4PEMA

Crystal structure of s1g mutant of penicillin g acylase from kluyvera citrophila
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
258
structure length
235
Chain Sequence
PPTEVIVRDYGMPHIYADDYLFYGYGYVVAQDRLFQMEMARRSTQGTVSEVLGAFVFDKIRNYWPDSIRAQIASLSAEDKSILQGYADGMNAWDKVNASPLLPQQFSTFGFPKHWEPFDVAMIFVGTMANRFSDSTSEDNLALLTALKDKYGKQQGMAVFNQLKWLVNPSAPTTIAARSAYPLKTAALLPRYDPAPMLDRAKGTDGALLALTADQNRETIAAQFAQSGANGLAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin G acylase Alpha
publication title Crystal Structure of S1G mutant of Penicillin G Acylase from Kluyvera citrophilla
rcsb
source organism Kluyvera cryocrescens
molecule tags Hydrolase
total genus 64
structure length 235
sequence length 258
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4pemA01
4YFAA 3SRAA 1GK1A 4K2FA 4K2GA 4BTHA 1GM8A 1KECA 1GM9A 1GK9A 3JTRA 2WYCA 4E57A 4E55A 4E56A 1GHDA 3L91A 4WKTA 1AI7A 2ADVA 1FXVA 2AE5A 1K7DA 1AI5A 3SRBA 2AE4A 4HSTA 4YF9A 1AJNA 1GK0A 1K5SA 1OR0A 3L94A 1AI6A 1K5QA 1JX9A 1JW0A 4PELA 1E3AA 2WYBA 3K3WA 3ML0A 4WKUA 1FM2A 4WKVA 2WYDA 3S8RA 1GKFA 3SRCA 4PEMA 1AI4A 1FXHA 1PNKA 1PNLA 1AJPA 4HSRA 4WKSA 4YFBA 2AE3A 4M1JA 1CP9A 1AJQA 1PNMA 1GM7A 1JVZA 2WYEA 1KEHA 3JTQA 1H2GA
chains in the Genus database with same CATH superfamily
4YFAA 3SRAA 1GK1A 4K2FA 4K2GA 4BTHA 1GM8A 1KECA 1GM9A 1GK9A 3JTRA 2WYCA 4E57A 4E55A 4E56A 1GHDA 3L91A 4WKTA 1AI7A 2ADVA 1FXVA 2AE5A 1K7DA 1AI5A 3SRBA 2AE4A 4BWCA 4HSTA 4YF9A 1AJNA 1GK0A 1K5SA 3FGRA 1OR0A 3L94A 1AI6A 1K5QA 1JX9A 1JW0A 4PELA 1E3AA 2WYBA 3K3WA 3ML0A 4WKUA 1FM2A 3FGTA 4WKVA 2WYDA 3S8RA 1GKFA 3SRCA 4PEMA 1AI4A 1FXHA 1PNKA 1PNLA 1AJPA 4HSRA 4WKSA 4YFBA 2AE3A 4M1JA 1CP9A 1AJQA 1PNMA 1GM7A 1JVZA 2WYEA 1KEHA 3JTQA 1H2GA
chains in the Genus database with same CATH topology
4YFAA 3SRAA 1GK1A 4K2FA 4K2GA 4BTHA 1GM8A 1KECA 1GM9A 1GK9A 3JTRA 2WYCA 4E57A 4E55A 4E56A 1GHDA 3L91A 4WKTA 1AI7A 2ADVA 1FXVA 2AE5A 1K7DA 1AI5A 3SRBA 2AE4A 4HSTA 4YF9A 1AJNA 1GK0A 1K5SA 1OR0A 3L94A 1AI6A 1K5QA 1JX9A 1JW0A 4PELA 1E3AA 2WYBA 3K3WA 3ML0A 4WKUA 1FM2A 4WKVA 2WYDA 3S8RA 1GKFA 3SRCA 4PEMA 1AI4A 1FXHA 1PNKA 1PNLA 1AJPA 4HSRA 4WKSA 4YFBA 2AE3A 4M1JA 1CP9A 1AJQA 1PNMA 1GM7A 1JVZA 2WYEA 1KEHA 3JTQA 1H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFA A;  3SRA A;  1GK1 A;  4K2F A;  4K2G A;  4BTH A;  1GM8 A;  1KEC A;  1GM9 A;  1GK9 A;  3JTR A;  2WYC A;  4E57 A;  4E55 A;  4E56 A;  1GHD A;  3L91 A;  4WKT A;  1AI7 A;  2ADV A;  1FXV A;  2AE5 A;  1K7D A;  1AI5 A;  3SRB A;  2AE4 A;  4HST A;  4YF9 A;  1AJN A;  1GK0 A;  1K5S A;  1OR0 A;  3L94 A;  1AI6 A;  1K5Q A;  1JX9 A;  1JW0 A;  4PEL A;  1E3A A;  2WYB A;  3K3W A;  3ML0 A;  4WKU A;  1FM2 A;  4WKV A;  2WYD A;  3S8R A;  1GKF A;  3SRC A;  4PEM A;  1AI4 A;  1FXH A;  1PNK A;  1PNL A;  1AJP A;  4HSR A;  4WKS A;  4YFB A;  2AE3 A;  4M1J A;  1CP9 A;  1AJQ A;  1PNM A;  1GM7 A;  1JVZ A;  2WYE A;  1KEH A;  3JTQ A;  1H2G A; 
#chains in the Genus database with same CATH topology
 4YFA A;  3SRA A;  1GK1 A;  4K2F A;  4K2G A;  4BTH A;  1GM8 A;  1KEC A;  1GM9 A;  1GK9 A;  3JTR A;  2WYC A;  4E57 A;  4E55 A;  4E56 A;  1GHD A;  3L91 A;  4WKT A;  1AI7 A;  2ADV A;  1FXV A;  2AE5 A;  1K7D A;  1AI5 A;  3SRB A;  2AE4 A;  4BWC A;  4HST A;  4YF9 A;  1AJN A;  1GK0 A;  1K5S A;  3FGR A;  1OR0 A;  3L94 A;  1AI6 A;  1K5Q A;  1JX9 A;  1JW0 A;  4PEL A;  1E3A A;  2WYB A;  3K3W A;  3ML0 A;  4WKU A;  1FM2 A;  3FGT A;  4WKV A;  2WYD A;  3S8R A;  1GKF A;  3SRC A;  4PEM A;  1AI4 A;  1FXH A;  1PNK A;  1PNL A;  1AJP A;  4HSR A;  4WKS A;  4YFB A;  2AE3 A;  4M1J A;  1CP9 A;  1AJQ A;  1PNM A;  1GM7 A;  1JVZ A;  2WYE A;  1KEH A;  3JTQ A;  1H2G A; 
#chains in the Genus database with same CATH homology
 4YFA A;  3SRA A;  1GK1 A;  4K2F A;  4K2G A;  4BTH A;  1GM8 A;  1KEC A;  1GM9 A;  1GK9 A;  3JTR A;  2WYC A;  4E57 A;  4E55 A;  4E56 A;  1GHD A;  3L91 A;  4WKT A;  1AI7 A;  2ADV A;  1FXV A;  2AE5 A;  1K7D A;  1AI5 A;  3SRB A;  2AE4 A;  4HST A;  4YF9 A;  1AJN A;  1GK0 A;  1K5S A;  1OR0 A;  3L94 A;  1AI6 A;  1K5Q A;  1JX9 A;  1JW0 A;  4PEL A;  1E3A A;  2WYB A;  3K3W A;  3ML0 A;  4WKU A;  1FM2 A;  4WKV A;  2WYD A;  3S8R A;  1GKF A;  3SRC A;  4PEM A;  1AI4 A;  1FXH A;  1PNK A;  1PNL A;  1AJP A;  4HSR A;  4WKS A;  4YFB A;  2AE3 A;  4M1J A;  1CP9 A;  1AJQ A;  1PNM A;  1GM7 A;  1JVZ A;  2WYE A;  1KEH A;  3JTQ A;  1H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...