The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
EHVVYVGNKPVMNYVLATLTQLNEGADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVSTIEIVLAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a Sir2 substrate, alba, reveals a mechanism for deacetylation-induced enhancement of DNA-binding
pubmed doi rcsb |
| molecule keywords |
conserved hypothetical protein AF1956
|
| molecule tags |
Gene regulation
|
| source organism |
Archaeoglobus fulgidus
|
| total genus |
22
|
| structure length |
87
|
| sequence length |
87
|
| ec nomenclature | |
| pdb deposition date | 2002-12-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01918 | Alba | Alba |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Alba-like domain |
#chains in the Genus database with same CATH superfamily 1NFJ A; 2Z7C A; 1H0X A; 2H9U A; 1Y9X A; 3U6Y A; 3TOE A; 1UDV A; 3IAB A; 1NH9 A; 2BKY X; 1H0Y A; 1NFH A; 4Z9E A; 2A2Y A; 2EK0 A; 2EH1 A; 3WBM A; 3IAB B; 1VM0 A; 2Q3V A; #chains in the Genus database with same CATH topology 3TSP A; 4NCX A; 3ZII A; 4HVZ A; 1DCJ A; 2GTC A; 4FBK A; 3T1I A; 3DSC A; 1H4S A; 1TIG A; 2IFE A; 4OLF A; 1RQ8 A; 1II7 A; 2EK0 A; 1H4Q A; 1JDQ A; 4NZT M; 3LVK B; 4HVC A; 3TTD A; 2H9U A; 3HZ7 A; 1VR4 A; 4FBW A; 3DSD A; 4FCX A; 1JO0 A; 1S8E A; 2P9B A; 4K88 A; 2LXR A; 1NFH A; 4Z9E A; 1H4T A; 4WI1 A; 1LN4 A; 2Q3V A; 3LVJ C; 3P04 A; 4K87 A; 1NJ5 A; 2Z7C A; 3ZIG A; 2L8Y A; 4NZR M; 2Y1B A; 1PAV A; 3U6Y A; 3TOE A; 1UDV A; 2M71 A; 4K86 A; 3TSU A; 2BKY X; 3TTF A; 3ZIH A; 1H0Y A; 3TTC A; 4Q15 A; 3ZIE A; 3IAB B; 4YKE A; 1VM0 A; 2CRQ A; 3TSQ A; 1NJ6 A; 4HD0 A; 4YDQ A; 3VTI A; 1NJ2 A; 1NFJ A; 1H0X A; 1JE3 A; 1Y2I A; 1XEZ A; 1HC7 A; 1Y9X A; 1NJ1 A; 3IAB A; 1NH9 A; 4TWA A; 3VTH A; 4EO0 A; 3QKB A; 3IAL A; 2A2Y A; 4FBQ A; 2LN3 A; 2EH1 A; 3WBM A; 1NJ8 A; #chains in the Genus database with same CATH homology 1NFJ A; 2Z7C A; 1H0X A; 2H9U A; 1Y9X A; 3U6Y A; 3TOE A; 1UDV A; 3IAB A; 1NH9 A; 2BKY X; 1H0Y A; 1NFH A; 4Z9E A; 2A2Y A; 2EK0 A; 2EH1 A; 3WBM A; 3IAB B; 1VM0 A; 2Q3V A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...