The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
163
|
structure length |
163
|
Chain Sequence |
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural characterization and high-throughput screening of inhibitors of PvdQ, an NTN hydrolase involved in pyoverdine synthesis.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Pseudomonas aeruginosa
|
molecule keywords |
Acyl-homoserine lactone acylase pvdQ subunit alpha
|
total genus |
52
|
structure length |
163
|
sequence length |
163
|
ec nomenclature |
ec
3.5.1.97: Acyl-homoserine-lactone acylase. |
pdb deposition date | 2010-01-04 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Penicillin Amidohydrolase; domain 1 | Penicillin Amidohydrolase, domain 1 |
#chains in the Genus database with same CATH superfamily 1AI7 A; 1JVZ A; 1AI6 A; 1H2G A; 4HSR A; 1K7D A; 1GK9 A; 1FXV A; 1AJQ A; 1PNK A; 4YFA A; 2AE4 A; 2AE5 A; 2WYD A; 4HST A; 4WKT A; 4WKS A; 1PNM A; 4YF9 A; 1GK0 A; 3ML0 A; 1GK1 A; 3S8R A; 4E55 A; 1K5S A; 1AJP A; 4YFB A; 1FXH A; 1GHD A; 4PEL A; 1PNL A; 2ADV A; 1GM9 A; 1GM8 A; 3SRA A; 1AI4 A; 4E56 A; 1JW0 A; 3JTQ A; 3SRC A; 4BTH A; 1CP9 A; 1KEC A; 4M1J A; 1OR0 A; 3K3W A; 3JTR A; 4WKV A; 1KEH A; 4K2F A; 1E3A A; 1GKF A; 2WYC A; 2WYE A; 3L94 A; 4K2G A; 1JX9 A; 1GM7 A; 1AJN A; 1K5Q A; 1AI5 A; 1FM2 A; 4PEM A; 3SRB A; 3L91 A; 4E57 A; 2AE3 A; 2WYB A; 4WKU A; #chains in the Genus database with same CATH topology 1AI7 A; 1JVZ A; 1AI6 A; 1H2G A; 3FGR A; 1K7D A; 3FGT A; 4HSR A; 1GK9 A; 1FXV A; 1AJQ A; 1PNK A; 4YFA A; 2AE4 A; 2AE5 A; 2WYD A; 4HST A; 4WKT A; 4WKS A; 1PNM A; 4YF9 A; 1GK0 A; 3ML0 A; 1GK1 A; 3S8R A; 4E55 A; 1K5S A; 1AJP A; 4YFB A; 1FXH A; 1GHD A; 4PEL A; 1PNL A; 2ADV A; 1GM9 A; 1GM8 A; 3SRA A; 1AI4 A; 4E56 A; 1JW0 A; 3JTQ A; 3SRC A; 4BTH A; 1CP9 A; 1KEC A; 4M1J A; 1OR0 A; 3K3W A; 3JTR A; 4WKV A; 4BWC A; 1KEH A; 4K2F A; 1E3A A; 1GKF A; 2WYC A; 2WYE A; 3L94 A; 4K2G A; 1JX9 A; 1GM7 A; 1AJN A; 1K5Q A; 1AI5 A; 1FM2 A; 4PEM A; 3SRB A; 3L91 A; 4E57 A; 2AE3 A; 2WYB A; 4WKU A; #chains in the Genus database with same CATH homology 1AI7 A; 1JVZ A; 1AI6 A; 1H2G A; 4HSR A; 1K7D A; 1GK9 A; 1FXV A; 1AJQ A; 1PNK A; 4YFA A; 2AE4 A; 2AE5 A; 2WYD A; 4HST A; 4WKT A; 4WKS A; 1PNM A; 4YF9 A; 1GK0 A; 3ML0 A; 1GK1 A; 3S8R A; 4E55 A; 1K5S A; 1AJP A; 4YFB A; 1FXH A; 1GHD A; 4PEL A; 1PNL A; 2ADV A; 1GM9 A; 1GM8 A; 3SRA A; 1AI4 A; 4E56 A; 1JW0 A; 3JTQ A; 3SRC A; 4BTH A; 1CP9 A; 1KEC A; 4M1J A; 1OR0 A; 3K3W A; 3JTR A; 4WKV A; 1KEH A; 4K2F A; 1E3A A; 1GKF A; 2WYC A; 2WYE A; 3L94 A; 4K2G A; 1JX9 A; 1GM7 A; 1AJN A; 1K5Q A; 1AI5 A; 1FM2 A; 4PEM A; 3SRB A; 3L91 A; 4E57 A; 2AE3 A; 2WYB A; 4WKU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...