4K88A

Crystal structure of human prolyl-trna synthetase (halofuginone bound form)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
497
structure length
490
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords Proline--tRNA ligase
total genus 143
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k88A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k88A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k88A02
3RUXA 2DU7A 2P0LA 1SESA 2P5IA 4TQFA 1IL2A 1PYSA 2E5AA 1QF6A 4HWPA 3W3SA 3LSQA 2DKGA 3L4GA 4WI1A 4H02A 3HXZA 4TTVA 5K1PA 1WQWA 2E3CA 3NEMA 1G5HA 3VBBA 2J3MA 4YRIA 4YROA 4HA8A 2ODRC 3DSQA 3NELA 4H2TA 1NYRA 3UGTA 3V8JA 2DJZA 4RMFA 4P74A 2DXTA 2EJGA 1B7YB 1X54A 2ZT8A 3BFMA 3IALA 4P74C 1G5IA 1EVKA 12ASA 4XU1A 2DTOA 2FYKA 3V8LA 2IY5A 3UH0A 4YRFA 4CH4A 2DTIA 2QHUA 3L4GB 4HVCA 1HTTA 2ZIOA 1LYLA 4P3OA 3V7SA 1Z7NA 3IKLA 4XTVA 4KQEA 2DZ9A 2G4CA 4OLFA 4X5OA 4J15A 4YRCA 1BIAA 4CS3A 4Q6GA 1B7YA 4H2XA 3MF2A 4WJ4A 1WPYA 1NJ8A 1NNHA 4TVAB 4XU3A 4PG3A 3QTCA 4TVAA 1E1TA 4P75C 4G84A 1H4SA 1G51A 2C8MA 1E22A 1ASYA 4OP0A 3RACA 2CJBA 1KMMA 2E1HA 3L2ZA 5ELNA 3A5ZA 2ZNIA 1X01A 2E10A 1HXDA 3HY1A 2DQ3A 2RHQA 1E1OA 4ZTUB 2PMFA 4UP8A 1NJ5A 3V7RA 4BWAA 2AKWB 1C0AA 3V8KA 2AKWA 3A74A 2RHSB 3HXWA 4L87A 1ADJA 1N9WA 4PHCA 1W66A 4XTZA 3PZCA 4XEMA 1BBWA 3ICAA 1ASZA 4XU2A 2ZNJA 4XTXA 1PYSB 4H2UA 3A32A 2ZIMA 5C53B 1FYFA 5C51B 2I4NA 1H4TA 2EL9A 3VQYA 5C52B 4YRGA 1V95A 5KNNA 4P3NA 1WU7A 4XTUA 2ZR3A 4CH6A 3BJUA 4H2YA 1YFRA 3A7UA 3EFRA 2ARUA 3V7CA 1EOVA 4YYEA 2ALYB 3UFGA 1KOGA 2ZTGA 2ALYA 2ARTA 4CH5A 4YRTA 1EIYA 3NETA 4NCXA 4YP0A 5K1XA 2LW7A 2EJ9A 4K88A 3HXYA 1VQZA 1BBUA 2ZT5A 4P72C 4HWSA 3VQWA 3WQZA 4RDXA 4P73C 4P3PA 1EFWA 3QNEA 4H2WA 4UP7A 1EQRA 4WJ3M 2J3LA 1YFTA 1SRYA 3HFZB 3HXXA 1USYA 3HFZA 4H2XB 3HRIA 2CJ9A 4P73A 2DQ0A 4CS2A 2ARSA 4P72A 2EAYA 4O2DA 3PCOB 4HWTA 4YREA 3OD1A 3REUA 2I4OA 4CH3A 3M4QA 4WF2A 3A5YA 3RKYA 2Q7GA 2QHTA 2ZZGA 1B70B 3I7FA 4UP9A 3ERRA 1QE0A 4LNSA 4YRLA 3CMQA 4RQFA 3MEYA 2E41A 1WLEA 1X2GA 4HWOA 4YRJA 3IKMB 2E65A 4ZIBA 4E51A 3E9IA 5ELOA 1E24A 4YCWA 2ZT6A 2Q7EA 4EO4A 4RQEA 4AH6A 4CS4A 3QO5A 4UPAA 4YRMA 3VQVA 4G85A 1X56A 4XTWA 2Q5IA 3RKWA 4BW9A 4H2VA 4YRSA 1B70A 1B8AA 2Q5HA 1JJCB 3RKXA 4YRKA 1JJCA 1X55A 1WYDA 4YCUA 3QO7A 2XGTA 3RL6A 4ZTZB 2I4MA 3HXVA 5HGQA 4KR3A 3VQXA 2AMCA 1RIQA 4YRQA 11ASA 1BIBA 4KR2A 4YRPA 2DTHA 1NJ6A 1EVLA 1YFSA 2CGHA 2DZCA 3L1AA 2RHSA 3HXUA 1YGBA 2XTIA 1USYC 2CJAA 1KMNA 4K86A 4DQ2A 4TVYA 1Z7MA 2DVEA 4HWRA 2HNIA 1ATIA 1H4QA 2QHVA 3P8TA 1SETA 4YRRA 3LC0A 1H4VB 2EJFA 4YRNA 3FJPA 3HY0A 3TUPA 4XEOA 2ZCEA 2ZXFA 4Q15A 4TWAA 2EWNA 3LSSA 4TQDA 1WNLA 3RIRA 2QHSA 4TVWA 2IY5B 3TEHA 1EIYB 3TEHB 4P75A 4P71C 5E3IA 2DEQA 3MF1A 3QO8A 4DPGA 1HC7A 1B76A 3R07A 1NYQA 2ZGWA 3A7RA 3A7AA 3HTZA 2Q7HA 3IG2A 3RGLA 3NENA 3KFUA 2DDZA 3REXA 3UGQA 2ZT7A 4YPFA 3RF1A 3M4PA 2PMEA 2I4LA 1GGMA 2ODRD 2ZZFA 4YCVA 3PCOA 4K87A 1NJ1A 1NJ2A 2DXUA 2ZINA 5F5WA 3G1ZA 4XTYA 3P8YA 2C7IA 1J5WA 2DU5A 3EFSA 1X2HA 3HRKA 3E9HA 2AMCB 3HFVA 2CIMA 1YB3A 4XU0A 2RHQB 3P8VA 1WQ7A 1L0WA 1ADYA 1SERA 2ZR2A 4EX5A 4YDQA 2E64A 4P71A 3TEGA 4H2SA 2ZZEA 3A31A
chains in the Genus database with same CATH superfamily
3SJBA 2FEWB 1JNYA 1UEXC 4F3NA 3SQDA 1BH2A 2G72A 3ROGA 3LBIA 1N6RA 3D6UA 2QNRA 1M1UA 4GWLA 2VHZA 1IJKA 1H5NA 1DTWB 3BICA 4TQFA 1SUCA 2XKBA 2HA3A 1R8YA 3PQ7A 4YLGA 4BNYA 5BSFA 1T2AA 2BJVA 4H17A 2WF9A 4C22A 4JP1A 3OBBA 3OFND 3IO3A 5F1OA 4KWTA 3P52A 3EVNA 3WIDA 3X2SA 1K9SA 2QS9A 1OSNA 2Q3BA 3WB9A 4YRIA 3MGAA 4CLOA 5KAMA 3X1KA 2R1VB 2CXXA 3B1VA 2RBEA 5I5GA 1R18A 1RWVA 3NELA 3EZNA 3JS5A 2DFVA 3O3MB 4MVJD 5KYXB 4ZI7F 2MINA 1Q44A 5IAJA 1QDLB 1UBRS 2P9TA 4RCYA 1JXOA 2FY8A 3MTQA 2DJZA 1NASA 1CDEA 1X7ZA 2CXUA 2H4FA 3OT1A 3SJ7A 4US2R 3ZE6A 1ZLYA 5L4SA 4O2AF 1M6NA 3DF7A 1DIGA 2P1ZA 4KZPA 4C89A 5A2QA 2H1RA 2YMMA 4NBUA 1SG6A 2GGSA 1TCAA 4OQMA 4KPEC 1CY7A 1SCJA 3GLVA 4K2HA 4RNCA 2NU9B 4JI6B 1EDDA 4ZOBA 1A9OA 5B55A 1JIXA 1CYDA 3DDUA 1JQKA 1Q6ZA 1YKFA 3PEYA 1KAQA 3RSGA 4R2KA 1P6QA 1QF7A 1DG3A 1E7QA 2JIMA 1C9MA 3GVPA 4NOMA 4OHRA 1J0EA 2FN4A 5CYOA 2QP9X 4IIXA 4O4IF 4WNAB 4DILA 4BQEA 3R7BA 3VZDA 1OH7A 3OIVA 4IDBA 3KWJA 1FS5A 2VBCA 3GGDA 1JDBB 3H4TA 1R8JA 1LRJA 2DQKA 3K1AA 1QFSA 3OPVA 3WGNA 3CF6R 3BSFA 5JNWA 3PV0A 2FGJA 4WOJA 3V8VA 4LTNA 3ROZA 2YW2A 5B12A 4FGSA 4WDRA 5AHOA 4Z7QB 2GK6A 5JZBA 4HR7A 1WXGA 1Z47A 2WJGA 3UMSA 2HFKA 4LDRA 4MKZA 4TN1A 1KFJB 3COPA 4R69A 5BRAA 2P8SA 3IXMA 4NI5A 1E3MA 4BCCA 4KB5A 3U13A 1TZJA 2OHFA 1DLJA 2FXVA 1VKNA 3CNLA 4UU7A 2PZ8A 3B6EA 4PG8A 3GX1A 1YI1A 1YVDA 1XBTA 2WJHA 2V7TA 3CH4B 2LKCA 3CX7A 5GPBA 3BVPA 2V0GA 1BH6A 2H51A 1IHXA 3QUSA 4XM2A 1SEPA 5D1NA 3L0OA 1CC1S 3EQ2A 1EA5A 3I32A 3KHSA 3PNMA 2FDCA 2OECA 3WIEA 1UJNA 4I66A 5K3SA 2JLWA 1GDHA 1BGWA 1UJ5A 5A3VA 3ZVMA 3AKZA 3PCXA 3QA9A 2FRXA 2FSIA 3H2YA 4OKSA 2I1LA 4NFHA 4BVEA 2LDBA 4KUHA 3RVJA 3KSUA 1JALA 2IZZA 1IUPA 4YQZA 4ZVPA 1YQUA 2JRCA 2KB0A 3PZRA 5DTEA 1YDEA 2M6RA 3LDUA 3P9IA 4MAMA 4IDEA 1ETUA 1Z0KA 1BE8A 1U1EA 1UXOA 2BTQB 2CNWD 4QO8A 2AKYA 5AK0A 2YNMD 3LWZA 2P9BA 5B2FA 1JU3A 3L46A 2GBFA 4E32A 2PZBA 3M5WA 2VEDA 3WKCA 1NI5A 1JHRA 1XJQA 3QU7A 4MINA 2OQVA 4CUKA 2RHHA 3CE9A 4G1EB 3JZFA 1KYTA 1DCFA 1YQ9A 1S89A 3V4ZA 4R9UC 4U9UA 5EXDA 3PQFA 2IV7A 2O3QA 4X7RA 4TTTS 4YIKA 3FGPA 3L8ZA 1U6KA 5JROA 3BE6A 1KPHA 3FCEA 3R5KA 4RLQA 2BSAA 1CQJB 4EECA 1MAVA 4EO0A 4GZMA 2ZPAA 1J39A 5ECYA 3O5AA 2DG2A 2DERA 1J97A 4YGXB 3RVQA 3UVEA 2B83A 3KL4A 2FQXA 5LB4A 5KJCA 1E6WA 1XVVA 1CF4A 1EI9A 1VG0B 3QEJA 4B81A 2Y9MB 2C3YA 2BCGY 3B78A 1VJDA 4DLRA 1E79D 1MO3A 1WDTA 3GMSA 2GDJA 4I0WB 3DTTA 4JX8A 3V6MA 1F7VA 1V1MA 1C7JA 2FR8A 2IHJA 5EMMA 4KQ1A 3PJFA 4GPD1 1J0DA 4MVWA 2ZDHA 4Y2XA 4QECA 5ELMA 1VXOA 1WL8A 4NJEB 4PR3A 1NC3A 3IDQA 3IP5A 3K5PA 4XPIA 4MV6A 3VU8A 4JS0A 4UPDA 1RZ3A 3Q9SA 3ZV7A 4AZTA 3PDJA 4IFTA 1A8UA 5ICMA 2FHPA 3RAFC 3UOAB 1W87A 2R62A 2XLCA 3WLIA 4L3OA 2Q5QA 4TYQA 3ZDZB 2QRJA 1N1MA 2Y9PB 3FFWA 5DKFA 1ZM2A 2F3SA 3GFQA 5FQOA 4L5IA 3ZGOA 3L7NA 4W9NA 3GARA 3N2ZB 3OWXA 4UHCA 4XZ3A 4Y2PA 3SSNA 3GLKA 2XNHA 2XZTA 4INOA 4ERNA 4ZGGA 1Q16A 1M8FA 1Z88A 4GP9A 1C9JA 4EBFA 5JNSA 2ZB8A 3JVVA 1Z6TA 3M1LA 3ORHA 2DJIA 4N65A 4V38A 3TAXA 4TWJA 1GG8A 1Y6QA 1Z8FA 3SC3A 1FFGA 3A7UA 2H1VA 2F64A 3DD5A 5GJBA 4LXHA 1LPPA 5CMLA 4ZJUA 3MTIA 2D2XA 1PVVA 2B3DA 3RTDA 4DCNA 3P9KA 3SHFA 2VHWA 3P9YA 1J2JA 5BV7A 3HUTA 3L7YA 1AKQA 1TEVA 1E99A 5T57A 2HBZA 1W0CA 2ZITA 3M1IA 5KTPA 3EBLA 4JJKA 1OJLA 1UFQA 5LXTF 2XTJA 2E5WA 4U8HA 3GRUA 1S96A 5CU7A 5T6MA 1US8A 5TPWB 2C07A 3O1JC 3VPDA 2GXQA 2ZUDA 1FDOA 2R1TB 2VP5A 1OMOA 1E5DA 3DAPA 2HY7A 2X5XA 3K09A 4JP5A 2ZE8A 5U4XA 1PZXA 3VQTA 3PF8A 3IE1A 2N46A 5A3RA 2C98A 1TVMA 1K88A 2WUEA 2HLHA 3C7AA 3DNFA 1INLA 2ZI6A 3EDCA 3O8QA 4ZT5A 5C1DA 2CLMB 5BOSA 2ZIGA 2P91A 1YFTA 4D9BA 4UOEA 3PUZA 2ZB7A 3Q5DA 2A9RA 3W2HA 5BW4A 3GEHA 3WLOA 4GRIA 3R3ZA 3T7DA 3L84A 1NUTA 3FCUB 1SUDA 3TTVA 4TMZA 4KE6A 2PSHA 4RE5A 4UPEA 2O20A 1N77A 2FEKA 2VSOA 4P72A 1EDZA 2C8KA 3VSDA 4BEBA 4LRXA 3IQXA 2UYHA 2MSCB 3ONNA 2VHCA 3S2EA 3WL6A 4D9EA 2X0KA 4WN9A 3PA8A 4UXHA 4AJ9A 1PGJA 2VEOA 3FOBA 1QE3A 5AK3A 4G65A 3C15C 3F96A 4UOQA 3F7MA 4WF2A 2GZDA 3HU2A 1JE3A 1XGKA 3PCRB 4PYMA 1T10A 4H7KA 4XKJA 1YVPA 1T9CA 5JH7A 1NQXA 4IJWA 4JZYA 1P0IA 4MW6A 3GLGB 3I7FA 2I91A 3ERRA 3HPRA 1WY7A 4KO2S 4M1TA 1DO8A 4GWGA 4PVDA 5AKGA 4PW0A 2C5LA 3VHXA 4DJFC 1NHGA 5AVYA 4OH7A 2NYAA 5M34A 2X8BA 1C7RA 1JSXA 3T0IA 3I9OA 4HWOA 3MCWA 4DCJA 2ZIEA 3SHWA 2UYOA 3FA2A 5TMEA 3OO0A 5A9RA 2Y0PA 2WG1A 1S7CA 3R5XA 4EBBA 3WHKA 2C0QA 5NLLA 4I8DA 4CDMA 3TGLA 1NKTA 3MUNA 3NRBA 2P75A 1EXWA 4LRQA 1P5JA 4JLAA 1EVZA 3PGVA 1CF2O 4J0KA 4AJ2A 3MM4A 3UMVA 2H63A 4EYEA 1UKYA 4F4JA 2IPOA 3FGZA 1PX2A 2GNPA 2H85A 3BD8A 2AQHA 4OJKA 4LV5B 2HJHA 1NY6A 4UPAA 2VRCA 1IBSA 4RAQA 4DZZA 3GLFB 4ZARA 4JI1B 1OV4A 5T41A 3QOFA 3LMKA 1GZSA 4KMSA 4OXNA 2W6PA 1JR3E 1PKXA 4XPZA 3U3ZA 2Z08A 4J2TA 4XTWA 4BW9A 2Q5EA 3PC7A 1C1XA 2QB5A 1USVA 4FINA 3HJNA 4BRWA 3GK3A 4OB7A 3DE0X 4WBNA 1GU7A 4C0KA 1F8FA 1F60A 1E2LA 4YXFA 3UK7A 3T1HB 4DV5B 5EIXA 1F14A 1I7NA 3ZLVA 1TT5A 3A9UA 4EUFA 4MVJP 4QRHA 4O2BF 3VISA 1Z4OA 3GRPA 3KUUA 4K03A 4KR7A 2GXUA 2I9PA 3EEIA 4QEKA 2VJPA 3OEWA 1KBOA 4FYKA 1IPHA 4LXIA 1VRVA 4ZYUA 3T1QA 1XYGA 2H5JA 3FUWA 3STXA 3HDYA 1BFUA 2GZMA 4TV9A 1T4CB 5D3KA 3RLIA 4H1TA 4NU5A 4NYJR 4PRZA 4DLYA 5BMVA 1GNPA 1DMSA 4CV0A 2Q6OA 3FPCA 3NTRA 4B44A 3MS2A 3QVMA 1CEQA 3TUZC 1BA2A 2CK3A 4QBKA 2FJUA 4ND2A 1JSCA 1PNOA 2JFUA 2VQDA 3HBFA 3HVIA 1IXKA 2C7GA 3AB7A 4M6WA 4BNJA 2EZ4A 2G36A 1ZO8A 3HC7A 2XGJA 3DE6X 4IWNA 1M54A 1VCNA 2KPOA 4QUIA 2QAGB 4I1OA 4UARA 5HS6A 4NV0A 5BSEA 4F6LA 4Q3OA 1E61A 3ZOKA 3PT9A 1L7AA 2QK4A 1RW4A 1Q1BA 4I9NA 1HE2A 4J0JA 4L16A 4H2DA 3SLGA 2G4VA 4JN6B 1NVEA 5JD5A 3G8DA 4R1UA 4F1WA 4BGDA 4C4RA 1DT3A 1CQIB 3BIFA 4J49A 4YJFB 4QBHA 1XA4A 3ELUA 2XWPA 1C3OA 1ZRSA 2WLSA 3AI2A 1OILA 3LKDA 1AQUA 3E84A 3N0VA 2YN2A 5TF4A 3TPFA 3L6UA 2E85A 4HXEB 4XASA 5EKSA 1G2PA 5C46F 3PYLA 4P0PB 4L5YA 4LF8B 2GWRA 4YRRA 3LVBA 3PR2B 4RGVA 3GUHA 3F74A 3OTWA 1O89A 2Q6IA 3TTYA 1VFNA 2JGNA 3GO4A 3DP7A 4JAVC 4KK4A 4EY5A 1YFLA 4G0VA 4P82A 1LN4A 2LE0A 4CNQA 4UTPA 3TE7A 1JU4A 2FEPA 6GPBA 3BB4A 3I05A 1EFPB 1L7PA 2J5BA 2IH2A 3IERA 1P80A 4RVCA 4FN5A 3QW4B 4G97A 3GEDA 1UBHS 4H4DA 4S05A 3KXPA 4U1RA 1L5GB 5CCXA 3T1NA 3TL6A 1LTKA 3E27A 1K5DA 5LZ2A 1K7SN 4ZRMA 5C1PA 2R6R1 3DNPA 1ZM3A 3AJEA 3IELA 2XYHA 3CE6A 3HY6A 4DEVA 4EJSB 1GPJA 2QHSA 5JISA 2GCIA 3IBFA 4LVCA 3U5TA 5IZCA 3TEHA 3ERCA 3BCUA 3ZTYA 5LOVA 2WWTA 4QGAA 3G85A 3D81A 1CJMA 4PYQA 4Q02A 5CGZA 2Z8XA 5KZMB 3IPXA 1I8TA 4Z1OA 5LKRA 1P1IA 3ZWDA 3LGAA 4E88A 3D5EA 5D87A 3KAQA 2HBYA 3MF1A 1IZYA 1XEZA 1DINA 2LR0A 4BOYA 1PUXA 4Y8VA 1DBIA 2YN4A 2OORC 3O84A 2IPXA 4IS2A 4CTMA 2QDKA 1YJXA 4QXQA 4LNUB 1Y81A 2IZOA 3SEZA 4AJIA 1GKIA 2CUZA 4GLOA 2QTBA 3S2FA 3KLBA 2IHBA 3A7AA 2OCKA 1W19A 2RJNA 3CZ5A 3CLSD 3DDHA 3H9QA 1FF9A 3R5TA 4QGBA 4R1LA 1TO1E 4BMDA 4CYMA 4H7FA 4CDNA 4Y1RB 3F6EX 3CLHA 2DFLA 2B99A 3F78A 4G56A 5K8IA 1AQYA 1NULA 1NLYA 2H2HA 1QX4A 1S5PA 4J8PA 1QKKA 1Q14A 3LU1A 3DYVA 3UJ3X 4QYIB 3REXA 1ZR2A 2W0MA 1WMBA 1XZCA 1OVMA 2OXRA 2Q28A 3QKRB 3KJNA 2GI4A 2XB9A 2QRHA 4O0MA 1WF3A 3RF1A 1G6OA 1TAQA 2PT6A 4X84A 5SZJA 2OV3A 2Y1OA 3KZKA 1NJFA 3SN6A 2AEFA 1QU2A 4AJJA 4ZV4A 4M9CA 1T1RA 2SKCA 5B4VA 1JR3A 3FB4A 1NX9A 3E61A 4FLEA 4XGIA 3AUYA 2ONJA 1PJ2A 3OZFA 5T4HA 3OJOA 3HUUA 3ZI7A 3GLSA 2QLLA 2GNOA 3H5TA 4TTPA 1RHRA 3DA8A 1DO0A 4QOEA 1FU4A 3KAKA 4C07A 4JXZA 1J06A 2PH7A 3E8XA 1LS6A 3GOHA 5CA0F 1B73A 1C30B 3O93A 4WCVA 1T1EA 2VYFA 1JQ5A 3G8BA 1VPVA 2MU1A 5KPJA 4B3MB 2GN9A 1SU8A 3JYNA 1ZW6A 2EZTA 3EIXA 1KEUA 1Y6GA 2P4QA 2ZOSA 3I1YA 4LWZA 4WLFA 4L9WA 4PAOA 2ZZKA 1RRKA 5CNMA 3RK4A 2D0OB 1QIMA 3DLPX 3FHOA 4QUHA 4QELA 5IEJA 3C7KA 4XSHA 2VJDA 3D8SA 1JIKA 4BQSA 3GROA 4IXMA 4LYFA 1G55A 2FZVA 2QBYB 1P3JA 4BUJA 2PBFA 1M74A 1J9ZA 1TFUA 2ENUA 3RIHA 4LRUA 4HT3B 1JYSA 2P5SA 3FWPA 1MB0A 3DDZX 3MZ0A 4FKBA 3I9V6 5KYKA 4E0BA 3HU3A 2AJBA 2OHIA 4AZ0B 4D57A 5GJCA 5B7PA 2FUCA 2VWGA 3Q15C 1UKZA 2G0NA 2Q21A 4MLPA 1E2KA 4WMLA 3DT9A 1L5HA 4DM4A 1I32A 4JKIA 2YXNA 5D1HA 3AVUA 4RLHA 3EBPA 3ANNA 3BWDD 3DEJA 1U8AA 1TC1A 4NMXB 3RFUA 1CUEA 4TOIA 5EIEA 2WFZA 2ZJ2A 1E79A 4UUMA 1J99A 5E1MA 4ZEXA 3PNSA 4MV5A 4AJ4A 1CP3A 3HI4A 3RS9A 3GOQA 1HYHA 4TM8A 5GOTA 1JLLB 1ZGGA 5C8YA 5B2ZA 4BNUA 3OKCA 1PL0A 2QSZA 4R8MA 4BY9E 2FK7A 3VH1A 4K9NA 1UXJA 3DKVA 3KWFA 4IGFA 4PCUA 1X6VA 1BIFA 4DHEA 2B4YA 4QYXA 4X45A 1YFKA 3WKAA 2G1UA 4FNMA 4K8RB 1YR7A 1Z5PA 2OBFA 5TPWA 1KE1A 5AWFC 1CUGA 3PITA 1SUBA 2VHXA 4LZJA 1ZPDA 4B17A 2PZAA 4K5QA 4HH0A 2CB0A 2C96A 1VMDA 2ZJ0A 4MGKR 1S2NA 4K81B 4MKRA 3OQVA 4TL9A 3WKDA 2DWCA 5FULA 5E6SA 2WR8A 2A67A 1DC7A 2HNBA 3ZIDA 3VOBA 3N1UA 3M81A 3N05A 3P0HA 4QUAA 3RIEA 2OYSA 3BTOA 1P33A 3OPNA 4B71A 3IOBA 4QGHA 1PN3A 4WERA 5FPHA 1OAKA 5HCUA 1ISFA 2HRZA 3O75A 3QVGB 4NZYA 1CQXA 3IDSA 5IC4A 2RI6A 1KR5A 2YCBA 4DWWA 1OT5A 2WHEA 2XGMA 1WD7A 4YRFA 1GTG1 3UIEA 1ISSA 1VMKA 2JDIA 3QENA 1H0RA 4RNDB 4FOOA 1N0HA 3CV3A 4HQOA 3Q7QA 4M9UA 4MEBA 3F49S 2IOQA 1A98A 2ZVJA 4WQMA 4F84A 1O8CA 5I8PA 1FSGA 1OFHA 4XJSA 3GRZA 1PR6A 2BGGA 16PKA 2ESRA 4OUDB 1YUNA 3IDZA 2QZJA 3VTAA 2I33A 4WCFC 4R01A 3HP4A 1KAHA 2J7PD 3U49A 5LD2B 4ZO9A 5EIBD 1NVVQ 2GXSA 3TDNA 4BLQA 3ET5A 3F7OA 3H11A 5E2AA 3ZBQA 1FFWA 2RK4A 3LQKA 2NWQA 3KLNA 2BE9A 1CB0A 2NT4A 2GKGA 2Z43A 4OGLA 3V48A 1ODKA 2DOKA 4NYMQ 3PVSA 1A7AA 1ITZA 3PEUA 5JJBA 1E9SA 5TNXA 2CF5A 2I62A 2O2JA 3EDOA 3IP6A 1QRTA 1BIAA 3BL6A 4RD0A 3G2JA 4HC4A 3UG6A 1EWTA 4CF6A 2B2CA 5ISMA 2J4FA 1N5JA 2PZMA 3P4YA 4EATA 3TL2A 4JUCA 2J5KA 2P4SA 5E1BA 1RYZA 3GCZA 2IP1A 1E59A 1KZ6A 2FQQA 5J5AA 4CU5A 1ORHA 4DDMA 1N34B 2P2NA 2DFPA 1MCZA 3FYTA 4ALMA 2GBCA 3E5HA 3DKIA 4PZLA 3ZYZA 4LF4B 1JPVA 2R6CA 4TVAA 3UK6A 3B3FA 3IFSA 2RC5A 4NBTA 4L9SA 5ADVA 4PPYA 3TECE 1XK6A 4G0YA 3SIXA 3UC5A 2HR1A 4AKIA 4DLPA 4WKCA 2DLNA 3B5IA 3H3XA 5AT1A 2WUDA 2RAPA 4CL8A 1G51A 1GKLA 1K6MA 3CB2A 5L9AA 3FY4A 1AQIA 1LBHA 5IDYA 1IL0A 3VMMA 5G0UA 4IHJA 4ONEA 2PEYA 4BJ1A 1VL0A 1P18A 4JWTA 2TMYA 1SUWA 2W6CX 4ZOLB 2QG9A 1ULBA 3SNKA 3E7PA 3LCMA 3PHBE 4RKFA 2XMCA 1QIEA 4LJ9A 3W04A 1EG2A 4DM3A 4BLPA 3KNZA 3U31A 4Q1FA 2JVJA 2PFSA 3L8CA 4UBLA 1DOHA 4F5DA 3JQFC 3EQ8A 1SR8A 1Q1ZA 1BSVA 2NXWA 3BC1A 2O54A 2HDNB 3KYJB 2VTBA 4YQFA 4UCWA 1B23P 3JYPA 5J9FA 5IEBA 4U7JA 1TE2A 2OZKA 4L4SA 1TL7C 1RKBA 4KQWA 3BL8A 2QRNA 2HTEA 3A9TA 3BZWA 3TOXA 2Y92A 3V8KA 3EH2A 2EFCB 2PUVA 5BN1A 1HPLA 1XO1A 1QTQA 4HH3C 3R3SA 3TZLA 4ZCTA 2IX3A 4DC9A 3IQIX 5AVRA 4QTYA 1LBQA 4KGVA 3TLYA 3N39C 4X20A 1YK0A 1W0KD 4TKMA 1CQIA 1WMEA 3KJZA 4IZHA 4K1XA 5EIAA 4YMVA 4G5FA 3VU1A 3OSZA 1LLDA 5HR5A 5KINB 4KFCA 1C3OB 1VJ5A 2QF7A 2PWYA 3V46A 3KKPA 4U3JB 1T9GR 4H2UA 2REQB 1U2GC 3H4MA 4TRJA 3RF6A 3WP1B 3PICA 1MABB 4UEJA 2BHNA 1Y9ZA 4EHBA 1PR1A 2GR9A 1P5ZB 4J0GA 3V3TA 1FLVA 1SVUA 2OKCA 1VJRA 3IMCA 4NZRM 1CZUA 1OH8A 1TMKA 4RMHA 1WF6A 4TS1A 3WGLA 4E07A 3EEBA 3EDQA 3M0EA 1YV9A 2H1IA 3LHKA 4DXDA 1SUEA 2QRPA 2HWYA 4QARA 2NUPB 3UG7A 3G2QA 4QOSA 3V4LA 4B6GA 3X1JA 3P2MA 4E4RA 1BCSA 1HYGA 2PMDA 3QF4A 4OOEA 4WK2B 5DCUA 4CL2A 3L4KA 3KQUA 1P91A 4TS3A 2LCFA 4DMGA 2QT9A 1OXXK 2OENG 4WXPA 3TZHA 1RPAA 3CVVA 4IDHA 1ESMA 3T7IA 3T9FA 4Y2VA 2ARUA 1ODFA 4RHYA 1EOVA 1PFKA 3R7WB 1J6UA 4Q4HB 3D43A 5CFPA 1B0AA 1PV2A 2C4MA 2AFIA 5AHWA 4FZVA 3ST7A 5GV8A 4MKHA 3ZE9A 1AKRA 4OJNA 3ZWBA 5C5CA 4HNTA 3MTEA 1MGOA 2X76A 2CXQA 2ZZMA 2X7JA 4F3KA 5JBNA 3X1WA 4HMOA 3DW3X 4OAOA 1BBUA 4AKHA 3H5IA 3LZDA 3S6JA 4LJRA 1ZINA 3NUZA 2EX0A 1IRXA 3J80A 4DBZA 4OYYA 1MNQA 1T1IA 1DIOB 2B92A 3E3AA 2FN8A 3QBDA 5FTNA 3ZXYA 3WQZA 3JWGA 3R0XA 5F51A 3D1LA 4IFEA 4OXIA 1IG3A 5KNBD 3K32A 5COQA 4L5AA 1N6IA 5L7YA 4P38A 2BCEA 1R6UA 1O94D 2R60A 3BXFA 1DAPA 2HT6A 2B82A 4JXJA 2F3RA 3BXHA 3BZUA 1X38A 5HUQA 2QKYA 4H31A 1EAMA 1LV8A 3DFZA 3HN6A 2O52A 2V7QD 4N41A 4X6LA 1A9YA 1WKBA 4MYUA 5CIWA 2ETXA 4P58A 3QVUA 4BMPB 4RWEA 3CPHA 2R85A 1W8IA 2JAUA 2TS1A 4XLZA 4B79A 3JCZA 1Q6YA 3L6EA 3I39X 4BYGA 4FEGA 2X13A 4AULA 1IAQA 3LF2A 1NF2A 4DF3A 4MITA 2ZG6A 4HHEA 4M2LA 4C7JA 1BXKA 3TQSA 2W93A 1DXHA 1NVVR 1QKJA 4FBMA 4QXOA 5FJIA 5AM5A 3EVTA 4CH3A 3H1TA 1JPUA 4FZ3A 4IHJF 4OHOA 1VRWA 1DFHA 4N47A 2EWWA 3Q4GA 2YC2C 3HXOA 1X1AA 1IU9A 4HNAA 3IR7A 4F12A 3OOSA 2PRJA 1U9IC 2YIJA 3D0OA 3WMRA 1X7WB 4GI5A 4ZCRA 4B6QA 5M7EA 1R5NA 1TGYA 5G4KB 4YALA 5CTJA 1K5HA 1J1IA 4CDRA 1U8CB 3UK2A 4MRRA 2JLYA 1KYIA 1TZMA 4EG1A 3DV0A 3F3YA 3HCAA 3TRKA 3ZC3A 4C2TA 1I24A 2YWXA 1CSEE 4EFLA 4GQBA 4BNFA 3UJ8A 4B80A 1TDJA 3VZSA 4OJQA 2O4CA 1QH0A 4MP8A 4NZTM 4MQEA 2GAIA 1GDDA 4JY7A 3I04M 5C7LO 4G6ZA 3RKSA 1F6WA 1F6BA 4JKYA 2CVHA 5A02A 3EBOA 2UZ1B 3UT5B 4M1SA 4FD3A 1FLAA 3TLZA 1THGA 2QNBA 2MMGA 4EHFA 4HGNA 5EGSA 3S81A 4WOBA 5CG1A 4CM6A 3SVZA 2WHRA 2PK3A 2QRGA 2HT1A 4RTPA 3RC7A 1I7PA 3OOEA 5EP3A 1DX4A 3NOVA 4HAUA 2BM0A 2OLEA 4MVXA 4C9BA 3U44B 1RAAA 4NDZA 4ZVNA 4EL0A 4LXYA 2O2DA 2C77A 1DC8A 5BOVA 3GVIA 2ZJZA 4EZBA 1KO5A 1NMEA 2YJGA 4ZICA 5A4MS 2O8CA 4FVTA 5SY6A 3RREA 2HUPA 4CPDA 1TEZA 2A8YA 4U2EA 3IP7A 4N7BA 1VP3A 2AOUA 2HA0A 2OCXA 2ODQA 1OAOA 2VHTA 4ZEWA 1U8YA 3TNDA 2XTAA 4P34A 1CJUC 4I4LA 5FQNA 3TIXB 2GZSA 3O26A 4P53A 4O3MA 4W9RA 1TUIA 4RV5A 4BKUA 1M0WA 1Y3AA 2EKPA 1TUGA 4G8CA 3T5TA 4NTZA 4LK2A 1G8AA 2QSYA 3AZQA 1GPMA 2A92A 3E2MA 4GM1A 5IMBA 2FMHA 3QPAA 1M8PA 2NIPA 1ABFA 2PU7A 4QNMA 1ZNXA 4REOA 2B2XA 3WLNA 1JFSA 4Y2SA 4IILA 4PZUA 3IXLA 3ENWA 4PAQA 5JSQA 2NXCA 1GEGA 4JI3B 4A4DA 2G9RA 3A6FA 3KBOA 5KBYA 4ZAWA 3U7IA 1LPNA 1AE1A 3F97A 2FWNA 1NAIA 1UPFA 1XDZA 3GPCA 2BBTA 4UHKA 3FMGA 3EXHA 3JQAA 2HNIA 2G0AA 2XUIA 1YUMA 2H31A 1XVTA 3K4QA 4GU5A 5ADWA 4FBKA 2QHVA 1BE0A 3TQFA 3KX2A 1P1FA 4L4UA 5IU6A 4TXNA 1ORIA 1SETA 3MS7A 2NZXA 4I1RA 1JLHA 2VRNA 1QPGA 1DAKA 1QIFA 4BGVA 2FWRA 1AK1A 2D59A 3AT1A 4ID9A 1GT6A 1MJGA 2XUOA 4RA6B 4BXOA 1N7GA 1D2MA 4BP3A 4CM8B 1ZNQO 1Q0LA 5B30A 1SPBS 2CCJA 4M0FA 5FWYA 2H9IA 2PX6A 3LSSA 1ZK0A 2C7OA 1WNLA 3OZCA 2GAOA 5F7JA 2AJLI 2DBZA 2O3RA 3AG6A 1Z6PA 2R8ZA 4O2AB 1GV1A 4LKRA 1OB5A 2Z6UA 2IY5B 4QDZA 5TJHA 3LC1O 1B74A 1E0SA 3BD7A 4J9UE 4V3CA 4C7KA 5ADUS 2I5PO 3NWBA 1Z6AA 2N0SA 4KXVA 3VV2A 3QKUA 2D1FA 3A4TA 4CIBA 1D5CA 2R7KA 5JZ9A 4LMPA 1JH9A 1KRXA 3PPIA 4RJ2A 4AXBA 3HPQA 5PGMA 1QPBA 1SOMA 2HMYB 3M49A 5D3QA 2ENWA 3G17A 1NWCA 4A7PA 2F00A 3SDZA 1L3BA 4AO8A 3R9WA 2Y0CA 4YMHA 4HGRA 1R6XA 1R0CA 4IZIA 1FEZA 1ZOSA 3L4EA 3FSGD 1PEDA 3D4PA 1STOA 1VHLA 5AI9A 3NV9A 4MVCA 4B6FA 3GEBA 4R0NA 3W5IA 4NU8X 3QQPA 2P2YA 4AVYA 3FNEA 3L0ZA 1UBFA 1GAWA 1JFFB 1KY2A 1RE0A 1NXQA 1U2PA 3GUCA 4KDCA 1DXYA 4KPFC 3ZKWB 3L0DA 5B57C 4JGIA 2I4LA 4NENA 3V1UA 4H77A 3HVHA 3AHFA 1I01A 2FPMA 5DHQA 4ZD6A 1IBCA 2GH1A 2COEA 3DMHA 3K53A 4GLJA 1OYYA 3Q0IA 4C76A 5DBHX 5DTJA 1FW8A 1GZ6A 3HKCA 3KG2A 2X0RA 1NJ1A 2AJDA 1KJYA 1RS0A 4O1MA 1BG6A 2DETA 3EZGA 1QFYA 1BYIA 4GAEA 4XUGB 1NOJA 2VDNB 4N3BA 3GAAA 3O0TA 3ZWMA 4L27A 1ZKMA 4DNOA 5IYZB 2RGNA 3OX1A 3I72A 5BSTA 5ITWA 1XCBA 5AXBA 4L76A 3E5MA 2AI3A 4BZZA 1SO8A 3K9HA 4NU6A 4EB6B 5J59A 3M6UA 4FFLA 4XB2A 2M98A 3BKXA 3B48A 1AS0A 3G1TA 2REQA 5ICFA 1IQRA 2BGJA 2D7CA 2DLDA 4YN3A 3Q1KA 1MABA 1PKEA 3JPYA 4LGMA 5IUNC 1WJGA 4OLHA 2RE8A 1LW6E 3HFVA 2JIDA 1P39A 5DP2A 5C4GB 4NC9A 5IJ9A 4CIAA 3MN1A 1HZJA 3H99A 3CCFA 4QQFA 4RVSA 3VO2A 3FTEA 4KC0A 1NUHA 1R0WA 1N6PA 4R5MA 4L4ZA 4XQGA 3M6MD 3NC4A 5A3JA 2DXIA 2WTEA 1CVIA 1KO4A 5DWQA 1M2OA 3ZI4A 3CLUD 1JG7A 3DPIA 5DO9A 4MVJE 5DSZA 4XLTA 1OFUA 4A0SA 1EXMA 3E3MA 1WMFA 3O4HA 1UKVY 2NO6A 5BN3A 3K09C 2QGZA 4TTJA 3UFBA 3R7WA 4MI3A 1JHYA 1XZNA 4GM4A 4IWXA 4WEOA 3RSFA 3WL8A 2ZJ3A 1SB9A 4F2WA 5GIPE 1KTIA 2W7TA 1IDOA 3C6ZA 1WMDA 2DU7A 4K05A 4KGDA 2P0LA 4RGBA 4C0WA 3QYAA 4XYEA 4Z9YA 3TZKA 4XGNA 2H06A 2JFFA 3AV0B 3HJHA 4TMXA 2YJZA 4OGWA 1Z7BA 1CZHA 3AFIA 2JLRA 2BJHA 4KXXA 4CTNA 1S2LA 3GLHA 2WNSA 4HGZA 4QFDA 4NJMA 5TPZD 2X3FA 3EGCA 3RC1A 2AFHB 1T9HA 3OJFA 2ZBVA 3WR5A 3AUAA 1RBYA 4EY3A 2C88A 2B2NA 2ZUTA 1M5RA 1QBKC 2NQTA 3V00A 3U7HB 2HM7A 6Q21A 3I23A 4URXR 4TLMB 3FTFA 1NNEA 3SVTA 1MB2A 3IQZA 4KQXA 4G4JA 5CLFA 3IVAA 2DC1A 1H2ZA 1IRIA 2YQ5A 3SQMA 4F2DA 4EZIA 2D5IA 1DBPA 1UKEA 3I30X 2CFTA 4BNTA 4NCAA 5AUNB 1TVKB 1E0KA 10MHA 5JVDB 2DUWA 2W6JA 1J1ZA 4RPIA 1Y1PA 1J90A 2CDRA 1AIPA 4P36A 4FCXA 1JJBA 3H8SA 3P32A 4EITA 1MTZA 2ZQYA 4XU1A 1RHUA 4CETA 2CMFA 1MO5A 2NO4A 2ZJ8A 3QWBA 2J9FB 2YWRA 2AE2A 1AF4A 1PS0A 2VBIA 3QOWA 1S2OA 4I9GA 2VL7A 1Z28A 4IF4A 3OKPA 5T8KC 3UV6A 3QUTA 2SBTA 5ES4B 4TVBA 4RPLA 1G7TA 3CONA 2DFNA 3TZCA 3SLKA 4M0PA 3ZWCA 4AWAA 4W5TA 1J24A 4EY4A 1U9YA 2CFRA 2PYZA 4C4OA 4NF2A 2Z1NA 2XCLA 3DTNA 1HQDA 1MFZA 2GEFA 4U7WA 2BYTA 1P1HA 3V7SA 1XALA 2QD2A 3LOPA 4QREA 4YAEA 2XT9A 4DCOA 2C7PA 5CB4F 2NPIA 5K8TA 3ZNOA 2AHRA 2PUDA 2HA6A 4GXQA 3ZY2A 2BFBB 4NOJA 2N1MA 1HNNA 3EEOA 3JSXA 1LI4A 1LRKA 1RYBA 3NHKA 1JG1A 1CQZA 4L22A 3ICEA 4FGLA 3KT6A 4O2BA 1RQRA 4OKIA 3I28A 4E21A 2G0TA 3WDKA 3P9PA 1QWOA 4CMKA 1OZ0A 3MT0A 3QTBA 5H82A 3TQRA 3RU9A 3B3JA 1DIHA 3A1VA 1KKLA 4ITVA 4BZWA 3CRZA 1XWFA 2FPOA 1GJRA 3DEKA 3ADBA 4OLBA 4DB2A 4X6UA 3R5HA 2FP4B 3H6KA 2YXDA 2YHBA 5T6BA 3KQSA 2V96A 4YJ2B 5DNAA 5HA5A 4EYSA 2XYRA 3FPGA 1JDPA 3P0EA 3QXJA 1N78A 3OZEA 5TRTA 1ENYA 3KQWA 1U9JA 1P19A 2IHZA 3Q8XB 1GXSA 4C3VA 5K8CA 5GP1A 2QQ0A 3TFOA 3D7MA 1G8MA 4MUIA 2PMKA 5FOTA 3RKRA 3K0CA 4FGKA 4TMYA 5AKIA 1N0UA 1O95C 2WF6A 1U0GA 3DXZA 3RIGA 3TTTA 3IR6A 1U0FA 4YMSA 2D5BA 2E9SA 4LDJA 4BMNA 4E5YA 4OI4A 3UPDA 1ODTC 1U7XA 1JVBA 2DSTA 3TUJC 3V4FA 5JANA 3QUBA 2PGJA 3JU3A 4CQMD 1T25A 1P9NA 3O03A 2C4VA 4OHPA 3W2FA 2W9XA 1KARA 1RWKA 5D3MB 4ML3A 2XT6A 3G82C 4CLRA 2RD2A 2J67A 2C83A 1V5GA 2JEYA 1XRLA 3B36A 3OHMA 4GMHA 3PD0A 1VB5A 3U61B 5E9QA 1FDVA 3IIIA 2FV8A 1CVLA 4KFRA 1ZHOA 2BZGA 3K70C 4OAQA 1F48A 3TEFA 2ZIZA 3NYIA 3HGTA 1PWEA 2F3QA 3QLUA 3ETGA 4HB2A 3C98A 1R0LA 4LDNA 4XXHA 1OLSA 1XXHE 1WV1A 3I2IA 4MKGA 4DQVA 4WBSA 1P8AA 2PGAA 4OHFA 3D2BA 1P81A 3P4XA 1WVMA 2BMWA 2HMUA 3AOEC 2PXAA 1Z38A 1VL1A 2FN9A 5KMGA 3UMCA 2J45A 2CDCA 4BJ5A 3KU4A 4EK9A 1WD5A 4S04A 1W36C 4HEHA 5HFNA 2ZQ5A 3EXIB 4ARCA 2R2AA 5F3DA 3S28A 3KE8A 1QYDA 4QXPA 3IIKA 3VYTB 4B3XA 4XDYA 4ND5A 5JNVA 7REQB 1AQLA 2QOEA 3T1IA 2Z1MA 3OCVA 3RRNA 4Z54A 5IT0A 5JJKA 1ZA1A 3AVOA 3AR8A 4M86A 1X1EA 3QVSA 2GM5A 4ARSA 1PT9A 3R0VA 2A4KA 5L40A 2IUSA 2E4UA 2W2LA 1GSOA 5GGXA 1FZTA 2EWMA 1U8UA 4I50F 3BKWA 5K8LA 3BILA 1PGPA 1H2WA 4CLEA 2X2PA 3OPMA 4TV9B 4F97A 3WYNA 2B4TO 2CRQA 5FWXA 3H05A 4PO9A 1PT8A 1TF7A 3FYUA 1P9LA 1WP4A 4NYIQ 4Y2YA 4C05A 5J4VA 1T6ZA 5KYVA 1EMDA 2XCTB 2PT9A 5DNDA 3TNYA 4ROSA 3FYUC 4MO2A 4QUGA 3T9EA 1LKZA 2ZYVX 4YCDA 2NG1A 1AU9A 4FDUA 3I2KA 4P2GA 2MR5A 4IQFA 2NU6B 3QI7A 4YRDA 5ECDA 5FI0B 2YVKA 2RGDA 1VG1A 1SC4A 1YFRA 4NMWA 1Z4QA 2CKMA 2O07A 4RORA 4WZAA 5G0VA 3TX6A 2FX2A 1N8TA 4R3WA 4BO0A 4UZEA 3QEKA 1XCJA 3IPRA 3KVRA 1ISHA 1VBKA 1NMXA 3HA3A 2X58A 5DB4A 2AJCA 3ADCA 2WM2A 1T0BA 2FPSA 4D8TA 4IWYA 4LJSA 2FAXA 2JHCA 2WJZB 3ROKA 3H42B 5HPYB 1HMYA 5DP1A 3TZBA 2AH5A 2W6MA 2JLQA 3WYBA 5LJIA 1M67A 3EVCA 5B53A 2YKGA 4H16A 1IBKB 2XMPA 2MSWA 3RPEA 1BGXT 1QP0A 2ZT5A 1XR3A 4HXYA 4LSWA 5EIFA 2H17A 4KO4S 3THRA 3ZBTA 4Y1FA 3PQ4A 1ZL2A 2EAUA 4CV2A 5JRJA 1KDPA 3CJQA 3D6VA 2FZKA 4UVIA 1QYCA 5CA0A 1QBGA 1I6WA 2IXGA 2JKVA 4BVHA 4C0XA 5DTMA 2NAPA 3RHTA 2ORVA 1GGNA 1NVBA 2BFEB 3CZMA 5ANRB 2QN1A 4LC1A 5JLAA 1IATA 1X1BA 3R3JA 4HV4A 3RV3A 3K1ZA 4PO8A 2Z2YA 4ZZ0A 2BFPA 1BN6A 3K6JA 1QB8A 2R751 3EQ6A 4GKKB 1PBTA 3Q3HA 3OMXA 4QNRA 3EARA 4LF7B 5IC6A 4P73A 5G40A 2RGBA 5KTTA 4GE0A 5GMOA 2NZWA 2Z0MA 2UUPA 1VJTA 3FLEA 3I5XA 2XXAA 2QW0X 4B7ZA 2EAYA 2OC4A 3Q0EA 3PGKA 3VAAA 2D74A 1UQRA 2AC4A 1D0VA 1W4ZA 2XA2A 5JSZB 1ZEJA 1M3SA 3CZAA 2EZUA 4QYTA 3M4QA 4ZYZA 3UQZA 2EW2A 2MYUA 3OQJA 3N2YA 1RI4A 3TRFA 2QHTA 4ARZB 4JOCA 1R9MA 4RACA 4AIIA 4JLKA 2BF4A 1W88B 2EZ9A 3KXIA 5BN4B 2ORWA 5CVEA 5LD2C 2PQMA 2PNJA 4HDRA 2DCMA 3P9RA 4YRLA 3CMQA 3FDZA 3ELYA 1XD8A 3SJCA 3K9CA 3UHPA 5IRCD 1XHFA 1QGYA 2QX8A 3QBTA 3R76A 3VZCA 4TS9A 3M70A 4GMFA 4ASUD 3NNDA 2GCEA 2AXNA 3IKMB 4GX0A 4ID3A 2V7GA 1BD4A 1XDWA 3NIFB 5G2OA 2ZI5A 2O3SA 1O9HA 1OC2A 1J0AA 4RQAA 3FX2A 3H86A 3KDAA 4NOKA 2V7BA 1PYDA 2O8EA 2R8PA 5B7NA 2YHIB 2QORA 2B1IA 4AH6A 4BX2A 1FS6A 3AI3A 1Q1QA 2EF1A 2CNOA 2J0UA 4IQ4A 2XCSB 3LCCA 2I8AA 4GBED 1EVQA 2WWVD 4X8OA 1BS2A 2VRBA 2SNIE 4RVOA 4OPMA 3ER6A 4J0FA 4NAHA 3T3OA 1JO0A 1X56A 2R6GA 2RHTA 3ZWNA 5IG2A 3MJSA 1XCOA 2RKWA 4L5BA 1FXSA 1KPGA 1E2DA 1AS2A 4KWEA 3ZHXA 4FYIA 3ZWVA 4H08A 2IV2X 4WBNB 1KMCA 1JI3A 1KVSA 1XQ1A 2VK8A 4AQYB 4PLHA 4WW0A 3PRHA 1A69A 1ICIA 2Y3IA 1OXSC 5B2EA 4RJIA 1Y63A 2JGMA 3C6QA 4DCVA 1L5LA 2O59A 1VOTA 4JROA 4MGIR 1TQ2A 1XRQA 3Q88A 1P8JA 2Z9CA 2FPXA 4GC5A 2UUCB 5DVZA 4BQOA 2IZ0A 3RYCB 1Z7GA 2AFHA 1DRWA 1RQ7A 3WLMA 1CUYA 5A7HA 2W58A 2CLEB 1X3SA 1ID8A 1NNSA 1PE0A 1RQLA 1B8OA 5JV5A 4FDLA 1W25A 1U90A 5DXJA 2FPLA 1YA8A 3CUVA 5A71A 2ZYTX 3R6TA 2X86A 3SC2A 2G70A 3ZK8A 2WINI 5LP6B 3N8IA 5I4KA 1AMUA 3WDSA 1BXZA 2VPWA 4BLTA 5LKAA 3SYKA 4I4IA 4GOXA 4XJXA 1D4OA 1A2QA 1EBBA 3O7WA 2XE8A 4P31A 4U2FA 3SSAA 1KBZA 1YDHA 1TYZA 1P5HA 2BFNA 1CR1A 1TVKA 5GM2A 1L5HB 4PANA 4IV5A 4KTTE 3WYDA 1L4BA 2ZSIA 2IEZA 5CJJA 3DAFA 4ZVKA 3WMXA 1QZUA 1EJ0A 1KI3A 1P0QA 2Q1WA 4PM4A 4EEKA 1JHUA 3NBQA 4YR7A 2BHSA 3A36A 4D97A 3QPBA 4B4OA 2GJ4A 4BFXA 4CMGA 1FLNA 5JS1A 2J9FA 3T35A 2R8EA 1QORA 4MTLA 4NV3A 1NSTA 2GBLC 2WC1A 4RDIA 3KPWA 5ILOA 2PX4A 1WB9A 5C9ZA 5KHOC 3KT8A 4KKXB 4EPTA 1VSQA 3WYEA 2PU5A 2PN1A 2ZI9A 2Y27A 1JI0A 3RRXA 5LYJF 3HNRA 1AHPA 5HF5A 2R00C 1IHOA 3RM3A 2W2MA 3IXQA 3FZEA 4G09A 1OBCA 1JA0A 2NV2B 4HAXA 1ZH0A 4G1MB 4OJTA 2NVUB 4EHLA 2VHQA 1Z4KA 3N0RA 2C29D 4ESHA 4XEHA 1LSJA 4KOEC 2OBMA 3FJPA 5HUHA 2UVPB 1XTUA 2ZCEA 2WSSD 1KU6A 3A1SA 1XOIA 2P9ZA 3DFKA 3OFSA 2HV8A 2Q99A 3JX9A 1DJQA 1N9GB 4GC9A 4WL0A 1G5TA 3UM9A 3VKVA 5HJ5A 3QEBZ 1N2IA 2JATA 4J0EA 1R15A 4UNQA 4GP7A 2QVCA 1T2FA 2H11A 2QX9A 3OFJA 5FWAA 2BFDB 2A8EA 2HHHB 4YAUA 3AIIA 1G8FA 1PDVA 2AXEA 1NW5A 1OH5A 1SKQA 4GOMD 4JENA 1J9GA 5FWNA 2DHEA 4LGVA 3I8XA 1EIYB 1N2GA 1OGJA 3RNOA 3WLKX 3DFMA 4PC1A 1SA0A 1WPRA 3F4BA 4GYJA 4L2IB 2W6QA 1NFJA 3ORFA 4M8LA 1SPXA 1WTAA 4IZ6A 2WHPB 3O9VA 1P2GA 4KIGA 1GXSB 5G3ZA 3QHPA 3TQTA 3U0BA 1UOOA 2E87A 4U6NA 4YJ2F 3HVKA 2C5BA 3GRCA 3QTLA 4HYQA 2HSWA 3FLMA 1NOIA 2YFKA 3PNBA 3U1TA 5D5QA 4L6CA 2O7NA 2R8BA 4AWBA 3ND7A 4C30A 3A3YA 2P30A 4HRYA 4UU0A 4A27A 1VYHA 3KFUA 1K5PA 1P5RA 3AY7A 3Q7PA 5ALLA 4JB0A 3DBIA 3TSOA 3ANTA 3WQBA 2DDZA 4LRWA 1TZ2A 4YUYA 1G3RA 1QH8B 1U7UA 1DHRA 3F5FA 3UGQA 3AM3A 3KR2A 3PFHA 2PWAA 4HDKA 1XEFA 4LOJA 1BDBA 1GLGA 4HVLA 1BU8A 5BYAA 3FHLA 3M4PA 1WXWA 1CNFA 4GT1A 1TYEB 1GGMA 2II6A 3CLVA 4ZQIA 4ARBA 4OQZA 4JBLA 1N8KA 4JI5B 1WCXA 1IEQA 4IY1A 4ZZ1A 1J33A 1WRBA 4KLRA 3T9BA 1G41A 4AJ1A 1PIWA 2HU8A 3OM0A 2AZXA 4D8UA 2IV3A 3HM2A 2G40A 1Q57A 2W6NA 3E9DA 2VJYA 4P54A 2AKAB 3H2KA 4PGMA 2X1MA 5KMGB 3ETEA 4KAJA 4TKVA 2EP8A 2OILA 2XA9A 1E3WA 1NDUA 1FUEA 1U7DA 2JI7A 4A2WA 5KDDA 3A25A 2PL1A 3HKDA 4FUTA 4OMCA 3LS2A 5JSFA 3QU4A 3VHQA 4XDZA 4QVGA 3G68A 3LPCA 4TSRA 1VPLA 5LNK1 3IJPA 1BMQA 4PZZA 3W5AA 5AVUA 1RZRD 4Y0VA 4O5AA 3DEHA 3F6SA 2OXIA 4UPVA 3OQIB 521PA 3UNXA 1CUUA 3ZQKA 2MWMA 3OTOB 2CB9A 2IZ5A 3LPAA 3D7NA 1UFRA 1YS1X 4M87A 4U0JA 1CRWG 2X0IA 1LJLA 1FQKA 1RI5A 3E03A 4YFVA 3ADKA 3TG2A 1GL7A 1WQ7A 4A6PA 5D01A 1HDGO 3REQB 7ABPA 3HS3A 2BGKA 1KAMA 1SCIA 2IDZA 4C5CA 3M1AA 2NO9A 1JT2A 3QLVC 1KMIY 2GSDA 5CPFA 1PTKA 2AQKA 4ZANA 1HG0A 2QQ5A 1XKXA 1K63A 1A9RA 1NIPA 1HYBA 1UBMS 2QMYA 2XRYA 4FYWA 3B9PA 4JU8A 1RJ9B 2NVWA 3EULA 1X39A 4P4TA 3VKGA 4OP3A 3LHFA 2OO3A 5IPFA 3FPHA 3IP1A 4D0LB 1HORA 2CNDA 4NX2A 4NZOA 3TZQA 4ZK2A 5BP7A 5IFLA 3ZZMA 1AVTA 1CIVA 3MRXA 1W0JD 1RYEA 1MLDA 1QO0D 3ZHCA 5E3HA 4ZK6A 1X87A 4TYYA 1KNXA 2IPAB 2FFBA 2KE5A 2PUJA 3FTCA 3Q41A 4TUYB 2NUAB 4Q4LA 5JHGB 3N75A 1UODA 3OF2A 3QYJA 2CNWA 5F78A 4WNAA 3P2EA 4MW9A 1VGQA 2ZIXB 3HXZA 4QXMA 5C5EA 2BY4A 4BPBA 3FAKA 1L8XA 1BCRB 4LZWA 4PX5A 3VNSA 3WB1A 2PUAA 1CJSA 3RSOA 3ZXSA 3RC2A 1M7HA 1T0IA 4BVGA 2QUKA 3I4FA 2HPAA 3SKYA 1NYRA 1BCSB 3QF4B 4LE1A 3RT1A 2AIRA 3FPAA 4E1BA 2JFQA 1OIXA 1USWA 3COJA 1II8A 1MVOA 1F0YA 3QVGA 4YEDA 1AZSC 1Y5LA 4IM7A 5LOVF 2GO1A 5LQMA 3OZDA 2ZSDA 3HE3A 3QLEA 4UDNA 5HEKA 4H1WA 2AG5A 1JMKC 1X42A 1SOWA 2DTOA 1T34A 2WSSA 3GJ3A 3PLRA 4BNWA 4DVJA 1KY5A 2BGRA 1WTCA 4NKRA 3E9QA 3ZVRA 4YCSA 3GA7A 4R1QA 3UB3A 3FZGA 2YVAA 1UQTA 3JQ9A 3B12A 3TIFA 5CVTA 4NFLA 1XK7A 3Q5EA 1DCMA 2DTIA 1DQNA 4GZ5A 2H2GA 2PWBA 3IVGA 5SY4A 3KKMA 2Y1LA 1NUUA 4HVCA 2PD3A 3CKMA 5KTKA 1GSHA 2CZGA 3LW7A 3QELB 3PT5A 3JQ7B 3HJCA 1G21E 4E31A 4EW6A 2W6JD 1ZWKA 2V0NA 5AJWA 4KLZA 4Q16A 4QDJA 3RS5A 4S1OA 1R6AA 2PKCA 4M4SA 5GY7A 2C5SA 1HL7A 1RMQA 1K0UA 2W2TA 1Y6FA 3Q12A 5AJXA 4PONA 1L8AA 1CUDA 2ZVQX 5GIOE 2F55A 3ANLA 4N76A 3VMFA 1D2EA 4CS3A 3AUTA 3RTEA 2OZVA 2XJ4A 5DTQA 5KYYB 2EJBA 1E2HA 5CM2Z 3VNUA 3E18A 1CEEA 5KSPA 2XDQA 3N28A 4G0MA 1TYCA 1VE1A 1YR8A 3MJ4A 4ENTA 2Q9UA 1E32A 3Q85A 4LE2A 4AG6A 1DELA 1ECPA 1ISMA 1ZGAA 2ZETA 2J0UB 4FR5A 3OU7A 1JSLA 3MWKA 3L77A 4K6GA 4WFQA 2DR2A 1G20E 2BL4A 5JFTA 1CE8A 2DU8A 3ZV5A 2AF3C 2ZUBA 1OA1A 4OLJA 4ZPXA 1WB4A 3GNTA 5MF6A 2PBLA 1D6SA 4LVNA 1YBMA 2ORYA 3GT7A 3H1FA 1YNSA 1FDIA 3A6HA 3BDAA 4EKYA 1COWD 3NUQA 1N2XA 3L6CA 1H8ED 3ILHA 5DI3A 2MTBA 3SMVA 2OORA 3CUUA 3BZBA 4KN6A 1HO3A 5CTAA 5FUYA 4HB0A 4H60A 4MUHA 1QZ3A 4MRMB 3R1IA 3VDXA 4LYJA 3A1UA 1M2JA 4ZALA 3I37X 3UAWA 3UXEA 4EYKA 4K0KB 2QTLA 1K8RA 1QIKA 1L1QA 1II7A 2E6KA 2J08A 2X2EA 3CX4A 2PSDA 3HUEA 5ERXA 2ZJFA 5EZSA 5F1KA 2P4HX 3O4JA 5C3MA 3PS9A 2VZEA 3GUUA 2I6UA 1FRVA 4NRDA 4RD6A 4PHGA 3W9SA 3C8DA 2NU7A 2UUOA 2WWRA 4FUQA 2VTBB 2ATIA 1PFUA 4HMPA 2VWPA 3QYPA 1U8FO 4J4BA 2YWFA 2G7ZA 2PAFA 4N54A 4N3CA 5G4LA 3BGOS 2O14A 1EEXB 4E2XA 3NFRA 2ECKA 1BKDR 4FT2A 1OIVA 4ME6A 4ADSG 1B8PA 1NW6A 2QI9F 1IUKA 4Q1CA 1R1DA 2VT3A 1TCUA 2X4DA 2XMSA 3LLMA 5DXAA 1WCWA 3ZEIA 3ZLJA 1SZJG 2AKWB 2B7CA 2IOHA 4MK4A 4R8RA 2Z5GA 1HZZC 1N32B 3T34A 1N33B 3TGWA 4X1IB 3DL2A 5IYZF 4YI3A 1U99A 2XB6A 4F86A 3SZRA 4AZWA 1NQOA 2RCYA 3KWLA 1LK5A 4DQDA 2Z3WA 2WD7B 3IQGX 1TIPA 4D46A 1P9WA 3NKVA 3UWOA 3LPNA 1PEYA 1Y6JA 1NUAA 2H1LA 2CVFA 2OP1A 3AKYA 4JELA 2HREA 3DOFA 4UNNA 3TAUA 1FSZA 2G9QA 2C1XA 2I7CA 4B4UA 1ND6A 5HKKD 5I7WA 2FUG1 1OLUB 2V6GA 4A73A 3QMMA 1RXCA 2V65A 5ALMA 3SHTA 2OSBA 2YQ4A 3HL4A 4IPTA 1ZUWA 2CN1A 3PWTA 5C51B 1DDOA 3G6KA 4RVNA 1G60A 3ACBA 3HJAA 3I9JA 3VQYA 1BX3A 4KEAA 3BULA 4K9KA 4YI5A 1D9ZA 5C52B 1Y80A 4J7CA 4X0EA 3IABB 1T6YA 2AD5A 2OR3A 2PVSA 2XZDA 4HDMB 3ULKA 3D3JA 3LQFA 3ZCQA 2H1SA 2YVUA 2Q2WA 1E5LA 1IXSB 3ZU4A 4C4PA 3TH5A 5CLJA 2FYTA 3DNMA 3SMQA 4UM9B 4F6RB 1XZJA 3CM0A 3R4VA 621PA 4LIPD 3SQWA 1ZGCA 5CYFA 2LRHA 1QP7A 2WTNA 3OJCA 3C87A 1J07A 2VT6A 4XTRA 3EGWA 4XUCA 5FWDA 1IZ9A 3KJIA 2ZRBA 1BMDA 4G24A 3M6WA 1NBHA 3T12A 2WTUA 2BFCB 1KOGA 1UOPA 3S8MA 3USES 4OY3A 1WCIA 1Z63A 2KLBA 2QE7D 3VX3A 2ZUSA 4PQRA 2IX9A 2JHGA 4C4TA 4OD0A 4EG5A 3I0NA 3QWFA 4NS4A 1SIUA 3A58B 1SU4A 1R0ZA 4P93A 4K88A 2VUHB 5CH8A 3DL7A 3EGOA 1Q92A 2VSXA 4XLLA 1GRNA 1OU0A 4OXYA 2FW6A 1M0TA 1JHXA 4HKTA 3DUWA 3RVLA 2L18A 3W5CA 5BR1A 4IHQA 3ZWYA 1WQ4A 1N1DA 4RDXA 3QNEA 4TTSA 4PIVA 1DXOA 4DA7A 4OI0A 3LF1A 1EQRA 3MYYA 4X60A 1Z33A 3DVAB 2YINC 4NNOA 3N2IA 5GZ6A 3RAPR 3W6OA 1XDUA 1O5IA 3KVVA 3UC9A 5BR8B 3V4VB 4YWHA 2CCKA 2FU5C 5AI4A 3D31A 1GUZA 3TOZA 5HJ7A 2LKDA 4LAFA 1L5YA 1Y1LA 2R68A 2ZTSA 3UAOA 2EJVA 2FB9A 1A76A 3FHCB 4Q3NA 1JIQA 4UOZA 3L07A 1Y33E 2FLVA 3MT7A 2JA2A 6YASA 2FHSA 4AYTA 1J42A 1C4XA 5EUMA 3EC2A 1MPXA 2A78A 4FFBA 2NYRA 1O57A 4Q0MA 3U4DA 3UAGA 2Z04A 2HYDA 2KWIA 3WX0A 3L7JA 2I76A 3L7DA 3OCWA 5BQ3A 3RS8A 1L4UA 4GW3A 2X9QA 4P4SB 4RHUA 1TW3A 5JQGA 1HDXA 1K6JA 1N2CE 2PGXA 4RQUA 1XDDA 4RPHA 2L2QA 1VSTA 3ML1A 5ITZA 1OU4A 1J5PA 3OH8A 1ZC4A 2NM0A 3C43A 3ZX4A 3LC7O 1E3WB 4PG7A 2QIPA 1XXLA 3DZDA 3G13A 4NFSA 3S0JA 4UP9A 4G1UC 5AI5A 4AG5A 4DUGD 1J2UA 1LJUA 4D8WA 4L6IA 3GRYA 2GFIA 1HDRA 2RHLA 3TTUA 1CYEA 1OT3A 3GLHE 2X15A 4HDNA 2HXYA 2NSHA 5B4UA 1JR4A 4F21A 4D4JA 4DEYA 4CKCB 2BGLA 3N2NA 2O57A 4CG0A 3CW9A 5FORA 1LZKA 3VHLB 2ORED 4KJZA 4KRFA 2XRZA 3BH6A 4YRBA 4KQCA 1SWWA 4HVAA 4RSRA 3TDKA 4F0JA 4KDEA 3VTZA 5EJ4A 3DLHA 2RKBA 3CG4A 3AP1A 1OBFO 4I4NA 4CQNA 3X1MA 4RTMA 5HWSA 4AU1A 3CGGA 2GCGA 4Q3LA 2MDTA 1FP1D 2PMBA 4EPXA 1D0IA 2ANCA 1ESEA 1L5KA 2ZK7A 5CX4A 3SAJA 2V45A 3SXUB 3D59A 1T4GA 1F8YA 1H3EA 3WZLA 2NUBA 4C7VA 1YOVA 2Q0SA 1ZNYA 3VQVA 4GI1A 4QC2A 3NTLA 1CUFA 4QOGA 4IH4A 3R0JA 4FD2A 4QHSA 4Q4JB 3RKWA 5ALFA 4H2VA 1QKIA 3SYRA 1EGMB 4HLDA 1B8AA 3CMCO 4NE7A 3PC6A 3UUWA 1Q91A 1NVAA 2D00A 1JJCA 2JLXA 5HP4A 2J6HA 1X55A 1RKVA 2QD4A 3Q72A 4PLCA 1YFZA 1CZOA 1B43A 1X2EA 2V5UA 5DISB 5THXA 4D8VA 2BKAA 1ZD3A 2O8CB 4WVFA 4BFZA 1G64A 2OWEA 3VYSB 3HDQA 1HWYA 1GZUA 1NVDA 4BFVA 3QMWA 3LO8A 2YWCA 4FHFA 1KO7A 1I2MA 1CEYA 4CM8A 3GLRA 2RG7A 1H3NA 5I45A 4JI7B 1V37A 4CG2A 1O08A 5MDHA 4HVTA 4YUZA 1BCRA 4A36A 1GPAA 1Z07A 4ROTA 4RV9A 4WFJA 1UBEA 2C8JA 1GQYA 3QV2A 4KR2A 2TMGA 1LW7A 4MS1B 5DNWA 3I9MA 4O02B 2M6SA 2C5GA 2JLAA 3C6XA 1XZFA 1G38A 2AMLA 5DHSA 4Z4FA 1E2PA 3S68A 2XEXA 2RHSA 4NDAA 2YYZA 4BC1A 3NANA 3FF4A 3UAXA 5JTTA 2HHJA 3HXLA 5A4AA 4ZI2A 2PL3A 2H2AA 1YGBA 5CT4A 4XRRA 2GEKA 1SH7A 5DZSA 3HCEA 1G2QA 4AROA 4EJSA 3ENKA 3L7OA 1SVSA 4N40A 3OESA 2I7VA 4XR9A 4K86A 3C97A 3FFXA 4U6SA 1VIMA 2QTVA 3EJ6A 4L85A 4WEQA 1ZW1A 3R6WA 1K7XB 4UHEA 1YVUA 5DX0A 3FPLA 3LP6A 2JPDA 2ZYIA 3T4UA 1QUEA 1PO7A 1QTNA 3ACDA 4FZ5A 4DLSA 3P8TA 2YUIA 3Q6NA 4WGGA 3JWPA 2J5QA 2X2OA 4KK3A 1P7ZA 1Z0AA 1VIDA 2CXRA 1FNCA 1YR3A 3AL3A 3NRJA 3FJYA 2CYCA 1LQTA 4KN8A 1H05A 1YOBA 3WGKA 1W34A 1UKAA 4Y0NA 1ZN9A 1Z3CA 3HY0A 2Q5CA 3WBKA 1LSUA 2FUG6 4BLSA 4YCCA 2R4QA 5AW3A 3RYFB 1H8HD 2UYYA 1VE5A 3D3WA 4LN1A 1YMQA 7GPBA 1GN9A 1Q19A 3CRVA 5IBCA 5EERA 5ESXA 4ESOA 1E1CB 1UDWA 1KQPA 2WILA 2QVYX 1IJBA 1KSFX 2VNHA 3HABA 3KYCB 2D0DA 4FFNA 4N7MA 4U9HS 3QFFA 4Y9RA 3CUWA 1SURA 4NU0A 5DHTA 3ZV6A 4Q3EA 2G5PA 4DSAA 3E3LA 3AEUA 4BGUA 4CMIA 4PQFA 4AM8A 1O95D 1G5QA 3T7TA 3WO0A 4GXRA 1ZVKA 4X6XA 3DBRB 2GN0A 1WMAA 2H8KA 3JSAA 1MAHA 1NG1A 5H0IA 3TR5A 2QV0A 3B6ZA 5ALGA 4QJBA 1NE2A 1DP4A 1WO8A 1WPQA 1Y4UA 4JEIA 4PRLA 1PTJA 4IGEA 4CQLB 3PKZA 2BSXA 4DPGA 1OBVA 1S7GA 1SC3A 2Q3EA 2X23A 3OJEA 3FSJX 4M49A 1FYWA 1HC7A 1QO9A 1IBRA 5EC8A 1FPQA 4JQOA 2I2DA 3U16A 3AHHA 1BEUB 1FIUA 1GT91 3A7RA 4EY7A 1EJ2A 1UPTA 1JFTA 3KFVA 5JS2A 4GR4A 5H68A 4D80A 4YAGA 1ADFA 4N8EA 3V9AA 4J76A 3NENA 4IINA 4YJ3B 4YRAA 4A2PA 3S2SA 4ERXA 2V7XA 4HH4A 4I81A 2WF5A 3DC7A 4QPNA 4X1KB 4D02A 2QBYA 1IUNA 4QU0A 2Q9BA 4UULA 5C8ZA 1C9NA 3DBLB 3OJXA 4D0RA 1KEEA 1JHVA 4I50A 3SU8A 1DIAA 2BKVA 3QBVA 2CVOA 2HJVA 1T8WA 5KNCH 1FUUA 2XQVA 2CJWB 4X41A 5AQ1A 3VDNB 4AZ0A 5DYTA 2HSZA 5LBTA 2F3TA 1Q22A 3R8XA 1SC6A 1ODLA 3E9MA 5K3FB 3FVVA 3UGJA 2FN7A 1HOTA 4DA0A 4TXJA 2VF5X 3I5AA 2PQ6A 3E22A 4IIVA 3KQMA 4AZVA 1R0KA 1ZHFA 2QTGA 1V5FA 3GFFA 5C35A 5A62A 4I1UA 3D8NA 3HKEA 2V5VA 2HMTA 5DX1A 2R9VA 1LBEA 5DT2A 4ES6A 4LOHA 1L5ZA 4IG4A 2FGKA 2ZXEA 5TV2A 1IOVA 3L8EA 1VJ1A 2VDJA 1O97D 2BGWA 3T8YA 4MHTA 4HTFB 2ZBQA 1K6XA 3IEKA 1X2HA 4Z3DA 3VR4A 1B8NA 3PXAA 5KTRA 4N9QA 1FLDA 1AO3A 1E8NA 2JZOA 2C59A 2OAQ1 2IQ5A 2AFRA 2M32A 1H22A 1I2BA 3K9GA 4X97A 3U39A 4B9AA 4D44A 4BEWA 3IABA 4HDMA 3EA4A 3V3KA 1Q15A 4G89A 4CKEB 1LDEA 2ECQA 2GILA 1DC5A 2I2FA 3W6PA 2BF7A 3VSAA 5E6SB 1J21A 3JR3A 2Q62A 2QVZX 4HB4A 3NT2A 1P74A 3MTDA 5K8VA 4L78A 2OGWA 4ZT6A 1NTRA 4BEJA 5EA2A 5BN3B 2FPKA 2HIHA 2IHUA 4BO3A 3ILXA 3DE1X 4WIAA 2C2MA 2OBBA 1XNRB 2X6TA 3OQNA 3DKRA 4WLUA 3RUXA 2HV9A 2WVJA 1EBUA 2LWIA 3KLMX 2VNJA 3MXOA 3PE6A 1U2ZA 1G42A 3DXFA 1UQUA 1A8PA 1VLLA 1XAJA 2PL5A 3KSRA 1W29A 4F9EA 3CCBA 4YASA 3QFCA 1WUTA 3EF0A 3GJ8A 4LJ5A 2FW7A 4HYYA 2XWQA 1MH1A 3CPEA 3KS9A 4P2BA 7YASA 1NNLA 5TB5A 3IX7A 3II6X 1NURA 3V7UA 3X1XA 2OBNA 4ZAFA 3TK1A 1UEJA 3ANXA 2ASEA 4WI1A 4QE3A 3BL5A 2AOXA 3DFFA 4G63A 3ICPA 4F7WA 1HFKA 3EYAA 1VCOA 3NM5A 3P7MA 4LZZA 3SR0A 4E12A 1JYEA 3DVRX 3TVYA 4YROA 5LLDA 4LYEA 1WKVA 1RDFA 2B8NA 3H9EO 4RYDA 1ST2A 4M7PA 1Q83A 5EGNA 3AO0B 4R9VA 5WRFA 1Z22A 1Q77A 3Q40A 4KRYA 1Y5MA 2B6NA 3WI7A 2UZ3A 2MINB 5FAXA 3PI7A 2PJDA 4CMBA 2EJGA 2CF6A 3B3GA 3NOOA 4Y2RA 4B5KA 4RTJA 3K72B 4NIMA 2QVXX 3ANMA 3OZAA 4UATA 5HMLA 2Q3MA 5LZ8A 1N0VC 1QCCA 3SPXA 2FG7C 3L0BA 4K8OA 4B8ZA 4BNZA 4DR1B 1ZI8A 2CXOA 4OQ4A 3V8LA 3BRCA 5F1PA 4A6XA 5K0FA 1KIMA 5CDYA 1KMHB 2ZTHA 4FOTA 1CPYA 2V8BA 1DPFA 3MTAA 2H5IA 2VHYA 4QWMA 5F33A 3ZDEA 3A27A 1J5EB 4IYJA 4KNYA 1EUZA 4NZ9A 2D4HA 4NBRA 1RJGA 1TQ8A 1Z74A 2GF2A 5H70A 3EVAA 1MA3A 3OZWA 3L4GB 1T36A 4OK6A 4JL6A 5FPTA 3R77A 1ZVQA 1O58A 3DOUA 1VJCA 3OCCA 4LZNA 1FYDA 3KR9A 2AW3A 2JIOA 1J8YF 1V11A 1LBIA 5KNCD 4MUAA 1HRDA 4QT0A 1SRRA 3NTXA 1XDBA 2VHJA 4I5IA 3A10A 4H6WA 4KRXA 5F7ZA 5K6AA 3L04A 4OQFA 2RC6A 3RQSA 2VUTA 2Q3JA 1GG5A 1YHNA 2NV0A 1U98A 1RLTA 1XKQA 4GSLA 3GLQA 1QANA 1X8XA 4MMYB 5SV2A 2Q5JA 2VJCA 1PJQA 1CRPA 3I3SR 2JFWA 4Y9SA 3TW4A 1AKTA 1O94C 2JGDA 3WRXA 1WNFA 1TMYA 1BVUA 2PJRA 4QM7A 3EHDA 4C4AA 4CM4B 4K6HA 2HNKA 3TF5A 2XXAB 1GAXA 1SHJA 3LUJA 4YDSA 4DNFA 1E5VA 1W49A 3CF4G 2NVOA 3UOGA 3QTCA 4ND6A 4LZLA 1VBNA 1LX6A 4B33A 2HXSA 3FDIA 2VAPA 1DAIA 1OWPA 1PSDA 2B8EA 4ZXPA 2IU4A 1BXRA 4ARZA 1QVZA 2QX4A 4NNPA 3WXBA 4F38A 1JEYA 4KUGA 2HF8A 1H93A 4FWBA 1RTTA 1W88A 1XJWA 1JQDA 2A0FA 3BMOA 3GFTA 1A0OA 3OZVA 4PIPA 3VPHA 5DT9A 1Z34A 1OWLA 2O5RA 3BGWA 1RMTA 2XMDA 3EQ9A 3JQDA 3RS0A 1DOZA 2FEXA 4R1TA 3QLTA 4DPKA 3N7TA 4FEAA 2IWHA 2TSYB 3ED5A 1RYMA 1UPCA 4HFJA 3CWCA 5DWVA 3L7BA 5FDFA 3UJNA 4ZT3A 3KQOA 4FR2A 3BWVA 3KD3A 3FOZA 1PJ8A 3A6DA 4FDTA 5L3SB 3ZJ5A 5JJCA 4JDUA 3HY1A 4ZDWA 3AB3A 4R31A 4BB6A 1L1EA 2OMEA 3T9CA 2H92A 2R4TA 2GPYA 4BXOB 4QTUB 2YYYA 3O2SB 2QMZA 4XDHA 3CUSA 4Y2JA 4BBPA 4YV2A 3EZ6A 1L4NA 4W7IA 1HNWB 4YPVA 3FW1A 1I4WA 1U3GA 5TQVA 1M1YA 1NA5A 1Q0HA 3THOA 4Q37A 1K3UB 1J8FA 3NBYC 2Q1UA 1EK1A 3LDFA 2HNAA 2F9MA 2AVNA 4DYDA 1CY0A 4F2HA 1ZY2A 5FBLB 2RHSB 4BDTA 1HEUA 5EEHA 4EGSA 3EAQA 3PNLA 2CY0A 1ADJA 1ZI6A 2HK9A 2WFLA 4CMEC 4LY0A 4XTZA 3TOSA 1IZ0A 4DLUA 4R5HA 3SZOA 3WA7A 1UMKA 4X64B 4EUEA 2HF7A 4I99A 1VFPA 3OZTA 1V7QA 1W6UA 1AN0A 1E7RA 1PD1A 2PBZA 2ODEA 2YDXA 2P2DA 4R8SA 4UJ3A 4YCBA 2J32A 5CR9A 1DTWA 2J48A 2DWPA 2PYIA 4L8GA 3B9QA 4NPAA 3UJBA 5BPFA 4XTXA 2AYYA 4YBRA 1RYFA 3RSZA 1GPBA 3QNWA 3A32A 1FC0A 1A2BA 2JFXA 3MWGA 3PFNA 1ACJA 4G5XA 2BZ1A 4CF4A 3IOCA 2KM1A 3IVCA 3LM8A 1H3FA 5HK8A 4B74A 4JQYA 4FHCA 5KJFA 1KO8A 3FYUB 4DJJA 4YIHA 3PHIA 2RGCA 2F1RA 1AM4D 2LCQA 1ULHA 3HYRA 2ZDGA 3SC2B 2C9DA 1C50A 1YK1A 2DAPA 2ZAMA 3A06A 4FMDF 5HSGA 1AA6A 4TWRA 4DSUA 4W9NC 2A1UB 4RXUA 3QMVA 3ZDBA 1W73A 3I4LA 1EP3B 1WM1A 1DWUA 3E0XA 3B1ZA 3WAJA 1CJTC 5DK6A 1MC8A 2DUUA 2X9LA 3QFHA 3FKSA 1NR5A 4J1TA 2NU9A 2WBLC 1UP7A 1YCGA 2DGDA 4OQPA 4WD3A 3D4OA 1SOAA 3EZYA 3F5SA 4ABYA 2XAUA 1GUBA 1TQ6A 3OURA 1RD4A 4F5WA 4M1YA 1NGSA 1W2HA 4HNUA 5JZVA 4EYQA 4NCXA 1Z0FA 4EY8A 3KAJA 1A8HA 2YFHA 4PLZA 1J7KA 2YC4C 4Q3DA 4BB9A 4EG0A 3HXYA 2FLWA 4AMGA 1UBKS 3HA7A 1GTL1 4Z9XA 5DM60 2OCYC 1QQ7A 4LI3X 4AJHA 3R9KA 3GLIA 3GDGA 1XRNA 3RI3A 4C3UA 4PN7A 1HURA 2HK7A 4FIZA 1E1QD 5JBIA 4A0RA 1J09A 1W48A 2BONA 4M7WA 2H1CA 1XZBA 3KYIB 1ST3A 4TT8A 4B75A 1MO4A 3D02A 3IBGA 3L01A 2OTCA 4FBQA 3VR6A 4CT4B 1WW8A 4OBXA 3TSYA 5AVXA 1SRYA 4RXMA 2FMKA 3EIUA 4YMGA 2R3SA 3FZNA 3MILA 2PEZA 4D9CA 1U8TA 3KL2A 4R3NA 4WLOA 4C03A 1Y8RB 5HK9A 3T61A 5INTA 5GTDA 4JEMA 4H18A 3DBLA 4RGQA 1B2LA 1M34A 3U09A 2YWDA 4DKJA 4HGYA 1Y9EA 2OHGA 1A9ZA 1CFJA 1DVRA 1GU1A 1MTOA 1XFAA 4ZA2A 2GEUA 4C0LA 4HWTA 1P2FA 3OEHD 3EG5A 1CK4A 2GD6A 4PZEA 3T99A 4BP1A 3HNPA 4HD0A 3DMTC 1JZQA 1TVEA 4FBLA 4WN9B 1RWOA 2AR9A 4ENWA 2CMHA 1S6YA 5A03A 3LQQA 3FBTA 5B1EA 1KWKA 4XA8A 2NS6A 3HBMA 1P31A 4JUFA 1A95A 4N49A 3TGPA 1IN8A 2BTQA 3KDSE 5MGNA 3OLVA 4MIYA 4ICIA 1FNNA 3OIGA 4EEZA 1A96A 2GK3A 2Y1XA 4XOIA 1EP2B 5A5FA 4MQFA 4DNQA 3H5RA 2R86A 2P5UA 3LTNC 2W71A 4JNCA 5J40A 4HTFA 1WXHA 4LJAA 2XJ9A 1U7WA 4Y1EA 4P7FA 3TRHA 3PC8A 4KBFA 5LIPA 4X8MA 1IC6A 4Z8XA 1QH8A 1S8OA 2O1SA 3NRCA 2HEGA 3PUHA 3JZMA 3IUSA 2VG8A 2WZCA 3LO5A 1FJGB 4PWZA 1CY2A 3WYCA 3LQRA 4M8NE 1YQGA 1USIA 1EB8A 3EAGA 1TA9A 4M22A 3DHWC 2PJUA 1RQNA 1E2IA 1ODIA 4H3HB 5GVRA 5JZOA 2OV1A 3EGDB 5JR3A 4JFRA 4G85A 1GILA 2JHAA 1G7SA 4FX5A 2HJWA 4E1VA 2WAOA 3T7EA 4GX5A 5SICE 1HR0B 3VR2A 5IDXA 4S1VA 4H1HA 2VOJA 4IKEA 4ND4A 4BLWA 4JLWA 2R7NA 3HKDB 4R1SA 4RO0A 4XGQA 4NK4A 1F9AA 2ZBPA 4FMCF 4ZIRB 1C8BA 2UXCB 2P79A 3IDFA 1TM5E 1VJGA 3A11A 4L8LA 3BTUA 5A0FA 4JQCA 3WB0A 2UYQA 3B2NA 1N2OA 2D2IA 2IY9A 3CVXA 4NBNA 3TRIA 1XZQA 3VQXA 2YJTD 1C4WA 1P44A 5LP6A 4IDGA 3FSGA 3NWJA 2B5OA 2QUJA 1T4CA 5BMVB 5BVHA 4RK4A 3F71A 3B8HA 5EHZA 4GG1A 2KBEA 5BV1A 2VF4X 4J7AA 4DLZA 3QWAA 1POWA 2ID9A 3THXB 2YWHA 4LHSA 3Q0TA 1EVLA 3ZK9A 2FSVA 1PFGA 2ZB4A 5KYNA 1U6JA 4QDTA 3NBZC 1DFIA 3WTBA 3V8PA 5C37A 1TJ5A 3QJYA 1FTNA 5LA6B 2FSGA 4EKIA 1BMFD 3CXRA 5CFNA 2CJAA 3GQBA 1XX6A 3TIGA 1NPDA 2WZBA 5KJEA 1ZH4A 5EZ6B 2DEUA 2R65A 3KUXA 1ZHHA 3C48A 4ILEA 4IX9A 5CVDA 3K4HA 4KQGA 4Z5XA 1R74A 4YT2A 1A82A 3IHWA 4HLQB 4HUQB 2D06A 5DM70 3PUYA 1EGAA 3T7AA 1IVYA 4K3UA 3BIXA 1U04A 3RBVA 1I4OA 1PD0A 3UAYA 4AJEA 3K8OE 3E82A 2VHEA 2VFAA 5IK2D 4URZR 3A4IA 3PK0A 2NGRA 2QLMA 2B5WA 2Y1KA 3AFOA 3O94A 1OOEA 4JYCA 5ALZA 1OI2A 1PNTA 4C1NA 1V11B 4LBWA 4J3NA 4L72A 3TBHA 1YIOA 1BWPA 1TMOA 1DIBA 5E0KB 1EFDN 5F2EA 4BU1A 3ZXUB 2WOOA 4CMJA 4D3ZA 3W5UA 5J2UF 2VK4A 1QONA 1Q74A 2L42A 2OBLA 4Y2TA 1JHQA 2DF8A 3SEAA 2ZE5A 2QGFA 1SBQA 5FADA 4C3ZA 4KGZA 4LXQA 3S2YA 2AGVA 3B1KA 2AFIE 2W11A 4P4LA 4P7BA 2Q1SA 5JO9A 5FR1A 5DLPA 3FCOA 2A0YA 3DWGA 3V4PB 1X8LA 5DPMA 1W44A 1U3CA 4CLDA 1HUQA 1PNVA 1JFVA 3BPSA 4DIFA 4D26A 2J9RA 1EUCB 3FWYA 4D4GA 1GLNA 2H2FA 3FBWA 3TEHB 5EXEA 5E3IA 1SXIA 2HHCA 1FCJA 4FYYA 2C3OA 2HADA 3KUDA 5E3JA 1RRGA 1RMYA 5B4TA 3K0SA 3NDBB 4JBHA 3MBOA 4G0WA 3UUGA 5IYZA 1V7PC 1H65A 3CHYA 3L7MA 5T3UA 5JAIA 4RD4A 3T7CA 4G4GA 2IYVA 2XWBF 1N8SA 3HEMA 2BGTA 5AOVA 5GJVC 4CEIA 3CVYA 5BQOA 2Y8EA 2ZGWA 3FCXA 4N18A 4B84A 3VKHA 1LXCA 3QVLA 5I47A 4J2OA 2Q7HA 3RGLA 5EFZA 4DR3B 1X9HA 2QZZA 3CW8X 3WNBA 1T0HB 1TM7E 4H7DA 2P90A 3MUOA 4L8FA 3QITA 1TEXA 1SVMA 1ZDMA 4FHGA 4JH0A 1WWKA 3COWA 3V4SA 3RB8A 1NMQA 4MULA 5AW9A 3GL9A 2WTXA 4R2LA 2EQ5A 4GLFA