4K88A

Crystal structure of human prolyl-trna synthetase (halofuginone bound form)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
497
structure length
490
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proline--tRNA ligase
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 143
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k88A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k88A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k88A02
1E1OA 1YB3A 4DQ2A 2ZNJA 1BIBA 3A7AA 2ZZGA 1E22A 2CIMA 2DU7A 4XTVA 4XU3A 2C8MA 11ASA 3QNEA 2CJBA 1SETA 1JJCA 4PHCA 4RQFA 2AKWA 4ZTUB 4H2UA 3L4GA 3HY0A 4P75A 3HFZA 1X2GA 2ODRC 4UPAA 2RHSB 2ZNIA 3A5ZA 1B7YB 2E64A 2EJFA 4YCUA 1X2HA 2ZGWA 4HWOA 3RIRA 2DXUA 4H02A 4XEOA 3UGQA 1SRYA 2AMCB 3A5YA 4YDQA 3LSSA 4H2VA 4TQFA 3HXWA 4H2XB 4WF2A 4P72C 3HRKA 3RF1A 3HXZA 3R07A 1V95A 2J3LA 3V8LA 4HVCA 4YYEA 3VQWA 2ZTGA 2G4CA 4YRJA 1EVLA 2ZXFA 1WU7A 2ODRD 4WJ4A 1VQZA 1NJ5A 1E1TA 4P74C 1QE0A 3UH0A 1B70A 1EQRA 1X54A 4XU2A 4YCVA 4TVAA 5K1PA 12ASA 4RMFA 4TWAA 1ADYA 1G5IA 2E5AA 2DZ9A 1PYSA 1H4VB 2ALYA 4XTZA 3HY1A 3RKXA 4L87A 1L0WA 2E10A 1BIAA 3HTZA 4K86A 4YRSA 4Q6GA 1KMMA 4BW9A 3A7RA 2ARSA 4HWPA 1Z7MA 5C52B 1B76A 5C53B 2ZT5A 2ZINA 2DTOA 3L2ZA 2ARUA 4KR2A 4WJ3M 2Q7HA 4RQEA 4YROA 1BBUA 3FJPA 5C51B 1BBWA 1B70B 2ZIOA 4YRTA 3QO7A 3M4QA 4HA8A 4P71A 3LSQA 2DXTA 1YGBA 2Q5IA 2ZT8A 3BFMA 3MEYA 5ELOA 1J5WA 3OD1A 3V7RA 4K88A 1ASZA 3W3SA 4KR3A 4E51A 5KNNA 1FYFA 3IKMB 3UFGA 2QHTA 2DJZA 4YRNA 3TUPA 4YREA 1EOVA 1USYC 1WLEA 4YRIA 3QTCA 3QO5A 2QHUA 2ZT6A 1B8AA 2FYKA 3HRIA 4PG3A 3REXA 4DPGA 1G5HA 2P0LA 2DEQA 3E9IA 1QF6A 1W66A 3V8KA 3RACA 1LYLA 4YCWA 3P8VA 4YRLA 4LNSA 4P3OA 2E65A 3PCOA 1JJCB 2ZR2A 2AKWB 4CH3A 1H4QA 3L4GB 4XTXA 1WPYA 4CH6A 1ATIA 1WNLA 4P73C 3HFZB 3VQVA 2RHQA 3A74A 2I4OA 2I4LA 3VQXA 2LW7A 1G51A 3TEHA 1C0AA 3NENA 2CGHA 2I4MA 3V7CA 4P3NA 4CH4A 4XTUA 4ZTZB 4YRQA 4Q15A 1KMNA 1ADJA 1WYDA 4YRGA 4OLFA 2J3MA 1RIQA 2ZR3A 4P74A 3E9HA 1HXDA 2EJGA 2QHVA 5ELNA 4G84A 3DSQA 5F5WA 1E24A 3G1ZA 3MF1A 1NJ1A 1GGMA 2DQ3A 4EX5A 4TVWA 3IALA 3M4PA 1IL2A 4YRCA 1KOGA 4OP0A 4YRRA 2RHSA 4HWSA 1B7YA 4XEMA 2ZZEA 3TEHB 4P71C 2I4NA 1EIYA 1NJ8A 4TVAB 2DKGA 4HWRA 3CMQA 4H2TA 3RUXA 4H2YA 4TTVA 3IKLA 1PYSB 2ZZFA 2ALYB 4H2XA 4YRMA 1SERA 2EAYA 4P75C 1NYQA 4K87A 4RDXA 1USYA 2Q7GA 3P8TA 4X5OA 1NYRA 1YFSA 4G85A 2HNIA 4XTYA 1NJ2A 4CS2A 3ERRA 4TQDA 3V8JA 4YRKA 3HXYA 2ZCEA 3NELA 4UP9A 3A31A 3VBBA 4YP0A 3UGTA 4P3PA 3KFUA 1NNHA 1EIYB 1X01A 1YFRA 2DU5A 3L1AA 1EVKA 3HFVA 3IG2A 4KQEA 1ASYA 2Q7EA 2IY5A 4NCXA 3PZCA 2QHSA 2C7IA 2DTHA 2Q5HA 3HXUA 5E3IA 4XTWA 2PMEA 4CH5A 3A7UA 2PMFA 4P72A 4TVYA 2P5IA 3I7FA 4XU0A 1Z7NA 4AH6A 2DTIA 4O2DA 2CJAA 2DVEA 4EO4A 3NEMA 1HTTA 3TEGA 1YFTA 4H2WA 1H4SA 2XTIA 4P73A 5K1XA 2DQ0A 4ZIBA 2CJ9A 1HC7A 1X55A 2EJ9A 4HWTA 4XU1A 2E41A 1WQWA 3NETA 4H2SA 1EFWA 2IY5B 1N9WA 4CS3A 1SESA 3PCOB 3EFSA 4J15A 4BWAA 2EWNA 1WQ7A 4UP8A 1H4TA 4YRFA 3MF2A 3RKWA 2EL9A 3ICAA 2E3CA 3VQYA 3RL6A 3WQZA 3HXVA 3REUA 2RHQB 1NJ6A 3HXXA 3V7SA 3BJUA 2ARTA 2ZT7A 1X56A 4UP7A 3RKYA 4YRPA 3QO8A 2DZCA 3EFRA 2ZIMA 3P8YA 3LC0A 4YPFA 5HGQA 2E1HA 4WI1A 4CS4A 2AMCA 2DDZA 2XGTA 3RGLA 3A32A
chains in the Genus database with same CATH superfamily
2A57A 4RHEA 2EZ8A 2ZIGA 3B2QA 3GN2A 4MS3A 4OIMA 3PFWO 4AZ3A 3HDYA 4R0MA 4NMWA 1EUZA 4JEHA 2ATCA 4ATNA 1GPYA 5M7EA 3DKRA 3GZ4A 2AEFA 2P6MA 4PGFA 3L4EA 1JDVA 4S1TA 4UNSA 3LTEA 1HQCA 1RRPA 4YGXB 3T06B 1CUYA 1QCZA 4OM8A 4GR4A 2RGXA 1L3IA 5KTOA 11ASA 1VL6A 4J7CA 1U28A 5LZ8A 4UEOA 5SZIA 2TYSB 3X1MA 4JDPA 5DSTA 4LHYA 4UUOA 1Y4ZA 4LNUA 3ZU3A 1V4NA 4V0QA 3QE9Y 1DZIA 1FTNA 2BISA 3B1FA 2GTHA 4KQ1A 4TTIA 3R8FA 3L4GA 2FK7A 2X15A 4P2GA 4WOCA 2HHHB 1MCZA 1H2FA 3HN6A 4WSOA 4ZU1X 1XPOA 4DWWA 1GLNA 3G8AA 3D8UA 2PQ6A 3I34X 3MERA 1PKEA 1JPJA 1FFAA 1PYGA 1A69A 2DSNA 2J0VA 1Z0KA 3OQIB 4HH3C 1X39A 5GGXA 2J3DA 4Q18A 5E1BA 2HT6A 3UUWA 4FZVA 3LV8A 3O8CA 2UVDA 3A1NA 4BO5A 1NXTA 2IU0A 3RRZA 2H1OA 1QIHA 2V7BA 1L8OA 2VRBA 1ZMTA 4FNGA 1NQUA 3NP9A 2V65A 3B2EA 2H7CA 1OFVA 4ZZ1A 2XE4A 4WINA 3IHKA 1W0KA 2G1AA 1D09A 3MRVA 3PJEA 3LLMA 2Z1MA 4MQFA 3KU4A 4RY9A 4YLGA 5BN4B 3ZIAD 4AY4A 1R50A 3GRFA 1OA0A 5HFNA 4KQMA 1C5KA 2X0KA 1X8XA 1ZEMA 2V8BA 3TRIA 5HTOA 5HZMA 3P2MA 1CEQA 3UAVA 1HSOA 2CEKA 3NXKA 3KPWA 2Y67A 2JGDA 3H3JA 2B8TA 4P72C 4QUKA 3RF1A 4RQTA 5G0VA 4CXMA 1KQGA 2J3LA 4L5BA 4MJLA 3HYRA 5F4ZA 3EB9A 2XUAA 4YCDA 2IHNA 4LDQA 1S7CA 1WBDA 1NA5A 5LWQA 1ISPA 2D5AA 1E3TA 2CE7A 3OWHA 1EU1A 1I10A 3RJZA 4B31A 4EMTA 1ZOSA 4M7RA 1FXUA 4BO8A 2B82A 1DMSA 3T61A 3MS4A 2ZXFA 3U39A 3E0QA 4LYHA 4YS6A 1DLIA 4M49A 2VH5R 3NVKI 3LKZA 3RJMA 1CJBA 4I2VA 1YASA 4DR6B 2ODRD 2GRJA 4AJOA 5FLKA 3B7GA 4TQUS 4MICA 2IL1A 3WWYA 1D7AA 3T1VA 1AQNA 1V8DA 3PD1A 4IX1A 4CQJA 2KSQA 2VDWA 4Y67A 3NM4A 1ZMXA 5H3LA 3ZDFA 4N40A 4LVIA 1J2UA 1DEKA 2CFTA 3V9PA 3ZXYA 4NU6A 1O97C 2JIPA 4GYJA 1MB2A 4MWGA 4I4NA 1TL7C 5T3YA 4FR5A 5DWQA 2OSVA 1X54A 2VCEA 3QUCA 1FLAA 4LHXA 5I8ZA 1M2OB 3AXSA 2ERCA 3ECAA 3T54A 1S02A 2NQ2C 2V03A 3FJYA 1FC0A 2NAFA 5KPJA 3PLAE 4XI9A 1U7PA 5TMEA 1C14A 4I5DA 2RHDA 4CKEB 3R4CA 5LQMA 2JHCA 4CG2A 5A5VA 1QYIA 3PRYA 3FF1A 2ZR0A 3STVA 4H0NA 4X3PA 5FBLB 3RLIA 4D9MA 4NCBA 4JMLA 4M0KA 1YZFA 3HL0A 3HU3A 4I9FA 4UARA 1U5BA 2WIDA 3RKXA 1Y5MA 3ABSB 3KU1A 4CKBB 5A0TA 1FP4B 1PJSA 3QTLA 3B8EA 3RSFA 1ZWKA 1ULBA 2FPGA 1V5GA 3MTAA 4OHRA 5AKEA 5FO0A 3T7CA 1A5TA 2X14A 4D4MA 3K8QA 3MT9A 4A7PA 1AMNA 4NWIA 2QSUA 3GP3A 4J2OA 4YRSA 1Z7WA 3S70A 4CLXA 2FLWA 3HUDA 2IKQA 1D0IA 3I9KA 2SKDA 2WF8A 4RVFA 4M8KA 4JKOA 2H0QA 1QVRA 2K7FA 1QIFA 3KBOA 3UNXA 1ABBA 3I9OA 1R6VA 1P7YA 1X1RA 2ODQA 3K73O 2AWNA 2VN8A 2ARUA 4FMDF 5ALIA 5DLYA 1V47A 4NFSA 1HQKA 3WK7A 3WQSB 1OJLA 1P62B 2B99A 1WLYA 4HO1X 4Q1EA 5E7MA 4KTVE 2YVAA 2ZJ0A 4KQXA 4RK4A 1GA6A 1V9CA 2FZEA 2EKPA 4I8DA 3QQPA 4KRYA 1B70B 1MQAA 3EDQA 3HSSA 2O52A 3K6KA 2BFDA 4AMBA 4D4KA 2OD9A 4EITA 3HCPA 4NZ9A 1L5GB 3N0VA 5CT5A 2M1ZA 2VHUA 3Q3EA 4IDAA 2PUWA 1IQRA 2J48A 5ELOA 1Y4UA 3EW9A 1UKBA 4IGIA 1Y8RB 1GT6A 1Z83A 4IIUA 5HR5A 4FCTA 4PLFA 2N42A 4E13A 4BEWA 2H4YA 4K8RB 4LRWA 2AZMA 3ZV3A 3COWA 3HLTA 1WUYA 3ZLTA 3B1ZA 5DHAA 2W8ZA 4DC1A 3INTA 3KSRA 4I1IA 4NECA 2W6PA 9GPBA 3PEFA 5DEIA 3SVLA 2YXLA 1RKQA 2QE6A 4ZAWA 4IVRA 5B4UA 3AVVA 2FG6C 3KLMX 3ZX4A 3U3MA 4G4GA 5IT9A 1COWA 2PZ8A 4J0FA 3TTVA 4DNFA 2C8KA 2O6LA 3EH1A 3D6VA 3UMCA 2PZAA 2P3OA 1DBRA 4KBFA 4Q3NA 4A2PA 4L3VA 4NU0A 3C5EA 3QO5A 3I1JA 1OFIA 3A2KA 1B8AA 2ZYSA 2BTOA 2ZU6A 1A1SA 3NDPA 3RFFA 4AMYA 1D0SA 4XTCS 2OBFA 1ELOA 2RHGB 2G07A 3NTOA 4M1YA 4DGQA 2CZCA 4IJVA 1Y8AA 2BCJQ 4E5SA 4C2UA 4RD4A 2H48A 3WJ2A 4LE1A 2FN9A 4EPYA 1K68A 2JGAA 2QMOA 1UKEA 3G7NA 4M55A 2R1ZA 1K7CA 2Z09A 5CEEA 2W2XA 4OBBA 2POCA 4MS3B 2C2BA 3VNRA 3NKVA 5CM2Z 3CLHA 3IS3A 2D0OB 3A27A 1D2CA 3KBBA 4JP8A 1U5CA 3G9TA 2JH3A 3L4SO 1OW3B 1F17A 5HIKA 3ZIUA 1QIIA 5THXA 1LI4A 3GUVA 3R75A 5KJ1A 1C30A 1M83A 1Z75A 3L0YA 2Q41A 5EHGA 3OEYA 4GRAA 5C5DA 3JS5A 3ABRB 3PCOA 2HADA 3CUSA 1F3OA 4OCZA 3W6NA 3ZHUA 2NV2B 5HKKA 1QB8A 3PQEA 3Q5GA 4IOJA 3UK1A 3L4GB 1CR1A 4FEGA 1QR6A 1AUQA 3FUUA 1QTIA 3CE6A 3TNJA 2DTDA 3EDOA 2PLNA 1CYDA 2JEZA 2A5GA 3TSCA 4DCTA 5DNWA 2A94A 4HT3B 1NXVA 4QBTA 2WG1A 4C0QC 2TMKA 4NCAA 5T7BA 1WMDA 3KQNA 4CEJB 4LCBA 3MTBA 5IU6A 1A8PA 3CLUD 4L73A 5LNK6 4MW0A 2F2TA 2G17A 2H2FA 3VKUA 2CGHA 1QOPB 2WTAA 5HW0A 3LHFA 4PXYA 3DKPA 3EG5A 3KZOA 3ERCA 1PJQA 2JFBA 5EN4A 4ZV9A 1Z5VA 2HJWA 2CHFA 3P94A 1KPHA 3HJNA 4NX2A 4PLGA 3Q3CA 4MR9A 4CM4A 4EX6A 3MMZA 1PT8A 5AHOA 1LU9A 3AKEA 1GPJA 2ZBEA 5CJPA 3BN3A 1Z18A 4DFDA 2JNWA 2ATVA 3I76A 3OKAA 4HBGA 1RRMA 4ZC8A 2JGDB 3A4NA 1QPGA 5KYGA 4YACA 4I1VA 4ZCMA 4QXAA 2BAGA 3WC4A 4UVHA 4BOYA 3FNBA 3WGKA 3WL7A 3F1LA 1Z0AA 4FYWA 2VBIA 2D1RA 1RJGA 3BOSA 3SOPA 3KC2A 3SQOA 2ROQA 3EQ8A 2EHDA 4IRUB 1ZGBA 3R40A 5TT0A 4C7KA 4DIOA 4N0EA 5F33A 3AVYA 3OKFA 2Q27A 3QJGA 3AKZA 2C1XA 4J9UE 3EGCA 1ZD5A 4DV2B 3FFWA 4BGIA 2NUAB 3OPVA 3I6YA 3VTIA 1JG7A 1Q95A 1D1TA 3I5XA 2DQ3A 1BCSB 4DA7A 3CR3C 4WZZA 3FPBA 4NEQA 4YT5A 4BNIA 2AN1A 3IALA 4XFJA 3T3DA 3LVKB 2AG0A 3M7IA 4RYLA 2Z7CA 1Y5NA 3TRHA 4EG3A 1JU3A 5ALEA 4GZMA 4M1WA 5IJZA 2B7CA 1KYTA 4LC0A 4I6GA 4J1TA 4N0MA 4PGAA 1RCFA 1L7PA 1B7YA 1ZS9A 4R51A 3EASA 1L7DA 3BCSA 3MJCA 1TT7A 3G2MA 3NFYA 3WGHA 1LTHR 2UZ1A 5DTIA 3JQAB 4YQFA 4QJ3A 2UZIR 1ZZGA 2VTKA 3OP4A 2FJ0A 2HA2A 4LMPA 3AU9A 4TYQA 1DGQA 3G2KA 3GRVA 2BDEA 4AICA 1GTG1 2VDNB 2YJ6A 3CMQA 3DWGA 1E9SA 5F64A 4RJIA 3EDRA 5KS2A 1CIJA 2CFCA 4FGLA 2IHZA 2IHUA 1T1JA 3F1KA 4K5QA 2ZQZA 3HH8A 3GRRA 2I4IA 5CYOA 2BSXA 3FAKA 5G40A 4C4YA 4QVIA 1KKMA 3M9WA 1EGAA 5LUBA 1BOOA 2W22A 3UTCA 4CDRA 3LD9A 3W79A 5KNDA 4LSZA 4YUWA 1RZRD 3TR6A 4BECA 4M0MA 1PWZA 3EZLA 3EJ6A 2EKDA 4X5OA 4FBQA 1VYTA 3GARA 3QF4B 3V1LA 4B40A 2YDYA 3IULA 1AA9A 1AVTA 3D59A 1M72A 3HNPA 3NWPA 4DTIA 1QP7A 3MJFA 4DWOA 3WB0A 1NKTA 1AQLA 2V98A 3JD2A 4LK2A 3LT2A 4L07A 3LYHA 2A0YA 2UYHA 2HOQA 5BW8A 1W581 4H31A 3UM9A 5JFGA 5KOHA 4Q9NA 1P33A 3I04M 4JK3A 3EPKA 3DZJA 2AOWA 3EZ7A 2F3UA 4EFMA 3Q87B 1GL6A 2BGTA 3KS9A 4L50A 4N76A 4F11A 1IDOA 1SUSA 2Q6OA 3GJQA 1Z0DA 1U7UA 3BFPA 3NHWA 1DX9A 1FOEB 4H7KA 4YV7A 1PDVA 2RGBA 2Q8NA 1BROA 2EYQA 3B3FA 1LI7A 3QBDA 2OHXA 3ZWXA 5KO2A 2WT4A 2EDAA 4OV6B 2JC3A 4AUMA 4GGMX 1QCDA 1SBIA 2ODPA 1G8YA 4JGBA 4Q3BA 1KDZA 1V1RB 4TTSA 3R9XA 1GSIA 3FCCA 1ZJ5A 2VG8A 2BFDB 3W3AD 3AUXA 1QFZA 3LUFA 1VMEA 1TU4A 2G5GX 2W2KA 3A6GA 1O4WA 4FW9A 1RCTE 3T3HA 4ML3A 4HQNA 1MJGA 3KXIA 1AOXA 3U3RA 4LVNA 4DV6B 1SBCA 2WJ3A 5WRFA 3UJCA 5JNWA 2VZ8A 2QHSA 2PCJA 3SNHA 2BHNA 5LBIA 4TTRA 1TYCA 2IEIA 1UKAA 4U4AA 2WPNA 3IE0A 5GPBA 4QRHA 2FEWB 3LBYA 3NORA 7YASA 1QV9A 4ZALA 2ZB7A 2PCLA 3UMMA 5FQOA 1A71A 4ZVLA 3FKSD 4PSKA 3H0KA 1XQ6A 3TVTA 1AHIA 2PRSA 2QTVA 4LRYA 1BVRA 2RJNA 4HNQA 4LXYA 4PC1A 3V00A 4MUAA 1RLTA 1ZJYA 4BMOB 4WXHA 3PDIA 5JWRA 2QBYA 5CTJA 2OTCA 4XVCA 3GLIE 2PGOA 1ZHHA 3FOBA 5C3UA 4GQBA 1TKRA 2NN3C 2Q49A 4PC6A 5DOZA 4KFSA 1A9XA 1KJQA 3C7TA 1YC2A 1KOLA 3V34A 2ODAA 3MHPA 3PRKE 3NEMA 2C4WA 1JO0A 1TVMA 2I6QA 2CNLA 3AUKA 4QJ5A 1GKIA 4ASUA 5LN1A 1SD1A 2EHJA 4AJEA 3RS2A 3ZDEA 3L4JA 4H2WA 4WLVA 4TUYF 3RASA 2XJ9A 2G06A 2IP4A 1X1QA 4KVGA 3HADA 3A6KA 3X0DA 5K4HA 5LM3A 4UCFA 4O8ZA 5K1XA 2XNHA 5EWLA 4BGDA 3TTFA 1SUAA 4ZYLA 2X5NA 5AKKA 5GP1A 1W49A 1E3QA 3BIXA 5DN6A 5FBKA 2Y0EA 4M1KA 3VR4A 4RC9A 1PNQA 2PLWA 3L9XA 1TZCA 2G04A 1ISMA 2BOVA 2O2DA 1G8JA 1AGRA 1PL0A 2VPXA 3GGSA 3VPCA 1O87A 2VDPB 4RKYA 2V7EA 2XF2A 4NULA 4EA7A 4EYEA 3ZWMA 3DWFA 4ARBA 2YZ7A 2HB6A 1MDBA 3CUUA 1LDMA 2X1LA 1YB2A 3PCOB 5JTTA 4OF4A 1GLVA 5TF0A 2B4YA 1GYQA 3SAJA 4HDNA 3OCZA 2DPYA 4BHTA 1ETHA 1T9GR 1DAGA 1JU4A 4NABA 3PUZA 1S3SA 3L92A 5I51A 2EZ9A 4Z9YA 1HMYA 2PT6A 3T1HB 5A03A 5A6VA 2ZUTA 2G76A 3DSRA 4FR0A 2ZRQA 3E15A 3V7SA 3BJUA 2VA9A 4Q12A 2ZT7A 2OBNA 3LHSA 4MSUA 3ENZA 3L1UA 2Q5LA 2W98A 4OTZA 5K0TA 2CHUA 2XWJI 3ROFA 4YRPA 4U2GA 3SICE 3W0LB 4B7AA 4FQ7A 4P5PA 3F8WA 2DZCA 2WJIA 4XQ0A 4BNTA 3UJ7A 1NONA 4KXQA 1OI3A 3CRQA 2X3YA 2L19A 3GFRA 3NOVA 3OJEA 3PS9A 1C1YA 3EXHB 1S2GA 1E32A 2B8WA 4QUDA 4AURA 4JI5B 1X0VA 3DLIA 4CR8A 2PGNA 2GAOA 4NESA 4X7RA 1LJLA 1Z5WA 1JALA 1IJKA 4KSBA 4KXXA 3UQZA 5IASA 3D3WA 3RADC 1BDIA 2X41A 3TS1A 1YB3A 3ZIDA 4BLPA 5I9MA 1T1EA 2JFOA 2QDKA 4K2AA 4Q6BA 5KC9A 2XH8A 5AKHA 2XUIA 3OOEA 2Z58A 3TEJA 1N3BA 3HKDA 1KE2A 4MRRA 3W8EA 3ZGVA 5LQAA 3IMGA 1T5SA 1EG7A 2CJWB 5ER6A 3G2QA 3WAJA 3KJNA 4D4HA 3HYCA 3B1YA 1RHMA 3H05A 1SIWA 3ZHCA 3D7MA 4S04A 2ZJYA 4ZXFA 4RA9A 5ENVA 1BHQ1 3MNFA 3NP7A 2Y3IA 1C8VB 3HYLA 4ZAFA 3OCWA 3TTXA 3B82A 3C5HA 4CCYB 4DV7B 4NY1A 2RKBA 3AY0A 5JV5A 3LRPA 1RXCA 4QSMA 3ET5A 3QE4A 4KIFA 4RDHA 3RFXA 1UBUS 1B8UA 3TLCA 4RTJA 1PJTA 3H2BA 3P0JA 2D2IA 3TLMA 4TT3D 3DH0A 4UPAA 4HDCA 3R0ZA 3KIPA 1B7YB 1EUCA 1FNNA 1G3UA 1VJGA 1KFCB 3H5NA 4NZPA 3MF4A 1AE1A 1ITZA 1P0FA 1WB6A 1ZM2A 2JHFA 1DTWA 2UZ1B 5GQSA 1NC3A 2BHSA 5EQJB 1PVDA 4GP7A 3ACDA 4D8TA 2V7QA 2O4UX 3HKEA 5TVGA 4KAJA 5C80A 5AVZA 3RIRA 1AK9A 1DPFA 4XEOA 1G5PA 1M5TA 4OSPA 5G4LA 4YDSA 1OXVA 1L4GA 4AVYA 2MT9A 1W4LA 4OVKA 2GNPA 3AHCA 2FHSA 3GZTB 1GTJ1 3BH6A 1F4VA 3G85A 1FW8A 2CCGA 4I4TA 3SS8A 1JR3D 3FYSA 3BT7A 3BDVA 1EP3B 1T24A 3EUEA 4BV9A 4BBJA 3COZA 5C7YA 4L8WB 4OJTA 4Y6LA 1YJBA 4EF6A 3NNNA 1MC1A 4HH0A 4GOLD 2F17A 3E53A 3PFCA 3CXUA 4IV5A 5DZSA 3BJMA 3IP6A 2V0GA 3QUSA 4HVCA 1SBYA 2P6OA 3VJLA 4BVFA 2XXAA 4BKUA 4IBOA 2ZTGA 1PR1A 4NDAA 4RFLA 4YHHB 4DIBA 4KQJA 1LRKA 3KQYA 3DAGA 3OUTA 4XXHA 1XZGA 5ITZB 3ER9A 4Y1EA 3AFNA 4EJ6A 4MIOA 5KOHB 2OBLA 4NBUA 3OZTA 3D0QA 4FYMA 4XYGA 3UWPA 7AT1A 2P6NA 1Q1GA 3LQFA 4E1BA 5D85A 1GDHA 4CCWA 1AXEA 4Q21A 3RSZA 3E27A 1EX1A 3OJXA 5IW8A 3C6ZA 3ANNA 2YV1A 5F9HA 3B36A 2WHQA 3IP3A 2PKXA 1J0CA 3BHIA 1OZGA 5BW4A 1FJHA 4O63O 5A5FA 3DMYA 2P9TA 4XDZA 1NI4A 2RD2A 1SKBA 2HYIC 1M34B 4C87A 1WXFA 3SBXA 3KPVA 4V2UA 2YTZA 2D4HA 4XPIA 2W2KB 1QOZA 2Q9CA 2XUJA 3UHPA 4F3CA 1GM5A 1VIMA 1I5RA 2M98A 4DCVA 3F0TA 4DLTA 2BKEA 2CXPA 1QCYA 1DBWA 4UTOA 2OYSA 5LYYA 4OSEA 3MWEB 2DZ9A 1H4VB 1FFYA 2AZTA 4Q19A 4CNQA 4W6QA 4MZXA 1Q1NA 4TKVA 4YH1A 1B0UA 2O57A 4RE5A 1YIDA 1ZJJA 1O95A 4FHGA 4WK2B 2Q7XA 1M54A 2HY7A 4GZ6A 3TFOA 1KJJA 5I7RA 1BIAA 4EL0A 3PPWA 1GU0A 3ZEAA 1XXHA 1OPRA 3IXMA 1E1LA 5AVSA 4WTOA 5IYZF 2QBYB 1NG1A 3OOJA 3UK2A 1J7KA 3IQHX 3KSZO 3OJ0A 3QUAA 1A9XB 1DT3A 1USKA 4Y1GA 5BWBA 1VKNA 4QHTA 3TAXA 3RTEA 1LFDB 5J58A 1B76A 2HDWA 1D03A 1WZEA 3C16C 3NTLA 1FP7A 1XHLA 2ZT5A 2GN4A 2ZQ5A 3DZHA 1AY0A 1RTKA 1T4CB 2YH2A 5LZ5A 1NXWA 2IZ7A 1JEQA 1Z0IA 2PRKA 5IJWA 3SP1A 4KR2A 1PQPA 1NW4A 3JASA 4WEQA 3F3KA 3WWDA 3PNLA 1MORA 4RACA 2OHGA 3CRNA 5EWLB 3FSEA 3H1GA 1J6UA 5AJUA 2E2WA 5EIAA 4XIIA 3CUVA 1E9DA 1NX9A 4M53A 1BBWA 3CF6R 1GTSA 3JQQA 4HQRA 5EIEA 2BJVA 1XDZA 2W6ID 1ONPA 4GI3A 1SPBS 3T7TA 3QO7A 2DKNA 2GARA 2PGIA 3AUJB 2IYRA 2NU7A 3KLBA 3WFZA 4V1CI 5JS7A 4JEIA 1Z6AA 2L8YA 3MN1A 3STUA 2UZ4A 1E2LA 2JGJA 1N1MA 3COVA 1M1NA 3OZUA 4MYHA 1EFTA 3JVDA 4ILEA 3IJ5A 2R87A 3L1HA 4WK6A 1WIWA 1B0PA 4ZFNA 2JKZA 1G8HA 4HN4B 4P4NA 2AFRA 2C42A 4JI1B 5TQ0B 3WLMA 4HDNB 4G24A 5AVTA 5HJ2A 3ESAA 2NWQA 2XRYA 3PD7A 1Q5PA 1VPLA 4IDBA 1LV7A 4W63A 4ZQBA 1R6AA 3H13A 5IS2A 1FLNA 4EHKA 4N9WA 3OPYB 3MJVA 3Q0IA 4XJSA 1XF1A 4ALIA 2P77A 5JJLA 4LN1A 1RI5A 1JR4A 1V9LA 4L6CA 4CV2A 5AW7A 5COAA 3CVWA 1YDHA 2DQKA 4Q3OA 5TEWA 3GOHA 4E32A 4ZCLA 2G83A 1EAMA 5F76A 2HREA 3EVEA 3K7EA 4J7UA 1XB2A 3EBPA 1ZSYA 2HDNB 3CH5A 4GUAA 2OOKA 4IF4A 2I5PO 3TIXB 1P2FA 5EZSA 2QE7D 1MW9X 3K2IA 4OBWA 1VA5A 1ZUHA 1ZQ1A 2OUKA 2B1RA 2WUFA 4PTZA 2ZI9A 3NBFA 3WK4A 1P19A 4ONEA 2OCGA 3KJFA 3WYCA 4EQ6B 4AKGA 3L7NA 4UTXA 2W4IA 1A8IA 2VEOA 3I4CA 1SWWA 4P58A 4DUYB 4KFCA 4OB8A 3AUYA 2IQIA 2Q46A 1JH8A 4DWJA 1PG5A 3HKDB 4E0BA 4YAUA 1CRPA 3LK6A 5AJYA 3EDCA 3QFSA 4LZOA 1H69A 5BSTA 4B4OA 1XMJA 2BLLA 4OJQA 1NF3A 2P6PA 2VSNA 3QVLA 3QA9A 3IERA 1RDFA 1ZVKA 5TVKA 4RA9B 3ZV6A 1TGVA 4OI4A 1XZEA 3TGPA 4L51A 2WUWE 3AGPA 2FSVA 2PZBA 4P9NA 4KQHA 5FHRA 1W88A 2SBTA 4K03A 2QMUA 1W1UA 4TZTA 2NSLA 2EGHA 4DV0B 4G63A 3M83A 3W1VA 2G9UA 2ZYAA 4Q00A 3I39X 1SH7A 2BJWA 4BEVA 5HCUA 1J99A 5K1ZA 5HZGA 3GNLA 1K6IA 1MJFA 3CRZA 1ICEA 4LMBA 4PSVA 2WSBA 1P61B 2V96A 1SR8A 1VHJA 2XNKA 4HF7A 4OP1A 4DZRA 5C7OO 3PEYA 1TAUA 5CFQA 1Y3BE 2ISCA 2XE6A 3BRWD 3HKEB 4I6JA 1P4SA 2HEGA 1LVHA 4MA0A 2X0FA 5F5NA 1GCAA 2WD9A 4V03A 1F1JA 1K4KA 2V9ZA 3CWCA 5DHQA 2Z9CA 1IRXA 4AS1A 5DYYA 5CP8A 1TAQA 3LKBA 2YHSA 3WB1A 3ZS8A 5JRZA 2RAVA 1GFWA 3QKSA 2C9YA 4C6RA 3SM9A 1ADJA 2BE7A 3UB2A 1W8IA 5TARA 2D2VA 3HWX1 1G0NA 1WXXA 2X4IA 4KQGA 4UEQA 2J3MA 4X7MA 4ZVUA 4OXKA 4R1LA 2LCQA 2XCTB 4P74A 2RGNC 4EYOA 3NHYA 3PX3A 4V3CA 1F51E 3HI6A 3FYUA 4LJ9A 3VTKA 2YFHA 3A2MA 5TLSA 2H3EA 1PLKA 4DYHA 2WFLA 4HRAA 1NH9A 1GUAA 3HO8A 4L7VA 5HMLA 3GGOA 2VAWA 4PLVA 3GXOA 3FOCA 3NM6B 5CBKA 4BCDA 4Q0MA 1HRDA 1M66A 2I2BA 5JAZA 3IBFA 1ZM7A 3PF8A 1YSCA 2WJHA 3IEUA 1KIFA 3JQGA 3MBIA 1YJQA 3OCUA 1NZJA 3PC6A 4RNDB 5J5AA 4BEJA 1TNDA 3CLRD 3G5TA 1CVIA 4IJ6A 3S8EA 4RTSA 3A3PA 3OF5A 1S3FA 2FFRA 3SZUA 1Z6QA 2AC4A 4I3FA 3TQCA 3WIOA 1Y82A 3OPQA 3C6XA 1XQWA 1JFFA 4C2BA 3PR1A 3TSOA 1NI4B 4JJ6A 4LPSA 5DGCA 3TRJA 3PUYA 3KEMA 3NH9A 2Y1OA 1F6BA 2R8OA 4KPYA 2VT3A 5I3ZA 5IM5A 3TZHA 3VR3A 1U28C 5DFAA 3W77A 5HF5A 5TJ9A 1KR2A 4MPRA 4RTOA 4TKUA 1U8TA 2XLCA 1J2EA 3L6EA 2WSIA 4IKOA 4Y6GB 2IVFA 3CRVA 3V33A 3D64A 1QKKA 1R0RE 3F96A 1LC3A 4D8YA 2CF6A 1X9GA 1CY8A 2VF2A 3V1UA 3VR5H 4TKVB 5J5VA 2J0SA 5CNMA 3HM9A 4H2XA 1OFHA 2XGMA 3IDZA 3OQ1A 3S2EA 2CNDA 1A9QA 3FAZA 3E9NA 4MV5A 1PLJA 1KY3A 4Q9HA 2JIMA 1DIOB 1K3TA 1P6UA 1YOVB 4BX9A 1Y8ZA 4NEHB 3JRWA 4X9XA 2RSLA 1XXHB 3INNA 3NC4A 1E6CA 3HKCA 3P2KA 1M2NA 1GOTA 1MFPA 4WOPA 1BE1A 3GEIA 1UMDA 3CLTC 5JSQA 4RF5A 1ZJWA 5I7EA 1GDTA 1IPHA 2P30A 2QTGA 3C7DB 5K3OA 3LG2A 1ZGJA 1GPKA 1QIJA 2A9PA 2ZS7A 4BPRA 3QNUA 5KHOC 3V8JA 3VU8A 4RK0A 5J4LA 3OOHA 5AKGA 4LCEA 2ZXEA 2ZCEA 3IGFA 2OD2A 1C0IA 5B6IA 2WB2A 4G4JA 3VU9B 5BWOA 4C08A 3U7FB 1NQOA 1GT91 1VDMA 5SZJA 1EHCA 4EB6A 1VKHA 3O82A 4YUVA 3L93A 5LQCA 2B61A 2O4CA 4NCKA 4AMZA 1P1HA 1QO7A 2AI3A 3Q0EA 1UM9B 2QHXA 4PGHA 4EJMA 3LCVB 3HA3A 4OLBA 1MOSA 5F98A 1MLDA 3WNDA 2QS9A 4HGNA 3GA7A 2E0IA 4QWWA 1FZTA 3N8DA 2OV4A 4AQDA 1PFKA 2IHVA 2I1LA 1IAVA 3ZTTA 1XP8A 2OAEA 3GMIA 3FETA 3LVFO 1JSXA 3R9WA 2VNIA 1GU7A 3ZYZA 3L06A 4LRSB 2XMGA 5A9RA 3ORYA 4N65A 1XRQA 2HWKA 1CPYA 2NTEA 3KEFA 4P7FA 5CFOA 3OX2A 2BGJA 3NM5A 4TS3A 4OAPA 1MOZA 1RD4A 3IPAA 4X97A 3O3MB 1JRLA 1OILA 2Z4RA 4RLSA 1SCNE 5L4LA 5LSAA 1XLUA 2PKEA 1J5EB 3PFGA 1Z7NA 2OHJA 2GHIA 2RAUA 3AHIA 3K09A 1U9CA 1KK2A 1YI0A 3R7WA 3RPEA 3T1OA 2D1SA 2ZTHA 3T6KA 1PCXA 4RGVA 2OV6A 1R5BA 4JUFA 3NGMA 4QGBA 4E5UA 5BURA 3RTBA 2LVBA 1BEEA 3WBBA 1ZYUA 3OOWA 3IAAA 4COOA 3FNFA 5HKOA 3SZOA 1Z8HA 4DCSA 2XKKA 4A4DA 1NW8A 1V0JA 2VUHB 3A1FA 3TEGA 3T7DA 1BJRE 3ZXSA 4FX2A 4E3WA 2XTZA 1GPDG 2JCBA 3R6LA 3KKLA 3M9LA 2W70A 1FNCA 1YZUA 2YX1A 2Y1GA 2PA0A 3DTVA 3LVJC 2PJDA 3OLWA 4NV0A 2L42A 2A86A 1D5CA 2BSAA 2XODA 4DJEC 3RAFC 1T5BA 5KSYA 5JJBA 3TEMA 4F12A 1KZ7B 3FNRA 3VHRA 1OB2A 1BVUA 1TIPA 1E64A 3BD7A 4EZEA 4MGIR 4IYRA 4F4HA 5IFKA 4MUMA 1U2QA 4CM3A 1M8FA 1JZTA 1QO0A 2A9FA 2WV9A 1PNRA 4DM3A 2RJOA 4MQUA 4JU9A 1FNSA 4Z9FA 5NULA 3R3VA 2EKQA 1WPQA 4EGQA 4JLNA 4LQCA 3F3YA 4PGGA 1PK8A 1LF0A 2VH2A 1X42A 3LO5A 2G8NA 4QARA 5DNCA 3KYIB 4IQ0A 4J2TA 2J5RA 5AP9A 2GEVA 2WVAA 4H0CA 4IXTA 1T1IA 4CL2A 1EFAA 2D5LA 1NVWQ 3HXVA 2C0QA 1IZYA 2IRWA 4IJKA 5D6OA 5DI3A 3VGPA 3BJEA 3C6QA 3W78A 2LXNA 3ZQ4A 3BB3A 5JJ5A 3Q8KA 5EMJA 5GJBA 1K7XB 3HXXA 1YD7A 2ZIFA 1X0XA 4RW0A 4KTTE 5G4KB 2V6FA 4AY6A 3MLBA 4RKWA 1L4UA 1XEXB 2P68A 3QWFA 3RM3A 3FKJA 4JFAA 1GXSB 4CF3A 5GTDA 3NBMA 1U8XX 4G1EB 2NVWA 3ADPA 3AMVA 5KJCA 1XCOA 3CF4A 4E6EA 2RGCA 2XV1A 3ESRA 3N28A 2BY4A 3FB1A 1CDOA 4BFZA 3N0RA 1CJCA 2W6QA 3DEKA 5SV2A 5A3VA 1VBKA 4RK1A 1WR8A 2XA9A 1L9KA 3CZAA 1JQJC 1UFKA 4UHHA 5DYWA 1X80B 2GAFA 3TTTA 4D3YA 2P7IA 2XXBA 3KOUA 4TRNA 1U8ZA 3EVZA 1YCFA 3NIFB 3V1YA 3MGKA 2YW9A 1C1DA 3E03A 4K6MA 1E1OA 1GNPA 3MG9A 2P4HX 3H97A 4PO9A 4IDHA 1UFVA 2M6LA 3SBDA 5F9MA 3FOEC 3HXLA 4WNAB 4D5EA 1BIBA 4RNCA 1NT4A 3UPUA 3RVRA 1XMXA 3TQFA 1E22A 1ZUWA 1J00A 2IXGA 2NTVA 2P2SA 2YWEA 3FYUB 2XI4A 4A0FA 1KMCA 2F9LA 5JH7A 2PD4A 4HJRA 5HP4A 2W2LA 4R8SA 1SVNA 4EI2A 5JPCA 1BRMA 3F6RA 3QNEA 3GT7A 2ZRNA 1EX9A 1AB5A 2IOQA 3C3WA 3PQ7A 1SETA 4RA6B 4EPRA 2GPNA 2ID7A 1E1MA 1S2DA 2XECA 1ZDMA 4RQFA 1H2WA 3AUSA 5BN5B 1OV4A 1TMKA 4H6VA 3Q4GA 3IPCA 3WL4A 3MTJA 4GFDA 1UQUA 1PYDA 1CE8B 4GGOA 2EU8A 3O8QA 5DXJA 5BRJA 5JMTA 3AM3A 4QEDA 4UOZA 2QT0A 3SJ7A 1XRSB 2JLAA 3KP1A 5ERXA 1JSRA 2AB0A 3UJ3X 5HM8A 5BUSA 4FFMA 4MV9A 2ZNIA 2K5UA 2NOAA 2XXJA 3L8YA 3UBMA 3EQ2A 3V7FA 1I7DA 2GCIA 2HHAA 2BKVA 3O0DA 3ZW7A 3T3OA 1KMQA 5F9FA 1Q1AA 5CYPA 2I7DA 4XLTA 5IEBA 4ZOBA 2E6UX 4PINA 3DZBA 4BRUA 3ZWPA 1FNBA 4B3IA 2XCOA 3RAGA 4TKUB 4F9FA 1ESCA 2DHDA 4IW3B 3AVQA 3C3KA 3PC4A 2J3HA 4TQFA 1KQOA 3LWDA 3MJSA 1AGYA 2F8LA 1D6MA 3UICA 2JLYA 4F71A 3DE4X 4H2XB 2IYNA 3Q72A 4P7KA 3SLRA 3SEQA 4QFCA 4RHTA 4BNVA 5D87A 3JU3A 4DPKA 1XPUA 4WRRA 1VA4A 1WJGA 5EEHA 5TPZA 2ZVQX 1AKVA 4WKCA 1WHTB 4YLYA 5BNTA 2QXTA 1B0ZA 4JQOA 1JKFA 5LQJA 3HKCB 1OJ7A 1UXOA 4INOA 4DF3A 3VYSB 5H80A 1T2CA 1UMDB 5J2UA 2PM8A 2I9PA 2I3ZA 4ZT4A 2VBFA 2WMDA 3CZ9A 3NAZA 4GS5A 3ZXIA 3EXHC 4B48A 3UXMA 2JGKA 1H0RA 2ZVJA 3QJ5A 1A7UA 4FNAA 3M2TA 1QIKA 2MDTA 1ZIXA 2R7MA 3V1MA 4QYSA 5FA5A 1I1HA 1N3LA 2WWIA 3CTMA 1Y89A 3W6OA 3QEMB 1MGPA 1BA2A 4L3OA 2YIMA 3R5JA 4U2DA 1JEEA 2XQGA 3DVAA 3OHSX 2O06A 5I7FA 3AL0C 3CUWA 4BFUA 3NC1C 1VGQA 2OXFA 4AKIA 4CWAA 1J0DA 4AJ9A 1HYBA 3JARA 1XTUA 3U5TA 5A1TA 3WO1A 3FYHA 2Q0QA 2X2PA 2ANCA 1SVSA 1RQLA 3IBSA 4JZYA 4FM9A 1IK4A 1Z4QA 4KVAA 3LBAA 1NMSA 3L2OB 1LLDA 3N9IA 3P0EA 4YCVA 1AXGA 5B57C 1CJVC 4CBVA 3E9MA 3DLHA 3QNWA 2QJFA 2AK3A 5EQDA 5BUCA 4FFBB 1G6KA 5AK0A 2NU6B 1SULA 1KOJA 5IFLA 2R6JA 1G5IA 1BWQA 4RHYA 3U4IA 1FA9A 3OPMA 4H2DA 3KHKA 4FX5A 3R8XA 4TWBA 3O1IC 3ZYCA 2VSFA 3F5DA 3HJFA 1SURA 2CNNA 1KSFX 1RJ9B 1V6AA 2QD1A 4L87A 5C4MA 1D4OA 4N5IX 2VJKA 1TAHA 2H2WA 4YCMA 1V16A 4Z0TA 4QASA 3TZ6A 1RNLA 1VG1A 4HEA6 1ZHOA 3QYFA 1KDVA 3ZC3A 1E0AA 1UDWA 3NEYA 4G0ZA 9ATCA 3PEWA 3WDKA 3HUUA 1ANKA 3R7WB 5BQPA 3KUXA 3OPXA 2O1EA 5EUCA 2C1ZA 1X94A 3IOYA 1Y1TA 5K0FA 2AMJA 3VYUB 4G1FA 1WUJS 4Q6GA 1Y3HA 1US8B 1KMMA 2AOVA 2QLMA 3CJTA 3MCUA 3QKRA 3I9JA 2Y1EA 4HGQA 4JLKA 1JAIA 5FNVA 2FPXA 2FG5A 2IC5A 3Q88A 3FW1A 3EQ9A 2C7BA 2FWMX 4C30A 2PYIA 3NW9A 1Z2AA 3K0KA 2CXSA 4FOTA 5G02A 1R6XA 2R1TB 1Z5UA 2VZ9A 3QVGB 1SK9A 1HE5A 3SE7A 3ZNPA 2PWAA 4B33A 4F5DA 1EFRA 3WGNA 2VJPA 3DTVB 3CCBA 4TV9F 1C0PA 4KDCA 5HOQA 4ENWA 5DWDA 1WKVA 3AONB 1R16A 1T35A 1T9HA 4ZAYA 1NYLA 1N2XA 2ZIOA 1JAYA 2RAFA 2BF4A 4LJKA 1YRAA 4WY5A 4UDOA 3TXAA 1G63A 1O58A 1R15A 3NG1A 4JR2A 4QOHA 4LF6B 1F2TA 4WXMA 4B8WA 4N4AA 1EFPA 3VMFA 3CWZA 1P0MA 4OLHA 2Q5IA 1BX0A 3UOGA 5IEJA 4G9BA 3E7PA 1E89A 1GPNA 1NFFA 5AM5A 3OVMA 1P45A 1XNGA 4BTLA 4K8OA 5FR2A 2ZOSA 3VR6H 3OD1A 2WW8A 1QHFA 1LC0A 2GO1A 3Q5DA 5HE8A 3WLEA 4UAGA 2AIRA 4UUAA 1ZVJA 3DBHB 4IIJB 4LOJA 4ZRDA 4K81B 3W3SA 5JSHA 1RADA 1T9AA 1DG9A 1GGKA 4BS9A 1HDEA 1RYDA 1VE3A 2NZYA 1QTNA 3NRCA 4MARA 5CFZA 1MXFA 5EQTA 3D7KA 3NKLA 3SZMA 4E14A 4G0UA 5MN5A 2WG0A 2YJ3A 5EZYA 2B35A 3UWMA 2AMFA 5LWHA 1GGHA 3U4MA 3CF4G 3FUXA 4PYQA 5LMCA 3HXOA 4D26A 2O54A 2QLJA 2VJAA 4D82A 4YREA 3OPNA 4QPZA 4RD0A 4RV9A 4WKOA 4BUJA 5GONF 1QVVA 4Q9LA 4C2AA 4YP9A 2NPOA 1JFLA 3OM0A 1QWOA 4OHPA 1BMTA 4DR2B 3M3DA 4O4JA 3SYLA 3DOCA 2DQYA 3WWPA 5EAIA 3BEDA 3DLCA 4BMYA 3BMNA 3HRIA 2D2FA 1AURA 2OP0A 4RHXA 2Z0MA 1I80A 1DKPA 3S1AA 4K9SA 1DBVO 3VVCA 3I53A 1P9NA 2HA6A 3BTSA 4ZVNA 4ROSA 5C31A 2XZPA 5CAEB 2P0LA 4ZHQF 1C1DB 3VAYA 5MN6A 1NY6A 1M5UA 2DPHA 1MV5A 1T26A 2Y77A 1K6MA 4BGUA 3UHJA 4JYZA 5ARDA 3K9BA 3VAAA 1IZ0A 4G07A 4G3XA 3RK4A 4ZQGA 2X23A 3DWIA 3LMKA 3B3QA 4MV6A 5JH7B 4H08A 1GL9B 3TDNA 3QX8A 3ZCSA 4LNSA 2YVLA 2YBEA 4S2UA 3R09A 4CIVA 5LP6A 2H5JA 5LVAA 1JLLA 4G1BA 4MX8A 1YBHA 2VT6A 4ODIA 5KPDA 3AEYA 1WULS 2WP0A 1F2UA 2FWPA 1ZNQO 2RFLA 3RWBA 4HDOB 5CDYA 1IMJA 4CUZA 3O8QB 1VRCA 4FFRA 3TOVA 4KXYA 1W1WA 3SC2A 4DMFA 4DDMA 1V3QE 4HLUA 1PV1A 3E7WA 3OTWA 2A9QA 3D6MA 2VF7A 2ZJ3A 4R2IA 2L18A 1E63A 2Q1UA 2V7TA 1OU0A 1FMJA 1K4MA 1K5DA 4LJ8A 5ALPA 5HCIA 3TSWA 3RARA 5ESWA 3W2IA 3RS5A 4IQ4A 1QG2A 3MAJA 1SHJA 5FJJA 3L4BC 1C0AA 4AL4A 4KPGA 3NENA 2B8EA 3DC7A 1Y4DE 3HU2A 4WLOA 4BNLA 2PUGA 1WRBA 2X22A 2JFQA 2IEGA 3BD8A 4ZRNA 3ZLBA 4NNOA 3L7YA 4UAJA 2VYVA 1XRJA 3DB2A 3DTYA 4J16A 5AM1A 2DHEA 1A4IA 1Z3IX 2CVHA 1EGVB 3QY0A 3ETLA 4MWOA 4CN8A 2TSYB 4BLVA 2HSGA 2AKEA 3UY4A 2J5XA 1N34B 2HCBA 2AUTA 1QRUA 4MEBA 1PK7A 3HGQA 3WYGA 3VU1A 1EXVA 4ARZB 1JE3A 2YCBA 2FPPB 2R79A 1SXJA 1YRWA 3FPGA 2HUPA 3QEJA 4M38A 4MYTA 1Z5OA 4WKBA 3R7SA 3RRYA 3S2FA 3UPDA 1PAUA 4KUGA 1Q0LA 3GLUA 1DFGA 1UBSB 3LQKA 2Y9MB 1JG1A 1UEIA 3B1JA 3DE0X 3EC7A 5CNJA 4W7SA 1YI1A 4GLLA 2Q9UA 5JQGF 2QQ0A 3KWJA 4CDGA 4QL3A 1IATA 4KSYA 4IM7A 1BMFD 1XELA 2DFVA 3I01A 2FN7A 3OQ6A 5ITSA 3LLVA 1P7VA 3BF8A 1PJAA 1UBOS 3I2HA 4FGZA 4IDNA 1IL2A 3VC2A 3AP2A 1GPLA 3DVAB 3G8BA 3DV9A 4KGVA 1D04A 4AO8A 5KOJA 2RDMA 3K70D 5L7YA 5LU9A 2F8MA 1OBVA 3KHTA 3OQHA 4XASA 5HGJA 4DNOA 1L4BA 3D9QX 4I55B 4LGMA 3RIYA 3SLKA 1COZA 1D8TA 3OTGA 5IVPA 3QFTA 2ES4A 3EVBA 3FCSB 4ZARA 4H3HB 1GQRA 3WWOA 4EY5A 5CCBA 2PVSA 1E7RA 5FOTA 4DLZA 2R86A 1T0JB 3CPJB 5C35A 3C3MA 3DZFA 3LC2O 3R8CA 3LBIA 4PCAA 2NZXA 3DBRA 4Y0AA 5EXXA 2W5UA 3HBFA 4FSDA 4FCCA 2ZB2A 2ZZFA 1JKIA 1Z2PX 4GE0A 4NFLA 5IM4A 1QX3A 3AF3A 4REMA 3PLNA 1RRGA 4R1QA 5TQ2A 1V3TA 3P9ZA 1VSTA 1FRQA 1M7GA 4K87A 3BHNA 1RHRA 4J03A 1K75A 1V16B 3BZUA 1T15A 4P83A 3AHGA 5THQA 1ENOA 2OHOA 1RAEA 2PRZA 3L8EA 3B9PA 3PDJA 2IYAA 2F90A 2PQ0A 2Q9BA 1K89A 2C82A 3MOSA 2XZOA 2P3QA 3VPXA 3PUWA 1XCMA 3VC7A 2YC4C 2CLHB 1E79D 3D6JA 1YF3A 4DS3A 1ZR4A 1RXVA 5FNVB 1M6VA 1V1MB 4FWIB 3R9IA 2A35A 4MI1A 1O94D 5BNZA 1LJUA 4B71A 3OZCA 3EF1A 4ND4A 2F55A 4C7MA 3RTDA 2BW0A 4OXRA 3CZQA 1B4DA 3C3YA 3WLKX 5B3LA 3NAMA 4UVIA 2ZANA 4C7BA 2XOXA 2XRFA 4HYEA 3IQXA 1G3RA 3O03A 4W5RA 2BP7B 1BW9A 1TLLA 4ALJA 3KFVA 1M67A 3TMYA 2H9YA 2OFXA 1PFQA 1QVAA 2X4GA 4I2NA 1XF9A 2HF9A 3ECSA 1JEOA 1PR6A 4BQPA 3X1JA 1C9JA 3K8ZA 2UYCA 2GX6A 1F2TB 4WCDA 2ZR9A 1PR4A 3SMQA 5FPKA 3IG2A 1T3SA 4MWBA 3UIEA 4U8HA 1XMOB 2Q2QA 4QPNA 2IY5A 2ZIWB 3FHJA 1S3GA 3T9BA 2H51A 3FOZA 3HXUA 2WAAA 2WLSA 4FIZA 1XNJA 1Q0UA 2BFCA 2HI0A 4NU5A 3WA6A 3OZRA 2HCFA 3GEMA 3SVTA 1MB9A 2DAPA 2CF5A 3U0VA 3KJQA 3LW7A 4ZZ3A 3R5SA 5ALUA 5JRDS 1MOQA 1Q7TA 2VLBA 1WBJB 3NVAA 1WE2A 2GCOB 4ZJPA 1PT7A 1H42A 1YKFA 1S2OA 2P62A 4FFOA 4JD5A 5CJ2A 4ZVVA 2EQAA 3ZGXA 3BIOA 3EWNA 3UBTA 2VOJA 4E5DA 2G71A 2XVMA 3ES9A 1BX1A 1Z5PA 2Q8QA 2VT7A 3MTIA 2LCFA 3QX9A 1LNZA 1YQ9A 5BOSA 5DBHX 1OASA 4LXHA 5D7NA 2CJAA 2Q45A 2QEQA 2X9NA 1MC5A 2QT1A 4O4JB 3H87A 2QXYA 3BMNB 2QUHA 1UAYA 4N12A 5DHTA 1MW8X 4C05A 2FFQA 3PXBA 4V38A 3SX0A 2E6KA 2OXTA 2HA7A 3FSGD 4QOSA 4X41A 2OXRA 2JDID 4GOJA 2DQ0A 821PA 3TBKA 1PX2A 5JYBA 1JMKC 3K1YA 1IQPA 4DLWA 3S99A 5HKBA 2IYUA 4FEYA 3KYBA 5KNDH 4X1IB 3M81A 1OI7A 2I6FA 2V45A 4KO1S 3SY8A 3WMGA 1P73A 1PEYA 4LX0A 5LDGA 3SXUA 1GCUA 1E9AA 5LUAA 1HNZB 2XUKA 2ODWA 1KQPA 2HSDA 3G0HA 4R5MA 5EFOA 1IJEA 2CLMB 2FNAA 3DAYA 5IPFA 2BZ0A 2FUG1 2APJA 1ZITA 3EFSA 4J15A 1HM5A 1YZTA 2KHZA 3VBEA 4Y2VA 2I3BA 1DB3A 5AI4A 3GFVA 1F2UB 3C3BA 3T4EA 5K6RA 3RANA 1JJ7A 2IH4A 3MF2A 3DXYA 1ZFNA 1XJWA 3HI4A 3RKWA 2EL9A 3SC2B 1QSGA 1KJIA 2D4AA 3Q1LA 1O9HA 4Q6WA 4EECA 1NMZA 1GKUB 3WQZA 4LDJA 2C07A 2VHYA 4KXFB 4XGKA 2SKEA 3L5KA 2ZYHA 5F12A 1D7OA 1JHVA 4GYKA 1HORA 5BT8A 3I73A 3KOMA 4I7EA 3S4YA 4DIEA 1ZD3A 3UFXA 4MI9A 2YJTD 4I50B 4PF1A 1KQNA 2RHCA 4E2YA 1KDYA 3O93A 1QNFA 2F3QA 4ID9A 2P0YA 3DL0A 3RTCA 2N3ZA 1XVLA 2PSSA 5JHHB 1I30A 1N6IA 2QGNA 2FGKA 2VR1A 4IHKA 4FMCF 2UUOA 3JZFA 1NGSA 5T6BA 5L53A 1UP4A 1RM5A 3R3ZA 4J1SA 5EKXA 4F91B 2XGTA 1DKRA 3JYOA 3OFVA 4QRDA 1GAWA 4ESOA 1JHDA 3SM3A 5I7AA 4AYTA 2PR7A 5LQKA 1SXJB 1W4CA 1ZVQA 3PVCA 2RE8A 3U4GA 4URUR 2COEA 5KJ6A 4Q1DA 2EKLA 3WRXA 1M34E 3CG4A 4NE2A 1EIZA 2CEAA 2Z6AA 1RP7A 3OZFA 2RC5A 3FPKA 1J8FA 4HMOA 4YJGA 3JQFC 1SHLA 3NYRA 4PPNA 3WY9A 2GTCA 1D2HA 3H6HA 4Z4EA 1D9XA 2CJBA 3EZXA 1CXZA 1DO2A 3OO1A 1X3SA 1PN3A 2GVZC 4M9ZA 2OCIA 5JZMA 4ESHA 2AKWA 1NHGA 1YS2X 3AESB 4QUAA 4N5DA 1QHNA 2OECA 4ZREA 5DW0A 5JXJA 2PAAA 5EIBC 1UDVA 2BC9A 5JAOA 2ZUUA 4TVSA 2RGEA 2YIDA 4MKXA 1HY3A 3WXBA 1ZONA 4Q02A 2AF4C 4Q1CA 5A3RA 5KOJB 4RVNA 3G5AA 1QDUA 3SS9X 2IZ1A 5IKPA 1CUZA 4M86A 5IN4A 1CDZA 1POXA 2Z4TA 3N6XA 4BQEA 2BD0A 1WXEA 4Q1VA 2QTRA 2PRJA 3FM9A 4GKBA 4FZ3A 5E0KB 3ZJTA 1XAHA 4RTMA 4E7PA 3LQQA 3TQIA 5D86A 2JW5A 4XD2A 1E5LA 1F06A 1W2WB 1L4MA 1VI2A 2XMPA 3HUTA 3NEAA 4EMBA 4H02A 4FU0A 4XJVA 5CLGA 2X0DA 3IPYA 4BP3A 1GV1A 1RC8A 3KG2A 4ARCA 2MINA 2YHBA 3DBRB 3SK0A 3F3SA 5EHZA 2DRIA 1MU0A 3K2EA 4S1PA 1YWGO 1SRYA 1EAYA 1N7HA 1TA9A 3EXFA 2C29D 1AUOA 1UBRS 3EFOB 4QPDA 1NI3A 3WBKA 3ILVA 3LK7A 1BWPA 2ZWOA 5TQ2B 1TM7E 1NF2A 3DAHA 3E9RA 5AOAA 1XDUA 1JDTA 2V54A 2G6TA 2H17A 4L76A 4F06A 1WX1A 5JROA 2QTFA 2YWFA 3UUEA 5DGHA 3W2TA 4EY8A 2OP1A 4YYEA 4CIWA 2X2OA 3CONA 2AHRA 1I5OA 2H7XA 3C98A 1PVVA 2VYNA 4R2XA 5IAGA 2O3TA 1TTPB 1R9NA 1WDKA 2H4HA 1NJSA 2QENA 1I6WA 4OY3A 3IMKA 5TMBA 2R97A 4ZT3A 3TVDA 1JQ5A 5TPWA 1CYEA 2IIVA 4DJTA 1M6VB 5COQA 1Z2CA 5DBEX 3J80A 5AUNB 4PONA 1CQIA 3N58A 1R2QA 1FS5A 3CCCA 4EB3A 3OFND 3H1FA 5H3HA 4B32A 2R6DA 4EVSA 1Q22A 3HJGA 3L8HA 5I9SA 4DC9A 5FI0B 1XMQB 2H85A 3ZV7A 4KYVA 4ES6A 3C1OA 4MRNA 3VMMA 2PZKA 5K3EA 1TD9A 2ZB8A 4E4YA 1BW9B 4P74C 5IVKA 2D59A 3GFSA 3HLKA 1R0YA 4ALMA 1OIWA 1J06A 3JYQA 5C0OE 2NIPA 2RI1A 1LUAA 3FYUC 3NATA 2E55A 1FS4A 4DHWA 3EMDA 4MXDA 3D3KA 2BPOA 1JV2B 2YUTA 3ENWA 1WY7A 4PLWA 2RGGA 5JYDA 3URKA 2HXYA 3U60B 2H9IA 3RU2A 1JBKA 4PBRA 2FY8A 1C9YA 1G3IA 2UZ3A 3H8VA 4MVWA 12ASA 1R6DA 1IHXA 4TWAA 1PD1A 4B44A 1ADYA 1ZY2A 4EMSA 5JQWA 3DEYX 5KX5F 1LBEA 4PPQA 1QQBA 3WYAA 2E5AA 1ML3A 5KDDA 4LWZA 5CFMA 2BFCB 2YV5A 1IBLB 3IAS6 2M71A 3FMOB 3BMXA 1UBMS 2EL7A 3O90A 3TLEA 4B8YA 4XJTA 4FBLA 4L8VA 3TQTA 1CUIA 3OU7A 4A0RA 4MS1A 2OXCA 2QUZA 3ZIGA 2VWHA 2NUPB 4L8FA 3THRA 4EK9A 4L5CA 4GMGA 3A3NA 1Z47A 3F90A 4EHHA 3ZD9A 1GWNA 4YCSA 1Y9DA 2GD6A 2NW6A 3EFBA 1VIDA 4FDAA 4K3VA 5KYTA 1R0XA 5FUWA 3FLMA 1LX7A 4M1OA 3JCZA 4XWWA 1ZD4A 3CVUA 3W06A 2GFHA 3W8DA 4KHPB 3G2IA 3DQQA 1UBJS 3IVMA 3QFFA 2OY0A 3E58A 2QX8A 3M1IA 1BZYA 3O9MA 4UUPA 3I83A 4RTRA 2OILA 1DEHA 1EWKA 1QGAA 2ODBA 3LCJA 3KXPA 5DBGA 1B93A 1M8GA 2ZUVA 3FWNA 3R74A 3RQSA 3W4IA 4FB4A 5LOVF 3REQA 4E2ZA 1L7XA 1NN3A 1SU7A 4KXWA 1WVGA 4NJOA 4TS9A 1PE0A 4Q9KA 3A4MA 4REOA 1KOFA 2A3RA 2BEUB 3STTA 3UAWA 4RPGA 2OMEA 2WTEA 1H0KA 2VSQA 3G1WA 5DTJA 4Z53A 4Y1RA 1MIOB 3DVRX 4J76A 2LP4Y 4P4TA 1SXHA 1Q2XA 4JIMA 4RQUA 3K5WA 4UFPA 4H35A 4YO8A 1U90A 5EE1A 4YIKA 3THSA 4BMSA 2TMGA 4PYRA 3ANMA 4GUDA 1CR4A 3QEAZ 4EG0A 4ZYYA 2ETXA 3G6KA 4Q1AA 5JSZB 1WW8A 4H3VA 4ZV4A 4DCPA 2CVOA 2GJKA 3RBAA 1NBMA 3WV4A 3RI3A 4NZTM 2QM8A 3L8ZA 3IP8A 1C3VA 4LBWA 1MHPA 4PTYA 4PYLA 3SKXA 2I2WA 2M6SA 1ASZA 1G98A 1XPJA 1YQQA 2REQA 3JD3A 2I3GA 4PS0A 3FUCA 4KFRA 5DV9A 2GLTA 2VF8A 4M1SA 4W9NA 3EHDA 3P2EA 4IWXA 1PDWA 2QHTA 3ZK9A 2BVNA 3WZLA 1ZC3A 4GWKA 4UU7A 2C5FA 5KNBD 2RKOA 3DOHA 1V1JA 4FP9A 2GASA 4JVOA 1G60A 3MRTA 3Q5EA 2HCRA 1B8OA 2C84A 1O8CA 2MMCA 3DBVO 3MCTA 3QYPA 4G1CA 1NVDA 3ZDDA 2I2AA 1WETA 4XYMA 4H1HA 3EGEA 3KB1A 2Q1YA 5FBZA 3GNQA 4V0NA 4A26A 1QIEA 1KJZA 3L01A 5CHEA 2KJQA 1EBBA 3KCQA 4DG9A 1GQSA 2PL3A 1N0HA 3PKJA 1BKDR 1SXIA 3KJXA 3V8RA 3TOXA 1KEPA 2XR1A 3AGQA 3GA5A 3WL5A 5EIHA 2M32A 3THYA 1QFSA 3N70A 3PFHA 3H3FA 4WGGA 3PC2A 3CWQA 3D6NB 3HUEA 4FGSA 3P9PA 4FHDA 4KI7A 3KALA 3UT0A 3LC7O 2CHEA 4RH1A 2OCLA 2YJ5A 5CH5A 3SG0A 4ETIA 4XA8A 2QTCA 4Z0NA 2JANA 2R62A 4M2LA 4R1NA 3L7OA 2LNDA 4NYJQ 3RHFA 5LIPA 4HDQB 1CS0A 3PUIA 1F0NA 5B6PA 3E81A 4Z8XA 4P3OA 2WTBA 1H8EA 3K92A 4KKXB 2QJTA 4PG5A 3SMVA 1U3TA 3IV6A 5EE5B 3L0OA 2QSJA 3L18A 4FFSA 4S12A 2VRWA 2AKWB 2IXFA 2QN6A 1UWKA 2ZPUA 1FVXA 2YQZA 3CPSA 1G7CA 1HF3A 3CURA 4HYQA 4RYDA 1J8MF 1T0HB 1TRHA 1A4XA 1Q15A 1YB7A 3K53A 3R5TA 4JYPA 1UT6A 2QOEA 4V3BA 3IOBA 5IXYA 1P7PA 1NXSA 4F2DA 3DMGA 1G20A 3WOHA 1B6SA 2B30A 2GJ4A 4I3HA 3RGGA 2GXQA 2QJWA 3ZGOA 4F86A 2CXOA 4EKYA 2X5JO 2Y27A 3U16A 4DR4B 3BA6A 2X8LA 3Q85A 2P4QA 1QP0A 4TMZA 4Z1OA 4UEWA 4MULA 3AT1A 5FOUA 3PPYA 2BELA 4EG5A 3AFMA 1Z29A 3UJPA 2WOOA 3IH5A 1GNVA 2D7DA 2J3KA 3AEUA 3FMIA 2RHBA 3KOOA 2ATIA 2PRIA 2ZRLA 3EXFB 1N5OX 3A14A 2ZJ6A 3GPCA 4FMCB 5E9AA 1PJLA 1ID1A 3KXKA 5AVJA 2UVQA 4D42A 5HJEA 1PL7A 2PSEA 2FYTA 2HHLA 3S5JA 1GYRA 5E6RB 5DWVA 3ROGA 1WB5A 2W8BA 4UHEA 1SB8A 4ZOLA 3SI7A 5ALJA 1YFKA 1RIQA 1Y81A 4HXYA 3A4LA 1BC5A 1T3HA 3KAJA 5BMVA 4IDPA 1AKNA 1CT9A 1ENZA 1JXAA 1XTPA 1JXMA 2O07A 3FJOA 3ZHZA 2GZHA 1Y1RA 2QSYA 2GWHA 2GBPA 3CJRA 3AI2A 4NOJA 3ICCA 3QITA 5TPWB 3RLFA 4BB6A 4CQMD 3I61A 4G0VA 4MKHA 3UQYS 3PGVA 5AJXA 1NXOA 1OQAA 1RAGA 4HNHA 4X84A 3GT0A 1JDNA 2FSGA 3QMWA 4R9VA 1ZM9A 1NJ1A 4W4TA 3OY2A 1EVQA 3ZHRA 5L4SA 3AFHA 2AG5A 4YT4A 2AMLA 1MTZA 2X7JA 5TMPA 4Z2AA 2XD9A 2O8EA 3OEED 1Z6XA 1QFYA 1X87A 2BM8A 3GA0A 1U8UA 4KE7A 3RWMB 4YT2A 1R9MA 3JQDA 3RHSA 2HJRA 5AW9A 4N01A 1YIOA 1YKSA 5BY2A 3VH4A 4GNKA 4DYDA 3ELBA 4IIEA 3L6BA 2CVQA 2Y1LA 3QPUA 2BBOA 4LX8A 2A1UA 1HG0A 3AUFA 3GLSA 1NJ8A 4UCWA 3U3DA 2C5LA 3UAYA 4ED9A 5CDTA 4QECA 5I7UA 3KB6A 1E4VA 3R5KA 1Y42X 5CCDA 4GX5A 1Z6TA 1JYSA 1Y3AA 5TE9A 3GU3A 3LSTA 3RUXA 1D4ZA 2DWUA 4Z1MD 4KXVA 1H1LA 1D5WA 1MQ9A 3K0FA 4WZ6A 4B6GA 1SZCA 4PLHA 3LUBA 5TIIA 3DYBA 3NHAA 2ZAIA 4BAZA 4EW2A 5A2QA 3L0ZA 4MS1B 3RVOA 1KI6A 1LZKA 3SU8A 1DC4A 1X19A 2IY7A 3UWOA 4OEHA 1CHNA 2FI1A 5JD4A 5JXWA 1C4OA 4HEJA 1KAGA 1MAHA 4UU0A 3RROA 1TJPB 2I7XA 3E35A 3KV3O 2A84A 4W5JA 2J5QA 5A3SA 1VCIA 2YZ2A 4TLEA 1E69A 4UMVA 5D5HA 1JAXA 2LDXA 4EUKA 2Z1NA 1FQWA 1WF6A 2ABWA 3T9EA 4L0MA 4C0XA 2P78A 2GEUA 1P6XA 3H16A 3RIGA 3PXEA 3UEOA 3DEAA 4KR0A 5AW4A 3I2GA 1NSTA 5JNUA 2PXXA 1J07A 3PKIA 4NU8X 3REQB 3H11B 3HABA 1RSZA 4IQ8A 3RYFB 5IUNC 2NUBA 4YQEA 3HDQA 4BVGA 4ARUA 4XIJA 2UZ0A 4R68A 5ARCA 3FI9A 3LO8A 4MVJA 1DRUA 1SBZA 4US2R 3DKIA 1K3FA 2JD0A 2X8AA 1RRVA 2XWPA 1VCMA 2P67A 2JB9A 3PPXA 3PUVA 4Y1RB 4YMIA 5DCWA 1M2EA 4RAOA 4BKRA 4DBVO 1W1IA 4EWLA 3ZU6A 5K5EA 4AULA 1WP4A 2WM3A 4UMDA 4BFCA 4BP9A 2V3VA 4P0TA 5JVDA 1JXOA 4L1KA 4C3OB 1HLFA 4EYGA 1ORDA 3R5XA 1ULSA 3AR6A 3RO7A 1KP9A 2R48A 2QNIA 2VZLA 1RKBA 3ESZA 1R8QA 4M8LA 3TNYA 4CI0B 4HSEA 1N92A 1XWFA 3M1YA 1X1SA 3IEIA 1E0SA 1ZK1A 4CLDA 4TRRA 2VVTA 4DCGA 1U9IA 1I4WA 3F47A 4HFRA 5ESDA 1ECBA 4Y7CA 1GPUA 3ND6A 5K09A 2I62A 4U7HA 2YV3A 5EVCA 4K6FA 2REQB 3QLUA 1F12A 1M1YA 2ZI5A 4GIBA 4NICA 1HZJA 2VHXA 4Z99A 4ERXA 4NK5A 4OM7A 2Y92A 1IXKA 3I7FA 3LPCA 5A5DA 4JBYA 1Z88A 4DR3B 1MRSA 3C14C 4AH6A 2A5YB 1Z07A 2GKOA 3BE5A 5J2TB 4ZVRA 3EGDB 3P2IA 4KMMA 2W6MA 2D06A 3N74A 5FOXA 4EB0A 2EWWA 3L7AA 2AOXA 1U8FO 2YNMA 5B3JA 5BOVA 4ER3A 5CDHA 4X1OA 3U80A 2INGX 4BBAA 4GWLA 3KYDA 2VP6A 4CM9D 1JX6A 4M21A 2ONYA 3UB4A 1SVKA 3CMCO 3BPSA 4H6PA 2C4NA 3WADA 1LPPA 2Y1WA 3UKJA 2CJ9A 1TPZA 2PK3A 1EB9A 2NUTB 3COYA 1ETUA 3SVZA 1J2TA 2PLAA 2WJJA 2FZ4A 1I2MA 4XU1A 3G2PA 1OXUA 3IDAA 3GPBA 2G4LA 1LX6A 5UKDA 5D01A 4CV3A 1V8ZA 1G8KA 1XNRB 4P4LA 5IABA 1MB3A 1QGUA 2JCSA 3O31A 3OH8A 4R1SA 1WB9A 5BSUA 2QG9A 1ZCAA 2W71A 2WYHA 2ZIVB 1X6VA 4K3UA 3Q6NA 1D1QA 3OJFA 4P2BA 4DC0A 3BERA 1YBFA 2R2GA 3BF7A 4N6OA 4NRDA 4CIDA 2YHUA 2J3JA 3V3KA 2FZWA 3HU5A 3O91A 1AXRA 1CCWA 3DR3A 1CZOA 1GSAA 1WUTA 3NTVA 4I9UA 2BFEA 3DCJA 3DMFA 4G5FA 4MLDA 4HUTA 3S8YA 1Z2OX 1BHO1 3HWRA 4X1YA 4RZIA 3O75A 2QP9X 3N2EA 4YDRA 3LY8A 1FTSA 4OHYA 3RVQA 3BM5A 3QO8A 5ALNA 1VZ2A 1Q77A 4P31A 2NTNA 2H92A 5BQFA 4FSHA 3LC0A 1YCHA 4YPFA 5IZCC 4YYZA 4HSGA 3H5VA 5BW5A 1XEWX 2FMUA 3BX1A 3AEUB 3DYVA 4LQ4A 3G88A 1T6YA 3G2HA 4H1UA 3ME5A 1C7IA 4PCUA 2WSSD 3I9V1 2VSYA 1CB0A 3BYZA 3EQZA 3WDLA 3WGOA 1RYEA 3WRYA 1ZLXA 1SQ0A 4RADA 5DDIP 3COSA 5DGDA 5JNTA 3HP1A 5AHXA 1YCGA 4R3WA 1NNEA 2PBRA 3KWMA 3HM2A 3H84A 4TTTS 4IMJB 1GRVA 2BZSA 2F9MA 3D1LA 2XT9A 3FOFC 3ETNA 3GMDA 1WSWA 2H1CA 2C5AA 3N2ZB 1MT0A 3O94A 4WWHA 3SJZA 2ODNA 5BMVB 2ZE8A 1UXGA 1C7EA 5J1TB 2Y93A 3S6JA 2Q3HA 3C8DA 4DMKA 1Y8QB 3D2LA 2ECKA 3HVIA 5K9ZA 3ORRA 1GKYA 4H1TA 1WKCA 3LPMA 1R0CA 1DXOA 3EWIA 4FC6A 5J63A 4FGWA 4BDSA 5B12A 1OV6A 5IYZA 1K1EA 2P5TB 2Z83A 2QYHA 2RH4A 4NYIR 3RVLA 3ESYA 4MHOA 3VKWA 3KETA 5ALXA 3ST7A 1NM5C 4PHCA 5TC4A 4BMZA 3W3AA 4DEYA 4ZTUB 5ELMA 1C8BA 4LY6A 1CRQA 4BWYA 1Z4JA 1Z06A 3AJDA 4JX9A 4J4BA 5AUOB 2MYNA 4G5GA 2O8EB 1PQUA 2VA8A 1DOZA 1M73E 3BEOA 1EM6A 2J87A 3W8NA 4B5LA 1I7LA 5JXHA 3HFZA 4KPUB 4DDTA 1GRRA 5ER9A 1K97A 1C0LA 4DCMA 3IQDB 1VG0B 3SJBA 3SDSA 4AQ7A 2F59A 1QAQA 1SCDA 2ZJ1A 3FG9A 3PFKA 4B80A 3GYGA 5DYTA 1K7SN 4EFLA 2CLDX 4EENA 3NUQA 1BH6A 3U6BA 3L40A 4B17A 1G3MA 1HZZA 1PR0A 4HQ6A 1MJHA 2ZM6B 3B6JA 1MRZA 3KDPA 5TSDA 3WX0A 4AF6A 2Q4EA 3SHOA 1SZDA 1ZOIA 4FK8A 1O5OA 2W37A 5CBPA 1XZQA 2I54A 4TYWA 5JATA 2NO0A 1DKQA 4GMHA 1R3UA 2X40A 5CXXA 4DUPA 2D1FA 2DERA 2NP6A 5CK5A 4D8WA 4YDQA 1FYXA 2XUPA 4ND3A 2WD7A 4N6NA 1PTJC 1U1DA 4TWRA 4EI7A 3C97A 3R0XA 1UIMA 3ZWYA 3AY3A 5DBIA 3I04A 1EP2B 1HLDA 1VI5A 3CX3A 3HR7A 4Q3LA 1O9GA 3PKZA 1S3IA 3LNCA 2A4MA 1WP9A 3QU9A 1KU0A 4F2WA 2C5BA 3RV4A 3QPWA 4BC0A 1E6MA 1UC9A 3SX2A 2V7UA 1W0CA 1B2LA 4BBPA 1VE9A 2FZCA 2A5JA 4MMZB 3QK7A 3EOZA 2PHZA 4Q9AA 4IIBA 3EGOA 4QT0A 4YB8A 4PS1A 4KGDA 2BTQB 3DGEC 1DU4A 2CKMA 2GEJA 4ZVQA 2WVGA 1DBQA 3QVXA 4H18A 4XB2A 3S40A 4URXR 1FF9A 1C3OA 1R4ZA 2XUGA 4PIMA 1KH3A 1TIBA 1WEHA 1X9IA 4HQOA 4ZOEA 1IPFA 4YAFA 4WJ4A 4PX9A 5HRUA 3NU1A 4MVJG 1P18A 4M8IA 1F8UA 2W0MA 4GM0A 4K26A 1QVWA 2ZYIA 3V1NA 4F85A 3TGLA 3ZVNA 3RF7A 2DWCA 1Q0PA 1DUIA 1SXJC 5AI6A 1EE1A 5IAKA 5CFLA 2EGUA 3N59A 1W75A 1Z6ZA 1J9ZA 1QZTA 1F6WA 4P7JA 3K9FC 2PN1A 5DK6A 1VSBA 4EOGA 2HBZA 1W4RA 4G8CA 2FN4A 1XZAA 1HTWA 5JVDB 3W05A 2CNKA 2NZ2A 1JLSA 1EIWA 3O1JC 3ONDA 1O4VA 3B5EA 1OYVA 3X1YA 4TV8F 4B7CA 1VPWA 3DDWA 1CJMA 2PWPA 5C7LO 4FKMA 2MYTA 4XTZA 1G41A 2IYSA 2MIIA 3C43A 3IA2A 4UTZA 2JHAA 3OCVA 3W9UA 4ZICA 4WDQA 2H65A 2HNBA 5KI6A 4I14A 3BWMA 3X2EA 1V8PA 1CUJA 3EMVA 4WOKA 3OQBA 5CW1A 5DM2A 4PZCA 4WUVA 2G25A 3HK2A 2NZUG 5A1JA 3NI2A 1A7JA 1GZ5A 3EUWA 2NV6A 1AK2A 4LW8A 1LJ8A 4RZ2A 3UJ9A 4BW9A 4BCCA 3TSZA 2GN0A 4G26A 1T9GS 3VI3B 1PFUA 1VJCA 3P9CA 4GKAA 4BNKA 4W99A 2JAQA 1IG0A 4G9GA 4GI2A 2VWPA 4WA8A 2PG3A 5AOBA 3KYDB 3O4VA 5EWMA 5TT1A 3OIVA 2CUNA 1IXYA 1P1BA 3LFTA 5K99A 3U4QB 1GAXA 3OTIA 4LYDA 4ZYVA 1NRWA 3G3EA 3TTCA 5LKRA 4C0SA 2FEXA 4HGPA 3THXA 1KDTA 1N2OA 1J0EA 3MXTA 5D7BA 1VP3A 2GPSA 5AK3A 5AYVA 4L4UA 2A1TR 1F4PA 2Z5GA 2JI4A 3LUKA 4GSKA 2BMEA 1P3Y1 1Y2IA 3M4QA 2EBUA 4QTXA 3UK7A 2L69A 4F4IA 4RF4A 2PZMA 3HWSA 1TW2A 1YGBA 2CKDA 4TT3A 1FDRA 5JWHA 4DAOA 5ALRA 1FYDA 2O7NA 1MH1A 3E70C 1FDUA 2DPGA 1AKWA 1U7TA 5KDLA 2UVPA 3VPGA 4CM1A 4A6PA 1GFZA 3UAGA 4B7ZA 1FXWA 4G8BA 4UBLA 2IPNA 1G5FA 4ETWA 3K8OE 4BP8A 2MYPA 5DBFA 4LQDA 1UZAA 3Q3GE 3PYLA 4H7HA 1YBMA 1Z82A 2XMRA 3AB3A 1IZZA 5CT6A 1NRIA 1P6QA 1X8LA 1GRCA 2VUUA 3B20A 1JR3A 2FKNA 3RR2A 1AZSC 1PJCA 9ABPA 1PJRA 5J23A 1K9VF 2OORA 4LZPA 3SJAA 2OHHA 1YL7A 3EIXA 4N7MA 4PLCA 4TGLA 4AX4A 1SGWA 1CKEA 3M34A 5I47A 4C2TA 1Z25A 3SSNA 1WLEA 1RWPA 1EVYA 5DNEA 4BEBA 5GADl 2HCJB 2UUPA 3D0OA 5EP3A 3TLJA 1RXEA 2AOTB 4FOSA 2FF7A 1UDCA 1PJBA 2ZWPA 4RVCA 5BQ5A 5JNRA 3L79A 1A3CA 4KAAA 3DR5A 4V0MA 3CT4A 4WEOA 5F51A 5G3YA 2AVDA 2FWJA 2C5EA 4PPFA 2ZZNA 4OH1A 3TK1A 5JYEA 1O08A 3QKBA 1UXKA 3R9KA 1EGMB 3QF7A 4HUQB 2B21A 3LUDA 3N3AC 4ZU6X 3ELUA 2WY2D 2XOEA 4V0KA 3TBHA 3V7NA 4NLLA 2P8SA 2TRSB 1BKYA 3ZQUA 3EAQA 3P8VA 1I3KA 1TMGE 1TUBA 2R7AA 4OK3A 3UUGA 4BVAA 2FJUA 1G2OA 4TM7A 2I7TA 1CTQA 3R3SA 4WVLA 1Z3CA 5BSRA 2D0DA 3OKPA 1JHZA 2ETVA 2DWOA 4M9QA 1J8VA 2QZPA 3U4AA 2PVPA 1LPNA 2XUHA 2IE8A 2Y1XA 4PE5B 4U0KA 4AROA 1OWNA 5EEGA 4O4HA 4BNXA 4UE3S 4GXTA 4WZAA 3ZCPA 1N0IA 1MX9A 4QJIA 3RSSA 3L84A 4FE3A 4W1SA 2XVXA 1I4LD 3DDHA 3HFZB 1NTOA 1DAOA 3DKKA 3HDTA 4RTPA 5C1DA 1V2HE 2F3TA 5GINE 1SK8A 1U0TA 1A4UA 1HETA 4PZ9A 4OBEA 4RPKA 4QLOA 2OG1A 4MUJA 4J0EA 5KDOA 1XNQB 3ADDA 1Y80A 2NNWB 1JG3A 3F8SA 1N25A 3MCZA 3OZEA 4FT4A 4QE3A 1UPUA 2H9AA 1RHJA 5JCOA 3WLHA 5GY7A 1YE5A 2RC6A 4P3KA 3T3GA 2E37A 4GC5A 4II2A 1A9TA 5CBPB 1OBOA 4AUKA 3AF6A 4FS8A 3MD0A 1XRPA 4FGJA 3BK1A 4URHA 1EK5A 2ZBFA 4QXRA 1RJDA 1ISRA 1ODIA 1MO6A 4Q15A 2CLSA 2WD7B 3DP7A 5JMOA 1GL3A 1ZNWA 2C2OA 5L3ZA 4L9SA 5IH7A 3OZBA 1YR3A 2VQDA 3C4JA 2YXBA 3S2UA 4EVQA 4KAXA 4PX3A 3RS9A 4WASA 1V6SA 4HWGA 3PUJA 4E4TA 1T8UA 2K2WA 5F5LA 3WLOA 2Z95A 4ZEXA 3E4CA 1J24A 1E4EA 2QVZX 2Z3WA 2X0IA 3B6MA 2IXAA 1BHJA 3IAEA 2I4TA 3BICA 1R4AA 2AJLI 3IQWA 3KD2A 4I1SA 3KJGA 1C3OB 1OAOA 4IJUA 3LJKA 3TL3A 2ZS8A 2AE1A 3B6IA 2JLSA 2OFOA 1VQ1A 1O97D 2FSPA 4Z0HO 3RCBA 1FXSA 4TVWA 1K63A 1U11A 2F00A 2G88A 521PA 3TNLA 4O2BA 3SWWA 5FOVA 4OP0A 4YRRA 1B6GA 3ZNQA 1U2TA 4YBZA 3MWKA 1SCKA 1DE0A 3SF8A 4IQFA 4XB1A 3ZD6A 3M4YA 3I58A 5E6UB 5B3KA 1T2DA 3PYMA 1RMTA 4MK4A 4TS4A 2G5TA 1KP2A 5C1PA 4JUBA 2QQGA 1N5DA 2CY0A 4IR7A 4LV6A 8ADHA 1N5JA 2GFQA 3EVCA 2H57A 1SB9A 3LDGA 4NFYA 3IT0A 3OWXA 1O96A 2MJLA 3ETGA 4D0NA 5LXTA 4HWRA 3KR2A 1SCUA 2V97A 2XDYA 5DGTA 4YXWD 2B92A 4G5XA 4URFA 4TTVA 2EG9A 3FDXA 3ZY4A 4MP8A 4CIBA 4YKEA 1ZN8A 3S5UA 4UHJA 4BKQA 2BKAA 4YONB 3K6SA 2IDJA 3QRWA 4CEHA 3I28A 4I19A 1NYQA 2O2EA 2HMVA 3ZWAA 3GDOA 4B2IA 4LDZA 1USYA 2IQ5A 4HYYA 4B46A 3D31A 4BATA 4Z4QA 3R7AA 3QLTA 1HBJA 2ZJ8A 4INAA 4TMTA 1YFSA 4LFCB 1XZKA 4IJWA 1UPAA 3RFUA 3WWCA 3UC9A 4Z7NB 3BFJA 2CN1A 4CTKA 2YY5A 2C2ZA 2YYYA 1RQ2A 4XTYA 1IN8A 2P9QA 2D62A 3P45A 3UATA 4D99A 4P3XA 4DRZA 1LLQA 3JATA 3IOEA 1NJ2A 2YINC 2ZLBA 2C2XA 2C9ZA 4U63A 3V32A 3ZBTA 3TQOA 4JCOA 5JFTA 3EBLA 5T8KA 1NF9A 3HXYA 3CEPB 3EXIA 4TWJA 3ORQA 2HF7A 2VRCD 3I92A 3TZBA 4RLQA 4AO6A 4UVDA 4BL5A 2VQEB 1A7AA 2H59A 5K8LA 2Z6VA 3IEXA 3THXB 4QUBA 3EYWA 5EPOA 2JCVA 2I1VB 4FDVA 4JIGA 4RY2A 1U0BB 3OLCX 4H17A 1HG1A 2HK7A 5DOVA 2ZTUA 4TMFA 3WL3A 1EFVA 5AI0A 2W9XA 1PLLA 3FF4A 4RMIA 3TMKA 4KH0A 2GZ1A 3B3JA 4G23A 4PRLA 3MGBA 4E22A 3O4HA 2O5CA 3OM8A 4IO1A 5A7FA 1QV6A 1XDWA 2UVPB 4H7FA 2Q5HA 2AFVA 3R3YA 2X6RA 4D44A 5AM0A 5JNVA 1RIIA 1GCGA 4XYEA 1HT2E 4GI5A 3BRWA 3KDAA 3PUXA 1XK6A 4O25A 4M1MA 5F2EA 2MCFA 4DCNA 1TCVA 3A7UA 4ENQA 3V1TC 1DP4A 3DV0A 1WCYA 3ID6C 1JZQA 4A03A 4CMCA 2PMFA 1MPTA 2Q6LA 3PPVA 2O3RA 1VIYA