4HSRA

Crystal structure of a class iii engineered cephalosporin acylase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
AALPPLSGSLPIPGLSASVRVRRDAWGIPHIKASGEADAYRALGFVHSQDRLFQMELTRRKALGRAAEWLGAEAAEADILVRRLGMEKVCRRDFEALGVEAKDMLRAYVAGVNAFLASGAPLPVEYGLLGAEPEPWEPWHSIAVMRRLGLLMGSVWFKLWRMLALPVVGAANALKLRYDDGGRDLLCIPPGAEADRLEADLATLRPAVDALLKAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaryl-7-aminocephalosporanic acid acylase alpha chain
publication title Structure of a class III engineered cephalosporin acylase: comparisons with class I acylase and implications for differences in substrate specificity and catalytic activity.
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hsrA02
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4hsrA01
3JTQA 4YFAA 1AJPA 1GK1A 1KEHA 1GM8A 4WKUA 1H2GA 2WYDA 1JVZA 1E3AA 1JW0A 4WKVA 4HSRA 2WYBA 1AI5A 1GKFA 4K2GA 4WKTA 4YF9A 2ADVA 3SRAA 1PNKA 4M1JA 4HSTA 1K5SA 3L91A 1K7DA 3JTRA 2WYEA 2AE3A 3SRCA 3S8RA 4E56A 1FXVA 1AI6A 3K3WA 4K2FA 4E57A 2WYCA 2AE5A 3SRBA 1FM2A 1GM9A 1JX9A 1FXHA 1AJNA 3ML0A 2AE4A 1AJQA 4BTHA 1AI4A 1K5QA 4WKSA 1GHDA 1PNLA 4PELA 1AI7A 1PNMA 4YFBA 1KECA 3L94A 1GK9A 4PEMA 1GM7A 1GK0A 1OR0A 1CP9A 4E55A
chains in the Genus database with same CATH superfamily
2LDUA 3DEUA 4PJ0C 1GVDA 2LLKA 5ICFA 3ERED 2CQNA 1A6IA 2P5KA 5CVVA 5JHFA 1R6RA 2GWRA 4FASD 1I3AA 3CC2I 1AA7A 4FCYA 5CVRA 4ITVA 3K1PA 3F8CA 3DLLF 3H3UA 5FLMJ 2COBA 1FZPB 2LVSA 3NARA 2EWNA 2ID3A 4A3IJ 3GTQJ 3MAJA 4NDLA 4F3QA 4I6ZA 2EA4A 4UVBA 3K1NA 2ZXJA 5DUKA 1D3YA 2VASA 3K1MA 4DOZA 4OIPF 1LVAA 4ZYHA 1QO0D 1HW1A 4ETSA 2DDAA 5ICGA 3I53A 2YU9J 4UNOA 2IW5A 3ZQLA 1UHMA 3R61A 3QYBA 3S2WA 2M45A 3HGGA 3MKYB 1FP2A 3ZQIA 2AQEA 3CJQB 4BNCA 4DYQA 1UG2A 1ZH5A 5ICEA 1APLC 5F04A 2KMUA 2X0LA 3JRDA 1JJ8C 1H0MA 2GXGA 1G3SA 4ON0A 5J1YA 1LPQA 3KP6A 4LB5A 1GK0A 2FRHA 3K4KA 3CCEI 1FYLA 2P5VA 3F8MA 1DPRA 1USSA 2BZTA 4OAZA 3MEXA 2EFPA 2RV8A 2VJ5A 3BPXA 4U0YA 2VKDA 3LOCA 5FKMA 3AG2H 1RI7A 4LD5A 4EJTA 3S1QJ 1SD4A 2PMZA 3BJOA 3L91A 2RN7A 2LKSA 2M7AA 4BXFA 2KLOA 1TWGJ 4IX7A 3PUBA 5LGTA 2O5RA 1ZG3A 4R79A 2P0WA 4KMUX 5D4SA 2R5ZA 1IN5A 4UVAA 3KYLA 3FXRA 2DBBA 4EJVA 1IN8A 2COMA 3HOSA 3LA7A 3PFIA 2Q1ZB 1MMSA 1W0UA 1HDDC 3VYRB 2ICWG 2E2IJ 2EZHA 2BYVE 3DTIA 4ZC3A 1PNKA 4UUSA 4P9FA 2FOKA 3JR9A 2KDZA 2F4IA 2RC4A 3K2ZA 2GLOA 3H0GJ 4XQFA 1LDKB 4RAYA 2OUMA 3TO6A 1MGTA 3K70D 2IGNA 4GCVA 5LHIA 3HUGA 1W1WE 1TT5B 2HQAA 2JK3A 3HSFA 3VPRA 3OL4A 2E1OA 5EYRA 5LGNA 5LLQA 3K4BA 1GLNA 2BOLA 3BCAA 3U2RA 3MZYA 2A6HF 2DJNA 1IG7A 2VLAA 5D5XB 4I02A 2WYDA 4V2FA 2HTJA 3BCBA 2EILH 5K5OA 1B9MA 2P81A 1W7PD 1NTCA 4YG2F 4XOPA 2QGUA 2KJBA 5J3LA 5JVGF 2ZJQF 5JLWA 2JA6J 4MTDA 2HR3A 2ZSIB 3KZZA 4YFNF 4OIRF 1IZ1A 1XS9A 3LL7A 2FMYA 3AAFA 3QP6A 5D5WB 4RBOA 1VQ7I 2QSHX 4BL0B 4EJWA 1OCOH 4BGDA 4DJAA 1YS6A 4F93B 4W97A 2UUZA 3KYDB 1IN4A 3FM3A 3C7JA 4I2OA 2VI6A 4B8XA 3IH3A 1S72I 4H4KC 3WGHA 1BI3A 2LF7A 3E0JB 2HXIA 2PMZN 2DN0A 1ZLKA 4D7NA 5L3EA 4BQAA 3CMEI 2M9HA 3CO7C 2X9DA 2VXZA 5M5WJ 4EEFG 4O3MA 3K4JA 4R1HA 1Y6IA 2MH9A 4A69C 3K70C 3RTRA 1X4PA 3IUOA 3UNGC 2MYSA 3E7LA 1FOKA 1E2XA 3QWLA 3HEFA 3HGYA 2KRHA 3DU6A 3F23A 3CCMI 1HBXG 2KZVA 2PQ8A 3M7GA 4BS9A 5EDNA 5BNGA 1IAWA 1ETYA 1R1TA 1GM8A 1ZGAA 1UJ8A 3FXMA 1U78A 1O7FA 2R7FA 1BOAA 2ADVA 4JK1X 2R5ZB 3IH4A 1VQLI 2D1HA 2DOEA 2E5NA 2ZKZA 2NVQJ 3S17J 1U6GA 2OC6A 2NNYA 1ZGWA 2F5CA 4RGUA 2K27A 4M3DA 1FXHA 1TQIA 1EKEA 4HNTA 4H0EA 1T98A 2LMDA 3O8HA 4A3MJ 3A03A 1LJ9A 1Z0XA 1TWCJ 2L4AA 4UUSB 2DPDA 2LFBA 2TRTA 5DD8A 4Q47A 3ZQCA 2AS5F 5F08A 2NS7A 2VOPA 1YJWI 2CWEA 1LEAA 2K4BA 3H3ZA 3HUGB 1FNNA 2VT3A 4HQEA 2P4WA 2YUSA 1LEBA 5HVQC 4HSTA 3L00A 1E17A 3IP4B 2W57A 2E7XA 2CQXA 4CCOA 3O3KA 2E1CA 1OKRA 1FIPA 1A04A 3FK7A 2XAGA 3ULQB 2JA8J 1O3SA 1SVOA 4RB2C 2OJED 2HU9A 2H09A 3M9AA 1TZLA 5IP9J 1FC3A 3WU1B 1CF7A 4G6QA 3QU6A 2E2JJ 1G6NA 4HNUA 4A6DA 4RGSA 5E17F 2GOXB 4XLHA 1CQTA 4ENNA 4B4CA 4BXXJ 1WH7A 3G71I 2WBMA 2X1DA 1R36A 1RKTA 3L2CA 1W5CC 1HKSA 1WJDA 3WG7H 4AYBA 1BI1A 4DBRA 1DUXC 1RETA 1Q1HA 3I0TA 1BM9A 2CUEA 5D8LB 2D1VA 4EGYA 3AKZA 1G8XA 4J19A 3WTWC 3PM1A 4GDFA 3QOPA 5E3LA 4DZPA 4C2TA 2R7VA 1M1EB 1Y8QB 1Z1DA 2EIKH 2VJ4A 3MFKA 1BC8C 2DYSH 1XC5A 2KZGA 3NAUA 2PJPA 4KMFA 1VNDA 2OD5A 4RAGA 2EFOA 2HVSA 2JPCA 5GPAA 1H89C 4U87A 3H0DA 2MW8A 4I0AA 4ESFA 2B0LA 4HDUA 1XN7A 3JAMZ 1GDTA 4RGXA 1RUNA 2W1OA 5DCFA 2WY8Q 2D2WA 3WTUC 2CQKA 3S32A 2NXNB 5FRNA 3B6CA 1OR0A 2XVCA 3ZPLA 3K69A 2VPLA 4KT5C 1ITYA 1LFBA 1J75A 4UVCA 1R58A 2NVTJ 2HZTA 4ZYEA 4OAYA 5J8FA 2ZMEC 3K10A 1B8IB 1IUYA 3SRCA 2W25A 3HRTA 1SD7A 4FQGA 1MBFA 2X6OA 2IGOA 2KT0A 2LOOA 4HDVA 1O3QA 3IH2A 3ZQHA 5HLGA 2WWYA 1SVLA 3CTAA 1WJ5A 2HDWA 2OBPA 4KIFA 4XKBA 1JJ6C 1G3WA 2NOGA 3E97A 1B6AA 2V9PA 4BBRJ 4FETA 4Y52J 4BBSJ 5HDGA 3I5UA 3TW6A 2DT7B 1MBEA 3CO6C 1QNTA 2V6EA 2CYYA 4IHYA 1OMIA 2Q2EA 5A2QK 3VYUB 3E6MA 3I4NJ 2K02A 1CF7B 3S3MA 2WYEA 4EM1A 2L9VA 4AYBN 2D45A 2E2HJ 3RI4A 1QPMA 4BWCA 1V55H 5FGMA 3JRAA 2M3AA 2MABA 4U0WA 2QM3A 3HRSA 2F2EA 3SZTA 2XF7A 5DCMB 2QBYA 1T38A 3KZIC 1BI2A 3HIFA 2ZJ2A 1NG7A 3DCFA 4QSHA 2P6SA 5J1UA 3GTGJ 2K7LA 3WGIA 1J9IA 4BYYA 2VB6A 1Z21A 2XV4S 1FTTA 3KX2A 3A01B 3PQJA 5A2QZ 1U9OA 5DD4A 4Y33A 4A3CJ 2XGCA 3A4CA 3RKYA 3SDGA 3RYPA 5HNFA 4IOCF 4XLCA 4XONA 5J1RA 4L0YB 2CW7A 2OQGA 1WSUA 4HOBA 1HOMA 5F27A 2JPBA 3GF2A 3QOEA 3GUDA 3RIRA 1F1ZA 4GYIA 2ME0A 2BV6A 2QYOA 5E8IA 1PYVA 2BW3A 3H5NA 4FT8A 2UWMA 3L7WA 3K6GA 2CQ7A 3FDYA 2DAOA 2HOSA 5TJJA 4J01A 4HLXA 1OR7C 1RUOA 3BTJA 3FGTA 5D6EA 3KEOA 1WPKA 4BDZA 5D5UB 4HV5A 1JT6A 4CA0A 3DF8A 4EATA 1YFHA 2LR8A 4I76A 2K9MA 3G1OA 4C9YA 9ANTA 2FEZA 3ZQ7A 3B73A 2CUZA 2EQRA 4JYKA 5FJ8J 4B3XA 3Q9VA 4MQVA 1LUJB 3OOUA 1W0TA 3OIQA 1ZN2A 3I56I 4ENKA 3N05A 4KYWA 2M4KA 2HDCA 2R7UA 4FISA 5FKOA 3QPSA 4CCLA 4D5FA 5E1ZB 1VQ5I 2Q2EB 2XAHA 5F1JA 3AG1H 3V7SA 3IRQA 1WRJA 2CFOA 2KP6A 2QKLB 1U3EM 4U7BA 2HKOA 4IL6C 1S9HA 2YX7A 5IP7J 1HDPA 1I39A 2DOAA 2K5CA 3HRMA 3OYLA 2BHYA 3SZPA 5JVTA 2L01A 2MC3A 3GFJA 4BEHA 3OYAA 4XKWA 4M71A 2BY2A 1UAAA 1JUPA 4U0VA 2A61A 2XUBA 3M8JA 3F9KA 4GRIA 1IV8A 1XGSA 1JT0A 2QQ8A 1MJ9A 4NB5A 3OSGA 2A3SA 2QQ9A 1SMTA 3CZ6A 1K4SA 3SEQA 1G59A 2EV0A 3PSIA 2GXBA 1MBHA 1S5LC 5E3NA 2R93J 1DQUA 4BE2A 2DA6A 2DA4A 2YR2A 4LOCA 4KICA 3HOTA 2F4OB 1DGRM 1I3QJ 2HYFA 1T0FC 1ZR4A 4RAZA 1T56A 2DMPA 2FUG2 2M2EA 2V1XA 1Z77A 1R5HA 2BHZA 3TMOA 1F4KA 2XSDC 3HHHA 2PMUA 1H8AC 3D0SA 2V1DA 4ZZDA 3WTSC 5IT9K 1XGOA 2JMWA 1MBGA 2JRTA 3H5RA 4WWCA 3OYKA 1SVMA 5HNHA 1P6RA 4A3LJ 5IYBJ 2BW3B 4DZJA 2KPMA 1BJAA 4IEJA 2CV0A 1PNMA 4M6VA 2BEOA 3ZXSA 1O4XA 1WQ2A 4PEMA 4E7HA 3TW7A 2X6WA 1S29A 2DK5A 5IP6A 1DPUA 4E55A 4ZYAA 4PJJA 3GW2A 2V7FA 2LP0A 5D5VB 4S05A 1X1BA 2A5YB 2EBIA 3SRAA 3LSIA 1MBKA 1ON1A 3GWZA 2A07F 1N78A 1A31A 3WTTC 2AE3A 3OS2A 3ABMH 5FFXA 1FT9A 4CCMA 1IC8A 3ONQA 5F0FA 2E1MB 2OZUA 3DFGA 1OYWA 3OYIA 3AL0B 2UV1A 3WTZA 3KPHA 1YJNI 5CQGA 2Q0OA 4IOAF 4W1UA 3HHGA 3IAS2 2LKXA 5CLSA 5C4XJ 3PSFA 5M3MJ 3IKVA 3HOXJ 3EUHA 1XX5A 1WJEA 4ABZA 1P2FA 2LC2A 1BW5A 3DQVC 5F1RA 2DQLA 3U21A 3Q3SA 1A6QA 4Y17A 1UG0A 5TRDA 3BJAA 5L3BA 2GBYA 2M30A 4N9HA 3L09A 2ME6A 2WV1A 3CLQA 3TL4X 2EV6A 4XR6A 2D5VA 1AI7A 2AXLA 2HDDA 3SFIA 1DU6A 1QPIA 2BY3A 1EJ9A 3IWFA 4L9TA 1HC8A 4MHGA 1X58A 3S1NJ 4NUBA 1WZ2A 2KQRA 4HG2A 1MJBA 2NVYJ 4G6TB 2WYBA 1D0YA 2FOWA 2NVUB 3KP7A 3VODA 1MMNA 2V4JC 2XGEA 3IKTA 3LFUA 4EVIA 4J00A 2I10A 1SFUA 2HVQA 1QZZA 1O57A 3FWEA 1GM9A 2AE5A 2VQGA 1JX9A 2XAQA 3K0LA 4HV6A 4DGWB 5LGUA 4A3JJ 2AE4A 2VE9A 1X2NA 3CUQA 4ZJZA 3DPUA 5IYDJ 4A3KJ 2RGVA 2F5FA 2X4HA 4HA8A 2NOJB 1B1BA 3CMYA 4XRSA 3HJEA 1ZELA 2OAZA 3L2WA 1S8NA 1ZAOA 1YE9A 2M0MA 4UHTA 4Y3OA 2H1KA 4CGZA 3T5XA 3I58A 3K4CA 1EH8A 4DYCA 2V26A 4IRIA 3FXKA 4PJNA 2E7WA 3GMEA 2XPWA 1RZ4A 5BOXA 2GM4A 3FGRA 3FZVA 2DFEA 3QPLA 4P55A 4LK1F 4OOIA 5H6QA 3LSRA 4PJLA 2Y30A 5JR3A 1DDNA 2Z5UA 3K9TA 4AUXA 2CMPA 3A02A 2ETHA 1W5TA 1K7DA 4AD9A 1JKPC 2IT0A 3LSHA 2QLZA 3ELKA 3TDUC 1EH7A 2CUJA 2DFIA 4KT6A 1OPCA 4ZYGA 4EGZA 2K85A 2Y0SA 3REOA 2ELKA 2JVHA 2VT2A 3HOVJ 3KLOA 3P9IA 3CJRB 3BQZA 2I8DA 1ETWA 2ACJA 1GV5A 2CFXA 4Z2YA 1HW2A 1KONA 2IS1A 2O61A 2CSOA 1WWXA 1U2WA 3RKXA 4YFBA 3KLNA 2XAUA 1H9GA 3OYHA 4IKFA 1UB9A 4E6KG 2HQRA 4E70A 4RB0A 1KEHA 4A3EJ 3DEWA 3P9KA 4QTRA 4AIDA 1K7AA 3CJNA 3L2QA 2KIFA 2BVMA 2RVCA 2NYXA 3FKJA 1U5TA 3CQZJ 4K2FA 2BE5F 2VOOA 2VBXA 1NK2P 2JQ7A 2ZNZA 5B66C 3E5XA 1MH4A 4LG0A 2VKVA 3KP3A 1OCPA 2ZBKA 2ZC2A 4RB3C 4L0ZB 1FPQA 2E71A 2OQRA 1SD6A 4NC7A 1K4TA 3ABTA 1TBXA 2GA1A 2H6CA 3MD2A 2ECBA 4BH9A 4FHTA 5B5EC 5F6FA 2WV0A 3CESA 1ODDA 3ZN0A 4BE0A 4N9IA 1U8RA 4KA4A 5ICCA 2BY0A 3CUQB 3FBNB 3KEYA 5JHUA 1FXVA 4A3FJ 1PP8F 4XN3A 4PK4A 1BIBA 1B72A 1AWCA 4BQQA 2EB7A 5GAEJ 2HI3A 3ROUA 3GZNB 4PDKA 2HOTA 4B44A 4CZCA 4JBAA 5K7ZA 3LMMA 1XTAA 2LD5A 1BR2A 5DEQA 1O7LA 1E3AA 4EJOA 4WX9A 1YQAA 2Y0SN 4UUTA 2KIMA 3QYFA 5FB2A 3S1MJ 2LREA 1HA8A 1IUFA 1T39A 2NS8A 2H27A 2EFWA 2IJLA 3MZ8A 3KEQA 4CZZA 2X85A 2ZFWA 2PLYA 1WJAA 4AIJA 1YTYA 2KIQA 2RDPA 3TOAA 1YLFA 2JVGA 1QVUA 1EV7A 5DM7F 4BHPA 1G3YA 1GT0C 3HG9A 1I6XA 3I59A 1Y1VJ 2HEOA 2VJJA 1RNLA 2WY7Q 2WADA 1Z91A 2XF5A 2KFDA 3GYHX 2L54A 5E1XA 3ZOBA 2M4GA 1ZREA 3CCRI 3HDDA 3CF5F 4M1JA 5HS9A 1V5EA 1E0EA 1GXQA 3JTRA 5EG0A 1XDSA 3LWFA 1YRNA 4Y13A 2H1LA 5BMZA 1IN7A 3KETA 3L1PA 1EF4A 3NQOA 3CCJI 1LE8B 3DWLE 2PI0A 4LB6B 1J09A 5LFAA 5EZHA 1K79A 1U5TB 2K40A 1LKXA 4BY1J 2L7KA 2B9SA 2JN6A 3QPTA 4EM0B 2GIZA 1Z7LA 3DLAA 4LG0B 3S2HJ 3J81K 1JKRC 3VEPA 4E7ZA 4JX4A 3H9GA 1MNMC 2VPRA 1X1PA 2M8GX 1OYIA 2H94A 3D1NI 3BP8A 2W00A 1RKWA 2LSOA 2RNJA 4KN4X 1XSDA 3CP8A 3S3OA 4XOTA 4CCKA 1OCTC 2KHMA 3IWZA 3KP2A 2O8KA 2MLKA 3E6DA 3S3NA 2L9NA 2LBFB 2NAZA 1V4RA 4RS8A 4X0GA 4UY8I 4OIOF 5B1BH 1BR4A 3FHZA 3TDZC 5E20A 1XCVA 4IPAA 5BPDA 1B72B 1ZRCA 5AONA 2R7TA 1OJLA 2O7OA 3J81Z 1KU7A 1X1CA 1KQ9A 3L2VA 1MSFC 2FMLA 3S15J 2STWA 3BR5A 4QLCU 1JHHA 2YX4A 3H5AA 4UUVA 5IPAA 3BG5A 5B1AH 5ILUA 2Z9OA 3LSPA 3BTLA 1JI8A 1R00A 1ETVA 2FU4A 2M87A 3TBIA 3ZQQA 5GADJ 2FNAA 1ON2A 4Q4ZF 2XROA 3G4SI 1LVKA 1K5QA 3OL3A 4ESJA 2L7MP 3UKGA 2DODA 3DV8A 1G4DA 3FXUA 2IGMA 2KDOA 1B8IA 3ABLH 2H6BA 3HRUA 3MQ0A 2ELHA 3V4GA 2QKMB 3RZDJ 4IHVA 4NNJA 4II2A 2GOMA 3WG9A 1SMYF 2VQCA 2LNBA 2G0EA 2QUFA 3I59B 5K1YA 3KE2A 1OFCX 3K4LA 4PSWA 2ISYA 1WFXA 3ZQFA 1H88C 1FSHA 3M1CA 3WTXC 5C44J 2G7HA 4PELA 1UFMA 2FNPA 1SAXA 3O2PE 1GVJA 2JRMA 3DXJF 5EG0B 3AFHA 1PVEA 4I09A 1ZARA 3ZCOA 5BPIA 2PX9A 3CC7I 1YRNB 5IT3A 2JA2A 2XB0X 1R5GA 4IF4A 4OU0A 3W6KB 1GK1A 4IRHA 1IRFA 2KISA 2NNNA 3IV5A 3LSKA 3D5SC 2XSJC 3VFZA 1MMDA 1VQOI 3DTEA 4IO9F 3E5UA 3BLYA 5DCMA 3MWMA 5LEJA 5E18F 1UHWA 3M07A 2J5OA 3JAMK 1FM2A 3CDLA 3COAC 5IOYA 3ML0A 1VF9A 3HPGA 3JRHA 5M3FJ 4M3GA 4F91B 3U1DA 1RESA 3GFLA 3HB9A 4I01A 1WJBA 1KECA 4V2GA 3A01A 3H9JA 1JTYA 1TP4A 1IXSB 2CU7A 1P7JA 3OYMA 2FX0A 5M5YJ 5CVUA 1BJZA 2ID6A 2PEXA 5ED4A 1QA6A 4Q48A 2Y69H 5HDNA 1E3HA 4D7MA 1VQNI 3HZJA 4U88A 3DKYA 1XMKA 2VBWA 1IDYA 3BG9A 3Q0VA 5EEGA 5FKNA 2FF4A 4L18B 2QQBA 3K4MA 2MGQA 4M74A 4KIBA 2XPVA 1BW6A 3HSEA 3ZMDA 5AIPA 1XDUA 1W7PB 1L3LA 3MCZA 3M4OJ 5E3OA 1D1AA 3RSNA 3PO3J 3X2QH 5C3EJ 1ZRDA 2W85A 3VSLA 4A0XA 4KDPA 4XRMA 4O5VA 4CXFA 2WYCA 2KRCA 4DBQA 5GAHJ 3SHFA 1O3TA 3EYIA 4CDGA 3FXLA 2IS2A 4EV0A 3OWTA 2X51A 1JGGA 2KJCA 1HSTA 2CV1A 1UMQA 2ZJRF 3I4MJ 2OV7A 3H92A 3VDXA 2WAQA 3DEEA 2WAFA 3GEZA 1ZK8A 2RAEA 3L2RA 5CKTA 3FMQA 3WE3A 1E3OC 5E3MA 3JTGA 3I54A 4NQWA 5E1WA 5KNLA 3D5LA 1ULYA 2AHQA 2DK8A 2QSFX 2KL4A 2VQLA 4LJZF 5D6FA 1DU0A 5LHGA 5CPRB 4AC0A 2UZKA 4RDUA 1IJWC 4MTEA 3QU3A 4KNYA 4CHUA 3QODA 2LKPA 3M1EA 1AJPA 1JUMA 3ECHA 1HF0A 4AIKA 3UR3C 1YW8A 2HYJA 3PUFA 5J40A 5EF6A 3V7RA 3HOZJ 1LDDA 1ERDA 1QU3A 2V9VA 2GIVA 3CDIA 1ZTRA 4FE7A 3U9GA 4A5MA 2CV2A 4YIFA 2LRDA 4EJUA 3DPTA 3JSPA 5DDGA 3FIWA 3DBLB 1TNTA 3PNVA 4KISA 2DJIA 2HTSA 3SZGA 3RKWA 1GUUA 2V79A 5HLHA 2Y31A 1OYYA 2DA5A 2E36A 3JCUC 4G6DA 3FK6A 2XF6A 4LK0F 3C3WA 3H35A 2A6TA 3J80K 1H9TA 3CP2A 4ANJA 1FIAA 2DA1A 4Y15A 1WI3A 5CVJA 1JXSA 4L5IA 4M3EA 1LFPA 2PJRA 4YFKF 4M9ZA 2K9NA 4P1WA 3RYRA 1Z67A 1KQ8A 5L3CA 1K6OA 4P5OA 4A2UA 3ML6A 1YIJI 3PL8A 2ZMEB 4IZZA 2CS3A 2WAQN 5L3FA 1F5TA 3MZHA 3J80Z 1D0XA 1G3TA 2OPTA 3H3VK 3O8GA 3H36A 3JSOA 5GP9A 3JRBA 4KN7X 2LG4A 3S1RJ 4V19K 1XGNA 1MMAA 1SFOJ 1SFEA 3S2DJ 3RQ4A 2FBKA 2OU2A 4JX5A 2JSCA 1F36A 4D9JA 4M3FA 4Y7NJ 2XB5A 4AWXB 1IN6A 3CCQI 3GZ6A 1VZ0A 4D5CA 5IYCJ 2XASA 2XC7A 4ASNA 2B63J 2L2OA 3K7AJ 3BZ6A 4NQWB 2XDVA 4Q5SF 4U7DA 5CQEA 1TWFJ 4ENJA 3LFKA 3PIPF 3AL0C 4MQ9F 4FX0A 3C18A 2IXSA 4PGHA 4OMZA 3V8KA 2EH3A 3RDIA 3BY6A 5JI6A 4I99C 2Y75A 3F22A 1MNEA 3HTSB 2IVMA 5C4JJ 2ECCA 2VODA 1FMVA 3GTKJ 3VB2A 2FJ1A 3L2UA 2DA2A 1F43A 2K9LA 1AI4A 1S7AA 4HPQA 2EK5A 2BXZA 4XSZF 1R7JA 4L9NA 4UXNA 5FKLA 2M0CA 2EV5A 3SXYA 4OMYA 3SYTA 3IHUA 1NH3A 2VQHA 1STZA 4M6YA 2QENA 1P9QC 3AG4H 1FBUA 3T8TA 1MZBA 3KIOA 4G94A 3BDDA 3CC4I 3FF5A 5E8GA 1I27A 2DYRH 1ACIA 3SQNA 4BJ6C 3BR3A 2EINH 4YFXF 3V8LA 4GGGA 1TWHJ 2NVXJ 4BY7J 3DU5A 2LY9A 4S04A 2HVRA 2P8TA 4XL9A 2E35A 3ZRGA 2F48A 2PJRB 4XLPF 5H2FC 1VFCA 4HX4A 2HQNA 2R4GA 1REPC 5LBQA 2A5WA 1V3FA 3OIPA 1H2GA 2JT1A 3LQRA 3R0JA 2M7BA 1XSXA 3DBHB 2XGXA 2DMQA 4A3GJ 1HSJA 2ZXWH 2VKHA 3ECOA 1TQPA 1WH5A 1ZQ3P 1VQKI 3KP5A 4IVNA 1R5ID 5DV5A 3BOQA 2A69F 2V1NA 3CMMA 1QHGA 1P92A 1U9NA 3T1BA 2R0QC 1SFKA 4XKVA 3W3CA 4IQJA 4B47A 1ORKA 2DDBA 3RPQA 4LMYA 3ISPA 1I1SA 4O6JA 2X1CA 3F8FA 4WK8F 2HOAA 4CYCA 1W4MA 2IA1A 2VBZA 1MSEC 3F8NA 2HGCA 1KU2A 3GTOJ 3R0AA 3GLLA 2L0KA 3NWSA 2DFHA 1RPWA 1X3ZB 1RC9A 2PG4A 2W48A 3G73A 2HQ5A 3NWTA 4A0YA 4HZFA 5GTHC 3SJMA 2IP2A 4AM3A 1DP3A 1J7KA 2V6CA 3HPHA 4E57A 4ZYDA 3RPUA 3A0BC 2O0YA 1KYZA 2G7UA 3EUHC 3N97A 3QYEA 1KU3A 3ERMA 5DYMA 3WHCA 3TEDA 3OYDA 1AKHA 2ESHA 1UHSA 2L9RA 2VE8A 2JA5J 4N4NB 1S6LA 1AI5A 3FXOA 1OCRH 1HW5A 2ELJA 3EUKL 1EH6A 2WB1A 5M5XJ 4RB1A 3I55I 5H20A 1MDMA 2CUFA 1JKOC 4MGRA 1D1BA 1ENHA 1P4WA 2O8XA 3OMYA 5KCMA 3VYSB 3HM5A 1GV2A 3WTYC 4XN0A 2R7XA 4C2MJ 3BTCA 4CO8A 4AIHA 3RJPA 1OCZH 2QF7A 1QGPA 4RAFA 4G12A 2VBYA 1LDJA 5GTIC 1Z6TA 2EZIA 2XAFA 3OIOA 2BBYA 2R7ZJ 1WGXA 4DW6A 2JJ7A 5FD5A 1SANA 2EIJH 1T08B 3RZOJ 1R23A 2BGCA 4CCJA 2FA5A 2FXAA 3CUQC 1R4NB 1Y56A 2M5WA 1VQ6I 3NEUA 2CH0A 3J7AY 1A35A 1LNWA 1FOYA 3DPLC 3R4KA 2MLGA 4BKXA 2HWVA 3JRIA 3PFYA 3E3VA 1FP1D 3ABKH 4NBQA 4HSRA 5AIQA 4YF9A 2QSGX 4RM2A 3LSMA 4EQQA 3A1YA 5L3DA 1PUEE 2CG4A 2DMTA 3KYCB 1ETXA 1WJFA 2A6EF 3BC8A 2MSYA 1IXCA 4LG3A 4C3HJ 5DUIA 2A68F 3OS1A 1AOYA 4GXOA 3ZMVA 2DLLA 4CYCB 2VUMJ 4RGRA 1ETOA 1K78A 2VONA 1LQ1A 4MIMA 1R9TJ 1MKMA 4I98B 5FFZA 5IY5H 1W5SA 3LSJA 1VTNC 1PUFA 2BXYA 3QQAA 1OQYA 3CCVI 2YS9A 5J4YA 4WKVA 5GAGJ 2R5YB 2OTLI 1XMAA 2VL8A 2WB1N 3KZYA 4L5JA 1LE8A 1I50J 1VQ4I 4P9UA 1P7IA 3DTKA 1XPXA 1X19A 2E19A 3CDHA 2EFNA 4KITB 1Y39A 5JFRA 1AKHB 1VQMI 2F6CA 4WF2A 2O9LA 3BG7A 1MMGA 1N77A 2G9WA 4G8XA 5DM6F 1PNLA 1K6YA 1FBSA 4F7ZA 1MDMB 1JE8A 5HLIA 5LD2C 1XMXA 3CUOA 4MLOA 4QWQA 3HOYJ 5D8KB 3F8BA 2LBFA 3EDPA 3O6BB 2HXOA 2L4MA 1U5TC 2IS6A 1GKFA 2CW0F 1BOBA 3GFMA 5F64A 4A6EA 2QQAA 1K5SA 3PNTA 5CYVA 2DMNA 3ESWB 5BQTA 3EQLF 1SEUA 2EIMH 2MC4A 2PBIA 4BQOA 5BS6A 3WTVC 1N25A 3Q0UA 4PGGA 2MA3A 2EA2A 3Q0WA 1YITI 1YO5C 4B3AA 1GK9A 2ZNYA 1B59A 3MVPA 3RQIA 3MKZA 2R7RA 3A0HC 1ZGJA 3J7YJ 3J7ZI 1IW7F 1KZHA 1WHUA 2L3DA 2ZB9A 1T2KA 4MNUA 4K2EA 3ZP5A 4C30A 3WU2C 3BTIA 3GZ5A 3H9QA 4YELA 1XCBA 4RM3A 5J6XA 1D0ZA 2HS5A 2KKOA 3GXOA 1KGSA 4TV7A 2DFFA 2K4JA 3DP7A 1TW2A 1MW7A 5FLXK 1OLTA 2R92J 1FTZA 2K86A 2R7DA 2ISZA 1BI0A 2R7OA 3HYIA 2HPMA 3G3ZA 4KUMA 4XRFA 4MEXF 2HPIA 2OCEA 2O03A 4P96A 2XPUA 3BR6A 1JVZA 1K78B 4BHCA 1FY7A 1D8KA 1ZG5A 4FX4A 3A2KA 2HNHA 1S3JA 2W4SA 2JA7J 4B1RA 2XRLA 4CH7A 1VQPI 5FD6A 1PUFB 3HOWJ 1X1AA 2QZ8A 3K4NA 4R8HA 1XSVA 1QHHD 5HLTA 2IRFG 2HYGD 2F4MB 4CUGA 1QZEA 3LSTA 4KIGA 4XLEA 5EGOA 5CVIA 3M3YJ 3PJRA 1ZR2A 5FLXZ 1W36D 2XKPA 2X6YA 3ZN1A 2L5QA 2IA0A 2P7VB 3GTLJ 3TQNA 1ETQA 5LHHA 3EETA 4PSXA 5KAFC 2MG4A 2IS4A 1QZYA 2LY2A 4Z6YA 4MFEA 2H8RA 2PN6A 2ZXIA 4B43A 1AI6A 1TT0A 1X3WB 1DGWY 5J47A 3I4PA 3TO7A 1IV6A 4WXHA 3C2BA 1YOVB 1HCRA 1J2XA 2E5ZA 1FX7A 2P7CB 5FKKA 2JUGA 3B02A 3G1LA 4M9SA 3QAHA 3VWBA 2ZFUA 2MBFA 2YPRA 1XB4A 1XG1A 1I5ZA 5LRRA 1YW9A 4G7HF 1JTXA 3BJ6A 2DTRA 1Y0UA 1UZCA 3V7CA 5FLVA 4PZJA 3K3WA 2RQQA 2W84A 4BQNA 5KHDA 3NRVA 1FYKA 3LAJA 3BROA 1W7PA 1POGA 3BR2A 5EEHA 1LFUP 2R7SA 2FBHA 4WXCA 1RIOH 4ENMA 4JOMA 4M9XA 3W6VA 2R7QA 1V5FA 4XSXF 2TDXA 3CCYA 1U0JA 4M73A 1GXPA 1W36C 2IGKA 1IGNA 2LYCA 4G7OF 2Z2SB 1C0WA 1QBJA 4XLNF 1I6HJ 2Y9ZA 1TW3A 1V54H 2DT6A 2F5DA 5CJ9A 5H6RA 2DU9A 2HOEA 2M8EA 3Q9SA 4A3BJ 1TC3C 3PQKA 1UELB 3ABUA 1YIOA 3BQYA 3E1SA 3JRCA 2E1NA 2GXAA 4HF1A 3J7AO 2V9KA 4NC8A 4ZDOA 3EYYA 2VKEA 1ONVA 1YG2A 2AO9A 5K5QA 1HKTA 4XMYA 3TKYA 2DA3A 4CSWA 4XIDA 3U1KA 3FBIB 2F5VA 3I3LA 2C6YA 2DCEA 3L9FA 4XK4A 2OZ6A 5EGOB 4CCNA 3H1CA 3W2VA 5LRSA 3OYNA 3E6BA 2JSPA 4HEA2 3FKIJ 3Q5FA 2DQRA 4IHWA 2OF7A 5J8CA 3GTMJ 3P5JA 3JW4A 3SRBA 4B09A 4IHTA 3PNYA 4IJAA 2VC1A 4E7SA 1Y1WJ 3R60A 1X3UA 5LEKA 4HBLA 5ERIA 1F9NA 4II3A 3FXJA 1IF1A 2QVOA 3WODF 4YRVA 3FXQA 5TGTA 3VYTB 2BVLA 4DQ2A 3VOEA 2QWWA 2YSRA 4S0HB 3GLXA 2MH2A 2HZDA 1O3RA 3AG3H 3HC7A 2LTPA 1DP7P 2LY1A 3CJTB 4ESBA 2DO7A 3TO9A 2WTEA 2UXNA 3TP0A 1FMWA 2XRNA 4I0BA 4L9JA 4G7ZF 5FO5A 1VQ8I 2YU3A 4WKSA 4GFBA 1YX5A 2R3SA 4OWRB 1GM7A 2A05A 2ZCWA 2X1EA 1FWZA 2FE3A 4JP0A 3W6JB 2GAUA 2Z3YA 1GHCA 1WJCA 1OCCH 3E5QA 3HXLA 2STTA 4LFUA 2DW4A 5FRMA 1R49A 4YIIA 3I64A 3JTHA 3GX4X 1NK3P 4XRSG 4AVZA 3CCLI 1U8BA 3MKWB 2HKXA 2JUCA 2ZMEA 2MD5A 2GA2A 5ILVA 3F3XA 5HDKA 2VJIA 3IC7A 1I1GA 3TGNA 1ZYRF 4XICA 3FISA 2K3FA 3FMSA 3HBLA 3K2AA 4RLFA 1FBQA 2OTJI 1QRYA 3WHBA 3JTQA 2Q8KA 4YFAA 2AQFA 1FOXA 4WKUA 4UB6C 1BL0A 3D5RC 3SFZA 1YHQI 1FLIA 4K2GA 2NRAC 6PAXA 2O3FA 1A36A 2XKOA 2RNGA 3V8JA 2FQ3A 3C2GA 3V42A 2VN2A 4HLYA 1MBJA 3T8RA 4E7IA 1B9NA 1Z05A 3SEZA 2ZO4A 3F72A 4GYGA 4UV8A 1AJNA 3P7NA 4BTHA 1S7OA 3ZMSA 4ZTFA 4M72A 2PFBA 2JTVA 3KP4A 4MFDA 1KQ0A 2OCCH 3T0YA 3E6CC 3WE2A 1JHFA 5F0HA 1IDZA 4DYRA 3FX3A 1HQCA 3ZGKA 3RKQA 2CQQA 1T6SA 2DTZA 1LB2A 5GPCA 2I5UA 2Z1DA 1VI0A 4E4HA 1K83J 3F21A 1AJQA 3C2HA 2W7NA 2K9QA 1R1UA 4LIUA 4BDYA 2FSWA 2Z16A 4ZTJA 4F92B 3BR1A 5E79C 4PJMA 3SDBA 1SFXA 4RA2A 4C2UA 1CP9A 4HF0A 1G2HA 3IAM2 2CJJA 5F0CA 2X48A 3ZMTA 3S8PA 1FEXA 1Z7UA 3I71A 1USTA 2WAEA 1MH3A 4I7HA 2IA2A 1R1VA 1ZRFA 4XORA 1FSEA 3LNQA 3WU0A 4MEYF 4E56A 3LSGA 4UB8C 5EZGA 1JGSA 3F6VA 3GCMA 3OYFA 1OISA 4HX7A 3OR2C 2MFZA 1E3PA 2VXDA 5DTDA 4A0ZA 4IHXA 1PDNC 3CLOA 4ZDLA 4XLFA 2L9SA 4D0PA 5L3GA 4BUPA 1KU9A 1OR7A 1R4MB 2IAIA 4LGWA 3CCUI 5D4RA 1Z3YA 1BIAA 4DNCA 4OINF 1HXDA 4AVPA 1X2MA 2ZXHA 4RMNA 2B7EA 2XHKA 5HS8A 1YS7A 3OYJA 1P4XA 1YI2I 4M6XA 1IRGA 2Y9YA 2VC0A 3PIOF 1HKQA 2ZSHB 4HAMA 3TP3A 2F5EA 4N4OB 1EA3A 2HFHA 3G1MA 1PP7U 4NHJA 1WKMA 4WCGA 3OYBA 1RRJA 2EPFA 2VIXA 1FJLA 4ZH4F 5DS9A 4N0BA 4D1QA 4JX6A 4XNFA 2E1MC 3BWGA 4WXDA 2KRFA 4HNVA 5TISC 1WCMJ 1Z6RA 2CW8A 1TTYA 3DKXA 4LLNA 5FROA 3FHNA 1L0OC 2O6GE 3HL2A 4L5EA 1J59A 4Y4RA 3ZR8X 4XKCA 1ZKGA 2CRGA 2LK2A 3ASOH 5EEAA 3OV8A 2DA7A 2Z99A 3W2AA 3OY9A 2KIUA 1ZLJA 3IL2A 3WGGA 2GQQA 5KVRA 4PCQA 4HW0A 2DOFA 4YEJA 1XD7A 1TL8A 1TLHB 2M1BA 4LIVA 4IRGA 3OSFA 3M8FA 4NC6A 3GO5A 5HOOA 1JW0A 2GZWA 2QBYB 3ZMUA 1T0FA 3KFWX 1D1CA 2Z33A 1RR7A 4E7JA 3BT9A 1BBYA 4HF2A 3LA3A 5J4VA 3BG6A 1BR1A 1QQIA 1AU7A 3S14J 4BE1A 4A93J 2MD0A 4DIQA 3G6EI 4KFCA 4F55A 3R6SA 1Z3XA 2JZYA 1P4AA 2ADUA 3DBRB 4HYEA 4UV9A 4E7LA 1TNSA 1MJAA 1BN5A 4BACA 2W24A 1WI9A 2IPQX 1D5YA 3BPVA 3M8EA 4RLQA 3LA2A 1ZHFA 4XM3A 3OYCA 4XBFA 1MD0A 2L02A 2X6XA 3GTJJ 4LITA 2UXXA 3F6OA 5K5RA 1YW7A 2CO5A 3C1DA 3P9CA 4PFOA 3MKLA 3JRGA 2IBDA 2M34A 4JQFA 3GVAA 3CF2A 3RPUD 1N75A 3GBGA 1YX3A 4A5NA 3OYEA 2LH9A 4BHBA 1UCRA 3JREA 3BR0A 3QP5A 3CD6I 1GHDA 3HKZA 3JRFA 2P5LC 2OA4A 4A12A 4ZZLA 2PMHA 4EM2A 2Y48A 4BJ5C 2XAJA 1SAUA 1MIJA 5KAIC 4FTHA 2NS0A 1K61A 1SC7A 2W82A 5JLXA 2CGPA 4OIQF 3B6AA 3QPHA 4WKTA 2N8GA 1Y8RB 2JWTA 5IOZA 5IT9Z 2EFQA 2J5PA 3PO2J 4IQ4A 2V1UA 3CCSI 2FD5A 2LF8A 3ZQGA 2EJRA 1ZG1A 2DPUA 4IHSA 3KCCA 5KK1A 2XGDA 4X1EA 2R5YA 1B4AA 4PUSA 2DI3A 2ESNA 4IXAA 1IRXA 2RKHA 1BC7C 1FOWA 1V5GA 1D8JA 1R71A 4G9YA 1WVRA 2WA0A 1ETKA 2IEKA 5ILSA 2DMUA 3N4MA 1Q1VA 1T95A 4AU7A 2QA4I 2E34A 4M3BA 3S16J 1Z9CA 1YYVA 3TOBA 2E60A 1BA5A 4HX8A 1J5YA 3S8RA 4HRIA 4BU2A 4CYDA 3CMAI 2H8WA 4C3JJ 3ZMZA 2QEXI 1X4OA 4BAYA 2ZJPF 2DXIA 2FBIA 4QIWN 1FYMA 4LLGF 3HOUJ 2EZLA 4MO7A 1D5VA 4BEHB 1RR8C 3LAPA 4GO1A 1IXRC 3LQQA 2RQPA 2AXTC 2FQ4A 1Y0NA 3FMRA 2R7WA 5K7FA 1T33A 3RCOA 3MMYB 1AHDP 4XLAA 5B3SH 4FE4A 3QRFF 4C3IJ 3I9V2 3EPZA 1NHAA 4ZDPA 3S93A 1NG6A 1XGMA 2DT5A 4YIRX 1SD5A 1CGPA 2K3PA 4LLLA 1T8IA 1KA8A 1R22A 3VSKA 1KYWA 1PJRA 5HS7A 1IRZA 3MN2A 2BY1A 4E7KA 1JUSA 3HKZN 3OR1C 5EJCA 3BZCA 4BJTA 4B48A 3IRRA 3GTPJ 2Y0MA 2TCTA 2XIGA 4A3DJ 1MNDA 1X1DA 3EUAA 3W2WA 5HODA 3HSRA 3OOPA 2P6TA 1TWAJ 2RREA 4PFPA 3F0CA 3OS0A 4X6AJ 3DKWA 4QPQA 3G2BA 3BZKA 4BXUA 2EZKA 4EMSA 2K9SA 4L9VA 3ASNH 3OYGA 1JKQC 2L7FP 1A5JA 3FM5A 1IO2A 1YJ9I 4QPOA 1HLVA 4KJZA 1J0RA 4HQMA 3GFIA 1TQMA 2L7ZA 1S7EA 2Y2ZA 2WC2A 5K7HA 1QVTA 2QCOA 3BG3A 3L94A 4F52A 4CICA 3HTUA 1VQ9I
chains in the Genus database with same CATH topology
2OV7A 2JUGA 1DGRM 3VWBA 1T0FC 2ZFUA 3VDXA 2WAQA 3DEEA 2FUG2 2WAFA 3L2RA 5CKTA 3TMOA 5JHFA 1R6RA 4FASD 5KNLA 2RQQA 4BQNA 1AA7A 5KHDA 3K3WA 3D5LA 4ITVA 3H5RA 3OYKA 5HNHA 2KL4A 2R7SA 2VQLA 2BW3B 2KPMA 5CPRB 2CV0A 4JOMA 1PNMA 4F3QA 2R7QA 3ZXSA 1V5FA 4PEMA 4E7HA 2X6WA 1U0JA 1W36C 3QODA 2IGKA 4E55A 2LYCA 4ZYAA 2VASA 1AJPA 4PJJA 2V7FA 2Z2SB 4DOZA 3UR3C 1X1BA 3SRAA 3LSIA 2DT6A 1ERDA 1N78A 1QU3A 2AE3A 3QYBA 3OS2A 2CV2A 1UELB 3MKYB 2AQEA 2LRDA 3CJQB 3DPTA 4CCMA 3E1SA 3ONQA 2E1MB 3AL0B 3PNVA 2V9KA 4NC8A 3OYIA 2UV1A 4KISA 2DJIA 2KMUA 3SZGA 4ZDOA 5CQGA 1GK0A 4XMYA 3IAS2 4CSWA 3K4KA 2XF6A 3PSFA 3H35A 3FBIB 2A6TA 2F5VA 3CP2A 3I3LA 4OAZA 4ANJA 1WJEA 2DCEA 2VJ5A 4CCNA 2LC2A 3DQVC 2VKDA 3W2VA 3OYNA 2JSPA 2PMZA 3L91A 4HEA2 1LFPA 3U21A 2PJRA 2M7AA 4BXFA 3SRBA 1UG0A 4P1WA 2KLOA 3PNYA 4IX7A 3TL4X 3PUBA 4XR6A 2O5RA 4E7SA 4R79A 1AI7A 2P0WA 4P5OA 3KYLA 3PL8A 3HOSA 4IZZA 2Q1ZB 4II3A 2CS3A 4NUBA 4YRVA 5TGTA 3VYTB 1D0XA 2BVLA 2KQRA 3VYRB 4HG2A 4G6TB 2WYBA 3DTIA 2LG4A 2HZDA 4ZC3A 1D0YA 1PNKA 1MMAA 1MMNA 3HC7A 2V4JC 2LY1A 2F4IA 3LFUA 3RQ4A 4J00A 4D9JA 2HVQA 4XQFA 1LDKB 2OUMA 2AE5A 1GM9A 2VQGA 1JX9A 1FMWA 1VZ0A 3K70D 2IGNA 4DGWB 2AE4A 2HQAA 4WKSA 2XC7A 3OL4A 1YX5A 2L2OA 4ZJZA 3DPUA 4OWRB 4NQWB 2XDVA 3K4BA 1GM7A 2X1EA 1GLNA 2BOLA 5CQEA 3BCAA 2NOJB 3AL0C 1ZELA 1WJCA 2VLAA 3L2WA 2IXSA 3HXLA 2M0MA 2WYDA 1YE9A 4Y3OA 3BCBA 3K4CA 5FRMA 2V26A 1MNEA 4PJNA 4XOPA 4AVZA 3MKWB 1FMVA 2ZSIB 3L2UA 3LL7A 2K9LA 1AI4A 2VJIA 4HPQA 4PJLA 4BL0B 2CMPA 4RLFA 4BGDA 4DJAA 4F93B 1K7DA 2UUZA 3JTQA 4YFAA 3SYTA 2AQFA 2VQHA 3LSHA 4WKUA 4H4KC 2CUJA 3D5RC 1P9QC 4KT6A 3E0JB 4K2GA 2Y0SA 2JVHA 2RNGA 3C2GA 3V42A 4E7IA 3CJRB 2I8DA 3SEZA 4BJ6C 2VXZA 1KONA 2IS1A 1AJNA 3K4JA 1Y6IA 4BTHA 3K70C 3DU5A 3RTRA 4ZTFA 2HVRA 1X4PA 3IUOA 4YFBA 3UNGC 2MYSA 2XAUA 3OYHA 4IKFA 2KRHA 3DU6A 4XL9A 3ZRGA 2PJRB 4E6KG 2R4GA 2A5WA 1KEHA 2KZVA 1GM8A 3OIPA 4BS9A 1H2GA 3ZGKA 2M7BA 2ADVA 3L2QA 2BVMA 3FKJA 2E5NA 2VKHA 2OC6A 4K2FA 2Z1DA 4E4HA 1FXHA 4HNTA 1AJQA 3C2HA 2V1NA 3CMMA 1QHGA 4LIUA 2W7NA 4BDYA 4ZTJA 2Z16A 1SFKA 4XKVA 4NC7A 3W3CA 4B47A 4F92B 4IQJA 4PJMA 3SDBA 4C2UA 1CP9A 3IAM2 3MD2A 3S8PA 3CESA 3HUGB 2WAEA 2X1CA 4BE0A 4XORA 5HVQC 3FBNB 4HSTA 3KEYA 3IP4B 4E56A 3LSGA 3NWSA 1FXVA 4XN3A 4CCOA 4PK4A 3OYFA 4BQQA 3OR2C 3NWTA 2MFZA 2VXDA 1DP3A 2HU9A 4ZDLA 4B44A 4XLFA 2L9SA 1TZLA 3HPHA 4CZCA 4BUPA 3LMMA 3EUHC 3QYEA 1Z3YA 4HNUA 1BR2A 3OYDA 2GOXB 4XLHA 4N4NB 1E3AA 1AI5A 2ZXHA 4RMNA 2WBMA 2ELJA 2X1DA 2WB1A 3EUKL 3QYFA 2LREA 3OYJA 1HA8A 1WJDA 1D1BA 4AYBA 4DBRA 2ZSHB 5KCMA 3OMYA 2X85A 1WJAA 4N4OB 3VYSB 1EA3A 3AKZA 1G8XA 3OYBA 2JVGA 2VIXA 4XN0A 2R7XA 4D1QA 4C2TA 2R7VA 3HG9A 4XNFA 2VJ4A 2E1MC 2VJJA 2WY7Q 2WADA 2XF5A 2CW8A 2M4GA 3DKXA 2HVSA 5FROA 3FHNA 4M1JA 1V5EA 4U87A 1E0EA 3H0DA 3HL2A 3JTRA 4Y4RA 3ZR8X 4XKCA 4CCJA 2W1OA 2WY8Q 1Y56A 3W2AA 3OY9A 3DWLE 3S32A 5FRNA 2CH0A 3J7AY 1J09A 5LFAA 1LKXA 4YEJA 1OR0A 2L7KA 2VPLA 3DPLC 3DLAA 1Z7LA 4LIVA 3PFYA 4E7ZA 5HOOA 1JW0A 3H9GA 4HSRA 4YF9A 4RM2A 1D1CA 3LSMA 4OAYA 3A1YA 2W00A 4E7JA 3K10A 3SRCA 3CP8A 3S3OA 4XOTA 4CCKA 3BG6A 1BR1A 2KHMA 1WJFA 3BC8A 4LG3A 4E57A 4BE1A 2MD0A 4DIQA 3OS1A 3S3NA 4F55A 2L9NA 2LBFB 1Z3XA 2IGOA 4X0GA 2LOOA 4E7LA 4BACA 1BR4A 1WJ5A 2HDWA 4XKBA 4RLQA 4FETA 2R7TA 4XM3A 3OYCA 1X1CA 2DT7B 3L2VA 2V6EA 4WKVA 2VL8A 2X6XA 4LITA 3VYUB 3H5AA 3S3MA 2WYEA 3DTKA 4PFOA 1X19A 4KITB 1JI8A 4JQFA 3CF2A 3TBIA 2F6CA 1N75A 3GBGA 1YX3A 3BG7A 1MMGA 2LH9A 3RPUD 2M3AA 2MABA 3ZQQA 3OYEA 1N77A 1LVKA 1K5QA 3OL3A 1GHDA 3HKZA 1PNLA 2XF7A 1K6YA 1NG7A 2KDOA 2IGMA 5LD2C 4BJ5C 4MLOA 1SAUA 2QKMB 2W82A 2VB6A 2LBFA 1Z21A 2IS6A 1GKFA 4NNJA 4WKTA 4II2A 3KX2A 1BOBA 2GOMA 2VQCA 3PNTA 1K5SA 4Y33A 3A4CA 4IQ4A 2MC4A 4BQOA 3K4LA 4PSWA 5HNFA 1WFXA 4XLCA 3M1CA 4XONA 2CW7A 4PELA 4PUSA 1GK9A 3QOEA 3AFHA 3ZCOA 1IRXA 1V5GA 3MKZA 2R7RA 2JA2A 1GK1A 2WA0A 3LSKA 1T95A 4AU7A 3D5SC 2XSJC 1PYVA 2BW3A 3H5NA 1MMDA 3DTEA 2UWMA 4C30A 2E60A 3BLYA 3K6GA 3S8RA 4HRIA 4BU2A 3H9QA 4YELA 3FDYA 4RM3A 1D0ZA 1FM2A 1X4OA 2DXIA 3ML0A 3HPGA 4J01A 1OR7C 4F91B 4BEHB 1WJBA 1KECA 1MW7A 1OLTA 3H9JA 2R7WA 4BDZA 4CA0A 3RCOA 3MMYB 4EATA 2R7OA 4XLAA 2HPMA 2K9MA 3OYMA 3I9V2 3EPZA 2HPIA 4C9YA 1JVZA 4ZDPA 3S93A 1NG6A 3A2KA 2CUZA 2HNHA 2W4SA 2K3PA 4B3XA 3VSKA 4CH7A 1PJRA 3DKYA 3OOUA 3OIQA 1X1AA 3K4NA 3N05A 4E7KA 1QHHD 2M4KA 5HLTA 2R7UA 3OR1C 4BJTA 4B48A 4CUGA 4XLEA 4CCLA 3K4MA 2Q2EB 3PJRA 1W36D 2CFOA 2X6YA 1MNDA 2KP6A 2QKLB 2L5QA 4U7BA 1X1DA 3EUAA 3W2WA 1S9HA 1D1AA 3RSNA 4PSXA 2DOAA 2RREA 2K5CA 3OYLA 4PFPA 3OS0A 2IS4A 2LY2A 3VSLA 4QPQA 3G2BA 4BEHA 3OYAA 4XKWA 1UAAA 1AI6A 2ZXIA 4B43A 3M8JA 4GRIA 3F9KA 3OYGA 1TT0A 2WYCA 2KRCA 4DBQA 4QPOA 4KJZA 1DGWY 2IS2A 3CZ6A 1G59A 3SEQA 3OWTA 2X51A 3PSIA 1DQUA 3L94A 4BE2A 4F52A 2E5ZA 3HOTA 2CV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTQ A;  4YFA A;  1AJP A;  1GK1 A;  1KEH A;  1GM8 A;  4WKU A;  1H2G A;  2WYD A;  1JVZ A;  1E3A A;  1JW0 A;  4WKV A;  4HSR A;  2WYB A;  1AI5 A;  1GKF A;  4K2G A;  4WKT A;  4YF9 A;  2ADV A;  3SRA A;  1PNK A;  4M1J A;  4HST A;  1K5S A;  3L91 A;  1K7D A;  3JTR A;  2WYE A;  2AE3 A;  3SRC A;  3S8R A;  4E56 A;  1FXV A;  1AI6 A;  3K3W A;  4K2F A;  4E57 A;  2WYC A;  2AE5 A;  3SRB A;  1FM2 A;  1GM9 A;  1JX9 A;  1FXH A;  1AJN A;  3ML0 A;  2AE4 A;  1AJQ A;  4BTH A;  1AI4 A;  1K5Q A;  4WKS A;  1GHD A;  1PNL A;  4PEL A;  1AI7 A;  1PNM A;  4YFB A;  1KEC A;  3L94 A;  1GK9 A;  4PEM A;  1GM7 A;  1GK0 A;  1OR0 A;  1CP9 A;  4E55 A; 
#chains in the Genus database with same CATH topology
 2LDU A;  3DEU A;  4PJ0 C;  1GVD A;  2LLK A;  5ICF A;  3ERE D;  2CQN A;  1A6I A;  2P5K A;  5CVV A;  5JHF A;  1R6R A;  2GWR A;  4FAS D;  1I3A A;  3CC2 I;  1AA7 A;  4FCY A;  5CVR A;  4ITV A;  3K1P A;  3F8C A;  3DLL F;  3H3U A;  5FLM J;  2COB A;  1FZP B;  2LVS A;  3NAR A;  2EWN A;  2ID3 A;  4A3I J;  3GTQ J;  3MAJ A;  4NDL A;  4F3Q A;  4I6Z A;  2EA4 A;  4UVB A;  3K1N A;  2ZXJ A;  5DUK A;  1D3Y A;  2VAS A;  3K1M A;  4DOZ A;  4OIP F;  1LVA A;  4ZYH A;  1QO0 D;  1HW1 A;  4ETS A;  2DDA A;  5ICG A;  3I53 A;  2YU9 J;  4UNO A;  2IW5 A;  3ZQL A;  1UHM A;  3R61 A;  3QYB A;  3S2W A;  2M45 A;  3HGG A;  3MKY B;  1FP2 A;  3ZQI A;  2AQE A;  3CJQ B;  4BNC A;  4DYQ A;  1UG2 A;  1ZH5 A;  5ICE A;  1APL C;  5F04 A;  2KMU A;  2X0L A;  3JRD A;  1JJ8 C;  1H0M A;  2GXG A;  1G3S A;  4ON0 A;  5J1Y A;  1LPQ A;  3KP6 A;  4LB5 A;  1GK0 A;  2FRH A;  3K4K A;  3CCE I;  1FYL A;  2P5V A;  3F8M A;  1DPR A;  1USS A;  2BZT A;  4OAZ A;  3MEX A;  2EFP A;  2RV8 A;  2VJ5 A;  3BPX A;  4U0Y A;  2VKD A;  3LOC A;  5FKM A;  3AG2 H;  1RI7 A;  4LD5 A;  4EJT A;  3S1Q J;  1SD4 A;  2PMZ A;  3BJO A;  3L91 A;  2RN7 A;  2LKS A;  2M7A A;  4BXF A;  2KLO A;  1TWG J;  4IX7 A;  3PUB A;  5LGT A;  2O5R A;  1ZG3 A;  4R79 A;  2P0W A;  4KMU X;  5D4S A;  2R5Z A;  1IN5 A;  4UVA A;  3KYL A;  3FXR A;  2DBB A;  4EJV A;  1IN8 A;  2COM A;  3HOS A;  3LA7 A;  3PFI A;  2Q1Z B;  1MMS A;  1W0U A;  1HDD C;  3VYR B;  2ICW G;  2E2I J;  2EZH A;  2BYV E;  3DTI A;  4ZC3 A;  1PNK A;  4UUS A;  4P9F A;  2FOK A;  3JR9 A;  2KDZ A;  2F4I A;  2RC4 A;  3K2Z A;  2GLO A;  3H0G J;  4XQF A;  1LDK B;  4RAY A;  2OUM A;  3TO6 A;  1MGT A;  3K70 D;  2IGN A;  4GCV A;  5LHI A;  3HUG A;  1W1W E;  1TT5 B;  2HQA A;  2JK3 A;  3HSF A;  3VPR A;  3OL4 A;  2E1O A;  5EYR A;  5LGN A;  5LLQ A;  3K4B A;  1GLN A;  2BOL A;  3BCA A;  3U2R A;  3MZY A;  2A6H F;  2DJN A;  1IG7 A;  2VLA A;  5D5X B;  4I02 A;  2WYD A;  4V2F A;  2HTJ A;  3BCB A;  2EIL H;  5K5O A;  1B9M A;  2P81 A;  1W7P D;  1NTC A;  4YG2 F;  4XOP A;  2QGU A;  2KJB A;  5J3L A;  5JVG F;  2ZJQ F;  5JLW A;  2JA6 J;  4MTD A;  2HR3 A;  2ZSI B;  3KZZ A;  4YFN F;  4OIR F;  1IZ1 A;  1XS9 A;  3LL7 A;  2FMY A;  3AAF A;  3QP6 A;  5D5W B;  4RBO A;  1VQ7 I;  2QSH X;  4BL0 B;  4EJW A;  1OCO H;  4BGD A;  4DJA A;  1YS6 A;  4F93 B;  4W97 A;  2UUZ A;  3KYD B;  1IN4 A;  3FM3 A;  3C7J A;  4I2O A;  2VI6 A;  4B8X A;  3IH3 A;  1S72 I;  4H4K C;  3WGH A;  1BI3 A;  2LF7 A;  3E0J B;  2HXI A;  2PMZ N;  2DN0 A;  1ZLK A;  4D7N A;  5L3E A;  4BQA A;  3CME I;  2M9H A;  3CO7 C;  2X9D A;  2VXZ A;  5M5W J;  4EEF G;  4O3M A;  3K4J A;  4R1H A;  1Y6I A;  2MH9 A;  4A69 C;  3K70 C;  3RTR A;  1X4P A;  3IUO A;  3UNG C;  2MYS A;  3E7L A;  1FOK A;  1E2X A;  3QWL A;  3HEF A;  3HGY A;  2KRH A;  3DU6 A;  3F23 A;  3CCM I;  1HBX G;  2KZV A;  2PQ8 A;  3M7G A;  4BS9 A;  5EDN A;  5BNG A;  1IAW A;  1ETY A;  1R1T A;  1GM8 A;  1ZGA A;  1UJ8 A;  3FXM A;  1U78 A;  1O7F A;  2R7F A;  1BOA A;  2ADV A;  4JK1 X;  2R5Z B;  3IH4 A;  1VQL I;  2D1H A;  2DOE A;  2E5N A;  2ZKZ A;  2NVQ J;  3S17 J;  1U6G A;  2OC6 A;  2NNY A;  1ZGW A;  2F5C A;  4RGU A;  2K27 A;  4M3D A;  1FXH A;  1TQI A;  1EKE A;  4HNT A;  4H0E A;  1T98 A;  2LMD A;  3O8H A;  4A3M J;  3A03 A;  1LJ9 A;  1Z0X A;  1TWC J;  2L4A A;  4UUS B;  2DPD A;  2LFB A;  2TRT A;  5DD8 A;  4Q47 A;  3ZQC A;  2AS5 F;  5F08 A;  2NS7 A;  2VOP A;  1YJW I;  2CWE A;  1LEA A;  2K4B A;  3H3Z A;  3HUG B;  1FNN A;  2VT3 A;  4HQE A;  2P4W A;  2YUS A;  1LEB A;  5HVQ C;  4HST A;  3L00 A;  1E17 A;  3IP4 B;  2W57 A;  2E7X A;  2CQX A;  4CCO A;  3O3K A;  2E1C A;  1OKR A;  1FIP A;  1A04 A;  3FK7 A;  2XAG A;  3ULQ B;  2JA8 J;  1O3S A;  1SVO A;  4RB2 C;  2OJE D;  2HU9 A;  2H09 A;  3M9A A;  1TZL A;  5IP9 J;  1FC3 A;  3WU1 B;  1CF7 A;  4G6Q A;  3QU6 A;  2E2J J;  1G6N A;  4HNU A;  4A6D A;  4RGS A;  5E17 F;  2GOX B;  4XLH A;  1CQT A;  4ENN A;  4B4C A;  4BXX J;  1WH7 A;  3G71 I;  2WBM A;  2X1D A;  1R36 A;  1RKT A;  3L2C A;  1W5C C;  1HKS A;  1WJD A;  3WG7 H;  4AYB A;  1BI1 A;  4DBR A;  1DUX C;  1RET A;  1Q1H A;  3I0T A;  1BM9 A;  2CUE A;  5D8L B;  2D1V A;  4EGY A;  3AKZ A;  1G8X A;  4J19 A;  3WTW C;  3PM1 A;  4GDF A;  3QOP A;  5E3L A;  4DZP A;  4C2T A;  2R7V A;  1M1E B;  1Y8Q B;  1Z1D A;  2EIK H;  2VJ4 A;  3MFK A;  1BC8 C;  2DYS H;  1XC5 A;  2KZG A;  3NAU A;  2PJP A;  4KMF A;  1VND A;  2OD5 A;  4RAG A;  2EFO A;  2HVS A;  2JPC A;  5GPA A;  1H89 C;  4U87 A;  3H0D A;  2MW8 A;  4I0A A;  4ESF A;  2B0L A;  4HDU A;  1XN7 A;  3JAM Z;  1GDT A;  4RGX A;  1RUN A;  2W1O A;  5DCF A;  2WY8 Q;  2D2W A;  3WTU C;  2CQK A;  3S32 A;  2NXN B;  5FRN A;  3B6C A;  1OR0 A;  2XVC A;  3ZPL A;  3K69 A;  2VPL A;  4KT5 C;  1ITY A;  1LFB A;  1J75 A;  4UVC A;  1R58 A;  2NVT J;  2HZT A;  4ZYE A;  4OAY A;  5J8F A;  2ZME C;  3K10 A;  1B8I B;  1IUY A;  3SRC A;  2W25 A;  3HRT A;  1SD7 A;  4FQG A;  1MBF A;  2X6O A;  2IGO A;  2KT0 A;  2LOO A;  4HDV A;  1O3Q A;  3IH2 A;  3ZQH A;  5HLG A;  2WWY A;  1SVL A;  3CTA A;  1WJ5 A;  2HDW A;  2OBP A;  4KIF A;  4XKB A;  1JJ6 C;  1G3W A;  2NOG A;  3E97 A;  1B6A A;  2V9P A;  4BBR J;  4FET A;  4Y52 J;  4BBS J;  5HDG A;  3I5U A;  3TW6 A;  2DT7 B;  1MBE A;  3CO6 C;  1QNT A;  2V6E A;  2CYY A;  4IHY A;  1OMI A;  2Q2E A;  5A2Q K;  3VYU B;  3E6M A;  3I4N J;  2K02 A;  1CF7 B;  3S3M A;  2WYE A;  4EM1 A;  2L9V A;  4AYB N;  2D45 A;  2E2H J;  3RI4 A;  1QPM A;  4BWC A;  1V55 H;  5FGM A;  3JRA A;  2M3A A;  2MAB A;  4U0W A;  2QM3 A;  3HRS A;  2F2E A;  3SZT A;  2XF7 A;  5DCM B;  2QBY A;  1T38 A;  3KZI C;  1BI2 A;  3HIF A;  2ZJ2 A;  1NG7 A;  3DCF A;  4QSH A;  2P6S A;  5J1U A;  3GTG J;  2K7L A;  3WGI A;  1J9I A;  4BYY A;  2VB6 A;  1Z21 A;  2XV4 S;  1FTT A;  3KX2 A;  3A01 B;  3PQJ A;  5A2Q Z;  1U9O A;  5DD4 A;  4Y33 A;  4A3C J;  2XGC A;  3A4C A;  3RKY A;  3SDG A;  3RYP A;  5HNF A;  4IOC F;  4XLC A;  4XON A;  5J1R A;  4L0Y B;  2CW7 A;  2OQG A;  1WSU A;  4HOB A;  1HOM A;  5F27 A;  2JPB A;  3GF2 A;  3QOE A;  3GUD A;  3RIR A;  1F1Z A;  4GYI A;  2ME0 A;  2BV6 A;  2QYO A;  5E8I A;  1PYV A;  2BW3 A;  3H5N A;  4FT8 A;  2UWM A;  3L7W A;  3K6G A;  2CQ7 A;  3FDY A;  2DAO A;  2HOS A;  5TJJ A;  4J01 A;  4HLX A;  1OR7 C;  1RUO A;  3BTJ A;  3FGT A;  5D6E A;  3KEO A;  1WPK A;  4BDZ A;  5D5U B;  4HV5 A;  1JT6 A;  4CA0 A;  3DF8 A;  4EAT A;  1YFH A;  2LR8 A;  4I76 A;  2K9M A;  3G1O A;  4C9Y A;  9ANT A;  2FEZ A;  3ZQ7 A;  3B73 A;  2CUZ A;  2EQR A;  4JYK A;  5FJ8 J;  4B3X A;  3Q9V A;  4MQV A;  1LUJ B;  3OOU A;  1W0T A;  3OIQ A;  1ZN2 A;  3I56 I;  4ENK A;  3N05 A;  4KYW A;  2M4K A;  2HDC A;  2R7U A;  4FIS A;  5FKO A;  3QPS A;  4CCL A;  4D5F A;  5E1Z B;  1VQ5 I;  2Q2E B;  2XAH A;  5F1J A;  3AG1 H;  3V7S A;  3IRQ A;  1WRJ A;  2CFO A;  2KP6 A;  2QKL B;  1U3E M;  4U7B A;  2HKO A;  4IL6 C;  1S9H A;  2YX7 A;  5IP7 J;  1HDP A;  1I39 A;  2DOA A;  2K5C A;  3HRM A;  3OYL A;  2BHY A;  3SZP A;  5JVT A;  2L01 A;  2MC3 A;  3GFJ A;  4BEH A;  3OYA A;  4XKW A;  4M71 A;  2BY2 A;  1UAA A;  1JUP A;  4U0V A;  2A61 A;  2XUB A;  3M8J A;  3F9K A;  4GRI A;  1IV8 A;  1XGS A;  1JT0 A;  2QQ8 A;  1MJ9 A;  4NB5 A;  3OSG A;  2A3S A;  2QQ9 A;  1SMT A;  3CZ6 A;  1K4S A;  3SEQ A;  1G59 A;  2EV0 A;  3PSI A;  2GXB A;  1MBH A;  1S5L C;  5E3N A;  2R93 J;  1DQU A;  4BE2 A;  2DA6 A;  2DA4 A;  2YR2 A;  4LOC A;  4KIC A;  3HOT A;  2F4O B;  1DGR M;  1I3Q J;  2HYF A;  1T0F C;  1ZR4 A;  4RAZ A;  1T56 A;  2DMP A;  2FUG 2;  2M2E A;  2V1X A;  1Z77 A;  1R5H A;  2BHZ A;  3TMO A;  1F4K A;  2XSD C;  3HHH A;  2PMU A;  1H8A C;  3D0S A;  2V1D A;  4ZZD A;  3WTS C;  5IT9 K;  1XGO A;  2JMW A;  1MBG A;  2JRT A;  3H5R A;  4WWC A;  3OYK A;  1SVM A;  5HNH A;  1P6R A;  4A3L J;  5IYB J;  2BW3 B;  4DZJ A;  2KPM A;  1BJA A;  4IEJ A;  2CV0 A;  1PNM A;  4M6V A;  2BEO A;  3ZXS A;  1O4X A;  1WQ2 A;  4PEM A;  4E7H A;  3TW7 A;  2X6W A;  1S29 A;  2DK5 A;  5IP6 A;  1DPU A;  4E55 A;  4ZYA A;  4PJJ A;  3GW2 A;  2V7F A;  2LP0 A;  5D5V B;  4S05 A;  1X1B A;  2A5Y B;  2EBI A;  3SRA A;  3LSI A;  1MBK A;  1ON1 A;  3GWZ A;  2A07 F;  1N78 A;  1A31 A;  3WTT C;  2AE3 A;  3OS2 A;  3ABM H;  5FFX A;  1FT9 A;  4CCM A;  1IC8 A;  3ONQ A;  5F0F A;  2E1M B;  2OZU A;  3DFG A;  1OYW A;  3OYI A;  3AL0 B;  2UV1 A;  3WTZ A;  3KPH A;  1YJN I;  5CQG A;  2Q0O A;  4IOA F;  4W1U A;  3HHG A;  3IAS 2;  2LKX A;  5CLS A;  5C4X J;  3PSF A;  5M3M J;  3IKV A;  3HOX J;  3EUH A;  1XX5 A;  1WJE A;  4ABZ A;  1P2F A;  2LC2 A;  1BW5 A;  3DQV C;  5F1R A;  2DQL A;  3U21 A;  3Q3S A;  1A6Q A;  4Y17 A;  1UG0 A;  5TRD A;  3BJA A;  5L3B A;  2GBY A;  2M30 A;  4N9H A;  3L09 A;  2ME6 A;  2WV1 A;  3CLQ A;  3TL4 X;  2EV6 A;  4XR6 A;  2D5V A;  1AI7 A;  2AXL A;  2HDD A;  3SFI A;  1DU6 A;  1QPI A;  2BY3 A;  1EJ9 A;  3IWF A;  4L9T A;  1HC8 A;  4MHG A;  1X58 A;  3S1N J;  4NUB A;  1WZ2 A;  2KQR A;  4HG2 A;  1MJB A;  2NVY J;  4G6T B;  2WYB A;  1D0Y A;  2FOW A;  2NVU B;  3KP7 A;  3VOD A;  1MMN A;  2V4J C;  2XGE A;  3IKT A;  3LFU A;  4EVI A;  4J00 A;  2I10 A;  1SFU A;  2HVQ A;  1QZZ A;  1O57 A;  3FWE A;  1GM9 A;  2AE5 A;  2VQG A;  1JX9 A;  2XAQ A;  3K0L A;  4HV6 A;  4DGW B;  5LGU A;  4A3J J;  2AE4 A;  2VE9 A;  1X2N A;  3CUQ A;  4ZJZ A;  3DPU A;  5IYD J;  4A3K J;  2RGV A;  2F5F A;  2X4H A;  4HA8 A;  2NOJ B;  1B1B A;  3CMY A;  4XRS A;  3HJE A;  1ZEL A;  2OAZ A;  3L2W A;  1S8N A;  1ZAO A;  1YE9 A;  2M0M A;  4UHT A;  4Y3O A;  2H1K A;  4CGZ A;  3T5X A;  3I58 A;  3K4C A;  1EH8 A;  4DYC A;  2V26 A;  4IRI A;  3FXK A;  4PJN A;  2E7W A;  3GME A;  2XPW A;  1RZ4 A;  5BOX A;  2GM4 A;  3FGR A;  3FZV A;  2DFE A;  3QPL A;  4P55 A;  4LK1 F;  4OOI A;  5H6Q A;  3LSR A;  4PJL A;  2Y30 A;  5JR3 A;  1DDN A;  2Z5U A;  3K9T A;  4AUX A;  2CMP A;  3A02 A;  2ETH A;  1W5T A;  1K7D A;  4AD9 A;  1JKP C;  2IT0 A;  3LSH A;  2QLZ A;  3ELK A;  3TDU C;  1EH7 A;  2CUJ A;  2DFI A;  4KT6 A;  1OPC A;  4ZYG A;  4EGZ A;  2K85 A;  2Y0S A;  3REO A;  2ELK A;  2JVH A;  2VT2 A;  3HOV J;  3KLO A;  3P9I A;  3CJR B;  3BQZ A;  2I8D A;  1ETW A;  2ACJ A;  1GV5 A;  2CFX A;  4Z2Y A;  1HW2 A;  1KON A;  2IS1 A;  2O61 A;  2CSO A;  1WWX A;  1U2W A;  3RKX A;  4YFB A;  3KLN A;  2XAU A;  1H9G A;  3OYH A;  4IKF A;  1UB9 A;  4E6K G;  2HQR A;  4E70 A;  4RB0 A;  1KEH A;  4A3E J;  3DEW A;  3P9K A;  4QTR A;  4AID A;  1K7A A;  3CJN A;  3L2Q A;  2KIF A;  2BVM A;  2RVC A;  2NYX A;  3FKJ A;  1U5T A;  3CQZ J;  4K2F A;  2BE5 F;  2VOO A;  2VBX A;  1NK2 P;  2JQ7 A;  2ZNZ A;  5B66 C;  3E5X A;  1MH4 A;  4LG0 A;  2VKV A;  3KP3 A;  1OCP A;  2ZBK A;  2ZC2 A;  4RB3 C;  4L0Z B;  1FPQ A;  2E71 A;  2OQR A;  1SD6 A;  4NC7 A;  1K4T A;  3ABT A;  1TBX A;  2GA1 A;  2H6C A;  3MD2 A;  2ECB A;  4BH9 A;  4FHT A;  5B5E C;  5F6F A;  2WV0 A;  3CES A;  1ODD A;  3ZN0 A;  4BE0 A;  4N9I A;  1U8R A;  4KA4 A;  5ICC A;  2BY0 A;  3CUQ B;  3FBN B;  3KEY A;  5JHU A;  1FXV A;  4A3F J;  1PP8 F;  4XN3 A;  4PK4 A;  1BIB A;  1B72 A;  1AWC A;  4BQQ A;  2EB7 A;  5GAE J;  2HI3 A;  3ROU A;  3GZN B;  4PDK A;  2HOT A;  4B44 A;  4CZC A;  4JBA A;  5K7Z A;  3LMM A;  1XTA A;  2LD5 A;  1BR2 A;  5DEQ A;  1O7L A;  1E3A A;  4EJO A;  4WX9 A;  1YQA A;  2Y0S N;  4UUT A;  2KIM A;  3QYF A;  5FB2 A;  3S1M J;  2LRE A;  1HA8 A;  1IUF A;  1T39 A;  2NS8 A;  2H27 A;  2EFW A;  2IJL A;  3MZ8 A;  3KEQ A;  4CZZ A;  2X85 A;  2ZFW A;  2PLY A;  1WJA A;  4AIJ A;  1YTY A;  2KIQ A;  2RDP A;  3TOA A;  1YLF A;  2JVG A;  1QVU A;  1EV7 A;  5DM7 F;  4BHP A;  1G3Y A;  1GT0 C;  3HG9 A;  1I6X A;  3I59 A;  1Y1V J;  2HEO A;  2VJJ A;  1RNL A;  2WY7 Q;  2WAD A;  1Z91 A;  2XF5 A;  2KFD A;  3GYH X;  2L54 A;  5E1X A;  3ZOB A;  2M4G A;  1ZRE A;  3CCR I;  3HDD A;  3CF5 F;  4M1J A;  5HS9 A;  1V5E A;  1E0E A;  1GXQ A;  3JTR A;  5EG0 A;  1XDS A;  3LWF A;  1YRN A;  4Y13 A;  2H1L A;  5BMZ A;  1IN7 A;  3KET A;  3L1P A;  1EF4 A;  3NQO A;  3CCJ I;  1LE8 B;  3DWL E;  2PI0 A;  4LB6 B;  1J09 A;  5LFA A;  5EZH A;  1K79 A;  1U5T B;  2K40 A;  1LKX A;  4BY1 J;  2L7K A;  2B9S A;  2JN6 A;  3QPT A;  4EM0 B;  2GIZ A;  1Z7L A;  3DLA A;  4LG0 B;  3S2H J;  3J81 K;  1JKR C;  3VEP A;  4E7Z A;  4JX4 A;  3H9G A;  1MNM C;  2VPR A;  1X1P A;  2M8G X;  1OYI A;  2H94 A;  3D1N I;  3BP8 A;  2W00 A;  1RKW A;  2LSO A;  2RNJ A;  4KN4 X;  1XSD A;  3CP8 A;  3S3O A;  4XOT A;  4CCK A;  1OCT C;  2KHM A;  3IWZ A;  3KP2 A;  2O8K A;  2MLK A;  3E6D A;  3S3N A;  2L9N A;  2LBF B;  2NAZ A;  1V4R A;  4RS8 A;  4X0G A;  4UY8 I;  4OIO F;  5B1B H;  1BR4 A;  3FHZ A;  3TDZ C;  5E20 A;  1XCV A;  4IPA A;  5BPD A;  1B72 B;  1ZRC A;  5AON A;  2R7T A;  1OJL A;  2O7O A;  3J81 Z;  1KU7 A;  1X1C A;  1KQ9 A;  3L2V A;  1MSF C;  2FML A;  3S15 J;  2STW A;  3BR5 A;  4QLC U;  1JHH A;  2YX4 A;  3H5A A;  4UUV A;  5IPA A;  3BG5 A;  5B1A H;  5ILU A;  2Z9O A;  3LSP A;  3BTL A;  1JI8 A;  1R00 A;  1ETV A;  2FU4 A;  2M87 A;  3TBI A;  3ZQQ A;  5GAD J;  2FNA A;  1ON2 A;  4Q4Z F;  2XRO A;  3G4S I;  1LVK A;  1K5Q A;  3OL3 A;  4ESJ A;  2L7M P;  3UKG A;  2DOD A;  3DV8 A;  1G4D A;  3FXU A;  2IGM A;  2KDO A;  1B8I A;  3ABL H;  2H6B A;  3HRU A;  3MQ0 A;  2ELH A;  3V4G A;  2QKM B;  3RZD J;  4IHV A;  4NNJ A;  4II2 A;  2GOM A;  3WG9 A;  1SMY F;  2VQC A;  2LNB A;  2G0E A;  2QUF A;  3I59 B;  5K1Y A;  3KE2 A;  1OFC X;  3K4L A;  4PSW A;  2ISY A;  1WFX A;  3ZQF A;  1H88 C;  1FSH A;  3M1C A;  3WTX C;  5C44 J;  2G7H A;  4PEL A;  1UFM A;  2FNP A;  1SAX A;  3O2P E;  1GVJ A;  2JRM A;  3DXJ F;  5EG0 B;  3AFH A;  1PVE A;  4I09 A;  1ZAR A;  3ZCO A;  5BPI A;  2PX9 A;  3CC7 I;  1YRN B;  5IT3 A;  2JA2 A;  2XB0 X;  1R5G A;  4IF4 A;  4OU0 A;  3W6K B;  1GK1 A;  4IRH A;  1IRF A;  2KIS A;  2NNN A;  3IV5 A;  3LSK A;  3D5S C;  2XSJ C;  3VFZ A;  1MMD A;  1VQO I;  3DTE A;  4IO9 F;  3E5U A;  3BLY A;  5DCM A;  3MWM A;  5LEJ A;  5E18 F;  1UHW A;  3M07 A;  2J5O A;  3JAM K;  1FM2 A;  3CDL A;  3COA C;  5IOY A;  3ML0 A;  1VF9 A;  3HPG A;  3JRH A;  5M3F J;  4M3G A;  4F91 B;  3U1D A;  1RES A;  3GFL A;  3HB9 A;  4I01 A;  1WJB A;  1KEC A;  4V2G A;  3A01 A;  3H9J A;  1JTY A;  1TP4 A;  1IXS B;  2CU7 A;  1P7J A;  3OYM A;  2FX0 A;  5M5Y J;  5CVU A;  1BJZ A;  2ID6 A;  2PEX A;  5ED4 A;  1QA6 A;  4Q48 A;  2Y69 H;  5HDN A;  1E3H A;  4D7M A;  1VQN I;  3HZJ A;  4U88 A;  3DKY A;  1XMK A;  2VBW A;  1IDY A;  3BG9 A;  3Q0V A;  5EEG A;  5FKN A;  2FF4 A;  4L18 B;  2QQB A;  3K4M A;  2MGQ A;  4M74 A;  4KIB A;  2XPV A;  1BW6 A;  3HSE A;  3ZMD A;  5AIP A;  1XDU A;  1W7P B;  1L3L A;  3MCZ A;  3M4O J;  5E3O A;  1D1A A;  3RSN A;  3PO3 J;  3X2Q H;  5C3E J;  1ZRD A;  2W85 A;  3VSL A;  4A0X A;  4KDP A;  4XRM A;  4O5V A;  4CXF A;  2WYC A;  2KRC A;  4DBQ A;  5GAH J;  3SHF A;  1O3T A;  3EYI A;  4CDG A;  3FXL A;  2IS2 A;  4EV0 A;  3OWT A;  2X51 A;  1JGG A;  2KJC A;  1HST A;  2CV1 A;  1UMQ A;  2ZJR F;  3I4M J;  2OV7 A;  3H92 A;  3VDX A;  2WAQ A;  3DEE A;  2WAF A;  3GEZ A;  1ZK8 A;  2RAE A;  3L2R A;  5CKT A;  3FMQ A;  3WE3 A;  1E3O C;  5E3M A;  3JTG A;  3I54 A;  4NQW A;  5E1W A;  5KNL A;  3D5L A;  1ULY A;  2AHQ A;  2DK8 A;  2QSF X;  2KL4 A;  2VQL A;  4LJZ F;  5D6F A;  1DU0 A;  5LHG A;  5CPR B;  4AC0 A;  2UZK A;  4RDU A;  1IJW C;  4MTE A;  3QU3 A;  4KNY A;  4CHU A;  3QOD A;  2LKP A;  3M1E A;  1AJP A;  1JUM A;  3ECH A;  1HF0 A;  4AIK A;  3UR3 C;  1YW8 A;  2HYJ A;  3PUF A;  5J40 A;  5EF6 A;  3V7R A;  3HOZ J;  1LDD A;  1ERD A;  1QU3 A;  2V9V A;  2GIV A;  3CDI A;  1ZTR A;  4FE7 A;  3U9G A;  4A5M A;  2CV2 A;  4YIF A;  2LRD A;  4EJU A;  3DPT A;  3JSP A;  5DDG A;  3FIW A;  3DBL B;  1TNT A;  3PNV A;  4KIS A;  2DJI A;  2HTS A;  3SZG A;  3RKW A;  1GUU A;  2V79 A;  5HLH A;  2Y31 A;  1OYY A;  2DA5 A;  2E36 A;  3JCU C;  4G6D A;  3FK6 A;  2XF6 A;  4LK0 F;  3C3W A;  3H35 A;  2A6T A;  3J80 K;  1H9T A;  3CP2 A;  4ANJ A;  1FIA A;  2DA1 A;  4Y15 A;  1WI3 A;  5CVJ A;  1JXS A;  4L5I A;  4M3E A;  1LFP A;  2PJR A;  4YFK F;  4M9Z A;  2K9N A;  4P1W A;  3RYR A;  1Z67 A;  1KQ8 A;  5L3C A;  1K6O A;  4P5O A;  4A2U A;  3ML6 A;  1YIJ I;  3PL8 A;  2ZME B;  4IZZ A;  2CS3 A;  2WAQ N;  5L3F A;  1F5T A;  3MZH A;  3J80 Z;  1D0X A;  1G3T A;  2OPT A;  3H3V K;  3O8G A;  3H36 A;  3JSO A;  5GP9 A;  3JRB A;  4KN7 X;  2LG4 A;  3S1R J;  4V19 K;  1XGN A;  1MMA A;  1SFO J;  1SFE A;  3S2D J;  3RQ4 A;  2FBK A;  2OU2 A;  4JX5 A;  2JSC A;  1F36 A;  4D9J A;  4M3F A;  4Y7N J;  2XB5 A;  4AWX B;  1IN6 A;  3CCQ I;  3GZ6 A;  1VZ0 A;  4D5C A;  5IYC J;  2XAS A;  2XC7 A;  4ASN A;  2B63 J;  2L2O A;  3K7A J;  3BZ6 A;  4NQW B;  2XDV A;  4Q5S F;  4U7D A;  5CQE A;  1TWF J;  4ENJ A;  3LFK A;  3PIP F;  3AL0 C;  4MQ9 F;  4FX0 A;  3C18 A;  2IXS A;  4PGH A;  4OMZ A;  3V8K A;  2EH3 A;  3RDI A;  3BY6 A;  5JI6 A;  4I99 C;  2Y75 A;  3F22 A;  1MNE A;  3HTS B;  2IVM A;  5C4J J;  2ECC A;  2VOD A;  1FMV A;  3GTK J;  3VB2 A;  2FJ1 A;  3L2U A;  2DA2 A;  1F43 A;  2K9L A;  1AI4 A;  1S7A A;  4HPQ A;  2EK5 A;  2BXZ A;  4XSZ F;  1R7J A;  4L9N A;  4UXN A;  5FKL A;  2M0C A;  2EV5 A;  3SXY A;  4OMY A;  3SYT A;  3IHU A;  1NH3 A;  2VQH A;  1STZ A;  4M6Y A;  2QEN A;  1P9Q C;  3AG4 H;  1FBU A;  3T8T A;  1MZB A;  3KIO A;  4G94 A;  3BDD A;  3CC4 I;  3FF5 A;  5E8G A;  1I27 A;  2DYR H;  1ACI A;  3SQN A;  4BJ6 C;  3BR3 A;  2EIN H;  4YFX F;  3V8L A;  4GGG A;  1TWH J;  2NVX J;  4BY7 J;  3DU5 A;  2LY9 A;  4S04 A;  2HVR A;  2P8T A;  4XL9 A;  2E35 A;  3ZRG A;  2F48 A;  2PJR B;  4XLP F;  5H2F C;  1VFC A;  4HX4 A;  2HQN A;  2R4G A;  1REP C;  5LBQ A;  2A5W A;  1V3F A;  3OIP A;  1H2G A;  2JT1 A;  3LQR A;  3R0J A;  2M7B A;  1XSX A;  3DBH B;  2XGX A;  2DMQ A;  4A3G J;  1HSJ A;  2ZXW H;  2VKH A;  3ECO A;  1TQP A;  1WH5 A;  1ZQ3 P;  1VQK I;  3KP5 A;  4IVN A;  1R5I D;  5DV5 A;  3BOQ A;  2A69 F;  2V1N A;  3CMM A;  1QHG A;  1P92 A;  1U9N A;  3T1B A;  2R0Q C;  1SFK A;  4XKV A;  3W3C A;  4IQJ A;  4B47 A;  1ORK A;  2DDB A;  3RPQ A;  4LMY A;  3ISP A;  1I1S A;  4O6J A;  2X1C A;  3F8F A;  4WK8 F;  2HOA A;  4CYC A;  1W4M A;  2IA1 A;  2VBZ A;  1MSE C;  3F8N A;  2HGC A;  1KU2 A;  3GTO J;  3R0A A;  3GLL A;  2L0K A;  3NWS A;  2DFH A;  1RPW A;  1X3Z B;  1RC9 A;  2PG4 A;  2W48 A;  3G73 A;  2HQ5 A;  3NWT A;  4A0Y A;  4HZF A;  5GTH C;  3SJM A;  2IP2 A;  4AM3 A;  1DP3 A;  1J7K A;  2V6C A;  3HPH A;  4E57 A;  4ZYD A;  3RPU A;  3A0B C;  2O0Y A;  1KYZ A;  2G7U A;  3EUH C;  3N97 A;  3QYE A;  1KU3 A;  3ERM A;  5DYM A;  3WHC A;  3TED A;  3OYD A;  1AKH A;  2ESH A;  1UHS A;  2L9R A;  2VE8 A;  2JA5 J;  4N4N B;  1S6L A;  1AI5 A;  3FXO A;  1OCR H;  1HW5 A;  2ELJ A;  3EUK L;  1EH6 A;  2WB1 A;  5M5X J;  4RB1 A;  3I55 I;  5H20 A;  1MDM A;  2CUF A;  1JKO C;  4MGR A;  1D1B A;  1ENH A;  1P4W A;  2O8X A;  3OMY A;  5KCM A;  3VYS B;  3HM5 A;  1GV2 A;  3WTY C;  4XN0 A;  2R7X A;  4C2M J;  3BTC A;  4CO8 A;  4AIH A;  3RJP A;  1OCZ H;  2QF7 A;  1QGP A;  4RAF A;  4G12 A;  2VBY A;  1LDJ A;  5GTI C;  1Z6T A;  2EZI A;  2XAF A;  3OIO A;  2BBY A;  2R7Z J;  1WGX A;  4DW6 A;  2JJ7 A;  5FD5 A;  1SAN A;  2EIJ H;  1T08 B;  3RZO J;  1R23 A;  2BGC A;  4CCJ A;  2FA5 A;  2FXA A;  3CUQ C;  1R4N B;  1Y56 A;  2M5W A;  1VQ6 I;  3NEU A;  2CH0 A;  3J7A Y;  1A35 A;  1LNW A;  1FOY A;  3DPL C;  3R4K A;  2MLG A;  4BKX A;  2HWV A;  3JRI A;  3PFY A;  3E3V A;  1FP1 D;  3ABK H;  4NBQ A;  4HSR A;  5AIQ A;  4YF9 A;  2QSG X;  4RM2 A;  3LSM A;  4EQQ A;  3A1Y A;  5L3D A;  1PUE E;  2CG4 A;  2DMT A;  3KYC B;  1ETX A;  1WJF A;  2A6E F;  3BC8 A;  2MSY A;  1IXC A;  4LG3 A;  4C3H J;  5DUI A;  2A68 F;  3OS1 A;  1AOY A;  4GXO A;  3ZMV A;  2DLL A;  4CYC B;  2VUM J;  4RGR A;  1ETO A;  1K78 A;  2VON A;  1LQ1 A;  4MIM A;  1R9T J;  1MKM A;  4I98 B;  5FFZ A;  5IY5 H;  1W5S A;  3LSJ A;  1VTN C;  1PUF A;  2BXY A;  3QQA A;  1OQY A;  3CCV I;  2YS9 A;  5J4Y A;  4WKV A;  5GAG J;  2R5Y B;  2OTL I;  1XMA A;  2VL8 A;  2WB1 N;  3KZY A;  4L5J A;  1LE8 A;  1I50 J;  1VQ4 I;  4P9U A;  1P7I A;  3DTK A;  1XPX A;  1X19 A;  2E19 A;  3CDH A;  2EFN A;  4KIT B;  1Y39 A;  5JFR A;  1AKH B;  1VQM I;  2F6C A;  4WF2 A;  2O9L A;  3BG7 A;  1MMG A;  1N77 A;  2G9W A;  4G8X A;  5DM6 F;  1PNL A;  1K6Y A;  1FBS A;  4F7Z A;  1MDM B;  1JE8 A;  5HLI A;  5LD2 C;  1XMX A;  3CUO A;  4MLO A;  4QWQ A;  3HOY J;  5D8K B;  3F8B A;  2LBF A;  3EDP A;  3O6B B;  2HXO A;  2L4M A;  1U5T C;  2IS6 A;  1GKF A;  2CW0 F;  1BOB A;  3GFM A;  5F64 A;  4A6E A;  2QQA A;  1K5S A;  3PNT A;  5CYV A;  2DMN A;  3ESW B;  5BQT A;  3EQL F;  1SEU A;  2EIM H;  2MC4 A;  2PBI A;  4BQO A;  5BS6 A;  3WTV C;  1N25 A;  3Q0U A;  4PGG A;  2MA3 A;  2EA2 A;  3Q0W A;  1YIT I;  1YO5 C;  4B3A A;  1GK9 A;  2ZNY A;  1B59 A;  3MVP A;  3RQI A;  3MKZ A;  2R7R A;  3A0H C;  1ZGJ A;  3J7Y J;  3J7Z I;  1IW7 F;  1KZH A;  1WHU A;  2L3D A;  2ZB9 A;  1T2K A;  4MNU A;  4K2E A;  3ZP5 A;  4C30 A;  3WU2 C;  3BTI A;  3GZ5 A;  3H9Q A;  4YEL A;  1XCB A;  4RM3 A;  5J6X A;  1D0Z A;  2HS5 A;  2KKO A;  3GXO A;  1KGS A;  4TV7 A;  2DFF A;  2K4J A;  3DP7 A;  1TW2 A;  1MW7 A;  5FLX K;  1OLT A;  2R92 J;  1FTZ A;  2K86 A;  2R7D A;  2ISZ A;  1BI0 A;  2R7O A;  3HYI A;  2HPM A;  3G3Z A;  4KUM A;  4XRF A;  4MEX F;  2HPI A;  2OCE A;  2O03 A;  4P96 A;  2XPU A;  3BR6 A;  1JVZ A;  1K78 B;  4BHC A;  1FY7 A;  1D8K A;  1ZG5 A;  4FX4 A;  3A2K A;  2HNH A;  1S3J A;  2W4S A;  2JA7 J;  4B1R A;  2XRL A;  4CH7 A;  1VQP I;  5FD6 A;  1PUF B;  3HOW J;  1X1A A;  2QZ8 A;  3K4N A;  4R8H A;  1XSV A;  1QHH D;  5HLT A;  2IRF G;  2HYG D;  2F4M B;  4CUG A;  1QZE A;  3LST A;  4KIG A;  4XLE A;  5EGO A;  5CVI A;  3M3Y J;  3PJR A;  1ZR2 A;  5FLX Z;  1W36 D;  2XKP A;  2X6Y A;  3ZN1 A;  2L5Q A;  2IA0 A;  2P7V B;  3GTL J;  3TQN A;  1ETQ A;  5LHH A;  3EET A;  4PSX A;  5KAF C;  2MG4 A;  2IS4 A;  1QZY A;  2LY2 A;  4Z6Y A;  4MFE A;  2H8R A;  2PN6 A;  2ZXI A;  4B43 A;  1AI6 A;  1TT0 A;  1X3W B;  1DGW Y;  5J47 A;  3I4P A;  3TO7 A;  1IV6 A;  4WXH A;  3C2B A;  1YOV B;  1HCR A;  1J2X A;  2E5Z A;  1FX7 A;  2P7C B;  5FKK A;  2JUG A;  3B02 A;  3G1L A;  4M9S A;  3QAH A;  3VWB A;  2ZFU A;  2MBF A;  2YPR A;  1XB4 A;  1XG1 A;  1I5Z A;  5LRR A;  1YW9 A;  4G7H F;  1JTX A;  3BJ6 A;  2DTR A;  1Y0U A;  1UZC A;  3V7C A;  5FLV A;  4PZJ A;  3K3W A;  2RQQ A;  2W84 A;  4BQN A;  5KHD A;  3NRV A;  1FYK A;  3LAJ A;  3BRO A;  1W7P A;  1POG A;  3BR2 A;  5EEH A;  1LFU P;  2R7S A;  2FBH A;  4WXC A;  1RIO H;  4ENM A;  4JOM A;  4M9X A;  3W6V A;  2R7Q A;  1V5F A;  4XSX F;  2TDX A;  3CCY A;  1U0J A;  4M73 A;  1GXP A;  1W36 C;  2IGK A;  1IGN A;  2LYC A;  4G7O F;  2Z2S B;  1C0W A;  1QBJ A;  4XLN F;  1I6H J;  2Y9Z A;  1TW3 A;  1V54 H;  2DT6 A;  2F5D A;  5CJ9 A;  5H6R A;  2DU9 A;  2HOE A;  2M8E A;  3Q9S A;  4A3B J;  1TC3 C;  3PQK A;  1UEL B;  3ABU A;  1YIO A;  3BQY A;  3E1S A;  3JRC A;  2E1N A;  2GXA A;  4HF1 A;  3J7A O;  2V9K A;  4NC8 A;  4ZDO A;  3EYY A;  2VKE A;  1ONV A;  1YG2 A;  2AO9 A;  5K5Q A;  1HKT A;  4XMY A;  3TKY A;  2DA3 A;  4CSW A;  4XID A;  3U1K A;  3FBI B;  2F5V A;  3I3L A;  2C6Y A;  2DCE A;  3L9F A;  4XK4 A;  2OZ6 A;  5EGO B;  4CCN A;  3H1C A;  3W2V A;  5LRS A;  3OYN A;  3E6B A;  2JSP A;  4HEA 2;  3FKI J;  3Q5F A;  2DQR A;  4IHW A;  2OF7 A;  5J8C A;  3GTM J;  3P5J A;  3JW4 A;  3SRB A;  4B09 A;  4IHT A;  3PNY A;  4IJA A;  2VC1 A;  4E7S A;  1Y1W J;  3R60 A;  1X3U A;  5LEK A;  4HBL A;  5ERI A;  1F9N A;  4II3 A;  3FXJ A;  1IF1 A;  2QVO A;  3WOD F;  4YRV A;  3FXQ A;  5TGT A;  3VYT B;  2BVL A;  4DQ2 A;  3VOE A;  2QWW A;  2YSR A;  4S0H B;  3GLX A;  2MH2 A;  2HZD A;  1O3R A;  3AG3 H;  3HC7 A;  2LTP A;  1DP7 P;  2LY1 A;  3CJT B;  4ESB A;  2DO7 A;  3TO9 A;  2WTE A;  2UXN A;  3TP0 A;  1FMW A;  2XRN A;  4I0B A;  4L9J A;  4G7Z F;  5FO5 A;  1VQ8 I;  2YU3 A;  4WKS A;  4GFB A;  1YX5 A;  2R3S A;  4OWR B;  1GM7 A;  2A05 A;  2ZCW A;  2X1E A;  1FWZ A;  2FE3 A;  4JP0 A;  3W6J B;  2GAU A;  2Z3Y A;  1GHC A;  1WJC A;  1OCC H;  3E5Q A;  3HXL A;  2STT A;  4LFU A;  2DW4 A;  5FRM A;  1R49 A;  4YII A;  3I64 A;  3JTH A;  3GX4 X;  1NK3 P;  4XRS G;  4AVZ A;  3CCL I;  1U8B A;  3MKW B;  2HKX A;  2JUC A;  2ZME A;  2MD5 A;  2GA2 A;  5ILV A;  3F3X A;  5HDK A;  2VJI A;  3IC7 A;  1I1G A;  3TGN A;  1ZYR F;  4XIC A;  3FIS A;  2K3F A;  3FMS A;  3HBL A;  3K2A A;  4RLF A;  1FBQ A;  2OTJ I;  1QRY A;  3WHB A;  3JTQ A;  2Q8K A;  4YFA A;  2AQF A;  1FOX A;  4WKU A;  4UB6 C;  1BL0 A;  3D5R C;  3SFZ A;  1YHQ I;  1FLI A;  4K2G A;  2NRA C;  6PAX A;  2O3F A;  1A36 A;  2XKO A;  2RNG A;  3V8J A;  2FQ3 A;  3C2G A;  3V42 A;  2VN2 A;  4HLY A;  1MBJ A;  3T8R A;  4E7I A;  1B9N A;  1Z05 A;  3SEZ A;  2ZO4 A;  3F72 A;  4GYG A;  4UV8 A;  1AJN A;  3P7N A;  4BTH A;  1S7O A;  3ZMS A;  4ZTF A;  4M72 A;  2PFB A;  2JTV A;  3KP4 A;  4MFD A;  1KQ0 A;  2OCC H;  3T0Y A;  3E6C C;  3WE2 A;  1JHF A;  5F0H A;  1IDZ A;  4DYR A;  3FX3 A;  1HQC A;  3ZGK A;  3RKQ A;  2CQQ A;  1T6S A;  2DTZ A;  1LB2 A;  5GPC A;  2I5U A;  2Z1D A;  1VI0 A;  4E4H A;  1K83 J;  3F21 A;  1AJQ A;  3C2H A;  2W7N A;  2K9Q A;  1R1U A;  4LIU A;  4BDY A;  2FSW A;  2Z16 A;  4ZTJ A;  4F92 B;  3BR1 A;  5E79 C;  4PJM A;  3SDB A;  1SFX A;  4RA2 A;  4C2U A;  1CP9 A;  4HF0 A;  1G2H A;  3IAM 2;  2CJJ A;  5F0C A;  2X48 A;  3ZMT A;  3S8P A;  1FEX A;  1Z7U A;  3I71 A;  1UST A;  2WAE A;  1MH3 A;  4I7H A;  2IA2 A;  1R1V A;  1ZRF A;  4XOR A;  1FSE A;  3LNQ A;  3WU0 A;  4MEY F;  4E56 A;  3LSG A;  4UB8 C;  5EZG A;  1JGS A;  3F6V A;  3GCM A;  3OYF A;  1OIS A;  4HX7 A;  3OR2 C;  2MFZ A;  1E3P A;  2VXD A;  5DTD A;  4A0Z A;  4IHX A;  1PDN C;  3CLO A;  4ZDL A;  4XLF A;  2L9S A;  4D0P A;  5L3G A;  4BUP A;  1KU9 A;  1OR7 A;  1R4M B;  2IAI A;  4LGW A;  3CCU I;  5D4R A;  1Z3Y A;  1BIA A;  4DNC A;  4OIN F;  1HXD A;  4AVP A;  1X2M A;  2ZXH A;  4RMN A;  2B7E A;  2XHK A;  5HS8 A;  1YS7 A;  3OYJ A;  1P4X A;  1YI2 I;  4M6X A;  1IRG A;  2Y9Y A;  2VC0 A;  3PIO F;  1HKQ A;  2ZSH B;  4HAM A;  3TP3 A;  2F5E A;  4N4O B;  1EA3 A;  2HFH A;  3G1M A;  1PP7 U;  4NHJ A;  1WKM A;  4WCG A;  3OYB A;  1RRJ A;  2EPF A;  2VIX A;  1FJL A;  4ZH4 F;  5DS9 A;  4N0B A;  4D1Q A;  4JX6 A;  4XNF A;  2E1M C;  3BWG A;  4WXD A;  2KRF A;  4HNV A;  5TIS C;  1WCM J;  1Z6R A;  2CW8 A;  1TTY A;  3DKX A;  4LLN A;  5FRO A;  3FHN A;  1L0O C;  2O6G E;  3HL2 A;  4L5E A;  1J59 A;  4Y4R A;  3ZR8 X;  4XKC A;  1ZKG A;  2CRG A;  2LK2 A;  3ASO H;  5EEA A;  3OV8 A;  2DA7 A;  2Z99 A;  3W2A A;  3OY9 A;  2KIU A;  1ZLJ A;  3IL2 A;  3WGG A;  2GQQ A;  5KVR A;  4PCQ A;  4HW0 A;  2DOF A;  4YEJ A;  1XD7 A;  1TL8 A;  1TLH B;  2M1B A;  4LIV A;  4IRG A;  3OSF A;  3M8F A;  4NC6 A;  3GO5 A;  5HOO A;  1JW0 A;  2GZW A;  2QBY B;  3ZMU A;  1T0F A;  3KFW X;  1D1C A;  2Z33 A;  1RR7 A;  4E7J A;  3BT9 A;  1BBY A;  4HF2 A;  3LA3 A;  5J4V A;  3BG6 A;  1BR1 A;  1QQI A;  1AU7 A;  3S14 J;  4BE1 A;  4A93 J;  2MD0 A;  4DIQ A;  3G6E I;  4KFC A;  4F55 A;  3R6S A;  1Z3X A;  2JZY A;  1P4A A;  2ADU A;  3DBR B;  4HYE A;  4UV9 A;  4E7L A;  1TNS A;  1MJA A;  1BN5 A;  4BAC A;  2W24 A;  1WI9 A;  2IPQ X;  1D5Y A;  3BPV A;  3M8E A;  4RLQ A;  3LA2 A;  1ZHF A;  4XM3 A;  3OYC A;  4XBF A;  1MD0 A;  2L02 A;  2X6X A;  3GTJ J;  4LIT A;  2UXX A;  3F6O A;  5K5R A;  1YW7 A;  2CO5 A;  3C1D A;  3P9C A;  4PFO A;  3MKL A;  3JRG A;  2IBD A;  2M34 A;  4JQF A;  3GVA A;  3CF2 A;  3RPU D;  1N75 A;  3GBG A;  1YX3 A;  4A5N A;  3OYE A;  2LH9 A;  4BHB A;  1UCR A;  3JRE A;  3BR0 A;  3QP5 A;  3CD6 I;  1GHD A;  3HKZ A;  3JRF A;  2P5L C;  2OA4 A;  4A12 A;  4ZZL A;  2PMH A;  4EM2 A;  2Y48 A;  4BJ5 C;  2XAJ A;  1SAU A;  1MIJ A;  5KAI C;  4FTH A;  2NS0 A;  1K61 A;  1SC7 A;  2W82 A;  5JLX A;  2CGP A;  4OIQ F;  3B6A A;  3QPH A;  4WKT A;  2N8G A;  1Y8R B;  2JWT A;  5IOZ A;  5IT9 Z;  2EFQ A;  2J5P A;  3PO2 J;  4IQ4 A;  2V1U A;  3CCS I;  2FD5 A;  2LF8 A;  3ZQG A;  2EJR A;  1ZG1 A;  2DPU A;  4IHS A;  3KCC A;  5KK1 A;  2XGD A;  4X1E A;  2R5Y A;  1B4A A;  4PUS A;  2DI3 A;  2ESN A;  4IXA A;  1IRX A;  2RKH A;  1BC7 C;  1FOW A;  1V5G A;  1D8J A;  1R71 A;  4G9Y A;  1WVR A;  2WA0 A;  1ETK A;  2IEK A;  5ILS A;  2DMU A;  3N4M A;  1Q1V A;  1T95 A;  4AU7 A;  2QA4 I;  2E34 A;  4M3B A;  3S16 J;  1Z9C A;  1YYV A;  3TOB A;  2E60 A;  1BA5 A;  4HX8 A;  1J5Y A;  3S8R A;  4HRI A;  4BU2 A;  4CYD A;  3CMA I;  2H8W A;  4C3J J;  3ZMZ A;  2QEX I;  1X4O A;  4BAY A;  2ZJP F;  2DXI A;  2FBI A;  4QIW N;  1FYM A;  4LLG F;  3HOU J;  2EZL A;  4MO7 A;  1D5V A;  4BEH B;  1RR8 C;  3LAP A;  4GO1 A;  1IXR C;  3LQQ A;  2RQP A;  2AXT C;  2FQ4 A;  1Y0N A;  3FMR A;  2R7W A;  5K7F A;  1T33 A;  3RCO A;  3MMY B;  1AHD P;  4XLA A;  5B3S H;  4FE4 A;  3QRF F;  4C3I J;  3I9V 2;  3EPZ A;  1NHA A;  4ZDP A;  3S93 A;  1NG6 A;  1XGM A;  2DT5 A;  4YIR X;  1SD5 A;  1CGP A;  2K3P A;  4LLL A;  1T8I A;  1KA8 A;  1R22 A;  3VSK A;  1KYW A;  1PJR A;  5HS7 A;  1IRZ A;  3MN2 A;  2BY1 A;  4E7K A;  1JUS A;  3HKZ N;  3OR1 C;  5EJC A;  3BZC A;  4BJT A;  4B48 A;  3IRR A;  3GTP J;  2Y0M A;  2TCT A;  2XIG A;  4A3D J;  1MND A;  1X1D A;  3EUA A;  3W2W A;  5HOD A;  3HSR A;  3OOP A;  2P6T A;  1TWA J;  2RRE A;  4PFP A;  3F0C A;  3OS0 A;  4X6A J;  3DKW A;  4QPQ A;  3G2B A;  3BZK A;  4BXU A;  2EZK A;  4EMS A;  2K9S A;  4L9V A;  3ASN H;  3OYG A;  1JKQ C;  2L7F P;  1A5J A;  3FM5 A;  1IO2 A;  1YJ9 I;  4QPO A;  1HLV A;  4KJZ A;  1J0R A;  4HQM A;  3GFI A;  1TQM A;  2L7Z A;  1S7E A;  2Y2Z A;  2WC2 A;  5K7H A;  1QVT A;  2QCO A;  3BG3 A;  3L94 A;  4F52 A;  4CIC A;  3HTU A;  1VQ9 I; 
#chains in the Genus database with same CATH homology
 2OV7 A;  2JUG A;  1DGR M;  3VWB A;  1T0F C;  2ZFU A;  3VDX A;  2WAQ A;  3DEE A;  2FUG 2;  2WAF A;  3L2R A;  5CKT A;  3TMO A;  5JHF A;  1R6R A;  4FAS D;  5KNL A;  2RQQ A;  4BQN A;  1AA7 A;  5KHD A;  3K3W A;  3D5L A;  4ITV A;  3H5R A;  3OYK A;  5HNH A;  2KL4 A;  2R7S A;  2VQL A;  2BW3 B;  2KPM A;  5CPR B;  2CV0 A;  4JOM A;  1PNM A;  4F3Q A;  2R7Q A;  3ZXS A;  1V5F A;  4PEM A;  4E7H A;  2X6W A;  1U0J A;  1W36 C;  3QOD A;  2IGK A;  4E55 A;  2LYC A;  4ZYA A;  2VAS A;  1AJP A;  4PJJ A;  2V7F A;  2Z2S B;  4DOZ A;  3UR3 C;  1X1B A;  3SRA A;  3LSI A;  2DT6 A;  1ERD A;  1N78 A;  1QU3 A;  2AE3 A;  3QYB A;  3OS2 A;  2CV2 A;  1UEL B;  3MKY B;  2AQE A;  2LRD A;  3CJQ B;  3DPT A;  4CCM A;  3E1S A;  3ONQ A;  2E1M B;  3AL0 B;  3PNV A;  2V9K A;  4NC8 A;  3OYI A;  2UV1 A;  4KIS A;  2DJI A;  2KMU A;  3SZG A;  4ZDO A;  5CQG A;  1GK0 A;  4XMY A;  3IAS 2;  4CSW A;  3K4K A;  2XF6 A;  3PSF A;  3H35 A;  3FBI B;  2A6T A;  2F5V A;  3CP2 A;  3I3L A;  4OAZ A;  4ANJ A;  1WJE A;  2DCE A;  2VJ5 A;  4CCN A;  2LC2 A;  3DQV C;  2VKD A;  3W2V A;  3OYN A;  2JSP A;  2PMZ A;  3L91 A;  4HEA 2;  1LFP A;  3U21 A;  2PJR A;  2M7A A;  4BXF A;  3SRB A;  1UG0 A;  4P1W A;  2KLO A;  3PNY A;  4IX7 A;  3TL4 X;  3PUB A;  4XR6 A;  2O5R A;  4E7S A;  4R79 A;  1AI7 A;  2P0W A;  4P5O A;  3KYL A;  3PL8 A;  3HOS A;  4IZZ A;  2Q1Z B;  4II3 A;  2CS3 A;  4NUB A;  4YRV A;  5TGT A;  3VYT B;  1D0X A;  2BVL A;  2KQR A;  3VYR B;  4HG2 A;  4G6T B;  2WYB A;  3DTI A;  2LG4 A;  2HZD A;  4ZC3 A;  1D0Y A;  1PNK A;  1MMA A;  1MMN A;  3HC7 A;  2V4J C;  2LY1 A;  2F4I A;  3LFU A;  3RQ4 A;  4J00 A;  4D9J A;  2HVQ A;  4XQF A;  1LDK B;  2OUM A;  2AE5 A;  1GM9 A;  2VQG A;  1JX9 A;  1FMW A;  1VZ0 A;  3K70 D;  2IGN A;  4DGW B;  2AE4 A;  2HQA A;  4WKS A;  2XC7 A;  3OL4 A;  1YX5 A;  2L2O A;  4ZJZ A;  3DPU A;  4OWR B;  4NQW B;  2XDV A;  3K4B A;  1GM7 A;  2X1E A;  1GLN A;  2BOL A;  5CQE A;  3BCA A;  2NOJ B;  3AL0 C;  1ZEL A;  1WJC A;  2VLA A;  3L2W A;  2IXS A;  3HXL A;  2M0M A;  2WYD A;  1YE9 A;  4Y3O A;  3BCB A;  3K4C A;  5FRM A;  2V26 A;  1MNE A;  4PJN A;  4XOP A;  4AVZ A;  3MKW B;  1FMV A;  2ZSI B;  3L2U A;  3LL7 A;  2K9L A;  1AI4 A;  2VJI A;  4HPQ A;  4PJL A;  4BL0 B;  2CMP A;  4RLF A;  4BGD A;  4DJA A;  4F93 B;  1K7D A;  2UUZ A;  3JTQ A;  4YFA A;  3SYT A;  2AQF A;  2VQH A;  3LSH A;  4WKU A;  4H4K C;  2CUJ A;  3D5R C;  1P9Q C;  4KT6 A;  3E0J B;  4K2G A;  2Y0S A;  2JVH A;  2RNG A;  3C2G A;  3V42 A;  4E7I A;  3CJR B;  2I8D A;  3SEZ A;  4BJ6 C;  2VXZ A;  1KON A;  2IS1 A;  1AJN A;  3K4J A;  1Y6I A;  4BTH A;  3K70 C;  3DU5 A;  3RTR A;  4ZTF A;  2HVR A;  1X4P A;  3IUO A;  4YFB A;  3UNG C;  2MYS A;  2XAU A;  3OYH A;  4IKF A;  2KRH A;  3DU6 A;  4XL9 A;  3ZRG A;  2PJR B;  4E6K G;  2R4G A;  2A5W A;  1KEH A;  2KZV A;  1GM8 A;  3OIP A;  4BS9 A;  1H2G A;  3ZGK A;  2M7B A;  2ADV A;  3L2Q A;  2BVM A;  3FKJ A;  2E5N A;  2VKH A;  2OC6 A;  4K2F A;  2Z1D A;  4E4H A;  1FXH A;  4HNT A;  1AJQ A;  3C2H A;  2V1N A;  3CMM A;  1QHG A;  4LIU A;  2W7N A;  4BDY A;  4ZTJ A;  2Z16 A;  1SFK A;  4XKV A;  4NC7 A;  3W3C A;  4B47 A;  4F92 B;  4IQJ A;  4PJM A;  3SDB A;  4C2U A;  1CP9 A;  3IAM 2;  3MD2 A;  3S8P A;  3CES A;  3HUG B;  2WAE A;  2X1C A;  4BE0 A;  4XOR A;  5HVQ C;  3FBN B;  4HST A;  3KEY A;  3IP4 B;  4E56 A;  3LSG A;  3NWS A;  1FXV A;  4XN3 A;  4CCO A;  4PK4 A;  3OYF A;  4BQQ A;  3OR2 C;  3NWT A;  2MFZ A;  2VXD A;  1DP3 A;  2HU9 A;  4ZDL A;  4B44 A;  4XLF A;  2L9S A;  1TZL A;  3HPH A;  4CZC A;  4BUP A;  3LMM A;  3EUH C;  3QYE A;  1Z3Y A;  4HNU A;  1BR2 A;  3OYD A;  2GOX B;  4XLH A;  4N4N B;  1E3A A;  1AI5 A;  2ZXH A;  4RMN A;  2WBM A;  2ELJ A;  2X1D A;  2WB1 A;  3EUK L;  3QYF A;  2LRE A;  3OYJ A;  1HA8 A;  1WJD A;  1D1B A;  4AYB A;  4DBR A;  2ZSH B;  5KCM A;  3OMY A;  2X85 A;  1WJA A;  4N4O B;  3VYS B;  1EA3 A;  3AKZ A;  1G8X A;  3OYB A;  2JVG A;  2VIX A;  4XN0 A;  2R7X A;  4D1Q A;  4C2T A;  2R7V A;  3HG9 A;  4XNF A;  2VJ4 A;  2E1M C;  2VJJ A;  2WY7 Q;  2WAD A;  2XF5 A;  2CW8 A;  2M4G A;  3DKX A;  2HVS A;  5FRO A;  3FHN A;  4M1J A;  1V5E A;  4U87 A;  1E0E A;  3H0D A;  3HL2 A;  3JTR A;  4Y4R A;  3ZR8 X;  4XKC A;  4CCJ A;  2W1O A;  2WY8 Q;  1Y56 A;  3W2A A;  3OY9 A;  3DWL E;  3S32 A;  5FRN A;  2CH0 A;  3J7A Y;  1J09 A;  5LFA A;  1LKX A;  4YEJ A;  1OR0 A;  2L7K A;  2VPL A;  3DPL C;  3DLA A;  1Z7L A;  4LIV A;  3PFY A;  4E7Z A;  5HOO A;  1JW0 A;  3H9G A;  4HSR A;  4YF9 A;  4RM2 A;  1D1C A;  3LSM A;  4OAY A;  3A1Y A;  2W00 A;  4E7J A;  3K10 A;  3SRC A;  3CP8 A;  3S3O A;  4XOT A;  4CCK A;  3BG6 A;  1BR1 A;  2KHM A;  1WJF A;  3BC8 A;  4LG3 A;  4E57 A;  4BE1 A;  2MD0 A;  4DIQ A;  3OS1 A;  3S3N A;  4F55 A;  2L9N A;  2LBF B;  1Z3X A;  2IGO A;  4X0G A;  2LOO A;  4E7L A;  4BAC A;  1BR4 A;  1WJ5 A;  2HDW A;  4XKB A;  4RLQ A;  4FET A;  2R7T A;  4XM3 A;  3OYC A;  1X1C A;  2DT7 B;  3L2V A;  2V6E A;  4WKV A;  2VL8 A;  2X6X A;  4LIT A;  3VYU B;  3H5A A;  3S3M A;  2WYE A;  3DTK A;  4PFO A;  1X19 A;  4KIT B;  1JI8 A;  4JQF A;  3CF2 A;  3TBI A;  2F6C A;  1N75 A;  3GBG A;  1YX3 A;  3BG7 A;  1MMG A;  2LH9 A;  3RPU D;  2M3A A;  2MAB A;  3ZQQ A;  3OYE A;  1N77 A;  1LVK A;  1K5Q A;  3OL3 A;  1GHD A;  3HKZ A;  1PNL A;  2XF7 A;  1K6Y A;  1NG7 A;  2KDO A;  2IGM A;  5LD2 C;  4BJ5 C;  4MLO A;  1SAU A;  2QKM B;  2W82 A;  2VB6 A;  2LBF A;  1Z21 A;  2IS6 A;  1GKF A;  4NNJ A;  4WKT A;  4II2 A;  3KX2 A;  1BOB A;  2GOM A;  2VQC A;  3PNT A;  1K5S A;  4Y33 A;  3A4C A;  4IQ4 A;  2MC4 A;  4BQO A;  3K4L A;  4PSW A;  5HNF A;  1WFX A;  4XLC A;  3M1C A;  4XON A;  2CW7 A;  4PEL A;  4PUS A;  1GK9 A;  3QOE A;  3AFH A;  3ZCO A;  1IRX A;  1V5G A;  3MKZ A;  2R7R A;  2JA2 A;  1GK1 A;  2WA0 A;  3LSK A;  1T95 A;  4AU7 A;  3D5S C;  2XSJ C;  1PYV A;  2BW3 A;  3H5N A;  1MMD A;  3DTE A;  2UWM A;  4C30 A;  2E60 A;  3BLY A;  3K6G A;  3S8R A;  4HRI A;  4BU2 A;  3H9Q A;  4YEL A;  3FDY A;  4RM3 A;  1D0Z A;  1FM2 A;  1X4O A;  2DXI A;  3ML0 A;  3HPG A;  4J01 A;  1OR7 C;  4F91 B;  4BEH B;  1WJB A;  1KEC A;  1MW7 A;  1OLT A;  3H9J A;  2R7W A;  4BDZ A;  4CA0 A;  3RCO A;  3MMY B;  4EAT A;  2R7O A;  4XLA A;  2HPM A;  2K9M A;  3OYM A;  3I9V 2;  3EPZ A;  2HPI A;  4C9Y A;  1JVZ A;  4ZDP A;  3S93 A;  1NG6 A;  3A2K A;  2CUZ A;  2HNH A;  2W4S A;  2K3P A;  4B3X A;  3VSK A;  4CH7 A;  1PJR A;  3DKY A;  3OOU A;  3OIQ A;  1X1A A;  3K4N A;  3N05 A;  4E7K A;  1QHH D;  2M4K A;  5HLT A;  2R7U A;  3OR1 C;  4BJT A;  4B48 A;  4CUG A;  4XLE A;  4CCL A;  3K4M A;  2Q2E B;  3PJR A;  1W36 D;  2CFO A;  2X6Y A;  1MND A;  2KP6 A;  2QKL B;  2L5Q A;  4U7B A;  1X1D A;  3EUA A;  3W2W A;  1S9H A;  1D1A A;  3RSN A;  4PSX A;  2DOA A;  2RRE A;  2K5C A;  3OYL A;  4PFP A;  3OS0 A;  2IS4 A;  2LY2 A;  3VSL A;  4QPQ A;  3G2B A;  4BEH A;  3OYA A;  4XKW A;  1UAA A;  1AI6 A;  2ZXI A;  4B43 A;  3M8J A;  4GRI A;  3F9K A;  3OYG A;  1TT0 A;  2WYC A;  2KRC A;  4DBQ A;  4QPO A;  4KJZ A;  1DGW Y;  2IS2 A;  3CZ6 A;  1G59 A;  3SEQ A;  3OWT A;  2X51 A;  3PSI A;  1DQU A;  3L94 A;  4BE2 A;  4F52 A;  2E5Z A;  3HOT A;  2CV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...