The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
164
|
structure length |
164
|
Chain Sequence |
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRWLVEGGVGQFADALVAAAPPGAEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Reducing Virulence of the Human Pathogen Burkholderia by Altering the Substrate Specificity of the Quorum-Quenching Acylase Pvdq
pubmed doi rcsb |
| molecule keywords |
ACYL-HOMOSERINE LACTONE ACYLASE PVDQ SUBUNIT ALPHA
|
| molecule tags |
Hydrolase
|
| source organism |
Pseudomonas aeruginosa
|
| total genus |
53
|
| structure length |
164
|
| sequence length |
164
|
| ec nomenclature |
ec
3.5.1.97: Acyl-homoserine-lactone acylase. |
| pdb deposition date | 2013-06-18 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Penicillin Amidohydrolase; domain 1 | Penicillin Amidohydrolase, domain 1 |
#chains in the Genus database with same CATH superfamily 2AE3 A; 1AI4 A; 2WYD A; 1PNK A; 3L94 A; 4E57 A; 1GK9 A; 1H2G A; 1AI6 A; 1K5Q A; 4PEL A; 4YF9 A; 4E56 A; 1AJP A; 4WKU A; 4BTH A; 3S8R A; 1FM2 A; 4M1J A; 2AE5 A; 3SRC A; 4YFA A; 2WYB A; 1K5S A; 1GM9 A; 1CP9 A; 1GM8 A; 1OR0 A; 1PNM A; 3K3W A; 4WKT A; 1AI7 A; 1FXH A; 4HST A; 4YFB A; 3JTR A; 1GM7 A; 1AJQ A; 1GK0 A; 2WYC A; 4K2G A; 3JTQ A; 2WYE A; 1GKF A; 2AE4 A; 4WKV A; 1PNL A; 3L91 A; 3SRB A; 1JW0 A; 1JX9 A; 1K7D A; 1GHD A; 3SRA A; 1E3A A; 4HSR A; 3ML0 A; 4WKS A; 1AI5 A; 1JVZ A; 1KEH A; 4K2F A; 1KEC A; 4E55 A; 4PEM A; 1FXV A; 1AJN A; 2ADV A; 1GK1 A; #chains in the Genus database with same CATH topology 2AE3 A; 1AI4 A; 2WYD A; 1PNK A; 3L94 A; 4E57 A; 1GK9 A; 1H2G A; 1AI6 A; 1K5Q A; 4PEL A; 4YF9 A; 4E56 A; 1AJP A; 4WKU A; 4BTH A; 3S8R A; 1FM2 A; 4M1J A; 4BWC A; 2AE5 A; 3SRC A; 3FGR A; 2WYB A; 4YFA A; 1K5S A; 1GM9 A; 3FGT A; 1CP9 A; 1GM8 A; 1OR0 A; 1PNM A; 3K3W A; 4WKT A; 1AI7 A; 1FXH A; 4HST A; 4YFB A; 3JTR A; 1GM7 A; 1AJQ A; 1GK0 A; 2WYC A; 4K2G A; 3JTQ A; 2WYE A; 1GKF A; 2AE4 A; 4WKV A; 1PNL A; 3L91 A; 3SRB A; 1JW0 A; 1JX9 A; 1K7D A; 1GHD A; 3SRA A; 1E3A A; 4HSR A; 3ML0 A; 4WKS A; 1AI5 A; 1JVZ A; 1KEH A; 4K2F A; 1KEC A; 4E55 A; 4PEM A; 1FXV A; 1AJN A; 2ADV A; 1GK1 A; #chains in the Genus database with same CATH homology 2AE3 A; 1AI4 A; 2WYD A; 1PNK A; 3L94 A; 4E57 A; 1GK9 A; 1H2G A; 1AI6 A; 1K5Q A; 4PEL A; 4YF9 A; 4E56 A; 1AJP A; 4WKU A; 4BTH A; 3S8R A; 1FM2 A; 4M1J A; 2AE5 A; 3SRC A; 4YFA A; 2WYB A; 1K5S A; 1GM9 A; 1CP9 A; 1GM8 A; 1OR0 A; 1PNM A; 3K3W A; 4WKT A; 1AI7 A; 1FXH A; 4HST A; 4YFB A; 3JTR A; 1GM7 A; 1AJQ A; 1GK0 A; 2WYC A; 4K2G A; 3JTQ A; 2WYE A; 1GKF A; 2AE4 A; 4WKV A; 1PNL A; 3L91 A; 3SRB A; 1JW0 A; 1JX9 A; 1K7D A; 1GHD A; 3SRA A; 1E3A A; 4HSR A; 3ML0 A; 4WKS A; 1AI5 A; 1JVZ A; 1KEH A; 4K2F A; 1KEC A; 4E55 A; 4PEM A; 1FXV A; 1AJN A; 2ADV A; 1GK1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...