;  4KIT B;  3OYA A;  4WKS A;  3OYC A;  2LRE A;  4XOP A;  1UEL B;  3DKX A;  4E7J A;  1Y6I A;  3CP2 A;  2KDO A;  2R7X A;  3EUH C;  1KEC A;  3JTQ A;  3K4B A;  1N75 A;  3BG7 A;  4PEL A;  2HVS A;  4PSX A;  3K4K A;  2JUG A;  4BL0 B;  3U21 A;  3VYS B;  2ZXH A;  4BJ5 C;  2Y0S A;  4ZDO A;  4XM3 A;  1V5G A;  2LBF B;  4YF9 A;  5FRN A;  1BR1 A;  2WAD A;  2VJ5 A;  1Z7L A;  4LIT A;  3QYE A;  4XKW A;  3A4C A;  4YRV A;  2ZSI B;  3VSK A;  2A5W A;  2R7V A;  4HG2 A;  4LIU A;  2W82 A;  3PSF A;  1GM7 A;  2VQH A;  4XNF A;  4PUS A;  3OR1 C;  4P1W A;  4E7K A;  3DPL C;  2QKM B;  2UUZ A;  3H5N A;  1UAA A;  1T95 A;  2KHM A;  3I9V 2;  2Q2E B;  3FBI B;  3OL3 A;  3DWL E;  1NG7 A;  3L91 A;  4JOM A;  3PSI A;  2F4I A;  4D9J A;  3FKJ A;  1D0Z A;  3SRC A;  3W2A A;  2VPL A;  1PNK A;  3OYJ A;  4BEH B;  3SEQ A;  3MMY B;  4HEA 2;  4N4O B;  3CF2 A;  1GLN A;  2KRH A;  4F93 B;  1MMN A;  1Z3Y A;  4XQF A;  1N77 A;  3CZ6 A;  2VKH A;  2AE4 A;  2BVM A;  2RRE A;  3DPT A;  3I3L A;  2W4S A;  1G59 A;  1ZEL A;  1OLT A;  3S8P A;  3QOD A;  2KMU A;  1D0X A;  3D5S C;  1FMV A;  4HNU A;  2WAE A;  4RMN A;  4BAC A;  4IQ4 A;  3QYF A;  1DQU A;  3AL0 B;  3RTR A;  4ZDP A;  1DGR M;  3EPZ A;  4CCO A;  1J09 A;  1AJP A;  3RQ4 A;  2MD0 A;  2ADV A;  2CS3 A;  3QOE A;  3D5R C;  2HPI A;  4BS9 A;  3K4N A;  3MKY B;  1AJN A;  3SRA A;  3RSN A;  1CP9 A;  3E0J B;  2L2O A;  2LY2 A;  4XKV A;  2MC4 A;  4HNT A;  4YEL A;  4YEJ A;  2ZSH B;  2NOJ B;  3HPG A;  2R7T A;  5FRM A;  4E7I A;  3OIP A;  4CCN A;  2DXI A;  1KEH A;  2LH9 A;  2AQF A;  2V26 A;  2Z16 A;  4DOZ A;  1N78 A;  1V5E A;  1GK1 A;  2CV2 A;  1GM8 A;  4BQO A;  3BCB A;  3LMM A;  2VIX A;  3DQV C;  3AL0 C;  3PFY A;  4PFP A;  4XOR A;  1T0F C;  2E1M C;  2WYD A;  4XLA A;  4BU2 A;  4DJA A;  2MYS A;  4ITV A;  4PSW A;  2ZXI A;  3OYM A;  2X6X A;  4LG3 A;  2L9S A;  2IGO A;  2VJI A;  2WB1 A;  4K2F A;  1TZL A;  2W1O A;  3ZXS A;  4BJT A;  2V4J C;  2VKD A;  2AE3 A;  4CZC A;  3LSK A;  3DU6 A;  2MAB A;  2DT7 B;  3H9Q A;  2KPM A;  2GOM A;  1BR4 A;  1AI4 A;  3SDB A;  3D5L A;  3CMM A;  3FBN B;  3TBI A;  1X4O A;  3CP8 A;  2X1D A;  2DCE A;  2O5R A;  4K2G A;  4PFO A;  4X0G A;  3S3N A;  4E56 A;  3HOS A;  3NWS A;  4C2T A;  4XOT A;  2X85 A;  2HNH A;  1E3A A;  5TGT A;  1PJR A;  1KON A;  1AA7 A;  4XON A;  1D0Y A;  4PJL A;  5KNL A;  1EA3 A;  3K6G A;  4CCL A;  2OV7 A;  4HSR A;  2HVQ A;  3KYL A;  4B47 A;  2P0W A;  2K9M A;  2BW3 A;  2X1E A;  2IGK A;  5CQE A;  3OOU A;  1W36 D;  2X6Y A;  3M1C A;  2M4G A;  1D1A A;  3SZG A;  2XSJ C;  4ZDL A;  4BE2 A;  3W2W A;  3L94 A;  2F6C A;  4QPQ A;  3PNV A;  3K4M A;  5HOO A;  4XLH A;  3DTE A;  3H9G A;  4BTH A;  2XF6 A;  4P5O A;  2XDV A;  3BC8 A;  3S8R A;  4RLQ A;  4ZTJ A;  2HPM A;  1K6Y A;  4OAZ A;  5KHD A;  3OS2 A;  1Z3X A;  2RQQ A;  3LFU A;  4HPQ A;  3MKW B;  1X1C A;  2R7O A;  3K70 C;  4GRI A;  4CCJ A;  1AI6 A;  1MMD A;  2WBM A;  1LVK A;  4MLO A;  4HST A;  4U87 A;  3SEZ A;  5HNH A;  2HQA A;  1K7D A;  1HA8 A;  3H0D A;  4IX7 A;  1X1B A;  4BDY A;  4XR6 A;  1GKF A;  3VSL A;  5CKT A;  3LL7 A;  4CH7 A;  2F5V A;  2R7Q A;  4B48 A;  3TMO A;  3QYB A;  3E1S A;  1AI5 A;  4E7S A;  2V7F A;  1JX9 A;  3ONQ A;  2V9K A;  4B3X A;  4NQW B;  3OL4 A;  1D1C A;  2CMP A;  3HOT A;  1QU3 A;  3K10 A;  2L9N A;  4M1J A;  3H9J A;  2UV1 A;  2UWM A;  3AKZ A;  1AI7 A;  3W3C A;  4NNJ A;  2PJR A;  4WKT A;  4PK4 A;  4XKB A;  1DP3 A;  2ELJ A;  3CJR B;  3KX2 A;  2HZD A;  2E5N A;  2KQR A;  4AVZ A;  3KEY A;  3G2B A;  3VWB A;  3OYL A;  4F91 B;  2AE5 A;  2R7S A;  1AJQ A;  4C9Y A;  4BE0 A;  3L2R A;  2IS2 A;  3LSH A;  4RM2 A;  4IZZ A;  4BUP A;  1IRX A;  3UNG C;  1WJ5 A;  2HU9 A;  4CUG A;  3L2W A;  3DTI A;  4XN0 A;  4BGD A;  4IQJ A;  1JI8 A;  3CJQ B;  4PEM A;  1WJE A;  4H4K C;  5LFA A;  2KL4 A;  1YE9 A;  2VQC A;  3VDX A;  3IAS 2;  4XN3 A;  1LDK B;  5HVQ C;  3PJR A;  4RM3 A;  1UG0 A;  1WJD A;  4C2U A;  3C2H A;  1Z21 A;  4XLE A;  2KZV A;  3PUB A;  4BJ6 C;  4DGW B;  4XLC A;  2R7U A;  4E55 A;  4N4N B;  2WAF A;  3AFH A;  2E60 A;  3S3O A;  1VZ0 A;  1Y56 A;  3OIQ A;  2LYC A;  1GK9 A;  2VXD A;  2L5Q A;  1JW0 A;  4CCK A;  1SAU A;  1V5F A;  3FHN A;  2I8D A;  4AU7 A;  3NWT A;  3OYG A;  4PJM A;  4OWR B;  1K5Q A;  1K5S A;  2WYC A;  4Y33 A;  2M7B A;  2R4G A;  4XLF A;  4BDZ A;  3A2K A;  1WJA A;  3FDY A;  4RLF A;  2CW8 A;  2W7N A;  2E5Z A;  3VYR B;  3OWT A;  2CV1 A;  5HNF A;  2GOX B;  2W00 A;  2IXS A;  4J00 A;  1X1A A;  2VQG A;  3OYI A;  2ZFU A;  1PNM A;  4E57 A;  1SFK A;  1WFX A;  3C2G A;  2VB6 A;  4NC8 A;  3M8J A;  2DJI A;  3L2U A;  3OYK A;  3K4J A;  2Z1D A;  2AQE A;  2CUZ A;  4XKC A;  4CA0 A;  4BEH A;  4CSW A;  3A1Y A;  1OR7 C;  1LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...