4HSRA

Crystal structure of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hsrA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hsrA01
4WKTA 1AI4A 2WYBA 1GHDA 1FM2A 1K7DA 2ADVA 4K2FA 4E57A 4YFAA 2WYCA 1AI5A 4HSRA 4HSTA 1GKFA 1GK1A 4YFBA 4BTHA 1GK9A 2AE4A 1JW0A 4E55A 3L91A 3L94A 1AJQA 1AI7A 2AE5A 1FXHA 4K2GA 4PELA 1H2GA 4M1JA 4YF9A 1PNLA 1CP9A 1JVZA 1KEHA 4E56A 1GM7A 3SRCA 3JTQA 1OR0A 1AJPA 4WKVA 1PNMA 1K5SA 3JTRA 3K3WA 4PEMA 4WKSA 2WYEA 3S8RA 2AE3A 3ML0A 1JX9A 1GM8A 1FXVA 1AI6A 1AJNA 3SRBA 4WKUA 1KECA 1K5QA 1GK0A 1E3AA 1GM9A 3SRAA 2WYDA 1PNKA
chains in the Genus database with same CATH superfamily
3LSGA 4JP0A 2EZKA 2E1NA 3QPHA 5GAHJ 3CESA 1WJBA 4F3QA 4D1QA 2Y0MA 2HQ5A 4EMSA 2XRLA 5IYBJ 2M7AA 3G71I 3VYUB 4J19A 2JSPA 3S17J 4QTRA 3C3WA 4WX9A 1MBEA 2VKVA 4DBRA 1F9NA 3FDYA 4YF9A 2UXNA 3BZ6A 1JGSA 5D5XB 2IJLA 3CC4I 1X3WB 2LKPA 3BT9A 3HGGA 3LSJA 3R0AA 2M0MA 2WYEA 1IJWC 3DEEA 2MSYA 4KIFA 4Y13A 2DPDA 1HKTA 1P4WA 4IO9F 3H9GA 2HFHA 3CCEI 1IZ1A 3BOQA 2R7ZJ 4MTDA 4M9SA 4YEJA 4B1RA 3E7LA 3ZN0A 3K4BA 3V7SA 2JJ7A 3RPQA 5M5WJ 3NAUA 4JX5A 4YIIA 2LBFA 2OUMA 4AIHA 1U9NA 3K10A 3R6SA 2Z3YA 4NQWB 4XM3A 1VQPI 1X2NA 4KMUX 2VLAA 1R9TJ 2AQEA 4B09A 2YPRA 3HTSB 1MNMC 4ASNA 5K7HA 1S8NA 1TC3C 1KECA 1MW7A 2CH0A 4V19K 4AVPA 5EEHA 2GWRA 2QQ8A 1LKXA 2LF7A 4II3A 1U2WA 5HS7A 2LP0A 3I59A 2G7HA 3GLXA 1FTTA 5K1YA 1VQ8I 3H35A 3PFIA 2MH9A 2OCCH 5L3GA 3U1KA 3HL2A 2FBHA 1U5TA 2XSDC 5J1UA 2X9DA 1LNWA 3OYHA 1SC7A 3S16J 2ZSHB 4I0BA 4CUGA 3GFJA 1W7PB 3J7AO 4WKVA 3IV5A 4CO8A 2IT0A 2L9NA 4MIMA 5GPCA 1P2FA 2ECBA 5F1JA 1Y39A 4XSXF 4WXHA 3HJEA 5C4JJ 4JOMA 4HRIA 2LD5A 1XDSA 2V1UA 2QGUA 4XR6A 2WYCA 1HKQA 2HR3A 1XS9A 1SD5A 3RCOA 1JKOC 3VYSB 2WTEA 1TTYA 2WV1A 5F6FA 1W5SA 4ENNA 2AO9A 4PJLA 4CCOA 3ROUA 4MGRA 2L3DA 5EF6A 4HPQA 3DFGA 5F0HA 1QGPA 4P9FA 3ECHA 1B4AA 3DTKA 4HEA2 4ABZA 1W5CC 2BXZA 4Y17A 1TQMA 3JRBA 2PBIA 4GYGA 3M1CA 1O3TA 1MDMA 3DEWA 3L2VA 4I02A 4Q5SF 2JSCA 5DD8A 2A6EF 4NQWA 4ZJZA 2MYSA 1NHAA 2ZBKA 4FX4A 5AONA 4C30A 3I9V2 3HOTA 2O8XA 3OYGA 1XCBA 1FOKA 2IGNA 1IC8A 1XGOA 1S7EA 1IGNA 3RKYA 1FSHA 1A6IA 2E71A 3SFIA 2HKXA 2ZCWA 3NEUA 3U2RA 2EINH 5JLXA 3RKWA 2XVCA 4C3IJ 3F6OA 1T98A 1X3ZB 3G6EI 3QOPA 1UHSA 4RGRA 2WAQA 4PGGA 3ZCOA 1EH8A 1ERDA 3LQQA 1PNKA 3LMMA 2GXGA 3JAMK 2CUJA 4XRSG 4HSTA 3PL8A 1OPCA 5JLWA 2Y69H 4ZZDA 2STWA 4PJ0C 3GCMA 2JWTA 3BG9A 2V9PA 2EV0A 2L7ZA 3Q5FA 3U21A 3BTCA 2A6HF 3KP6A 5K7ZA 1PDNC 3MKYB 1J7KA 3CCLI 3M4OJ 1R1VA 3S2WA 3TBIA 2W85A 1FMVA 2DQRA 3BQZA 4EM0B 2ELKA 5BNGA 4UXNA 4BQQA 1YLFA 1WH7A 1GV5A 2EFPA 2KKOA 4XN0A 3ZN1A 5KAFC 5CLSA 2MC4A 5EEAA 1YRNA 2Y2ZA 5LHIA 3OYAA 1W36D 5ILVA 3K0LA 1RETA 3L00A 2DK8A 2NS7A 2NS0A 4AVZA 1R23A 1R36A 1WFXA 2DODA 1DPUA 5LGNA 3KP3A 4RLQA 3NWSA 2F5EA 5C44J 1P4AA 2PN6A 3DPTA 3DPLC 2VBXA 4XN3A 4EV0A 1Y8QB 2LFBA 2K86A 5ICEA 3J81K 3ZP5A 3JRAA 3NARA 1SVOA 3C2BA 3E6BA 4M3FA 3S1MJ 2IPQX 2LRDA 1ZG3A 2NNNA 2EFQA 2IGMA 4XIDA 2P5LC 2L9SA 5FD6A 3F22A 3SHFA 5AIQA 4IOCF 4G6TB 3F21A 1ZGAA 3ZMZA 2RVCA 5JVGF 2Q2EA 1M1EB 4UNOA 3CUQA 4BS9A 2FQ4A 3PO3J 4RAYA 1BA5A 4L9JA 3CQZJ 2A69F 2D5VA 4LG0A 4YFKF 1CF7B 1WPKA 4KJZA 2MG4A 2O8KA 2BW3B 4FTHA 5DV5A 5B66C 1EKEA 3EYIA 2R7FA 4K2EA 1RKWA 4CCKA 3FISA 1O3RA 3A0HC 5FFZA 1SFEA 1K4SA 3T5XA 4M72A 4RBOA 2HKOA 5GTIC 1Y6IA 2X85A 4BH9A 2NVYJ 3LSTA 3JCUC 1JHFA 2OD5A 3FWEA 3WODF 4G6QA 4DYCA 2P7VB 1JUPA 4NC8A 3J7YJ 3I4MJ 1RZ4A 2DFEA 3H0GJ 1VQOI 1ZR4A 3MN2A 2V79A 2XAJA 2H8WA 2ZMEA 5A2QZ 4J00A 3BCAA 4XLHA 1BBYA 3KP2A 3QAHA 1DUXC 5FO5A 1F1ZA 2E35A 4HZFA 2JA2A 3DKWA 3FKJA 2A05A 1JKPC 3TW6A 2E7WA 1A35A 4X1EA 2K9QA 2KJBA 1JE8A 4WXDA 2NNYA 1ZG1A 1IAWA 1KQ9A 4MO7A 1UHWA 4I09A 2JZYA 4PJMA 1RKTA 5J8CA 2X4HA 2ICWG 2F4IA 2CMPA 3TO9A 1T08B 2XAGA 3RZOJ 4UHTA 3QYFA 3VYTB 2XV4S 1SANA 2EBIA 3N4MA 1G8XA 3CP2A 2V6CA 5BPDA 2K7LA 3F8CA 2LY2A 3QOEA 4Y15A 1IN5A 3N97A 4LIUA 1JUMA 3GMEA 3NRVA 3WTTC 5TISC 3HOZJ 3PSIA 2VQGA 3EUAA 3KP7A 5EGOA 4L18B 4V2FA 3HSRA 4XONA 1BN5A 4R8HA 1JGGA 2X6WA 1BI2A 2LG4A 2XGDA 1L3LA 2M1BA 2BW3A 4IKFA 4P5OA 1D1CA 3AL0C 1AU7A 3SFZA 1U9OA 3HDDA 4F52A 2QLZA 5FJ8J 2CV0A 4E57A 2R93J 4BNCA 2EA2A 4A12A 3HOSA 3A02A 5DM6F 3FXQA 1IXRC 1S72I 5DCFA 2Z16A 5ILUA 1HDPA 1V54H 2VKDA 3JSOA 2JK3A 1UJ8A 2ECCA 3TMOA 5EG0B 1I39A 4UUSA 1XMAA 4DQ2A 2DMTA 1HCRA 2OV7A 1FXVA 2JUGA 2FD5A 5B3SH 1KA8A 4IL6C 2E2JJ 4E4HA 4CICA 5HDNA 4IHSA 4A0ZA 1GHDA 4KDPA 3LAJA 1FSEA 2KZVA 4E7ZA 5FKLA 1V55H 5ERIA 4EM1A 1GDTA 1B8IB 1YX3A 3I58A 1W4MA 3PUFA 1WJAA 5F08A 2BHYA 2P8TA 3IC7A 3MCZA 3BG3A 3ZQ7A 2AS5F 1R4NB 2IGKA 5HVQC 1XMKA 1X19A 3M07A 4EEFG 2HI3A 2O7OA 1SEUA 1FY7A 1USTA 2NVXJ 2NVTJ 4LIVA 1WI9A 5E1WA 5LEKA 3BP8A 3L2QA 1ITYA 3T8TA 2DBBA 2OTJI 3M3YJ 4WCGA 3QPLA 4E55A 3DV8A 3GTKJ 3L94A 3HHHA 2K5CA 4YELA 1Z91A 2CYYA 1DQUA 1T56A 1ZK8A 3F8BA 1SVMA 2BOLA 4U88A 2PJRB 2FOKA 3VDXA 4DBQA 2DQLA 4O5VA 1RESA 2QUFA 2AQFA 3B73A 3DPUA 1EF4A 1FYLA 2HTSA 2RV8A 1HW2A 2XSJC 3ML0A 2IS4A 2CQQA 2XF6A 4G12A 1BJAA 2MD0A 4YFXF 3L2UA 3QPTA 1QPMA 3RYPA 5E3NA 4I6ZA 1WCMJ 3CCRI 1B59A 2VQLA 5DCMB 1SAXA 5AIPA 4XOPA 5LD2C 4BHCA 2A5YB 1XMXA 2DOEA 5FLXK 4HF1A 2TCTA 2DA2A 1OCOH 2YU3A 1H89C 5FLVA 1HDDC 1ZLJA 3CC2I 1LFPA 1ETOA 2BHZA 4A3CJ 4BQOA 2ZNZA 3HYIA 5KK1A 3BR3A 5TGTA 2FOWA 4OAZA 5FGMA 1WHUA 3MWMA 4HDVA 2RNGA 4L9TA 3GYHX 3IUOA 5L3CA 2M5WA 2ZXHA 4XOTA 2KMUA 4A6EA 4EGYA 3GTPJ 1A5JA 3BR2A 2DLLA 1IXSB 2DI3A 4NB5A 1XSXA 1KU7A 2GOXB 2Q1ZB 3CCJI 3MZ8A 3SEQA 2K4JA 5D5UB 4IX7A 1OISA 5E79C 1P92A 1WKMA 4LOCA 3OOUA 1KZHA 1MBGA 3BZKA 5IP9J 2KIQA 2NRAC 4F7ZA 3VEPA 5FLMJ 4RB1A 3RPUA 1YO5C 4DJAA 1MSFC 4OAYA 2Y9ZA 1GLNA 2VB6A 5IT3A 4ESJA 2IXSA 3VSKA 6PAXA 1D8JA 1QRYA 2J5OA 2R7DA 1H9TA 1JJ6C 4CYCA 2A6TA 1R5HA 1RC9A 3LOCA 2WA0A 3FK7A 1KU3A 5CVUA 3DQVC 4A69C 1T6SA 4OMZA 1O4XA 5JHUA 3WTWC 3CP8A 2J5PA 1VQ7I 4HOBA 1LE8B 3L9FA 5F1RA 3QPSA 2HOAA 1REPC 1R71A 4LFUA 3KE2A 3I56I 3CLOA 1OFCX 1N25A 4AM3A 3SRBA 1XX5A 4EVIA 3IRRA 3CMEI 3AG2H 4PK4A 4XNFA 1JUSA 4XRMA 4PELA 1DGWY 2CUZA 4LD5A 2JA7J 5J3LA 2K9LA 2K9NA 1K7AA 4HQMA 2YU9J 4F92B 4ZYAA 3JRIA 1XC5A 4ETSA 2BY0A 3AAFA 3ZMDA 3HSFA 3M9AA 1X2MA 4Q47A 4RGSA 3ZXSA 3TDUC 5E20A 4V2GA 2WC2A 2P0WA 4Y7NJ 1TWGJ 2BGCA 1HSJA 1Z21A 2WADA 2R7UA 3O6BB 3CJQB 4DGWB 2PLYA 3TOAA 2W00A 4BU2A 1PYVA 4M74A 1BR1A 4GXOA 3OYCA 4A3FJ 1IRZA 4AUXA 4LLLA 5JFRA 2PQ8A 1R1UA 1BM9A 3FBIB 1GVDA 3I3LA 3CCQI 1Z1DA 1G59A 3V4GA 3QQAA 2V7FA 2DPUA 3I5UA 4BKXA 2GXAA 3ZPLA 3MFKA 2P5VA 1W7PD 4M1JA 4Z2YA 1LPQA 3IAS2 2ID3A 1K6OA 4S04A 4FE7A 4N4NB 2V6EA 4MHGA 1HF0A 4RMNA 3F3XA 2FF4A 1IN6A 5M3MJ 4A5MA 4FCYA 3WU0A 1X1BA 2GLOA 1SMYF 3TOBA 2XRNA 4B4CA 4XKWA 2QA4I 3LFUA 1ETXA 3R61A 1LE8A 3CJTB 4A3KJ 4N0BA 1TWAJ 3FHNA 3KCCA 3MEXA 2XAQA 2NS8A 4L9VA 1PUFB 2OJED 3K4KA 2YX7A 1Z77A 5EZHA 1NG6A 5HS9A 3OYMA 2PMZN 4TV7A 1V4RA 1CP9A 2LSOA 4RB2C 5J4VA 4H0EA 3Q0VA 1S3JA 2EK5A 1P7IA 2BVMA 1W5TA 3MD2A 2UUZA 2V26A 1P7JA 4XK4A 3CJNA 3EPZA 2CSOA 4N4OB 4D9JA 2LNBA 5CJ9A 3SZPA 4CZZA 3GTLJ 1AI4A 5DUKA 2H8RA 3FXJA 1IN7A 3OV8A 4ZDLA 1TLHB 3MZYA 1U6GA 1OMIA 3LNQA 3F23A 4A93J 1MBKA 1S7OA 3ZQIA 5IY5H 2Z9OA 4C2TA 4IF4A 1UG2A 1TQIA 3SZGA 3FBNB 5LGUA 2M34A 3FMSA 2NVQJ 1YOVB 5LLQA 4A3BJ 5J4YA 1W1WE 1MIJA 3V8JA 1HOMA 1BC8C 3CMMA 4P96A 1S7AA 1AWCA 2VUMJ 1EH7A 1HQCA 4AIKA 4U0WA 2O0YA 4EJOA 2GAUA 2OCEA 1E0EA 2EIJH 2LBFB 4D5CA 2R7SA 2E1OA 2EV5A 3TO7A 1XSVA 2ZC2A 3CO7C 4RAZA 1HW5A 3HKZN 1BJZA 1XD7A 1JVZA 3ASOH 2KZGA 5L3EA 3S1RJ 1AOYA 3I59B 3BR1A 2LREA 2ADUA 4M6XA 1JJ8C 1B9NA 4GYIA 2ZJQF 1SFXA 1IF1A 2MFZA 4RA2A 3MKWB 1E17A 3WTSC 4KN4X 1U5TB 2D1VA 4S0HB 3OYKA 2L9RA 4UY8I 3TP3A 2DT7B 1I27A 1SFKA 2AHQA 4HX4A 5M5YJ 2KRHA 4B3XA 1GK9A 4EJTA 1ZGJA 1RIOH 2HOSA 1LDKB 3OWTA 4AYBN 1HW1A 2XIGA 1LJ9A 2FQ3A 2XHKA 4B43A 5FKKA 3G1LA 4CCMA 3PSFA 1V5FA 3EQLF 1WJDA 4FX0A 1XG1A 3KZZA 3DKYA 2QYOA 3GUDA 1WVRA 4Y52J 2OQRA 2MA3A 3K1MA 3BTJA 4I01A 2KL4A 1Z67A 2EH3A 3I64A 2HXIA 4HSRA 3VFZA 5LHHA 1P9QC 5E3LA 2JRTA 3V7RA 3L91A 1X1PA 3S93A 4A3EJ 1MDMB 5DM7F 3KETA 1FEXA 2VONA 1IN4A 2EWNA 3IWFA 2DMQA 3WTVC 2KPMA 3O8HA 1MMGA 3WTXC 1Y8RB 2ESNA 2FJ1A 3GFMA 3D1NI 1QPIA 1ZREA 1AA7A 2WYDA 4L0YB 2GA1A 4MTEA 5LFAA 2HZTA 1YHQI 1SMTA 1FIPA 2ACJA 3K9TA 4YFNF 1LVAA 1FNNA 4B8XA 3DBLB 1BI1A 1R00A 3FKIJ 1YI2I 3V8LA 1IG7A 1XGSA 1E2XA 1SVLA 3S8PA 2EPFA 1YTYA 1GM7A 3JRFA 4AU7A 2HXOA 1B6AA 3DKXA 4AD9A 2NYXA 2FMLA 2KIMA 3F9KA 2KQRA 2WB1A 3J7ZI 4G8XA 3LSKA 3A0BC 3LA3A 2L4AA 1FJLA 4OMYA 5DEQA 5E1XA 1ON1A 2OTLI 1K7DA 2A07F 4YFAA 4UV8A 3BG5A 2EILH 4BTHA 3W6JB 1LDDA 3KYCB 1RRJA 3IH4A 2P7CB 1A31A 4BXXJ 2QM3A 1XCVA 1IO2A 2EFOA 1K78A 4KNYA 2XKOA 5GP9A 5ICCA 1JHHA 5JVTA 1DP3A 5H6RA 3SQNA 3Q0UA 1YRNB 2ZNYA 3RKQA 3AG4H 1YS6A 3HRUA 5J40A 1OQYA 4BJTA 1POGA 4I7HA 4XLFA 1ZN2A 1PUEE 4EJUA 1Z7UA 5FLXZ 3OYFA 3K4NA 5DYMA 1AKHA 1QZYA 2VJ4A 2KP6A 4HDUA 1ZAOA 3I55I 2ZSIB 1R7JA 2E60A 2Y0SN 1TQPA 2EFWA 1W36C 3GO5A 4IEJA 1IUYA 3QP5A 2GZWA 2QSGX 3O3KA 3HKZA 3QU3A 2XGEA 4W1UA 2ID6A 5LRRA 5GAEJ 4BGDA 3FK6A 2Q2EB 2L7KA 4UV9A 5EYRA 3CO6C 4KA4A 3CUQB 1VTNC 1J09A 1HBXG 4GCVA 1MH3A 2F6CA 2VBYA 5E8GA 1VQMI 4FHTA 5DS9A 4LG0B 2MABA 2MD5A 3I0TA 4BE1A 4CXFA 1VF9A 2K9SA 4Q48A 1I3AA 1J2XA 1G3SA 2XGCA 5HOOA 2VPLA 1YG2A 3BZCA 1N78A 1ETKA 5JHFA 3E0JB 1ON2A 4AYBA 4IQJA 4KUMA 2R7TA 3JW4A 4RB3C 2HGCA 4ZYEA 4M6YA 1G4DA 2K40A 5DUIA 1BIAA 1DP7P 2B9SA 2ZMEB 2IS1A 3KZIC 5DD4A 1YJWI 4BHPA 3RDIA 3TEDA 4PJJA 2VN2A 3JREA 4XMYA 3LSPA 1A04A 3OYJA 4HX7A 1IRXA 4ZDPA 1QNTA 4MQ9F 3IKVA 4M6VA 3A03A 2PFBA 3QYBA 5IPAA 2M4GA 1TBXA 2OC6A 1T2KA 1Y0UA 3BC8A 3C2GA 4FE4A 1IDZA 2VJ5A 2Z1DA 3JRDA 4C3JJ 1J9IA 2F5CA 1I6XA 4E7SA 4XLAA 2M3AA 3WGHA 2M8GX 2K85A 1Y56A 1W0UA 2DFHA 3K4MA 3WGIA 2DAOA 3M8FA 5D4RA 3FZVA 4BQAA 4JX4A 2UWMA 3P5JA 1WRJA 5IT9K 5EGOB 4E7LA 2YSRA 2IRFG 3GTMJ 1XDUA 1QA6A 2LTPA 3SDGA 1D5YA 1UB9A 3W3CA 3FMQA 3F72A 1YIOA 2EQRA 4PUSA 4E7KA 1OCZH 2ZB9A 3ABKH 3MQ0A 5D5VB 2QKLB 1BR2A 4BE2A 2FU4A 2XAFA 5L3DA 1JXSA 1GK0A 2GQQA 1ZLKA 3T8RA 3FXLA 4E7JA 1PP7U 5K5QA 4XKBA 4MNUA 3W2AA 3A2KA 1MGTA 3WU2C 3K2ZA 4XKCA 1UELB 2W82A 4BY7J 4UUSB 2VE9A 2QZ8A 4MFDA 1QZEA 4P55A 3DEUA 3BROA 5FROA 1O3SA 1L0OC 5IOYA 4EJVA 5EJCA 1X1CA 4DZPA 1ORKA 2H1LA 2R4GA 1U78A 1WQ2A 1R5ID 2WBMA 1B72A 3OIQA 2VOPA 1Z05A 4BJ5C 2L9VA 2JA6J 2P6TA 2W48A 4M73A 2DJIA 4UB6C 5D4SA 1XSDA 2R7QA 4OINF 2KISA 2DN0A 3KYDB 4A3GJ 3H9QA 1FC3A 1TWFJ 1MJ9A 4PFOA 3KPHA 4ZZLA 2DA5A 4JK1X 2ADVA 3E5XA 3WHBA 1V5EA 3EYYA 1VQLI 1TNTA 2V1DA 2FBIA 1JW0A 2AE4A 2YS9A 2O61A 5L3FA 1H2GA 2M4KA 3HGYA 4PFPA 2I5UA 1IN8A 2V9KA 5J6XA 5E1ZB 4R1HA 2PX9A 5BOXA 2KRFA 2VL8A 1U8BA 2FNPA 3G2BA 3LSIA 2QBYA 4KT6A 4BY1J 4P1WA 4E70A 2KDZA 1ZRFA 5H2FC 5C3EJ 5F27A 2QWWA 2BXYA 3SEZA 1OCCH 1N75A 2DTRA 1BIBA 3PFYA 3L2CA 5LGTA 1YX5A 3HRSA 4H4KC 4XLEA 2UZKA 2FX0A 2OZ6A 4KFCA 4M9XA 3VPRA 3VB2A 4LB5A 3DP7A 3H92A 4LGWA 2P4WA 2FNAA 2W1OA 4ZYDA 3A01A 3RJPA 3DTIA 4QSHA 3VSLA 4CSWA 3E6CC 4ENMA 2IBDA 4MEXF 2Q0OA 3PIPF 1FLIA 4HLYA 3S1QJ 1FYKA 1CQTA 2BE5F 2OPTA 2ELHA 2K27A 3V8KA 1HA8A 2MLGA 1XTAA 4ZYHA 3OYEA 2L4MA 3TO6A 3H0DA 2KRCA 4L9NA 4A0YA 1T39A 3W6KB 5KNLA 2HTJA 3J80Z 5D6EA 2WWYA 2HPMA 3FHZA 1T95A 1D0XA 1BOAA 4F93B 1ZYRF 1F36A 1V3FA 4JYKA 3GZ5A 3R60A 1MH4A 4DNCA 2IA0A 1UCRA 1U3EM 3GLLA 3IWZA 3KZYA 5HDKA 3Q9VA 3DBHB 2JN6A 4ZH4F 5LRSA 1I1SA 2FA5A 4FISA 5H20A 5CQGA 3WGGA 2WV0A 4OIOF 3HZJA 3S2DJ 1QHHD 1T38A 4FETA 4AIDA 4A0XA 2XDVA 9ANTA 2BZTA 1S5LC 3OYDA 2V4JC 3GTOJ 4YFBA 4M3BA 2E5ZA 3FMRA 3B02A 3WTUC 2LK2A 4HYEA 1TW2A 3HOVJ 1UAAA 3MMYB 2KFDA 1NK3P 2HVSA 2CUFA 4PGHA 2AXTC 3BR5A 2KLOA 3FXUA 3R0JA 4ENJA 3ZMTA 3ZQLA 1ZRCA 3S3OA 4QLCU 5D8LB 1RI7A 4CYCB 2DW4A 5KHDA 1LQ1A 4BUPA 1V5GA 2LKXA 1Y1VJ 2KHMA 5FRNA 2HPIA 4HF0A 4FASD 1OCRH 4UVBA 3HEFA 2E19A 3IP4B 1MMSA 1VQNI 3L2RA 2L7FP 1R6RA 1HLVA 5E8IA 1STZA 2CQNA 3JTHA 2CFXA 1UHMA 1VI0A 1MZBA 1JKQC 2E2HJ 1BL0A 3MZHA 4LLGF 3PQJA 4E56A 2QENA 1JT0A 1FT9A 4G7ZF 2VBZA 2VPRA 5GPAA 5HLTA 1MMNA 3MKLA 3CCUI 1Q1HA 4DW6A 3SDBA 1IV8A 2PMHA 2V9VA 3T0YA 3K4CA 5ILSA 2VODA 1K83J 2O6GE 4M3DA 1BC7C 1R1TA 3D5SC 2DT5A 1GK1A 2EV6A 4U7DA 5CVIA 3M8JA 2WAEA 1ZHFA 2BEOA 4K2GA 4ENKA 4DYRA 3RQ4A 1KEHA 1FOYA 3WE3A 2G9WA 3U1DA 2CV1A 3RQIA 3SZTA 4KISA 2R7WA 1E3AA 1VQ6I 4KIBA 5F0FA 1ENHA 4Z6YA 1X4PA 3LWFA 3HOUJ 4RLFA 1BW6A 1RR7A 2IP2A 2XPVA 4CA0A 4AIJA 2FE3A 2MBFA 3PIOF 2OZUA 1TT0A 1Z3XA 3H36A 4KIGA 4RGUA 4NUBA 4XLNF 3QP6A 2GM4A 1ZARA 2FRHA 4UUVA 3C1DA 2DOFA 2BY2A 3KEOA 3ABUA 3CJRB 4M3GA 1G2HA 1FPQA 2R7OA 3E6MA 2XPWA 1O7FA 4CGZA 2HS5A 1TNSA 4HA8A 1YJ9I 2CO5A 4XBFA 3S3MA 2Q8KA 3T1BA 3EUKL 5J8FA 3H5AA 1NTCA 5HDGA 3WTYC 3I71A 1YQAA 4KICA 2DA4A 2CV2A 1R58A 3ZR8X 4RM3A 3BQYA 2K3FA 4A3IJ 3UR3C 5K7FA 2F5FA 2VQHA 3TGNA 3JAMZ 3DTEA 2L2OA 5D5WB 2H94A 2XAUA 1D0ZA 3MKZA 3PNTA 3UNGC 4BEHA 1YIJI 1NG7A 1WJCA 3UKGA 2HQAA 4C3HJ 4DIQA 1G3TA 5FRMA 1OYWA 2CW0F 3FXRA 3R4KA 4F55A 4IHVA 2R5ZA 2DYSH 5KAIC 3FXOA 1X3UA 1VQKI 4PEMA 4Q4ZF 1JX9A 1YW8A 5TJJA 2E36A 2PI0A 1ETQA 3CC7I 2O9LA 2TRTA 3SRAA 3ERED 1MSEC 1I6HJ 3B6CA 3V7CA 1FOXA 2PG4A 3L09A 4IVNA 5DTDA 3E1SA 2MW8A 5KVRA 3S2HJ 3J81Z 1D1AA 4XRSA 4ZYGA 1ZRDA 4B47A 2ZXJA 1NH3A 1D3YA 1FX7A 4BAYA 2GOMA 4KYWA 4UB8C 2NAZA 2ETHA 3D0SA 3GF2A 2XGXA 3S15J 1HC8A 1KU9A 2QQ9A 3ABLH 3AL0B 2ZKZA 3G1MA 3GZNB 1DU6A 3KX2A 1J75A 2I8DA 1MD0A 3O8GA 4IPAA 3FGTA 3BG6A 2OU2A 1GKFA 2LOOA 2VBWA 3LQRA 4CZCA 4LJZF 4BACA 1KGSA 4BQNA 1HSTA 1O7LA 2D2WA 5FFXA 2XC7A 4NNJA 3ZMUA 3S1NJ 1FBUA 1PNLA 3HPGA 2COMA 2N8GA 2LH9A 3ML6A 2VOOA 1FP1D 4EQQA 4BYYA 3CDHA 5GTHC 1IXCA 2RC4A 4UVAA 3I54A 2R5YA 5FKMA 1TW3A 3QU6A 2HYFA 2E34A 1YITI 5E17F 2L01A 5M3FJ 3M1EA 3RTRA 4WWCA 3I53A 3K4LA 3GWZA 1GV2A 2FUG2 1JKRC 2RNJA 1QHGA 2QSFX 2XPUA 3K1PA 1BR4A 3GTQJ 1A36A 3JRHA 3ZQCA 1SFOJ 3BDDA 2X48A 4FQGA 4EJWA 3KLOA 2QSHX 3HUGA 2HYGD 4C9YA 1N77A 5L3BA 1KYWA 3TP0A 5C4XJ 4KT5C 4P9UA 4ZDOA 2M87A 4LK1F 1ZH5A 2VC1A 2HDDA 4IRGA 2VXDA 3RI4A 1SFUA 3OYBA 1Q1VA 3Q0WA 1PJRA 1WZ2A 2HVRA 3GTJJ 4RB0A 4L5EA 1EJ9A 1F4KA 3KLNA 2WAFA 1AI5A 2X51A 4YIRX 5DDGA 2UXXA 2ME6A 3TW7A 2X6XA 3FF5A 2CQXA 1WJEA 2LLKA 4CYDA 1A6QA 4ANJA 4ZC3A 5IYCJ 4E7IA 3GXOA 2M7BA 4S05A 2E1MC 3B6AA 2JPCA 3OSFA 1QBJA 2CFOA 3KP4A 4MFEA 2W25A 1FBSA 3TDZC 1GVJA 2DA6A 3MVPA 4MLOA 3WG9A 3S14J 3RKXA 2WAQN 4EGZA 4IRIA 1S9HA 1K78B 1MNEA 2DA1A 5H6QA 3CCVI 2L0KA 1ZKGA 5BS6A 5HLHA 2GIZA 1APLC 1YW7A 3E5UA 3HOYJ 4CCJA 3JRCA 2ZJ2A 3H5NA 2EZLA 3W2VA 5CVJA 1Y1WJ 2L54A 2VXZA 4BDZA 1K6YA 2NXNB 5TRDA 3GTGJ 3CD6I 3SYTA 1AKHB 4XKVA 2QKMB 4Y4RA 3ZQGA 3K70D 1T8IA 4JBAA 4HBLA 4NDLA 5J47A 1MMDA 2YR2A 4IHXA 2BVLA 3FXKA 2Z33A 2FEZA 3CCSI 3MAJA 1T33A 3DLLF 3PJRA 4BDYA 2R0QC 2GA2A 2HDWA 4L5JA 3ZRGA 1AI7A 1TP4A 1K79A 2X0LA 1XGMA 2TDXA 2XROA 4I76A 2KIFA 3DWLE 3Q9SA 4YG2F 3SRCA 2PMZA 2IA1A 4IHWA 4A6DA 1FYMA 2CW8A 1XGNA 4EATA 2E1CA 2DFIA 2Y30A 3H3ZA 5HS8A 3OIOA 3L1PA 3W6VA 3J7AY 4D7MA 2DO7A 1AHDP 3ERMA 2O03A 3HOWJ 2ZO4A 4HV5A 2CW7A 4M9ZA 3AFHA 5HLIA 1QZZA 2OBPA 3G73A 4IHYA 1OKRA 1Y0NA 1USSA 2CWEA 4CCNA 4HV6A 3BJOA 1AJPA 2COBA 2BY3A 5CQEA 4L5IA 2JPBA 1IRFA 1JTXA 3H5RA 1TT5B 2EJRA 3COAC 2OAZA 3K7AJ 2YX4A 3TKYA 4X6AJ 1JTYA 3HB9A 2DCEA 4QIWN 2HDCA 4OWRB 1HKSA 1ETWA 2CS3A 2X1CA 2LY9A 2X6YA 2E7XA 2VIXA 4N9IA 3OS2A 3LFKA 2ZFWA 1ULYA 4N9HA 4JX6A 2CGPA 1MKMA 3EETA 2W4SA 2VKEA 3OY9A 4MEYF 1ZELA 4GDFA 3G1OA 1I5ZA 4B3AA 4F91B 2R7XA 2EZHA 2GXBA 4YRVA 4A3JJ 3DBRB 3V42A 1KONA 2JVGA 4CDGA 4XQFA 2QCOA 2R92J 1RNLA 3DF8A 1R22A 4E6KG 3I4PA 3IH3A 4C2MJ 1IV6A 3LSHA 3DU6A 3HG9A 1X1AA 2DMPA 5E3MA 3I4NJ 2W7NA 5B1AH 3WU1B 1K5QA 4RAFA 1IUFA 2VC0A 2OA4A 2W84A 2DA3A 4WF2A 3KYLA 2WYBA 1D8KA 1W7PA 1OCPA 2DOAA 4BBRJ 1T0FC 3HRMA 3RPUD 3OL3A 4BXUA 1BW5A 3WG7H 1R4MB 1B72B 4RS8A 4IJAA 2Y9YA 2CQ7A 2K9MA 2XB0X 2EA4A 2F5VA 2IS6A 2HVQA 2Y75A 2P6SA 2ZXWH 3F8FA 1BI0A 2LR8A 5HNHA 4O3MA 2RAEA 2IS2A 4XRFA 3S3NA 4I99C 3EUHC 2IEKA 2Z99A 2HQNA 1MBFA 2IVMA 3TL4X 3H1CA 3H3VK 3LSMA 1CGPA 3L7WA 4G7HF 2QBYB 2EIKH 2O3FA 2ME0A 3IL2A 2B63J 1PP8F 3CLQA 2F5DA 4DZJA 2K02A 1WJ5A 5CKTA 4XLCA 5F64A 4I0AA 4NC6A 4PSXA 3TQNA 3ZQFA 2F4OB 1FIAA 3VOEA 2DT6A 3BJ6A 3FX3A 4A2UA 5BPIA 2M9HA 1TWHJ 1EH6A 3ONQA 1QQIA 2XAHA 4HG2A 4Y33A 2GIVA 5KCMA 1AJNA 1P6RA 2Z2SB 1J5YA 2DJNA 2V1NA 2W24A 3A01B 2RQPA 3HSEA 4D7NA 3KIOA 1VFCA 4IQ4A 3K1NA 4U87A 2QF7A 2VT3A 5BQTA 1FP2A 2D45A 5K5RA 1SD7A 4IXAA 2H27A 2DDAA 2HEOA 2Y31A 1FBQA 4HAMA 3X2QH 2HNHA 3OL4A 1UMQA 3BLYA 3EDPA 3GX4X 3FM5A 2KIUA 2LYCA 4W97A 4A5NA 2STTA 3S32A 2XASA 3HHGA 1D0YA 1WI3A 3LA2A 1ZG5A 1FZPB 1GXPA 2DK5A 4UUTA 2CU7A 4XICA 1OR7C 1VQ9I 1YYVA 3HOXJ 3BPVA 5ED4A 3DCFA 3OIPA 2RGVA 2E5NA 4ZTJA 3CZ6A 4I2OA 1GUUA 1GXQA 2HU9A 2HYJA 3GFLA 2VT2A 1F5TA 1H88C 1E3OC 2OQGA 3P9KA 2CUEA 2F2EA 4CCLA 1S29A 1UG0A 2KDOA 2Y0SA 1EA3A 2LKSA 4RAGA 2DTZA 3KFWX 2E1MB 4G6DA 4DOZA 2E2IJ 1TZLA 3N05A 5HLGA 2VASA 4NC7A 1MNDA 2CJJA 1KYZA 2H09A 2MGQA 1W0TA 2HOTA 2ZJPF 1YJNI 5F04A 5CVRA 3E97A 4D0PA 4J01A 5E3OA 2ZJRF 1X58A 2A5WA 2LDUA 5JI6A 3JR9A 1OCTC 4WKTA 3OOPA 1FMWA 2H1KA 1ODDA 3NWTA 3AKZA 2X1EA 4U7BA 2IGOA 3PNYA 4G9YA 1FWZA 1ONVA 4Y3OA 2VKHA 3HPHA 2A3SA 4II2A 2XF7A 2YUSA 5GAGJ 2Z5UA 4XSZF 3M7GA 4ZTFA 4PJNA 4GFBA 3DXJF 1CF7A 2L7MP 2NOGA 5J1YA 3PNVA 3RIRA 1QVTA 1DDNA 1LFUP 1RUOA 2P5KA 2ESHA 4O6JA 2VJJA 1FM2A 2WY7Q 1LFBA 2JTVA 4RGXA 2JA5J 1XPXA 2LVSA 3VODA 2AE5A 3A1YA 2DMNA 2ZFUA 3LAPA 2IW5A 3K6GA 2NVUB 3CCYA 2JMWA 4KN7X 2ZXIA 4B44A 3D5LA 2VQCA 3GZ6A 1FTZA 3E3VA 1U8RA 5EZGA 3OYLA 3GEZA 3FIWA 2VJIA 1OJLA 1GT0C 4OU0A 3OYNA 2RN7A 5E18F 1RUNA 1R49A 1OYYA 1K61A 1VZ0A 3FGRA 4QPOA 3WTZA 4NHJA 1LEBA 1YFHA 2IA2A 4LK0F 2PMUA 2Y48A 4CHUA 5GADJ 5IP6A 2KT0A 4ON0A 3LL7A 1Z9CA 4PSWA 1O57A 3HTUA 4BE0A 1BI3A 5CYVA 3GFIA 3ZOBA 3OR2C 3IHUA 4XORA 1VQ4I 3L2WA 2M8EA 4PDKA 1IDYA 4ESFA 2JA8J 1ZTRA 2RKHA 4BWCA 2DU9A 2O5RA 5CPRB 3WE2A 2MH2A 2G0EA 1FOWA 4OIQF 4NBQA 1F43A 2L02A 3HBLA 3P9CA 4GO1A 1U5TC 4K2FA 3HC7A 3ZMSA 1H8AC 1Z0XA 2FSWA 4X0GA 4BBSJ 2RDPA 3HIFA 2WY8Q 5ICFA 1TWCJ 4HQEA 1H9GA 1I1GA 3VWBA 3G4SI 3BR6A 3BTIA 3GBGA 4FT8A 4RDUA 4LLNA 4LG3A 3U9GA 2XKPA 1RR8C 1OLTA 4RM2A 3S8RA 1I50J 2AE3A 1R5GA 4M3EA 3GW2A 3ZQHA 1WGXA 1SAUA 4PCQA 4PZJA 3ZGKA 1P4XA 4HNUA 5M5XJ 2A68F 5EG0A 1LVKA 2EZIA 3G3ZA 3ISPA 3WHCA 1S6LA 5BMZA 4AC0A 3H9JA 4BJ6C 5J1RA 2H6CA 4EM2A 4LMYA 4IZZA 3ASNH 3GVAA 4HNVA 4HNTA 4BHBA 4BEHB 1D1BA 3OMYA 3JTQA 3BG7A 3KEYA 4BL0B 3FM3A 3K4JA 1Z7LA 3BCBA 1GHCA 5HNFA 4OOIA 2FXAA 1B8IA 2R5ZB 1Z6RA 5D8KB 3QWLA 2LC2A 1O3QA 1WWXA 4IOAF 2DDBA 5FD5A 2KJCA 3OSGA 1ZQ3P 3P7NA 5B1BH 1E3HA 1KQ0A 2G7UA 5F0CA 3BWGA 2JUCA 2W57A 4BXFA 1YW9A 3IRQA 1RPWA 3HM5A 3IKTA 1WSUA 4HF2A 1IRGA 2LMDA 3RZDJ 3BPXA 3CUOA 2PJPA 5FKNA 1QU3A 2M2EA 3VYRB 3OS0A 2HWVA 4OIRF 2QVOA 1YE9A 1C0WA 3CF2A 2PJRA 1KU2A 2QQAA 4HLXA 3F8MA 2VE8A 4GGGA 2DA7A 1QO0D 2QQBA 1DPRA 5IOZA 3HXLA 3ECOA 2I10A 3PO2J 1FXHA 2F4MB 2M30A 3D5RC 4DYQA 5DCMA 1XN7A 4G7OF 2XUBA 1UZCA 3H3UA 2XB5A 2R7RA 2ISZA 3K3WA 1K5SA 3E6DA 3KP5A 1XB4A 1U0JA 4AWXB 3JRGA 1K4TA 3E5QA 4WXCA 5JR3A 1X4OA 5IYDJ 1G6NA 2X6OA 3SXYA 3AG3H 4ESBA 1G3YA 3SJMA 3O2PE 1MMAA 3F6VA 2DMUA 2R3SA 4B48A 2JRMA 2F48A 2K3PA 2JQ7A 5B5EC 3IAM2 2R5YB 3AG1H 2PEXA 1EV7A 1LDJA 1T0FA 4LITA 2LF8A 1SD6A 4GRIA 2RQQA 1OYIA 3PUBA 1GM8A 3CCMI 4L0ZB 4U0VA 3CUQC 5IP7J 1DU0A 2JT1A 4R79A 4WKUA 2DFFA 2DXIA 3K2AA 1B9MA 1MBHA 2XF5A 2D1HA 3BJAA 5LBQA 2CRGA 1Z6TA 3HUGB 4HW0A 3PM1A 1JI8A 3BR0A 5D6FA 1LEAA 1BOBA 3EUHA 2A61A 1AJQA 3LSRA 4QPQA 3P9IA 2ISYA 1I3QJ 3QYEA 1MBJA 2FMYA 2K4BA 4M71A 1E3PA 3CTAA 1WJFA 5A2QK 3OR1C 1HXDA 3Q3SA 2CQKA 4YIFA 3FXMA 3RYRA 1KQ8A 3OYIA 5HODA 4A3DJ 5FB2A 2UV1A 3ESWB 2NOJB 5FKOA 1AI6A 2ZMEC 1DGRM 3K69A 4D5FA 2C6YA 4A3LJ 5IT9Z 5K5OA 4CH7A 5CVVA 1GM9A 4IRHA 5EDNA 1WH5A 2IAIA 3ABMH 1ZGWA 1LUJB 4JQFA 1YS7A 3ELKA 2MC3A 1SD4A 3ABTA 4MQVA 4U0YA 3C18A 3F0CA 1MJAA 4OIPF 2HOEA 3BTLA 4ITVA 2H6BA 4QWQA 3CDIA 3CMAI 1PNMA 4LB6B 3W2WA 4HX8A 2EFNA 2WB1N 3QRFF 2BY1A 2B7EA 2VI6A 3JSPA 3OS1A 4I98B 4C2UA 1PVEA 3NQOA 3C7JA 1X1DA 1IW7F 4G94A 2ELJA 3A4CA 3DLAA 1J0RA 1H0MA 1TL8A 2GBYA 3C2HA 1D5VA 5LHGA 1LB2A 1OR7A 2BBYA 1B1BA 2HZDA 3PQKA 3F8NA 2X1DA 3ZMVA 1G3WA 3QODA 3ULQB 5ICGA 4WK8F 3JTGA 1ZR2A 3LA7A 4KITB 4UVCA 3ZQQA 3RSNA 3CF5F 1ACIA 3JTRA 4XL9A 2MLKA 1VQ5I 2B0LA 2BYVE 2R7VA 1JT6A 3M8EA 2OF7A 3HRTA 3K70C 4WKSA 4E7HA 3REOA 1Z3YA 3KEQA 2HQRA 2LY1A 2V1XA 1QVUA 1MJBA 2DYRH 2QEXI 4IHTA 1J59A 4XLPF 2M45A 2L5QA 2P81A 3J80K 2CG4A 4KMFA 2EB7A 2RREA 3IH2A 4A3MJ 2AXLA 1ETYA 2BV6A 1VNDA 1ETVA 1NK2P 5LEJA 1OR0A 3DU5A 2JVHA 2M0CA 1UFMA 1PUFA 3BY6A 3CDLA 2FBKA 5EEGA 3CMYA 2EIMH
chains in the Genus database with same CATH topology
3KYLA 3LSGA 2WYBA 2CUZA 2DOAA 2K9LA 1T0FC 3CESA 3RPUD 3OL3A 5KNLA 1WJBA 2HPMA 4F3QA 4D1QA 1T95A 1D0XA 2M7AA 4F93B 4ZYAA 4F92B 3VYUB 2JSPA 2K9MA 4DBRA 2F5VA 3ZXSA 3FDYA 2IS6A 2HVQA 4YF9A 2P0WA 2R7UA 2WADA 1Z21A 2M0MA 5HNHA 2IS2A 2WYEA 3CJQB 3DEEA 4DGWB 3S3NA 2W00A 5CQGA 4BU2A 1PYVA 3EUHC 1BR1A 3OYCA 3H9GA 1QHHD 4FETA 2XDVA 3TL4X 3FBIB 3LSMA 3I3LA 3OYDA 2V4JC 1G59A 4YFBA 2E5ZA 4YEJA 1UAAA 2V7FA 3MMYB 2HVSA 3K4BA 1WJ5A 5CKTA 4XLCA 4M1JA 2LBFA 4PSXA 3IAS2 2KLOA 2OUMA 3K10A 3S3OA 4N4NB 2DT6A 4NQWB 4XM3A 2V6EA 4RMNA 2VLAA 2AQEA 3ONQA 4HG2A 4Y33A 1X1BA 5KCMA 1AJNA 5KHDA 1KECA 2Z2SB 2V1NA 1MW7A 2CH0A 1V5GA 4BUPA 2KHMA 4XKWA 1LKXA 4IQ4A 3LFUA 4U87A 5FRNA 4II3A 2HPIA 4FASD 3FHNA 3IP4B 3H35A 3L2RA 3HL2A 1R6RA 3K4KA 2HNHA 3OL4A 3BLYA 1NG6A 3OYMA 3OYHA 2LYCA 1CP9A 2ZSHB 4E56A 3S32A 4CUGA 4WKVA 5HLTA 1D0YA 1MMNA 2L9NA 3SDBA 2BVMA 3K4CA 3MD2A 2UUZA 1OR7C 2V26A 3EPZA 1AI4A 4JOMA 4N4OB 4D9JA 3OIPA 4HRIA 2E5NA 4ZTJA 3CZ6A 4XR6A 2WYCA 3D5SC 1GK1A 2HU9A 3RCOA 3VYSB 4ZDLA 3M8JA 4CCLA 2WAEA 2KDOA 1UG0A 2Y0SA 1EA3A 4PJLA 4CCOA 4K2GA 4C2TA 2E1MB 4HPQA 4DOZA 3RQ4A 1TZLA 3N05A 3SZGA 2VASA 1KEHA 4NC7A 1MNDA 3FBNB 3DTKA 4HEA2 3M1CA 2CV1A 3CMMA 4J01A 4KISA 3L2VA 2R7WA 2A5WA 1E3AA 4WKTA 1FMWA 1E0EA 1X4PA 2LBFB 3NWTA 4ZJZA 3AKZA 2X1EA 4U7BA 2R7SA 2MYSA 2IGOA 4RLFA 3PNYA 4Y3OA 4C30A 3I9V2 3HOTA 4CA0A 3OYGA 2VKHA 2IGNA 3HPHA 4II2A 2XF7A 1JVZA 1TT0A 1Z3XA 4ZTFA 4NUBA 2LREA 4PJNA 3CJRB 3PNVA 2MFZA 3MKWB 2WAQA 2R7OA 3ZCOA 1ERDA 1PNKA 2VJJA 3LMMA 1FM2A 2CUJA 2WY7Q 3OYKA 2DT7B 1SFKA 4HSTA 3PL8A 2KRHA 4B3XA 3S3MA 1GK9A 3EUKL 3H5AA 1LDKB 2AE5A 3A1YA 3OWTA 3U21A 2ZFUA 4B43A 3MKYB 2CV2A 3K6GA 4CCMA 3ZR8X 3PSFA 1V5FA 2ZXIA 4RM3A 3TBIA 3UR3C 1FMVA 1WJDA 4B44A 2VQHA 4BQQA 3DTEA 3D5LA 2L2OA 2VQCA 3DKYA 2XAUA 1D0ZA 3MKZA 4XN0A 3PNTA 3OYLA 3UNGC 4BEHA 1WJCA 1NG7A 2MC4A 2VJIA 3OYNA 2HQAA 3OYAA 2KL4A 4DIQA 1W36D 5FRMA 1VZ0A 4HSRA 1P9QC 4QPOA 4AVZA 4F55A 3L91A 3S93A 1WFXA 4RLQA 3LL7A 3NWSA 4PSWA 4BE0A 3DPTA 3DPLC 4XN3A 3OR2C 4PEMA 4XORA 3L2WA 1JX9A 2KPMA 1MMGA 2LRDA 2O5RA 2IGMA 5CPRB 2L9SA 1AA7A 3SRAA 2WYDA 4G6TB 4K2FA 3HC7A 5LFAA 4X0GA 3E1SA 4BS9A 2WY8Q 1D1AA 3VWBA 4KJZA 4B47A 2BW3B 3GBGA 3S8PA 4CCKA 4LG3A 1GM7A 2GOMA 4AU7A 3DKXA 1OLTA 4RM2A 3S8RA 2AE3A 1Y6IA 2KQRA 3F9KA 2X85A 2WB1A 1SAUA 3LSKA 3ZGKA 4HNUA 3AL0B 1LVKA 3KX2A 4NC8A 1K7DA 2I8DA 4YFAA 3BG6A 1GKFA 2LOOA 4BTHA 3H9JA 4BJ6C 4J00A 4CZCA 4BACA 3BCAA 4XLHA 4BQNA 4IZZA 2XC7A 4NNJA 2JA2A 3FKJA 4HNTA 4BEHB 1DP3A 1D1BA 1PNLA 3HPGA 3OMYA 2LH9A 3JTQA 3BG7A 3KEYA 4BL0B 3H0DA 3K4JA 1Z7LA 3BCBA 5HNFA 4PJMA 4BJTA 4XLFA 2LC2A 2F4IA 2CMPA 3OYFA 3K4NA 3QYFA 2VJ4A 3RTRA 2KP6A 3VYTB 3K4LA 2FUG2 2ZSIB 1G8XA 1QHGA 3CP2A 1BR4A 4BXFA 2E60A 2LY2A 3QOEA 1W36C 4LIUA 3HKZA 3PSIA 2VQGA 4C9YA 1N77A 3EUAA 4BGDA 1QU3A 2Q2EB 3VYRB 2L7KA 4XONA 4ZDOA 3OS0A 1J09A 2X6WA 2LG4A 1YE9A 2VXDA 2F6CA 3CF2A 3OYBA 2PJRA 2BW3A 4IKFA 4P5OA 1PJRA 2MABA 1D1CA 3AL0C 2HVRA 4E57A 4F52A 2CV0A 4BE1A 1AI5A 2WAFA 2X51A 3HOSA 5HOOA 2VPLA 2X6XA 3HXLA 1WJEA 1N78A 2Z16A 1FXHA 5JHFA 3E0JB 4AYBA 4ANJA 4IQJA 4ZC3A 2VKDA 4E7IA 3D5RC 2R7TA 2M7BA 2E1MC 3TMOA 2CFOA 2R7RA 3K3WA 1K5SA 4MLOA 1U0JA 2OV7A 2JUGA 1FXVA 4E4HA 1S9HA 2IS1A 4PJJA 1MNEA 1GHDA 4XMYA 3OYJA 1X4OA 1IRXA 4ZDPA 2KZVA 1MMAA 4E7ZA 4B48A 3QYBA 4CCJA 2K3PA 2M4GA 3IAM2 2OC6A 3BC8A 3C2GA 1YX3A 3H5NA 3W2VA 2VJ5A 2Z1DA 4LITA 2VXZA 4BDZA 1K6YA 4GRIA 1WJAA 3SYTA 4XKVA 2QKMB 4Y4RA 2RQQA 4XLAA 4E7SA 3K70D 2M3AA 3PUBA 1GM8A 1Y56A 2IGKA 5HVQC 1MMDA 4R79A 4WKUA 2DXIA 2BVLA 1X19A 2XF5A 3K4MA 2UWMA 3HUGB 4LIVA 3L2QA 1JI8A 4E7LA 4E55A 3PJRA 1BOBA 4BDYA 3L94A 2K5CA 2HDWA 1AI7A 4YELA 3ZRGA 1AJQA 4QPQA 1DQUA 3QYEA 2BOLA 2PJRB 3W3CA 3DWLE 3VDXA 4DBQA 1WJFA 3SRCA 3OR1C 4PUSA 4E7KA 2PMZA 2AQFA 3DPUA 3OYIA 2QKLB 2CW8A 1BR2A 2XSJC 4BE2A 2UV1A 3ML0A 4EATA 2NOJB 2IS4A 1AI6A 2XF6A 1DGRM 2MD0A 3L2UA 1GK0A 4CH7A 1GM9A 4E7JA 3J7AY 4XKBA 4JQFA 3W2AA 3A2KA 2VQLA 4XOPA 4XKCA 1UELB 2W82A 5LD2C 2CW7A 3AFHA 5FROA 4ITVA 1X1CA 4CCNA 1LFPA 2R4GA 4BQOA 2WBMA 3OIQA 1AJPA 1PNMA 3W2WA 5CQEA 4BJ5C 5TGTA 3H5RA 4OAZA 2DJIA 3OS1A 2R7QA 2RNGA 4C2UA 3IUOA 1X1DA 3H9QA 2ZXHA 4XOTA 2ELJA 2KMUA 4PFOA 3A4CA 3DLAA 2ADVA 2DCEA 1V5EA 3C2HA 2AE4A 1JW0A 4OWRB 2GOXB 2Q1ZB 2CS3A 2HZDA 3SEQA 2X1CA 4IX7A 1H2GA 2M4KA 2X1DA 4PFPA 2X6YA 3QODA 2V9KA 3OOUA 2VIXA 4KITB 3OS2A 2VL8A 3G2BA 3ZQQA 3LSIA 3RSNA 4KT6A 4P1WA 3JTRA 4XL9A 2R7VA 4DJAA 4OAYA 2W4SA 1GLNA 3SEZA 2VB6A 3OY9A 1N75A 1ZELA 3PFYA 3K70C 4WKSA 4F91B 2IXSA 1YX5A 3VSKA 4H4KC 4XLEA 4E7HA 2R7XA 1Z3YA 2LY1A 4YRVA 2A6TA 3V42A 1KONA 2JVGA 2W1OA 2L5QA 2WA0A 4XQFA 3DTIA 3VSLA 3DQVC 4CSWA 4E6KG 2RREA 3CP8A 3LSHA 3DU6A 3HG9A 1X1AA 1OR0A 3DU5A 2JVHA 2W7NA 1HA8A 3OYEA 3SRBA 1K5QA 4PK4A 4XNFA 2KRCA 4PELA 1DGWY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WKT A;  1AI4 A;  2WYB A;  1GHD A;  1FM2 A;  1K7D A;  2ADV A;  4K2F A;  4E57 A;  4YFA A;  2WYC A;  1AI5 A;  4HSR A;  4HST A;  1GKF A;  1GK1 A;  4YFB A;  4BTH A;  1GK9 A;  2AE4 A;  1JW0 A;  4E55 A;  3L91 A;  3L94 A;  1AJQ A;  1AI7 A;  2AE5 A;  1FXH A;  4K2G A;  4PEL A;  1H2G A;  4M1J A;  4YF9 A;  1PNL A;  1CP9 A;  1JVZ A;  1KEH A;  4E56 A;  1GM7 A;  3SRC A;  3JTQ A;  1OR0 A;  1AJP A;  4WKV A;  1PNM A;  1K5S A;  3JTR A;  3K3W A;  4PEM A;  4WKS A;  2WYE A;  3S8R A;  2AE3 A;  3ML0 A;  1JX9 A;  1GM8 A;  1FXV A;  1AI6 A;  1AJN A;  3SRB A;  4WKU A;  1KEC A;  1K5Q A;  1GK0 A;  1E3A A;  1GM9 A;  3SRA A;  2WYD A;  1PNK A; 
#chains in the Genus database with same CATH topology
 3LSG A;  4JP0 A;  2EZK A;  2E1N A;  3QPH A;  5GAH J;  3CES A;  1WJB A;  4F3Q A;  4D1Q A;  2Y0M A;  2HQ5 A;  4EMS A;  2XRL A;  5IYB J;  2M7A A;  3G71 I;  3VYU B;  4J19 A;  2JSP A;  3S17 J;  4QTR A;  3C3W A;  4WX9 A;  1MBE A;  2VKV A;  4DBR A;  1F9N A;  3FDY A;  4YF9 A;  2UXN A;  3BZ6 A;  1JGS A;  5D5X B;  2IJL A;  3CC4 I;  1X3W B;  2LKP A;  3BT9 A;  3HGG A;  3LSJ A;  3R0A A;  2M0M A;  2WYE A;  1IJW C;  3DEE A;  2MSY A;  4KIF A;  4Y13 A;  2DPD A;  1HKT A;  1P4W A;  4IO9 F;  3H9G A;  2HFH A;  3CCE I;  1IZ1 A;  3BOQ A;  2R7Z J;  4MTD A;  4M9S A;  4YEJ A;  4B1R A;  3E7L A;  3ZN0 A;  3K4B A;  3V7S A;  2JJ7 A;  3RPQ A;  5M5W J;  3NAU A;  4JX5 A;  4YII A;  2LBF A;  2OUM A;  4AIH A;  1U9N A;  3K10 A;  3R6S A;  2Z3Y A;  4NQW B;  4XM3 A;  1VQP I;  1X2N A;  4KMU X;  2VLA A;  1R9T J;  2AQE A;  4B09 A;  2YPR A;  3HTS B;  1MNM C;  4ASN A;  5K7H A;  1S8N A;  1TC3 C;  1KEC A;  1MW7 A;  2CH0 A;  4V19 K;  4AVP A;  5EEH A;  2GWR A;  2QQ8 A;  1LKX A;  2LF7 A;  4II3 A;  1U2W A;  5HS7 A;  2LP0 A;  3I59 A;  2G7H A;  3GLX A;  1FTT A;  5K1Y A;  1VQ8 I;  3H35 A;  3PFI A;  2MH9 A;  2OCC H;  5L3G A;  3U1K A;  3HL2 A;  2FBH A;  1U5T A;  2XSD C;  5J1U A;  2X9D A;  1LNW A;  3OYH A;  1SC7 A;  3S16 J;  2ZSH B;  4I0B A;  4CUG A;  3GFJ A;  1W7P B;  3J7A O;  4WKV A;  3IV5 A;  4CO8 A;  2IT0 A;  2L9N A;  4MIM A;  5GPC A;  1P2F A;  2ECB A;  5F1J A;  1Y39 A;  4XSX F;  4WXH A;  3HJE A;  5C4J J;  4JOM A;  4HRI A;  2LD5 A;  1XDS A;  2V1U A;  2QGU A;  4XR6 A;  2WYC A;  1HKQ A;  2HR3 A;  1XS9 A;  1SD5 A;  3RCO A;  1JKO C;  3VYS B;  2WTE A;  1TTY A;  2WV1 A;  5F6F A;  1W5S A;  4ENN A;  2AO9 A;  4PJL A;  4CCO A;  3ROU A;  4MGR A;  2L3D A;  5EF6 A;  4HPQ A;  3DFG A;  5F0H A;  1QGP A;  4P9F A;  3ECH A;  1B4A A;  3DTK A;  4HEA 2;  4ABZ A;  1W5C C;  2BXZ A;  4Y17 A;  1TQM A;  3JRB A;  2PBI A;  4GYG A;  3M1C A;  1O3T A;  1MDM A;  3DEW A;  3L2V A;  4I02 A;  4Q5S F;  2JSC A;  5DD8 A;  2A6E F;  4NQW A;  4ZJZ A;  2MYS A;  1NHA A;  2ZBK A;  4FX4 A;  5AON A;  4C30 A;  3I9V 2;  3HOT A;  2O8X A;  3OYG A;  1XCB A;  1FOK A;  2IGN A;  1IC8 A;  1XGO A;  1S7E A;  1IGN A;  3RKY A;  1FSH A;  1A6I A;  2E71 A;  3SFI A;  2HKX A;  2ZCW A;  3NEU A;  3U2R A;  2EIN H;  5JLX A;  3RKW A;  2XVC A;  4C3I J;  3F6O A;  1T98 A;  1X3Z B;  3G6E I;  3QOP A;  1UHS A;  4RGR A;  2WAQ A;  4PGG A;  3ZCO A;  1EH8 A;  1ERD A;  3LQQ A;  1PNK A;  3LMM A;  2GXG A;  3JAM K;  2CUJ A;  4XRS G;  4HST A;  3PL8 A;  1OPC A;  5JLW A;  2Y69 H;  4ZZD A;  2STW A;  4PJ0 C;  3GCM A;  2JWT A;  3BG9 A;  2V9P A;  2EV0 A;  2L7Z A;  3Q5F A;  3U21 A;  3BTC A;  2A6H F;  3KP6 A;  5K7Z A;  1PDN C;  3MKY B;  1J7K A;  3CCL I;  3M4O J;  1R1V A;  3S2W A;  3TBI A;  2W85 A;  1FMV A;  2DQR A;  3BQZ A;  4EM0 B;  2ELK A;  5BNG A;  4UXN A;  4BQQ A;  1YLF A;  1WH7 A;  1GV5 A;  2EFP A;  2KKO A;  4XN0 A;  3ZN1 A;  5KAF C;  5CLS A;  2MC4 A;  5EEA A;  1YRN A;  2Y2Z A;  5LHI A;  3OYA A;  1W36 D;  5ILV A;  3K0L A;  1RET A;  3L00 A;  2DK8 A;  2NS7 A;  2NS0 A;  4AVZ A;  1R23 A;  1R36 A;  1WFX A;  2DOD A;  1DPU A;  5LGN A;  3KP3 A;  4RLQ A;  3NWS A;  2F5E A;  5C44 J;  1P4A A;  2PN6 A;  3DPT A;  3DPL C;  2VBX A;  4XN3 A;  4EV0 A;  1Y8Q B;  2LFB A;  2K86 A;  5ICE A;  3J81 K;  3ZP5 A;  3JRA A;  3NAR A;  1SVO A;  3C2B A;  3E6B A;  4M3F A;  3S1M J;  2IPQ X;  2LRD A;  1ZG3 A;  2NNN A;  2EFQ A;  2IGM A;  4XID A;  2P5L C;  2L9S A;  5FD6 A;  3F22 A;  3SHF A;  5AIQ A;  4IOC F;  4G6T B;  3F21 A;  1ZGA A;  3ZMZ A;  2RVC A;  5JVG F;  2Q2E A;  1M1E B;  4UNO A;  3CUQ A;  4BS9 A;  2FQ4 A;  3PO3 J;  4RAY A;  1BA5 A;  4L9J A;  3CQZ J;  2A69 F;  2D5V A;  4LG0 A;  4YFK F;  1CF7 B;  1WPK A;  4KJZ A;  2MG4 A;  2O8K A;  2BW3 B;  4FTH A;  5DV5 A;  5B66 C;  1EKE A;  3EYI A;  2R7F A;  4K2E A;  1RKW A;  4CCK A;  3FIS A;  1O3R A;  3A0H C;  5FFZ A;  1SFE A;  1K4S A;  3T5X A;  4M72 A;  4RBO A;  2HKO A;  5GTI C;  1Y6I A;  2X85 A;  4BH9 A;  2NVY J;  3LST A;  3JCU C;  1JHF A;  2OD5 A;  3FWE A;  3WOD F;  4G6Q A;  4DYC A;  2P7V B;  1JUP A;  4NC8 A;  3J7Y J;  3I4M J;  1RZ4 A;  2DFE A;  3H0G J;  1VQO I;  1ZR4 A;  3MN2 A;  2V79 A;  2XAJ A;  2H8W A;  2ZME A;  5A2Q Z;  4J00 A;  3BCA A;  4XLH A;  1BBY A;  3KP2 A;  3QAH A;  1DUX C;  5FO5 A;  1F1Z A;  2E35 A;  4HZF A;  2JA2 A;  3DKW A;  3FKJ A;  2A05 A;  1JKP C;  3TW6 A;  2E7W A;  1A35 A;  4X1E A;  2K9Q A;  2KJB A;  1JE8 A;  4WXD A;  2NNY A;  1ZG1 A;  1IAW A;  1KQ9 A;  4MO7 A;  1UHW A;  4I09 A;  2JZY A;  4PJM A;  1RKT A;  5J8C A;  2X4H A;  2ICW G;  2F4I A;  2CMP A;  3TO9 A;  1T08 B;  2XAG A;  3RZO J;  4UHT A;  3QYF A;  3VYT B;  2XV4 S;  1SAN A;  2EBI A;  3N4M A;  1G8X A;  3CP2 A;  2V6C A;  5BPD A;  2K7L A;  3F8C A;  2LY2 A;  3QOE A;  4Y15 A;  1IN5 A;  3N97 A;  4LIU A;  1JUM A;  3GME A;  3NRV A;  3WTT C;  5TIS C;  3HOZ J;  3PSI A;  2VQG A;  3EUA A;  3KP7 A;  5EGO A;  4L18 B;  4V2F A;  3HSR A;  4XON A;  1BN5 A;  4R8H A;  1JGG A;  2X6W A;  1BI2 A;  2LG4 A;  2XGD A;  1L3L A;  2M1B A;  2BW3 A;  4IKF A;  4P5O A;  1D1C A;  3AL0 C;  1AU7 A;  3SFZ A;  1U9O A;  3HDD A;  4F52 A;  2QLZ A;  5FJ8 J;  2CV0 A;  4E57 A;  2R93 J;  4BNC A;  2EA2 A;  4A12 A;  3HOS A;  3A02 A;  5DM6 F;  3FXQ A;  1IXR C;  1S72 I;  5DCF A;  2Z16 A;  5ILU A;  1HDP A;  1V54 H;  2VKD A;  3JSO A;  2JK3 A;  1UJ8 A;  2ECC A;  3TMO A;  5EG0 B;  1I39 A;  4UUS A;  1XMA A;  4DQ2 A;  2DMT A;  1HCR A;  2OV7 A;  1FXV A;  2JUG A;  2FD5 A;  5B3S H;  1KA8 A;  4IL6 C;  2E2J J;  4E4H A;  4CIC A;  5HDN A;  4IHS A;  4A0Z A;  1GHD A;  4KDP A;  3LAJ A;  1FSE A;  2KZV A;  4E7Z A;  5FKL A;  1V55 H;  5ERI A;  4EM1 A;  1GDT A;  1B8I B;  1YX3 A;  3I58 A;  1W4M A;  3PUF A;  1WJA A;  5F08 A;  2BHY A;  2P8T A;  3IC7 A;  3MCZ A;  3BG3 A;  3ZQ7 A;  2AS5 F;  1R4N B;  2IGK A;  5HVQ C;  1XMK A;  1X19 A;  3M07 A;  4EEF G;  2HI3 A;  2O7O A;  1SEU A;  1FY7 A;  1UST A;  2NVX J;  2NVT J;  4LIV A;  1WI9 A;  5E1W A;  5LEK A;  3BP8 A;  3L2Q A;  1ITY A;  3T8T A;  2DBB A;  2OTJ I;  3M3Y J;  4WCG A;  3QPL A;  4E55 A;  3DV8 A;  3GTK J;  3L94 A;  3HHH A;  2K5C A;  4YEL A;  1Z91 A;  2CYY A;  1DQU A;  1T56 A;  1ZK8 A;  3F8B A;  1SVM A;  2BOL A;  4U88 A;  2PJR B;  2FOK A;  3VDX A;  4DBQ A;  2DQL A;  4O5V A;  1RES A;  2QUF A;  2AQF A;  3B73 A;  3DPU A;  1EF4 A;  1FYL A;  2HTS A;  2RV8 A;  1HW2 A;  2XSJ C;  3ML0 A;  2IS4 A;  2CQQ A;  2XF6 A;  4G12 A;  1BJA A;  2MD0 A;  4YFX F;  3L2U A;  3QPT A;  1QPM A;  3RYP A;  5E3N A;  4I6Z A;  1WCM J;  3CCR I;  1B59 A;  2VQL A;  5DCM B;  1SAX A;  5AIP A;  4XOP A;  5LD2 C;  4BHC A;  2A5Y B;  1XMX A;  2DOE A;  5FLX K;  4HF1 A;  2TCT A;  2DA2 A;  1OCO H;  2YU3 A;  1H89 C;  5FLV A;  1HDD C;  1ZLJ A;  3CC2 I;  1LFP A;  1ETO A;  2BHZ A;  4A3C J;  4BQO A;  2ZNZ A;  3HYI A;  5KK1 A;  3BR3 A;  5TGT A;  2FOW A;  4OAZ A;  5FGM A;  1WHU A;  3MWM A;  4HDV A;  2RNG A;  4L9T A;  3GYH X;  3IUO A;  5L3C A;  2M5W A;  2ZXH A;  4XOT A;  2KMU A;  4A6E A;  4EGY A;  3GTP J;  1A5J A;  3BR2 A;  2DLL A;  1IXS B;  2DI3 A;  4NB5 A;  1XSX A;  1KU7 A;  2GOX B;  2Q1Z B;  3CCJ I;  3MZ8 A;  3SEQ A;  2K4J A;  5D5U B;  4IX7 A;  1OIS A;  5E79 C;  1P92 A;  1WKM A;  4LOC A;  3OOU A;  1KZH A;  1MBG A;  3BZK A;  5IP9 J;  2KIQ A;  2NRA C;  4F7Z A;  3VEP A;  5FLM J;  4RB1 A;  3RPU A;  1YO5 C;  4DJA A;  1MSF C;  4OAY A;  2Y9Z A;  1GLN A;  2VB6 A;  5IT3 A;  4ESJ A;  2IXS A;  3VSK A;  6PAX A;  1D8J A;  1QRY A;  2J5O A;  2R7D A;  1H9T A;  1JJ6 C;  4CYC A;  2A6T A;  1R5H A;  1RC9 A;  3LOC A;  2WA0 A;  3FK7 A;  1KU3 A;  5CVU A;  3DQV C;  4A69 C;  1T6S A;  4OMZ A;  1O4X A;  5JHU A;  3WTW C;  3CP8 A;  2J5P A;  1VQ7 I;  4HOB A;  1LE8 B;  3L9F A;  5F1R A;  3QPS A;  2HOA A;  1REP C;  1R71 A;  4LFU A;  3KE2 A;  3I56 I;  3CLO A;  1OFC X;  1N25 A;  4AM3 A;  3SRB A;  1XX5 A;  4EVI A;  3IRR A;  3CME I;  3AG2 H;  4PK4 A;  4XNF A;  1JUS A;  4XRM A;  4PEL A;  1DGW Y;  2CUZ A;  4LD5 A;  2JA7 J;  5J3L A;  2K9L A;  2K9N A;  1K7A A;  4HQM A;  2YU9 J;  4F92 B;  4ZYA A;  3JRI A;  1XC5 A;  4ETS A;  2BY0 A;  3AAF A;  3ZMD A;  3HSF A;  3M9A A;  1X2M A;  4Q47 A;  4RGS A;  3ZXS A;  3TDU C;  5E20 A;  4V2G A;  2WC2 A;  2P0W A;  4Y7N J;  1TWG J;  2BGC A;  1HSJ A;  1Z21 A;  2WAD A;  2R7U A;  3O6B B;  3CJQ B;  4DGW B;  2PLY A;  3TOA A;  2W00 A;  4BU2 A;  1PYV A;  4M74 A;  1BR1 A;  4GXO A;  3OYC A;  4A3F J;  1IRZ A;  4AUX A;  4LLL A;  5JFR A;  2PQ8 A;  1R1U A;  1BM9 A;  3FBI B;  1GVD A;  3I3L A;  3CCQ I;  1Z1D A;  1G59 A;  3V4G A;  3QQA A;  2V7F A;  2DPU A;  3I5U A;  4BKX A;  2GXA A;  3ZPL A;  3MFK A;  2P5V A;  1W7P D;  4M1J A;  4Z2Y A;  1LPQ A;  3IAS 2;  2ID3 A;  1K6O A;  4S04 A;  4FE7 A;  4N4N B;  2V6E A;  4MHG A;  1HF0 A;  4RMN A;  3F3X A;  2FF4 A;  1IN6 A;  5M3M J;  4A5M A;  4FCY A;  3WU0 A;  1X1B A;  2GLO A;  1SMY F;  3TOB A;  2XRN A;  4B4C A;  4XKW A;  2QA4 I;  3LFU A;  1ETX A;  3R61 A;  1LE8 A;  3CJT B;  4A3K J;  4N0B A;  1TWA J;  3FHN A;  3KCC A;  3MEX A;  2XAQ A;  2NS8 A;  4L9V A;  1PUF B;  2OJE D;  3K4K A;  2YX7 A;  1Z77 A;  5EZH A;  1NG6 A;  5HS9 A;  3OYM A;  2PMZ N;  4TV7 A;  1V4R A;  1CP9 A;  2LSO A;  4RB2 C;  5J4V A;  4H0E A;  3Q0V A;  1S3J A;  2EK5 A;  1P7I A;  2BVM A;  1W5T A;  3MD2 A;  2UUZ A;  2V26 A;  1P7J A;  4XK4 A;  3CJN A;  3EPZ A;  2CSO A;  4N4O B;  4D9J A;  2LNB A;  5CJ9 A;  3SZP A;  4CZZ A;  3GTL J;  1AI4 A;  5DUK A;  2H8R A;  3FXJ A;  1IN7 A;  3OV8 A;  4ZDL A;  1TLH B;  3MZY A;  1U6G A;  1OMI A;  3LNQ A;  3F23 A;  4A93 J;  1MBK A;  1S7O A;  3ZQI A;  5IY5 H;  2Z9O A;  4C2T A;  4IF4 A;  1UG2 A;  1TQI A;  3SZG A;  3FBN B;  5LGU A;  2M34 A;  3FMS A;  2NVQ J;  1YOV B;  5LLQ A;  4A3B J;  5J4Y A;  1W1W E;  1MIJ A;  3V8J A;  1HOM A;  1BC8 C;  3CMM A;  4P96 A;  1S7A A;  1AWC A;  2VUM J;  1EH7 A;  1HQC A;  4AIK A;  4U0W A;  2O0Y A;  4EJO A;  2GAU A;  2OCE A;  1E0E A;  2EIJ H;  2LBF B;  4D5C A;  2R7S A;  2E1O A;  2EV5 A;  3TO7 A;  1XSV A;  2ZC2 A;  3CO7 C;  4RAZ A;  1HW5 A;  3HKZ N;  1BJZ A;  1XD7 A;  1JVZ A;  3ASO H;  2KZG A;  5L3E A;  3S1R J;  1AOY A;  3I59 B;  3BR1 A;  2LRE A;  2ADU A;  4M6X A;  1JJ8 C;  1B9N A;  4GYI A;  2ZJQ F;  1SFX A;  1IF1 A;  2MFZ A;  4RA2 A;  3MKW B;  1E17 A;  3WTS C;  4KN4 X;  1U5T B;  2D1V A;  4S0H B;  3OYK A;  2L9R A;  4UY8 I;  3TP3 A;  2DT7 B;  1I27 A;  1SFK A;  2AHQ A;  4HX4 A;  5M5Y J;  2KRH A;  4B3X A;  1GK9 A;  4EJT A;  1ZGJ A;  1RIO H;  2HOS A;  1LDK B;  3OWT A;  4AYB N;  1HW1 A;  2XIG A;  1LJ9 A;  2FQ3 A;  2XHK A;  4B43 A;  5FKK A;  3G1L A;  4CCM A;  3PSF A;  1V5F A;  3EQL F;  1WJD A;  4FX0 A;  1XG1 A;  3KZZ A;  3DKY A;  2QYO A;  3GUD A;  1WVR A;  4Y52 J;  2OQR A;  2MA3 A;  3K1M A;  3BTJ A;  4I01 A;  2KL4 A;  1Z67 A;  2EH3 A;  3I64 A;  2HXI A;  4HSR A;  3VFZ A;  5LHH A;  1P9Q C;  5E3L A;  2JRT A;  3V7R A;  3L91 A;  1X1P A;  3S93 A;  4A3E J;  1MDM B;  5DM7 F;  3KET A;  1FEX A;  2VON A;  1IN4 A;  2EWN A;  3IWF A;  2DMQ A;  3WTV C;  2KPM A;  3O8H A;  1MMG A;  3WTX C;  1Y8R B;  2ESN A;  2FJ1 A;  3GFM A;  3D1N I;  1QPI A;  1ZRE A;  1AA7 A;  2WYD A;  4L0Y B;  2GA1 A;  4MTE A;  5LFA A;  2HZT A;  1YHQ I;  1SMT A;  1FIP A;  2ACJ A;  3K9T A;  4YFN F;  1LVA A;  1FNN A;  4B8X A;  3DBL B;  1BI1 A;  1R00 A;  3FKI J;  1YI2 I;  3V8L A;  1IG7 A;  1XGS A;  1E2X A;  1SVL A;  3S8P A;  2EPF A;  1YTY A;  1GM7 A;  3JRF A;  4AU7 A;  2HXO A;  1B6A A;  3DKX A;  4AD9 A;  2NYX A;  2FML A;  2KIM A;  3F9K A;  2KQR A;  2WB1 A;  3J7Z I;  4G8X A;  3LSK A;  3A0B C;  3LA3 A;  2L4A A;  1FJL A;  4OMY A;  5DEQ A;  5E1X A;  1ON1 A;  2OTL I;  1K7D A;  2A07 F;  4YFA A;  4UV8 A;  3BG5 A;  2EIL H;  4BTH A;  3W6J B;  1LDD A;  3KYC B;  1RRJ A;  3IH4 A;  2P7C B;  1A31 A;  4BXX J;  2QM3 A;  1XCV A;  1IO2 A;  2EFO A;  1K78 A;  4KNY A;  2XKO A;  5GP9 A;  5ICC A;  1JHH A;  5JVT A;  1DP3 A;  5H6R A;  3SQN A;  3Q0U A;  1YRN B;  2ZNY A;  3RKQ A;  3AG4 H;  1YS6 A;  3HRU A;  5J40 A;  1OQY A;  4BJT A;  1POG A;  4I7H A;  4XLF A;  1ZN2 A;  1PUE E;  4EJU A;  1Z7U A;  5FLX Z;  3OYF A;  3K4N A;  5DYM A;  1AKH A;  1QZY A;  2VJ4 A;  2KP6 A;  4HDU A;  1ZAO A;  3I55 I;  2ZSI B;  1R7J A;  2E60 A;  2Y0S N;  1TQP A;  2EFW A;  1W36 C;  3GO5 A;  4IEJ A;  1IUY A;  3QP5 A;  2GZW A;  2QSG X;  3O3K A;  3HKZ A;  3QU3 A;  2XGE A;  4W1U A;  2ID6 A;  5LRR A;  5GAE J;  4BGD A;  3FK6 A;  2Q2E B;  2L7K A;  4UV9 A;  5EYR A;  3CO6 C;  4KA4 A;  3CUQ B;  1VTN C;  1J09 A;  1HBX G;  4GCV A;  1MH3 A;  2F6C A;  2VBY A;  5E8G A;  1VQM I;  4FHT A;  5DS9 A;  4LG0 B;  2MAB A;  2MD5 A;  3I0T A;  4BE1 A;  4CXF A;  1VF9 A;  2K9S A;  4Q48 A;  1I3A A;  1J2X A;  1G3S A;  2XGC A;  5HOO A;  2VPL A;  1YG2 A;  3BZC A;  1N78 A;  1ETK A;  5JHF A;  3E0J B;  1ON2 A;  4AYB A;  4IQJ A;  4KUM A;  2R7T A;  3JW4 A;  4RB3 C;  2HGC A;  4ZYE A;  4M6Y A;  1G4D A;  2K40 A;  5DUI A;  1BIA A;  1DP7 P;  2B9S A;  2ZME B;  2IS1 A;  3KZI C;  5DD4 A;  1YJW I;  4BHP A;  3RDI A;  3TED A;  4PJJ A;  2VN2 A;  3JRE A;  4XMY A;  3LSP A;  1A04 A;  3OYJ A;  4HX7 A;  1IRX A;  4ZDP A;  1QNT A;  4MQ9 F;  3IKV A;  4M6V A;  3A03 A;  2PFB A;  3QYB A;  5IPA A;  2M4G A;  1TBX A;  2OC6 A;  1T2K A;  1Y0U A;  3BC8 A;  3C2G A;  4FE4 A;  1IDZ A;  2VJ5 A;  2Z1D A;  3JRD A;  4C3J J;  1J9I A;  2F5C A;  1I6X A;  4E7S A;  4XLA A;  2M3A A;  3WGH A;  2M8G X;  2K85 A;  1Y56 A;  1W0U A;  2DFH A;  3K4M A;  3WGI A;  2DAO A;  3M8F A;  5D4R A;  3FZV A;  4BQA A;  4JX4 A;  2UWM A;  3P5J A;  1WRJ A;  5IT9 K;  5EGO B;  4E7L A;  2YSR A;  2IRF G;  3GTM J;  1XDU A;  1QA6 A;  2LTP A;  3SDG A;  1D5Y A;  1UB9 A;  3W3C A;  3FMQ A;  3F72 A;  1YIO A;  2EQR A;  4PUS A;  4E7K A;  1OCZ H;  2ZB9 A;  3ABK H;  3MQ0 A;  5D5V B;  2QKL B;  1BR2 A;  4BE2 A;  2FU4 A;  2XAF A;  5L3D A;  1JXS A;  1GK0 A;  2GQQ A;  1ZLK A;  3T8R A;  3FXL A;  4E7J A;  1PP7 U;  5K5Q A;  4XKB A;  4MNU A;  3W2A A;  3A2K A;  1MGT A;  3WU2 C;  3K2Z A;  4XKC A;  1UEL B;  2W82 A;  4BY7 J;  4UUS B;  2VE9 A;  2QZ8 A;  4MFD A;  1QZE A;  4P55 A;  3DEU A;  3BRO A;  5FRO A;  1O3S A;  1L0O C;  5IOY A;  4EJV A;  5EJC A;  1X1C A;  4DZP A;  1ORK A;  2H1L A;  2R4G A;  1U78 A;  1WQ2 A;  1R5I D;  2WBM A;  1B72 A;  3OIQ A;  2VOP A;  1Z05 A;  4BJ5 C;  2L9V A;  2JA6 J;  2P6T A;  2W48 A;  4M73 A;  2DJI A;  4UB6 C;  5D4S A;  1XSD A;  2R7Q A;  4OIN F;  2KIS A;  2DN0 A;  3KYD B;  4A3G J;  3H9Q A;  1FC3 A;  1TWF J;  1MJ9 A;  4PFO A;  3KPH A;  4ZZL A;  2DA5 A;  4JK1 X;  2ADV A;  3E5X A;  3WHB A;  1V5E A;  3EYY A;  1VQL I;  1TNT A;  2V1D A;  2FBI A;  1JW0 A;  2AE4 A;  2YS9 A;  2O61 A;  5L3F A;  1H2G A;  2M4K A;  3HGY A;  4PFP A;  2I5U A;  1IN8 A;  2V9K A;  5J6X A;  5E1Z B;  4R1H A;  2PX9 A;  5BOX A;  2KRF A;  2VL8 A;  1U8B A;  2FNP A;  3G2B A;  3LSI A;  2QBY A;  4KT6 A;  4BY1 J;  4P1W A;  4E70 A;  2KDZ A;  1ZRF A;  5H2F C;  5C3E J;  5F27 A;  2QWW A;  2BXY A;  3SEZ A;  1OCC H;  1N75 A;  2DTR A;  1BIB A;  3PFY A;  3L2C A;  5LGT A;  1YX5 A;  3HRS A;  4H4K C;  4XLE A;  2UZK A;  2FX0 A;  2OZ6 A;  4KFC A;  4M9X A;  3VPR A;  3VB2 A;  4LB5 A;  3DP7 A;  3H92 A;  4LGW A;  2P4W A;  2FNA A;  2W1O A;  4ZYD A;  3A01 A;  3RJP A;  3DTI A;  4QSH A;  3VSL A;  4CSW A;  3E6C C;  4ENM A;  2IBD A;  4MEX F;  2Q0O A;  3PIP F;  1FLI A;  4HLY A;  3S1Q J;  1FYK A;  1CQT A;  2BE5 F;  2OPT A;  2ELH A;  2K27 A;  3V8K A;  1HA8 A;  2MLG A;  1XTA A;  4ZYH A;  3OYE A;  2L4M A;  3TO6 A;  3H0D A;  2KRC A;  4L9N A;  4A0Y A;  1T39 A;  3W6K B;  5KNL A;  2HTJ A;  3J80 Z;  5D6E A;  2WWY A;  2HPM A;  3FHZ A;  1T95 A;  1D0X A;  1BOA A;  4F93 B;  1ZYR F;  1F36 A;  1V3F A;  4JYK A;  3GZ5 A;  3R60 A;  1MH4 A;  4DNC A;  2IA0 A;  1UCR A;  1U3E M;  3GLL A;  3IWZ A;  3KZY A;  5HDK A;  3Q9V A;  3DBH B;  2JN6 A;  4ZH4 F;  5LRS A;  1I1S A;  2FA5 A;  4FIS A;  5H20 A;  5CQG A;  3WGG A;  2WV0 A;  4OIO F;  3HZJ A;  3S2D J;  1QHH D;  1T38 A;  4FET A;  4AID A;  4A0X A;  2XDV A;  9ANT A;  2BZT A;  1S5L C;  3OYD A;  2V4J C;  3GTO J;  4YFB A;  4M3B A;  2E5Z A;  3FMR A;  3B02 A;  3WTU C;  2LK2 A;  4HYE A;  1TW2 A;  3HOV J;  1UAA A;  3MMY B;  2KFD A;  1NK3 P;  2HVS A;  2CUF A;  4PGH A;  2AXT C;  3BR5 A;  2KLO A;  3FXU A;  3R0J A;  4ENJ A;  3ZMT A;  3ZQL A;  1ZRC A;  3S3O A;  4QLC U;  5D8L B;  1RI7 A;  4CYC B;  2DW4 A;  5KHD A;  1LQ1 A;  4BUP A;  1V5G A;  2LKX A;  1Y1V J;  2KHM A;  5FRN A;  2HPI A;  4HF0 A;  4FAS D;  1OCR H;  4UVB A;  3HEF A;  2E19 A;  3IP4 B;  1MMS A;  1VQN I;  3L2R A;  2L7F P;  1R6R A;  1HLV A;  5E8I A;  1STZ A;  2CQN A;  3JTH A;  2CFX A;  1UHM A;  1VI0 A;  1MZB A;  1JKQ C;  2E2H J;  1BL0 A;  3MZH A;  4LLG F;  3PQJ A;  4E56 A;  2QEN A;  1JT0 A;  1FT9 A;  4G7Z F;  2VBZ A;  2VPR A;  5GPA A;  5HLT A;  1MMN A;  3MKL A;  3CCU I;  1Q1H A;  4DW6 A;  3SDB A;  1IV8 A;  2PMH A;  2V9V A;  3T0Y A;  3K4C A;  5ILS A;  2VOD A;  1K83 J;  2O6G E;  4M3D A;  1BC7 C;  1R1T A;  3D5S C;  2DT5 A;  1GK1 A;  2EV6 A;  4U7D A;  5CVI A;  3M8J A;  2WAE A;  1ZHF A;  2BEO A;  4K2G A;  4ENK A;  4DYR A;  3RQ4 A;  1KEH A;  1FOY A;  3WE3 A;  2G9W A;  3U1D A;  2CV1 A;  3RQI A;  3SZT A;  4KIS A;  2R7W A;  1E3A A;  1VQ6 I;  4KIB A;  5F0F A;  1ENH A;  4Z6Y A;  1X4P A;  3LWF A;  3HOU J;  4RLF A;  1BW6 A;  1RR7 A;  2IP2 A;  2XPV A;  4CA0 A;  4AIJ A;  2FE3 A;  2MBF A;  3PIO F;  2OZU A;  1TT0 A;  1Z3X A;  3H36 A;  4KIG A;  4RGU A;  4NUB A;  4XLN F;  3QP6 A;  2GM4 A;  1ZAR A;  2FRH A;  4UUV A;  3C1D A;  2DOF A;  2BY2 A;  3KEO A;  3ABU A;  3CJR B;  4M3G A;  1G2H A;  1FPQ A;  2R7O A;  3E6M A;  2XPW A;  1O7F A;  4CGZ A;  2HS5 A;  1TNS A;  4HA8 A;  1YJ9 I;  2CO5 A;  4XBF A;  3S3M A;  2Q8K A;  3T1B A;  3EUK L;  5J8F A;  3H5A A;  1NTC A;  5HDG A;  3WTY C;  3I71 A;  1YQA A;  4KIC A;  2DA4 A;  2CV2 A;  1R58 A;  3ZR8 X;  4RM3 A;  3BQY A;  2K3F A;  4A3I J;  3UR3 C;  5K7F A;  2F5F A;  2VQH A;  3TGN A;  3JAM Z;  3DTE A;  2L2O A;  5D5W B;  2H94 A;  2XAU A;  1D0Z A;  3MKZ A;  3PNT A;  3UNG C;  4BEH A;  1YIJ I;  1NG7 A;  1WJC A;  3UKG A;  2HQA A;  4C3H J;  4DIQ A;  1G3T A;  5FRM A;  1OYW A;  2CW0 F;  3FXR A;  3R4K A;  4F55 A;  4IHV A;  2R5Z A;  2DYS H;  5KAI C;  3FXO A;  1X3U A;  1VQK I;  4PEM A;  4Q4Z F;  1JX9 A;  1YW8 A;  5TJJ A;  2E36 A;  2PI0 A;  1ETQ A;  3CC7 I;  2O9L A;  2TRT A;  3SRA A;  3ERE D;  1MSE C;  1I6H J;  3B6C A;  3V7C A;  1FOX A;  2PG4 A;  3L09 A;  4IVN A;  5DTD A;  3E1S A;  2MW8 A;  5KVR A;  3S2H J;  3J81 Z;  1D1A A;  4XRS A;  4ZYG A;  1ZRD A;  4B47 A;  2ZXJ A;  1NH3 A;  1D3Y A;  1FX7 A;  4BAY A;  2GOM A;  4KYW A;  4UB8 C;  2NAZ A;  2ETH A;  3D0S A;  3GF2 A;  2XGX A;  3S15 J;  1HC8 A;  1KU9 A;  2QQ9 A;  3ABL H;  3AL0 B;  2ZKZ A;  3G1M A;  3GZN B;  1DU6 A;  3KX2 A;  1J75 A;  2I8D A;  1MD0 A;  3O8G A;  4IPA A;  3FGT A;  3BG6 A;  2OU2 A;  1GKF A;  2LOO A;  2VBW A;  3LQR A;  4CZC A;  4LJZ F;  4BAC A;  1KGS A;  4BQN A;  1HST A;  1O7L A;  2D2W A;  5FFX A;  2XC7 A;  4NNJ A;  3ZMU A;  3S1N J;  1FBU A;  1PNL A;  3HPG A;  2COM A;  2N8G A;  2LH9 A;  3ML6 A;  2VOO A;  1FP1 D;  4EQQ A;  4BYY A;  3CDH A;  5GTH C;  1IXC A;  2RC4 A;  4UVA A;  3I54 A;  2R5Y A;  5FKM A;  1TW3 A;  3QU6 A;  2HYF A;  2E34 A;  1YIT I;  5E17 F;  2L01 A;  5M3F J;  3M1E A;  3RTR A;  4WWC A;  3I53 A;  3K4L A;  3GWZ A;  1GV2 A;  2FUG 2;  1JKR C;  2RNJ A;  1QHG A;  2QSF X;  2XPU A;  3K1P A;  1BR4 A;  3GTQ J;  1A36 A;  3JRH A;  3ZQC A;  1SFO J;  3BDD A;  2X48 A;  4FQG A;  4EJW A;  3KLO A;  2QSH X;  3HUG A;  2HYG D;  4C9Y A;  1N77 A;  5L3B A;  1KYW A;  3TP0 A;  5C4X J;  4KT5 C;  4P9U A;  4ZDO A;  2M87 A;  4LK1 F;  1ZH5 A;  2VC1 A;  2HDD A;  4IRG A;  2VXD A;  3RI4 A;  1SFU A;  3OYB A;  1Q1V A;  3Q0W A;  1PJR A;  1WZ2 A;  2HVR A;  3GTJ J;  4RB0 A;  4L5E A;  1EJ9 A;  1F4K A;  3KLN A;  2WAF A;  1AI5 A;  2X51 A;  4YIR X;  5DDG A;  2UXX A;  2ME6 A;  3TW7 A;  2X6X A;  3FF5 A;  2CQX A;  1WJE A;  2LLK A;  4CYD A;  1A6Q A;  4ANJ A;  4ZC3 A;  5IYC J;  4E7I A;  3GXO A;  2M7B A;  4S05 A;  2E1M C;  3B6A A;  2JPC A;  3OSF A;  1QBJ A;  2CFO A;  3KP4 A;  4MFE A;  2W25 A;  1FBS A;  3TDZ C;  1GVJ A;  2DA6 A;  3MVP A;  4MLO A;  3WG9 A;  3S14 J;  3RKX A;  2WAQ N;  4EGZ A;  4IRI A;  1S9H A;  1K78 B;  1MNE A;  2DA1 A;  5H6Q A;  3CCV I;  2L0K A;  1ZKG A;  5BS6 A;  5HLH A;  2GIZ A;  1APL C;  1YW7 A;  3E5U A;  3HOY J;  4CCJ A;  3JRC A;  2ZJ2 A;  3H5N A;  2EZL A;  3W2V A;  5CVJ A;  1Y1W J;  2L54 A;  2VXZ A;  4BDZ A;  1K6Y A;  2NXN B;  5TRD A;  3GTG J;  3CD6 I;  3SYT A;  1AKH B;  4XKV A;  2QKM B;  4Y4R A;  3ZQG A;  3K70 D;  1T8I A;  4JBA A;  4HBL A;  4NDL A;  5J47 A;  1MMD A;  2YR2 A;  4IHX A;  2BVL A;  3FXK A;  2Z33 A;  2FEZ A;  3CCS I;  3MAJ A;  1T33 A;  3DLL F;  3PJR A;  4BDY A;  2R0Q C;  2GA2 A;  2HDW A;  4L5J A;  3ZRG A;  1AI7 A;  1TP4 A;  1K79 A;  2X0L A;  1XGM A;  2TDX A;  2XRO A;  4I76 A;  2KIF A;  3DWL E;  3Q9S A;  4YG2 F;  3SRC A;  2PMZ A;  2IA1 A;  4IHW A;  4A6D A;  1FYM A;  2CW8 A;  1XGN A;  4EAT A;  2E1C A;  2DFI A;  2Y30 A;  3H3Z A;  5HS8 A;  3OIO A;  3L1P A;  3W6V A;  3J7A Y;  4D7M A;  2DO7 A;  1AHD P;  3ERM A;  2O03 A;  3HOW J;  2ZO4 A;  4HV5 A;  2CW7 A;  4M9Z A;  3AFH A;  5HLI A;  1QZZ A;  2OBP A;  3G73 A;  4IHY A;  1OKR A;  1Y0N A;  1USS A;  2CWE A;  4CCN A;  4HV6 A;  3BJO A;  1AJP A;  2COB A;  2BY3 A;  5CQE A;  4L5I A;  2JPB A;  1IRF A;  1JTX A;  3H5R A;  1TT5 B;  2EJR A;  3COA C;  2OAZ A;  3K7A J;  2YX4 A;  3TKY A;  4X6A J;  1JTY A;  3HB9 A;  2DCE A;  4QIW N;  2HDC A;  4OWR B;  1HKS A;  1ETW A;  2CS3 A;  2X1C A;  2LY9 A;  2X6Y A;  2E7X A;  2VIX A;  4N9I A;  3OS2 A;  3LFK A;  2ZFW A;  1ULY A;  4N9H A;  4JX6 A;  2CGP A;  1MKM A;  3EET A;  2W4S A;  2VKE A;  3OY9 A;  4MEY F;  1ZEL A;  4GDF A;  3G1O A;  1I5Z A;  4B3A A;  4F91 B;  2R7X A;  2EZH A;  2GXB A;  4YRV A;  4A3J J;  3DBR B;  3V42 A;  1KON A;  2JVG A;  4CDG A;  4XQF A;  2QCO A;  2R92 J;  1RNL A;  3DF8 A;  1R22 A;  4E6K G;  3I4P A;  3IH3 A;  4C2M J;  1IV6 A;  3LSH A;  3DU6 A;  3HG9 A;  1X1A A;  2DMP A;  5E3M A;  3I4N J;  2W7N A;  5B1A H;  3WU1 B;  1K5Q A;  4RAF A;  1IUF A;  2VC0 A;  2OA4 A;  2W84 A;  2DA3 A;  4WF2 A;  3KYL A;  2WYB A;  1D8K A;  1W7P A;  1OCP A;  2DOA A;  4BBR J;  1T0F C;  3HRM A;  3RPU D;  3OL3 A;  4BXU A;  1BW5 A;  3WG7 H;  1R4M B;  1B72 B;  4RS8 A;  4IJA A;  2Y9Y A;  2CQ7 A;  2K9M A;  2XB0 X;  2EA4 A;  2F5V A;  2IS6 A;  2HVQ A;  2Y75 A;  2P6S A;  2ZXW H;  3F8F A;  1BI0 A;  2LR8 A;  5HNH A;  4O3M A;  2RAE A;  2IS2 A;  4XRF A;  3S3N A;  4I99 C;  3EUH C;  2IEK A;  2Z99 A;  2HQN A;  1MBF A;  2IVM A;  3TL4 X;  3H1C A;  3H3V K;  3LSM A;  1CGP A;  3L7W A;  4G7H F;  2QBY B;  2EIK H;  2O3F A;  2ME0 A;  3IL2 A;  2B63 J;  1PP8 F;  3CLQ A;  2F5D A;  4DZJ A;  2K02 A;  1WJ5 A;  5CKT A;  4XLC A;  5F64 A;  4I0A A;  4NC6 A;  4PSX A;  3TQN A;  3ZQF A;  2F4O B;  1FIA A;  3VOE A;  2DT6 A;  3BJ6 A;  3FX3 A;  4A2U A;  5BPI A;  2M9H A;  1TWH J;  1EH6 A;  3ONQ A;  1QQI A;  2XAH A;  4HG2 A;  4Y33 A;  2GIV A;  5KCM A;  1AJN A;  1P6R A;  2Z2S B;  1J5Y A;  2DJN A;  2V1N A;  2W24 A;  3A01 B;  2RQP A;  3HSE A;  4D7N A;  3KIO A;  1VFC A;  4IQ4 A;  3K1N A;  4U87 A;  2QF7 A;  2VT3 A;  5BQT A;  1FP2 A;  2D45 A;  5K5R A;  1SD7 A;  4IXA A;  2H27 A;  2DDA A;  2HEO A;  2Y31 A;  1FBQ A;  4HAM A;  3X2Q H;  2HNH A;  3OL4 A;  1UMQ A;  3BLY A;  3EDP A;  3GX4 X;  3FM5 A;  2KIU A;  2LYC A;  4W97 A;  4A5N A;  2STT A;  3S32 A;  2XAS A;  3HHG A;  1D0Y A;  1WI3 A;  3LA2 A;  1ZG5 A;  1FZP B;  1GXP A;  2DK5 A;  4UUT A;  2CU7 A;  4XIC A;  1OR7 C;  1VQ9 I;  1YYV A;  3HOX J;  3BPV A;  5ED4 A;  3DCF A;  3OIP A;  2RGV A;  2E5N A;  4ZTJ A;  3CZ6 A;  4I2O A;  1GUU A;  1GXQ A;  2HU9 A;  2HYJ A;  3GFL A;  2VT2 A;  1F5T A;  1H88 C;  1E3O C;  2OQG A;  3P9K A;  2CUE A;  2F2E A;  4CCL A;  1S29 A;  1UG0 A;  2KDO A;  2Y0S A;  1EA3 A;  2LKS A;  4RAG A;  2DTZ A;  3KFW X;  2E1M B;  4G6D A;  4DOZ A;  2E2I J;  1TZL A;  3N05 A;  5HLG A;  2VAS A;  4NC7 A;  1MND A;  2CJJ A;  1KYZ A;  2H09 A;  2MGQ A;  1W0T A;  2HOT A;  2ZJP F;  1YJN I;  5F04 A;  5CVR A;  3E97 A;  4D0P A;  4J01 A;  5E3O A;  2ZJR F;  1X58 A;  2A5W A;  2LDU A;  5JI6 A;  3JR9 A;  1OCT C;  4WKT A;  3OOP A;  1FMW A;  2H1K A;  1ODD A;  3NWT A;  3AKZ A;  2X1E A;  4U7B A;  2IGO A;  3PNY A;  4G9Y A;  1FWZ A;  1ONV A;  4Y3O A;  2VKH A;  3HPH A;  2A3S A;  4II2 A;  2XF7 A;  2YUS A;  5GAG J;  2Z5U A;  4XSZ F;  3M7G A;  4ZTF A;  4PJN A;  4GFB A;  3DXJ F;  1CF7 A;  2L7M P;  2NOG A;  5J1Y A;  3PNV A;  3RIR A;  1QVT A;  1DDN A;  1LFU P;  1RUO A;  2P5K A;  2ESH A;  4O6J A;  2VJJ A;  1FM2 A;  2WY7 Q;  1LFB A;  2JTV A;  4RGX A;  2JA5 J;  1XPX A;  2LVS A;  3VOD A;  2AE5 A;  3A1Y A;  2DMN A;  2ZFU A;  3LAP A;  2IW5 A;  3K6G A;  2NVU B;  3CCY A;  2JMW A;  4KN7 X;  2ZXI A;  4B44 A;  3D5L A;  2VQC A;  3GZ6 A;  1FTZ A;  3E3V A;  1U8R A;  5EZG A;  3OYL A;  3GEZ A;  3FIW A;  2VJI A;  1OJL A;  1GT0 C;  4OU0 A;  3OYN A;  2RN7 A;  5E18 F;  1RUN A;  1R49 A;  1OYY A;  1K61 A;  1VZ0 A;  3FGR A;  4QPO A;  3WTZ A;  4NHJ A;  1LEB A;  1YFH A;  2IA2 A;  4LK0 F;  2PMU A;  2Y48 A;  4CHU A;  5GAD J;  5IP6 A;  2KT0 A;  4ON0 A;  3LL7 A;  1Z9C A;  4PSW A;  1O57 A;  3HTU A;  4BE0 A;  1BI3 A;  5CYV A;  3GFI A;  3ZOB A;  3OR2 C;  3IHU A;  4XOR A;  1VQ4 I;  3L2W A;  2M8E A;  4PDK A;  1IDY A;  4ESF A;  2JA8 J;  1ZTR A;  2RKH A;  4BWC A;  2DU9 A;  2O5R A;  5CPR B;  3WE2 A;  2MH2 A;  2G0E A;  1FOW A;  4OIQ F;  4NBQ A;  1F43 A;  2L02 A;  3HBL A;  3P9C A;  4GO1 A;  1U5T C;  4K2F A;  3HC7 A;  3ZMS A;  1H8A C;  1Z0X A;  2FSW A;  4X0G A;  4BBS J;  2RDP A;  3HIF A;  2WY8 Q;  5ICF A;  1TWC J;  4HQE A;  1H9G A;  1I1G A;  3VWB A;  3G4S I;  3BR6 A;  3BTI A;  3GBG A;  4FT8 A;  4RDU A;  4LLN A;  4LG3 A;  3U9G A;  2XKP A;  1RR8 C;  1OLT A;  4RM2 A;  3S8R A;  1I50 J;  2AE3 A;  1R5G A;  4M3E A;  3GW2 A;  3ZQH A;  1WGX A;  1SAU A;  4PCQ A;  4PZJ A;  3ZGK A;  1P4X A;  4HNU A;  5M5X J;  2A68 F;  5EG0 A;  1LVK A;  2EZI A;  3G3Z A;  3ISP A;  3WHC A;  1S6L A;  5BMZ A;  4AC0 A;  3H9J A;  4BJ6 C;  5J1R A;  2H6C A;  4EM2 A;  4LMY A;  4IZZ A;  3ASN H;  3GVA A;  4HNV A;  4HNT A;  4BHB A;  4BEH B;  1D1B A;  3OMY A;  3JTQ A;  3BG7 A;  3KEY A;  4BL0 B;  3FM3 A;  3K4J A;  1Z7L A;  3BCB A;  1GHC A;  5HNF A;  4OOI A;  2FXA A;  1B8I A;  2R5Z B;  1Z6R A;  5D8K B;  3QWL A;  2LC2 A;  1O3Q A;  1WWX A;  4IOA F;  2DDB A;  5FD5 A;  2KJC A;  3OSG A;  1ZQ3 P;  3P7N A;  5B1B H;  1E3H A;  1KQ0 A;  2G7U A;  5F0C A;  3BWG A;  2JUC A;  2W57 A;  4BXF A;  1YW9 A;  3IRQ A;  1RPW A;  3HM5 A;  3IKT A;  1WSU A;  4HF2 A;  1IRG A;  2LMD A;  3RZD J;  3BPX A;  3CUO A;  2PJP A;  5FKN A;  1QU3 A;  2M2E A;  3VYR B;  3OS0 A;  2HWV A;  4OIR F;  2QVO A;  1YE9 A;  1C0W A;  3CF2 A;  2PJR A;  1KU2 A;  2QQA A;  4HLX A;  3F8M A;  2VE8 A;  4GGG A;  2DA7 A;  1QO0 D;  2QQB A;  1DPR A;  5IOZ A;  3HXL A;  3ECO A;  2I10 A;  3PO2 J;  1FXH A;  2F4M B;  2M30 A;  3D5R C;  4DYQ A;  5DCM A;  1XN7 A;  4G7O F;  2XUB A;  1UZC A;  3H3U A;  2XB5 A;  2R7R A;  2ISZ A;  3K3W A;  1K5S A;  3E6D A;  3KP5 A;  1XB4 A;  1U0J A;  4AWX B;  3JRG A;  1K4T A;  3E5Q A;  4WXC A;  5JR3 A;  1X4O A;  5IYD J;  1G6N A;  2X6O A;  3SXY A;  3AG3 H;  4ESB A;  1G3Y A;  3SJM A;  3O2P E;  1MMA A;  3F6V A;  2DMU A;  2R3S A;  4B48 A;  2JRM A;  2F48 A;  2K3P A;  2JQ7 A;  5B5E C;  3IAM 2;  2R5Y B;  3AG1 H;  2PEX A;  1EV7 A;  1LDJ A;  1T0F A;  4LIT A;  2LF8 A;  1SD6 A;  4GRI A;  2RQQ A;  1OYI A;  3PUB A;  1GM8 A;  3CCM I;  4L0Z B;  4U0V A;  3CUQ C;  5IP7 J;  1DU0 A;  2JT1 A;  4R79 A;  4WKU A;  2DFF A;  2DXI A;  3K2A A;  1B9M A;  1MBH A;  2XF5 A;  2D1H A;  3BJA A;  5LBQ A;  2CRG A;  1Z6T A;  3HUG B;  4HW0 A;  3PM1 A;  1JI8 A;  3BR0 A;  5D6F A;  1LEA A;  1BOB A;  3EUH A;  2A61 A;  1AJQ A;  3LSR A;  4QPQ A;  3P9I A;  2ISY A;  1I3Q J;  3QYE A;  1MBJ A;  2FMY A;  2K4B A;  4M71 A;  1E3P A;  3CTA A;  1WJF A;  5A2Q K;  3OR1 C;  1HXD A;  3Q3S A;  2CQK A;  4YIF A;  3FXM A;  3RYR A;  1KQ8 A;  3OYI A;  5HOD A;  4A3D J;  5FB2 A;  2UV1 A;  3ESW B;  2NOJ B;  5FKO A;  1AI6 A;  2ZME C;  1DGR M;  3K69 A;  4D5F A;  2C6Y A;  4A3L J;  5IT9 Z;  5K5O A;  4CH7 A;  5CVV A;  1GM9 A;  4IRH A;  5EDN A;  1WH5 A;  2IAI A;  3ABM H;  1ZGW A;  1LUJ B;  4JQF A;  1YS7 A;  3ELK A;  2MC3 A;  1SD4 A;  3ABT A;  4MQV A;  4U0Y A;  3C18 A;  3F0C A;  1MJA A;  4OIP F;  2HOE A;  3BTL A;  4ITV A;  2H6B A;  4QWQ A;  3CDI A;  3CMA I;  1PNM A;  4LB6 B;  3W2W A;  4HX8 A;  2EFN A;  2WB1 N;  3QRF F;  2BY1 A;  2B7E A;  2VI6 A;  3JSP A;  3OS1 A;  4I98 B;  4C2U A;  1PVE A;  3NQO A;  3C7J A;  1X1D A;  1IW7 F;  4G94 A;  2ELJ A;  3A4C A;  3DLA A;  1J0R A;  1H0M A;  1TL8 A;  2GBY A;  3C2H A;  1D5V A;  5LHG A;  1LB2 A;  1OR7 A;  2BBY A;  1B1B A;  2HZD A;  3PQK A;  3F8N A;  2X1D A;  3ZMV A;  1G3W A;  3QOD A;  3ULQ B;  5ICG A;  4WK8 F;  3JTG A;  1ZR2 A;  3LA7 A;  4KIT B;  4UVC A;  3ZQQ A;  3RSN A;  3CF5 F;  1ACI A;  3JTR A;  4XL9 A;  2MLK A;  1VQ5 I;  2B0L A;  2BYV E;  2R7V A;  1JT6 A;  3M8E A;  2OF7 A;  3HRT A;  3K70 C;  4WKS A;  4E7H A;  3REO A;  1Z3Y A;  3KEQ A;  2HQR A;  2LY1 A;  2V1X A;  1QVU A;  1MJB A;  2DYR H;  2QEX I;  4IHT A;  1J59 A;  4XLP F;  2M45 A;  2L5Q A;  2P81 A;  3J80 K;  2CG4 A;  4KMF A;  2EB7 A;  2RRE A;  3IH2 A;  4A3M J;  2AXL A;  1ETY A;  2BV6 A;  1VND A;  1ETV A;  1NK2 P;  5LEJ A;  1OR0 A;  3DU5 A;  2JVH A;  2M0C A;  1UFM A;  1PUF A;  3BY6 A;  3CDL A;  2FBK A;  5EEG A;  3CMY A;  2EIM H; 
#chains in the Genus database with same CATH homology
 3KYL A;  3LSG A;  2WYB A;  2CUZ A;  2DOA A;  2K9L A;  1T0F C;  3CES A;  3RPU D;  3OL3 A;  5KNL A;  1WJB A;  2HPM A;  4F3Q A;  4D1Q A;  1T95 A;  1D0X A;  2M7A A;  4F93 B;  4ZYA A;  4F92 B;  3VYU B;  2JSP A;  2K9M A;  4DBR A;  2F5V A;  3ZXS A;  3FDY A;  2IS6 A;  2HVQ A;  4YF9 A;  2P0W A;  2R7U A;  2WAD A;  1Z21 A;  2M0M A;  5HNH A;  2IS2 A;  2WYE A;  3CJQ B;  3DEE A;  4DGW B;  3S3N A;  2W00 A;  5CQG A;  4BU2 A;  1PYV A;  3EUH C;  1BR1 A;  3OYC A;  3H9G A;  1QHH D;  4FET A;  2XDV A;  3TL4 X;  3FBI B;  3LSM A;  3I3L A;  3OYD A;  2V4J C;  1G59 A;  4YFB A;  2E5Z A;  4YEJ A;  1UAA A;  2V7F A;  3MMY B;  2HVS A;  3K4B A;  1WJ5 A;  5CKT A;  4XLC A;  4M1J A;  2LBF A;  4PSX A;  3IAS 2;  2KLO A;  2OUM A;  3K10 A;  3S3O A;  4N4N B;  2DT6 A;  4NQW B;  4XM3 A;  2V6E A;  4RMN A;  2VLA A;  2AQE A;  3ONQ A;  4HG2 A;  4Y33 A;  1X1B A;  5KCM A;  1AJN A;  5KHD A;  1KEC A;  2Z2S B;  2V1N A;  1MW7 A;  2CH0 A;  1V5G A;  4BUP A;  2KHM A;  4XKW A;  1LKX A;  4IQ4 A;  3LFU A;  4U87 A;  5FRN A;  4II3 A;  2HPI A;  4FAS D;  3FHN A;  3IP4 B;  3H35 A;  3L2R A;  3HL2 A;  1R6R A;  3K4K A;  2HNH A;  3OL4 A;  3BLY A;  1NG6 A;  3OYM A;  3OYH A;  2LYC A;  1CP9 A;  2ZSH B;  4E56 A;  3S32 A;  4CUG A;  4WKV A;  5HLT A;  1D0Y A;  1MMN A;  2L9N A;  3SDB A;  2BVM A;  3K4C A;  3MD2 A;  2UUZ A;  1OR7 C;  2V26 A;  3EPZ A;  1AI4 A;  4JOM A;  4N4O B;  4D9J A;  3OIP A;  4HRI A;  2E5N A;  4ZTJ A;  3CZ6 A;  4XR6 A;  2WYC A;  3D5S C;  1GK1 A;  2HU9 A;  3RCO A;  3VYS B;  4ZDL A;  3M8J A;  4CCL A;  2WAE A;  2KDO A;  1UG0 A;  2Y0S A;  1EA3 A;  4PJL A;  4CCO A;  4K2G A;  4C2T A;  2E1M B;  4HPQ A;  4DOZ A;  3RQ4 A;  1TZL A;  3N05 A;  3SZG A;  2VAS A;  1KEH A;  4NC7 A;  1MND A;  3FBN B;  3DTK A;  4HEA 2;  3M1C A;  2CV1 A;  3CMM A;  4J01 A;  4KIS A;  3L2V A;  2R7W A;  2A5W A;  1E3A A;  4WKT A;  1FMW A;  1E0E A;  1X4P A;  2LBF B;  3NWT A;  4ZJZ A;  3AKZ A;  2X1E A;  4U7B A;  2R7S A;  2MYS A;  2IGO A;  4RLF A;  3PNY A;  4Y3O A;  4C30 A;  3I9V 2;  3HOT A;  4CA0 A;  3OYG A;  2VKH A;  2IGN A;  3HPH A;  4II2 A;  2XF7 A;  1JVZ A;  1TT0 A;  1Z3X A;  4ZTF A;  4NUB A;  2LRE A;  4PJN A;  3CJR B;  3PNV A;  2MFZ A;  3MKW B;  2WAQ A;  2R7O A;  3ZCO A;  1ERD A;  1PNK A;  2VJJ A;  3LMM A;  1FM2 A;  2CUJ A;  2WY7 Q;  3OYK A;  2DT7 B;  1SFK A;  4HST A;  3PL8 A;  2KRH A;  4B3X A;  3S3M A;  1GK9 A;  3EUK L;  3H5A A;  1LDK B;  2AE5 A;  3A1Y A;  3OWT A;  3U21 A;  2ZFU A;  4B43 A;  3MKY B;  2CV2 A;  3K6G A;  4CCM A;  3ZR8 X;  3PSF A;  1V5F A;  2ZXI A;  4RM3 A;  3TBI A;  3UR3 C;  1FMV A;  1WJD A;  4B44 A;  2VQH A;  4BQQ A;  3DTE A;  3D5L A;  2L2O A;  2VQC A;  3DKY A;  2XAU A;  1D0Z A;  3MKZ A;  4XN0 A;  3PNT A;  3OYL A;  3UNG C;  4BEH A;  1WJC A;  1NG7 A;  2MC4 A;  2VJI A;  3OYN A;  2HQA A;  3OYA A;  2KL4 A;  4DIQ A;  1W36 D;  5FRM A;  1VZ0 A;  4HSR A;  1P9Q C;  4QPO A;  4AVZ A;  4F55 A;  3L91 A;  3S93 A;  1WFX A;  4RLQ A;  3LL7 A;  3NWS A;  4PSW A;  4BE0 A;  3DPT A;  3DPL C;  4XN3 A;  3OR2 C;  4PEM A;  4XOR A;  3L2W A;  1JX9 A;  2KPM A;  1MMG A;  2LRD A;  2O5R A;  2IGM A;  5CPR B;  2L9S A;  1AA7 A;  3SRA A;  2WYD A;  4G6T B;  4K2F A;  3HC7 A;  5LFA A;  4X0G A;  3E1S A;  4BS9 A;  2WY8 Q;  1D1A A;  3VWB A;  4KJZ A;  4B47 A;  2BW3 B;  3GBG A;  3S8P A;  4CCK A;  4LG3 A;  1GM7 A;  2GOM A;  4AU7 A;  3DKX A;  1OLT A;  4RM2 A;  3S8R A;  2AE3 A;  1Y6I A;  2KQR A;  3F9K A;  2X85 A;  2WB1 A;  1SAU A;  3LSK A;  3ZGK A;  4HNU A;  3AL0 B;  1LVK A;  3KX2 A;  4NC8 A;  1K7D A;  2I8D A;  4YFA A;  3BG6 A;  1GKF A;  2LOO A;  4BTH A;  3H9J A;  4BJ6 C;  4J00 A;  4CZC A;  4BAC A;  3BCA A;  4XLH A;  4BQN A;  4IZZ A;  2XC7 A;  4NNJ A;  2JA2 A;  3FKJ A;  4HNT A;  4BEH B;  1DP3 A;  1D1B A;  1PNL A;  3HPG A;  3OMY A;  2LH9 A;  3JTQ A;  3BG7 A;  3KEY A;  4BL0 B;  3H0D A;  3K4J A;  1Z7L A;  3BCB A;  5HNF A;  4PJM A;  4BJT A;  4XLF A;  2LC2 A;  2F4I A;  2CMP A;  3OYF A;  3K4N A;  3QYF A;  2VJ4 A;  3RTR A;  2KP6 A;  3VYT B;  3K4L A;  2FUG 2;  2ZSI B;  1G8X A;  1QHG A;  3CP2 A;  1BR4 A;  4BXF A;  2E60 A;  2LY2 A;  3QOE A;  1W36 C;  4LIU A;  3HKZ A;  3PSI A;  2VQG A;  4C9Y A;  1N77 A;  3EUA A;  4BGD A;  1QU3 A;  2Q2E B;  3VYR B;  2L7K A;  4XON A;  4ZDO A;  3OS0 A;  1J09 A;  2X6W A;  2LG4 A;  1YE9 A;  2VXD A;  2F6C A;  3CF2 A;  3OYB A;  2PJR A;  2BW3 A;  4IKF A;  4P5O A;  1PJR A;  2MAB A;  1D1C A;  3AL0 C;  2HVR A;  4E57 A;  4F52 A;  2CV0 A;  4BE1 A;  1AI5 A;  2WAF A;  2X51 A;  3HOS A;  5HOO A;  2VPL A;  2X6X A;  3HXL A;  1WJE A;  1N78 A;  2Z16 A;  1FXH A;  5JHF A;  3E0J B;  4AYB A;  4ANJ A;  4IQJ A;  4ZC3 A;  2VKD A;  4E7I A;  3D5R C;  2R7T A;  2M7B A;  2E1M C;  3TMO A;  2CFO A;  2R7R A;  3K3W A;  1K5S A;  4MLO A;  1U0J A;  2OV7 A;  2JUG A;  1FXV A;  4E4H A;  1S9H A;  2IS1 A;  4PJJ A;  1MNE A;  1GHD A;  4XMY A;  3OYJ A;  1X4O A;  1IRX A;  4ZDP A;  2KZV A;  1MMA A;  4E7Z A;  4B48 A;  3QYB A;  4CCJ A;  2K3P A;  2M4G A;  3IAM 2;  2OC6 A;  3BC8 A;  3C2G A;  1YX3 A;  3H5N A;  3W2V A;  2VJ5 A;  2Z1D A;  4LIT A;  2VXZ A;  4BDZ A;  1K6Y A;  4GRI A;  1WJA A;  3SYT A;  4XKV A;  2QKM B;  4Y4R A;  2RQQ A;  4XLA A;  4E7S A;  3K70 D;  2M3A A;  3PUB A;  1GM8 A;  1Y56 A;  2IGK A;  5HVQ C;  1MMD A;  4R79 A;  4WKU A;  2DXI A;  2BVL A;  1X19 A;  2XF5 A;  3K4M A;  2UWM A;  3HUG B;  4LIV A;  3L2Q A;  1JI8 A;  4E7L A;  4E55 A;  3PJR A;  1BOB A;  4BDY A;  3L94 A;  2K5C A;  2HDW A;  1AI7 A;  4YEL A;  3ZRG A;  1AJQ A;  4QPQ A;  1DQU A;  3QYE A;  2BOL A;  2PJR B;  3W3C A;  3DWL E;  3VDX A;  4DBQ A;  1WJF A;  3SRC A;  3OR1 C;  4PUS A;  4E7K A;  2PMZ A;  2AQF A;  3DPU A;  3OYI A;  2QKL B;  2CW8 A;  1BR2 A;  2XSJ C;  4BE2 A;  2UV1 A;  3ML0 A;  4EAT A;  2NOJ B;  2IS4 A;  1AI6 A;  2XF6 A;  1DGR M;  2MD0 A;  3L2U A;  1GK0 A;  4CH7 A;  1GM9 A;  4E7J A;  3J7A Y;  4XKB A;  4JQF A;  3W2A A;  3A2K A;  2VQL A;  4XOP A;  4XKC A;  1UEL B;  2W82 A;  5LD2 C;  2CW7 A;  3AFH A;  5FRO A;  4ITV A;  1X1C A;  4CCN A;  1LFP A;  2R4G A;  4BQO A;  2WBM A;  3OIQ A;  1AJP A;  1PNM A;  3W2W A;  5CQE A;  4BJ5 C;  5TGT A;  3H5R A;  4OAZ A;  2DJI A;  3OS1 A;  2R7Q A;  2RNG A;  4C2U A;  3IUO A;  1X1D A;  3H9Q A;  2ZXH A;  4XOT A;  2ELJ A;  2KMU A;  4PFO A;  3A4C A;  3DLA A;  2ADV A;  2DCE A;  1V5E A;  3C2H A;  2AE4 A;  1JW0 A;  4OWR B;  2GOX B;  2Q1Z B;  2CS3 A;  2HZD A;  3SEQ A;  2X1C A;  4IX7 A;  1H2G A;  2M4K A;  2X1D A;  4PFP A;  2X6Y A;  3QOD A;  2V9K A;  3OOU A;  2VIX A;  4KIT B;  3OS2 A;  2VL8 A;  3G2B A;  3ZQQ A;  3LSI A;  3RSN A;  4KT6 A;  4P1W A;  3JTR A;  4XL9 A;  2R7V A;  4DJA A;  4OAY A;  2W4S A;  1GLN A;  3SEZ A;  2VB6 A;  3OY9 A;  1N75 A;  1ZEL A;  3PFY A;  3K70 C;  4WKS A;  4F91 B;  2IXS A;  1YX5 A;  3VSK A;  4H4K C;  4XLE A;  4E7H A;  2R7X A;  1Z3Y A;  2LY1 A;  4YRV A;  2A6T A;  3V42 A;  1KON A;  2JVG A;  2W1O A;  2L5Q A;  2WA0 A;  4XQF A;  3DTI A;  3VSL A;  3DQV C;  4CSW A;  4E6K G;  2RRE A;  3CP8 A;  3LSH A;  3DU6 A;  3HG9 A;  1X1A A;  1OR0 A;  3DU5 A;  2JVH A;  2W7N A;  1HA8 A;  3OYE A;  3SRB A;  1K5Q A;  4PK4 A;  4XNF A;  2KRC A;  4PEL A;  1DGW Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...