4K88A

Crystal structure of human prolyl-trna synthetase (halofuginone bound form)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
497
structure length
490
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/ligase inhibitor
molecule keywords Proline--tRNA ligase
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
total genus 143
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k88A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k88A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k88A02
3V7SA 1SETA 4UPAA 4PHCA 1GGMA 1YGBA 4KQEA 3CMQA 4TQFA 1EVLA 1USYA 2DXUA 4K87A 2J3MA 2EJGA 4YROA 4HVCA 2E1HA 2ARUA 4YRGA 1NNHA 3VQVA 3NEMA 4P73A 1USYC 4YRMA 3QO7A 4YRRA 2ALYA 1W66A 4XU3A 2QHUA 3HFZB 2Q7GA 4P73C 4TTVA 2DVEA 5ELOA 4YRLA 4DPGA 3OD1A 2DQ0A 1H4QA 1EOVA 4CS2A 2RHQB 4ZIBA 3V7RA 2E65A 1WNLA 2ZZGA 1X01A 4WF2A 2DEQA 2EJFA 3W3SA 1H4SA 2DDZA 4HA8A 4YRNA 1HXDA 2ZIOA 4YRJA 2ZIMA 1VQZA 1PYSB 1B76A 1B70A 4HWTA 2QHVA 3HXYA 1ASYA 1J5WA 4YCWA 2I4MA 4NCXA 2ZNIA 4WI1A 3PCOB 4YRCA 2DZ9A 3LSSA 4WJ4A 2Q5HA 5HGQA 4XTWA 3V8KA 3P8TA 4XU1A 4XEOA 2AMCB 4YP0A 2CIMA 1LYLA 5ELNA 3RF1A 2XTIA 4H02A 4YCUA 2DTHA 2E10A 3RACA 2AKWB 3HXXA 3HTZA 3UGQA 2CJ9A 3VQYA 3VBBA 3BFMA 3A5ZA 4RQFA 5K1XA 4CH6A 4P3PA 4P72C 3L1AA 3P8YA 3QO8A 2I4NA 1IL2A 4HWOA 3RUXA 4YYEA 2ALYB 4H2SA 1YFSA 4BW9A 1YB3A 4YDQA 5K1PA 3RL6A 2DKGA 2E64A 3A31A 1Z7NA 4XTZA 4CH3A 2P5IA 4XTVA 4P3NA 3E9HA 1EIYA 2FYKA 4PG3A 4TVAA 2Q7EA 4H2TA 4KR3A 2CJBA 4HWSA 12ASA 3G1ZA 1X2HA 3VQWA 3IKLA 1C0AA 1QE0A 4OLFA 2CJAA 2ZT6A 3M4PA 2G4CA 4H2UA 3V8JA 3NENA 2ZXFA 3DSQA 3HXWA 4DQ2A 1NJ6A 1B70B 1HC7A 2RHSA 1NYQA 1NJ8A 4YRSA 1ATIA 1SRYA 1WQ7A 3UGTA 4TWAA 4H2YA 4X5OA 1ADJA 1E1OA 2C7IA 2ODRD 5KNNA 2J3LA 2ZZFA 3NELA 5C52B 4XTYA 4YRTA 5C51B 2EJ9A 4L87A 1HTTA 2ZCEA 3R07A 4YRKA 3I7FA 3RKXA 1KMMA 3V8LA 2EAYA 2DXTA 4UP7A 4P3OA 4YREA 2DU7A 2ZT5A 3REXA 1V95A 4UP8A 3L4GA 1EQRA 4P74A 4LNSA 3IKMB 2I4OA 4RMFA 4WJ3M 4YRQA 2E41A 4BWAA 3V7CA 1EVKA 11ASA 2XGTA 1H4TA 3KFUA 1G5HA 3L2ZA 4G84A 3RIRA 3A7RA 3P8VA 4H2WA 2ZINA 3WQZA 5C53B 1G5IA 2IY5A 3IALA 2E5AA 4XU0A 3HXVA 4XU2A 1EIYB 2DTIA 4TVAB 1X55A 3QTCA 1E22A 4ZTZB 4H2XA 4XTXA 4CH4A 2DU5A 3QO5A 1X56A 1WQWA 2EWNA 1ASZA 5F5WA 1FYFA 4K88A 3HY0A 4ZTUB 4AH6A 3LSQA 1RIQA 1JJCA 4K86A 4UP9A 3RKYA 2RHSB 3E9IA 4XEMA 1QF6A 1B7YB 3A7UA 1NJ1A 3HRIA 2DZCA 1EFWA 3MF1A 4OP0A 1NYRA 1NJ2A 3EFRA 3NETA 1WYDA 1YFTA 2ZGWA 2C8MA 1KMNA 2Q5IA 1H4VB 3BJUA 1B7YA 3ERRA 2I4LA 3IG2A 4KR2A 2ARSA 1SERA 2CGHA 4O2DA 3RKWA 1KOGA 4RQEA 5E3IA 4TVYA 1BBUA 2DJZA 3TEHB 3HFZA 3HFVA 3HRKA 3MF2A 2QHTA 3L4GB 3QNEA 3PZCA 4G85A 2ZTGA 3M4QA 4H2VA 1YFRA 4YPFA 2EL9A 1BIAA 2RHQA 4E51A 2ZT8A 4P71A 4YRFA 4J15A 3A7AA 4HWPA 3TEHA 3VQXA 4TQDA 3ICAA 3EFSA 3HY1A 2LW7A 2ARTA 4CS3A 4P75A 2PMFA 4YRPA 4P71C 4EO4A 1SESA 1Z7MA 2IY5B 1E24A 2P0LA 1NJ5A 1B8AA 4P75C 3UFGA 3LC0A 2ZZEA 3RGLA 1X2GA 2E3CA 2ZT7A 4P74C 2DTOA 4RDXA 3FJPA 1PYSA 4H2XB 1BBWA 1N9WA 3TEGA 4CH5A 2QHSA 4CS4A 1WLEA 2ZR3A 4YCVA 1E1TA 2ZNJA 4HWRA 1JJCB 3PCOA 3A74A 3HXZA 1WPYA 1G51A 3REUA 4Q15A 4P72A 4YRIA 1X54A 3UH0A 2DQ3A 2PMEA 4Q6GA 1WU7A 2Q7HA 4EX5A 2AMCA 2ODRC 4XTUA 1ADYA 1L0WA 3A32A 4TVWA 2ZR2A 3TUPA 1BIBA 2HNIA 3MEYA 3A5YA 3HXUA 2AKWA
chains in the Genus database with same CATH superfamily
3KWLA 1SCNE 3DB2A 1JA0A 2N47A 1C9JA 3QKSB 3F90A 4RJJA 4W8OA 4EX7A 2W42A 1M74A 3ZLJA 1JDJA 3EEIA 2FUG1 4XPIB 1JLKA 2MHCA 4NBNA 5EMLA 2EYUA 1GNLA 1R1DA 4JWKA 2GRJA 3JQ9C 3UIEA 1SRRA 1EB8A 3RNOA 2PXAA 3MTBA 3R4CA 1B2LA 1JHQA 5ESDA 5C5EA 2BLLA 3DOIA 4Q47A 2WJHA 3HCAA 3V4LA 1BCRA 3R6LA 4NYMR 4BFCA 3O3MB 1C4OA 4KO2S 1TUGA 4U7HA 1B8VA 2GNPA 5FULA 4ZHQA 1P9NA 1BHSA 4CR6A 4YRMA 3TD6A 2H31A 1UK9A 1A98A 3NCHA 5A6SB 1Z2NX 1LVGA 1V5WA 1IUKA 1GTZA 3A25A 4LG1A 2BZ1A 1DKRA 1Z2AA 2VK2A 2WHRA 3TKLA 4CLDA 1LDBA 5F23A 5A5DA 1P7PA 3DHVA 3H0CA 4K1XA 1RVDA 1PEKE 3GJXC 1YQUA 4LMPA 4RIGA 3R40A 2X4DA 3DEZA 2JK1A 1DADA 2FUEA 1LNZA 3ITEA 2AKEA 3OA2A 3EXG2 1AH2A 1Z82A 2B37A 2XNKA 2XNDA 3O1JC 4R40A 4BKPA 1QP4A 3A11A 2QG6A 3BM5A 3JWJA 3CSDA 3FPCA 4PBSA 2NU9B 3LDFA 1A5BB 2WHQA 1VXOA 4KMMA 1YZ3A 2IK8A 2OFOA 3ABQB 3CJRA 2A3RA 5K0JA 4W5RA 1NN3A 2F3UA 3LD9A 2D7CA 2RHQB 1TKRA 2GF2A 3Q3EA 4C0HA 4J9UE 3HCRA 4RHEA 1Z45A 4HKTA 1E6CA 1U2TA 2CF5A 2YH2A 4LDJA 1NOJA 4GP6A 3VO1A 1KERA 2I55A 4IXDA 3M6XA 4WOBA 2H2IA 2VHQA 3U4DA 1W49A 3W2GA 3FDIA 5T64A 1U4NA 5BVHB 2PUGA 3BBLA 3AUYA 2DM6A 2X40A 1FMTA 1XJ5A 3EE6A 3L8ZA 3LQ1A 3JQ8B 4GXTA 4BBAA 1E3JA 3ML1A 1FQJA 4QWMA 4E15A 4BNMA 4BE9A 2Y1GA 2QORA 4WQMA 1V4BA 2BCGY 4ZI7F 3T94A 3BICA 3AY0A 3DEIA 1HLPA 3IQXA 1JLHA 3PKIA 4CT0A 4D8TA 3NT5A 2WPNA 5F2NA 5I47A 1JEYB 1C1YA 3OTOB 3PEUA 2I7VA 3BREA 4YBZA 3WL5A 3Q1KA 4DKJA 2RG1A 2W2PA 4EA8A 1CETA 1M2OA 2HQSA 3LHSA 4C88A 4YCMA 3MTQA 1W85A 1E2NA 1SD5A 2FW1A 1RBYA 1G98A 1GR1A 3PQ8A 4MLCA 2Q4RA 4N1AA 1OPXA 2FFJA 2NZVG 2QAGB 4MW1A 1VHDA 2EZ4A 2HIAA 2H2FA 3F8WA 3JQFA 4F3TA 3AVQA 3L02A 1TPYA 1Y7HA 1TQ8A 3TSCA 4O4LA 4Q4CA 3K6JA 1T0PA 2JCBA 1U0GA 4JC8A 5L4SA 1CUJA 2Z5GA 2WWYA 1SC3A 1I7NA 2GBLA 1JA9A 3D3NA 3NT2A 5TLSA 2JJQA 2Q1UA 1SXHA 2YWBA 1NL3A 3EZLA 4E2WA 4N8DA 4A23A 1E9CA 1N8SA 2BFFA 4RVNA 5G4LA 3ZW7A 4MKRA 4XU1A 1FVOA 4GL4A 3EWSA 2IYTA 5A1JA 2HNBA 1UKBA 2IXEA 3L4KA 4V1CA 1CT9A 2DBZA 4JASB 5E3JA 3WO0A 1J20A 3QG5A 5JS1A 2VHXA 4O4IA 3O73A 4WPGA 5C1DA 4L2IA 1R5BA 2WJWA 4B3CA 3HXTA 2Y1BA 1JMYA 2VP2A 3U7GA 2O0KA 2CEAA 2B1QA 1A4IA 2C9BA 2RIRA 1EBFA 3AFGA 3DVQX 3MD9A 2AKWB 3OHMA 4L8FA 4LX8A 5DXJA 4ZI2A 4ES6A 3SC2B 1S7GA 1UL1X 2FMKA 1G2OA 2GARA 2QSYA 3OT5A 4CLRA 5C7LO 5JU6A 3GFVA 2NO7A 3RODA 2OCLA 5KDOA 3QEKA 4PHGA 2GZ1A 2P2CA 3A37A 4G0YA 4LY9A 4Y30A 5HM8A 3K6SB 4ZIRA 2WVHA 4IIUA 4REQB 1SKUA 4PZLA 2IXDA 3CH4B 3STTA 1R9JA 4Z99A 5FTJA 3NWPA 1T2NA 4D0RA 2CDNA 4MI3A 3MOIA 5KYUA 2JGKA 3RBVA 1C1DA 4YMWA 3E35A 5KSPA 1DFGA 4TV9B 2XE7A 3E22A 4F3CA 2XECA 4QQRA 3AFHA 4CM6A 1SWVA 5FTKA 4IGAA 1T0HB 3MMXA 3HKEA 1K08A 2C29D 3RTEA 5DEIA 4QDKA 1HFKA 2FPIB 1GG5A 3VYRB 2ZDQA 3D4BA 4P4SA 4WL0A 2V98A 1II0A 4TZTA 3FPKA 4BQOA 3IKJA 1SD1A 4L3OA 1MJGM 4C0JA 3IFSA 2Q5QA 3NHAA 3ZGNA 3CN9A 4N01A 5CYOA 5B58T 4EF6A 4LDPA 4EVRA 4MIKA 1FBTA 1WXEA 2LPMA 5FYQA 4EGFA 2O0HA 2H1IA 4EBFA 3LL4A 3IAM1 5CT8A 4EJMA 4UREA 3C7AA 4AMUA 1K9SA 4I55A 3WJ1A 3ZE8A 4URFA 1U6JA 4QEKA 2V7QD 1E8DA 2BGLA 4JSRA 1O8BA 3R6DA 1XDDA 3RUCA 5A02A 1HSOA 2A1UA 2J45A 3Q72A 3RQIA 1IBKB 3JQ7B 4FE4A 1WMAA 3UHFA 1YZUA 3I04A 1UCFA 2EFJA 2P9FA 1XV5A 2CBZA 3OT1A 5L7WA 1H0KA 4U2EA 3S2GA 5DNAA 3TZBA 5BY2A 1DCJA 3DF9A 1PN3A 3TZCA 4DR5B 4ZAFA 5IYZF 2P4UA 4RMGA 3SVLA 1CK4A 3OSUA 2JASA 3GLKA 2QY6A 3D5TA 1QGOA 4G8DA 1MIOB 1OREA 4BNUA 1XQYA 4PSVA 4AO7A 1F8XA 1LI7A 2QRJA 5D7BA 5L3SB 1W34A 4WK6A 1HC7A 4BN4A 4CDRA 4AQYB 1CJMA 4LJLA 3HABA 1Z39A 1G9XA 2EKPA 2LDBA 5EWLB 1RBMA 4BUCA 1Y81A 2QI9F 3FLEA 4Q21A 3PDJA 4WNAB 2XTJA 4YP7A 2BEJA 4JWTA 3WNCA 4RSHA 3T3MB 2FQXA 4EL0A 4KO8A 4OPMA 3TI7A 4QUBA 3TBKA 3WNBA 4HZIA 5EZ5A 4DGSA 1M66A 3NIBA 3FCYA 3R3VA 3W5BA 3QUCA 4IKEA 4HZUB 1W4AA 2IVFA 4JOBA 5TPWA 4KQ9A 2EBHX 4N0EA 1YR2A 4CMCA 1T5LA 4UU0A 1WW3A 2FQQA 2EKDA 3LX4A 2YXDA 3N3BC 3PNBA 1BXZA 2BYTA 2GCIA 3DR3A 4CXMA 1MEJA 1BFDA 1SHZA 2XB9A 3R3HA 4LXIA 2RIPA 1IFXA 2JGJA 1LWNA 4G9EA 3EF1A 5AW4A 1X1AA 3BOSA 3FLAA 3LX5A 1XF1A 5LXTF 3R07A 5CYFA 1XEXB 1HSZA 2FCAA 2J5KA 1PHRA 3MRSA 4RF4A 3U56A 3TRJA 1N3BA 2NO1A 1DKPA 1YIOA 4BGDA 4OQLA 2K4MA 3CNEA 1VDZA 1Y1LA 2P4HX 4MAAA 4Q1DA 4YA6A 5L53A 4MWGA 1LLUA 5K3CA 1Z2OX 1ZD2P 4BEVA 1AQNA 3O2SB 2B0CA 3EOAI 1I7SB 2UUAB 1DJQA 1T13A 1IN5A 2ZTLA 1WUIS 2V0CA 3ZV6A 1FJGB 2HMWA 4XWOA 2BGTA 1LZKA 1IWPB 1SG0A 2POQX 4WFIA 5DLPA 2QMYA 2HPAA 3D6JA 1SGWA 1HE1C 5DU2A 1YRBA 3W2EA 1SKBA 2HA2A 4P4LA 2WV7A 3RRNA 5C8DA 1IN8A 3Q6IA 4F2GA 2JIOA 3ZJVA 1XTQA 3CKLA 5L9AA 3H4VA 5IXYA 1B7GO 2PWZA 1BAPA 2JKVA 2RJOA 1X7WB 4IHAA 2QTGA 3B7WA 5K4HA 2PJDA 1ABFA 3KKMA 3N7UA 4UQPA 2A88A 2FR0A 2YVLA 3T1OA 2ZIUB 1OFIA 1LDYA 1TFRA 2XNDD 3H5IA 3QKRA 4S2UA 3VR5A 4CLEA 2R6FA 5CXUA 1AV6A 1X7ZA 4B31A 1ZP6A 1J5EB 3E9CA 1PFKA 2DVMA 3CX4A 3HJBA 2C3MA 5JZ9A 1ZJWA 2OGWA 2PSDA 1GRQA 1NIPA 4L4XA 3EG9B 3PCXA 4XD2A 2VYNA 3RVOA 3HXVA 2DFLA 1DBWA 1TVCA 3B3AA 2RGNC 1M75A 2VJPA 1TYDE 4ND5A 3L7AA 4RVHA 2QR5A 3C1OA 2IYVA 4Y1FA 5B5SA 2PUWA 1WSBA 4HT3B 3AF6A 1X70A 4ZJPA 5B3LA 1DZIA 1RWVA 3VR5H 2V0NA 4E08A 4TL8A 3BILA 5F1OA 1ZJZA 1JB1A 1P9LA 3O8QA 4YJHA 3AF0A 1PX0A 1JR2A 1ZCAA 3C3MA 5I51A 2FSPA 3FTDA 4I5IA 4D6YA 5J5AA 1MFZA 4KLNA 1PVDA 2WG1A 2SCUA 4NBRA 2WYWA 3KKNA 4IM7A 3GLIA 4W7HA 2OUIA 2EHDA 4MIEA 3BZUA 3NBQA 3OTQA 5JVDB 3UKDA 3WICA 5FAXA 3BQ9A 3F7TA 2ZUSA 1U7PA 1OGIA 3CVWA 3OZUA 3UATA 3R9XB 3UYKA 1M34A 1Z15A 4BX2A 3M2PA 4PPGA 3M0EA 1J06A 4UC0A 5SZIA 4WESA 2ZW9A 2ZRKA 4ZVNA 1BZYA 3DYBA 4M0MA 2FSFA 1QANA 2AJBA 1KC1A 1Y6QA 5CUQA 4BRZA 5F7OA 1DOZA 1VYVA 3BPSA 4LWOA 4MWEA 5HCNA 4AJPA 1OH7A 5CFPA 4ZCPA 2Q6LA 2FFHA 1N9ZA 2I6XA 2WAYA 3L0BA 3ROXA 3DFIA 3UJAA 5KINB 1RMQA 1XG5A 4C2AA 3GLIE 2YJ5A 1YFLA 3CUEF 1JSXA 3OC6A 3O4GA 4V39A 3GIWA 4GOMD 1NMQA 1PJCA 1YFTA 3SVZA 3UAOA 4POAA 4HXYA 4LTNA 3S7TA 4M99A 3D6MA 1M34E 4EGSA 2SBTA 4E5PA 3TDNA 1MCZA 1YA8A 1BVUA 2HZBA 4XIIA 2HM7A 2RJNA 4OVKA 3C8DA 3JX9A 4R1SA 1X8LA 2H07A 3H99A 4F12A 1BH6A 4NJMA 1SQGA 1J33A 5B6IA 1L8QA 2FK7A 3NCTA 4QC2A 3U3RA 2ZXEA 3TTUA 3WRXA 4DC1A 3W5IA 4HWGA 4JB0A 5EHXA 1USKA 3BAFA 1US8A 4B7AA 2QGNA 4K9MA 1V11B 3C8MA 3ZR4B 2E3JA 4GZLA 1FP1D 1U31A 4TS1A 3RKWA 1HTBA 3WWOA 2QLMA 3ZCQA 5G3ZA 4Y2PA 4LQDA 3AP3A 1NG1A 5F3DA 3RROA 1WM1A 2E4VA 2DJZA 1K89A 3LPLA 5E38A 3PQ7A 5BQ5A 1MU0A 5JLAA 1N2ZA 1SURA 2AEFA 1F6WA 1I6LA 1U3UA 3HRKA 2B2XA 2ZUCA 3GYGA 3IBFA 1XFDA 2MSWA 4J7CA 2FFAA 3WLTA 1JEEA 2KI5A 3DJYA 3DT9A 3QBDA 2UUBB 4FBLA 4E09A 4MSUA 1XRPA 2JGNA 2Z95A 4A0QA 3EGXA 3IDQA 3DL4A 1WY5A 5B57C 2O7RA 1A2OA 2ZJ5A 1CDDA 1PSDA 3WBJA 1JDSA 2O50A 3CCCA 3FDJA 3L0OA 3PP8A 1E6UA 1HE3A 2EL9A 3OQOA 1E7MA 4UVIA 3E5MA 4BO2A 2IUYA 1E58A 1E6MA 3S3TA 4CM9A 3OPYB 4URXR 1E6WA 3AOEC 2XA2A 2VP0A 1L5NA 2QSZA 2BMWA 1GFIA 2I87A 5BYJA 4DHWA 3RYCB 4PFQA 2ZPTX 3HBAA 4NBVA 1DKUA 1FNDA 1ZRNA 2VNJA 4UVDA 5EY5B 4DQKA 1U5BA 2HU5A 3AY7A 5DB4A 2EWMA 4ZU6X 2IV3A 4R2KA 2P2ZA 3VZQA 3T4XA 5IXSA 1I5RA 1P80A 1UJ5A 3ILHA 3FOEC 1UOOA 1E24A 2P0LA 5BN5A 4ER3A 1W94A 5FOXA 3RABA 1U0JA 1OXBB 3ZK7A 5AM2A 2P90A 2YV4A 1B8AA 2G08A 3R5SA 1NVWQ 1XNGA 2HYDA 5AK3A 5DTIA 2K2QB 3CEHA 5DNYB 3I3SR 4E21A 4MPDA 3NDIA 1DC8A 1Z38A 2Q2OA 1K4YA 3E70C 2ZSKA 3W6NA 2YNMA 1J00A 3D4LA 1DBIA 4F85A 1H9BA 4NULA 4WKGA 3WDKA 1DTWB 5ITSA 1IZ8A 1E60A 1OLUB 2J85A 2WMYA 4M1KA 2YRWA 4XOIA 1X80A 3CZAA 1W96A 2QHSA 4Y98A 4D8UA 3CMMA 2LN3A 1WLEA 1HMYA 1Z12A 4MI6A 2DBYA 2XQGA 4X60A 4NCAA 1BIFA 4DPMA 2Y2UA 4HVAA 2VJAA 1IXZA 4FMDF 1LB1B 4FCVA 4O6VA 3E58A 1XF9A 4BVGA 4O59O 4YQFA 3KYIB 1A9YA 2I2XB 4L4ZA 3K9FC 3H75A 1XIVA 1FS6A 1XZCA 1E4OA 2XUAA 2JCSA 2GPBA 2JGDB 5DYWA 5BW6B 2RBKA 1QE3A 1YIAA 1K8QA 4F1JA 1V7PC 2QZZA 3E3LA 3REUA 1O7JA 1RYDA 2IY9A 2O2HA 3DOUA 4BGEA 3E8XA 2WWXA 3UH0A 1SN7A 2P3OA 2VNSA 3V1YA 4P33A 3I9FA 4OK6A 2EGHA 5JAQA 1IXRC 2C0PA 3KJEA 4AQ7A 2HRZA 3I2JA 4I99A 1E5XA 1LBTA 2PKWA 3E9DA 4Q3NA 4TL7A 2R85A 4DT1A 1IN6A 4LF7B 2GTCA 3A9VA 3MG9A 5ALRA 2ZIXB 3VKFA 5CM2Z 3DSRA 3RJTA 1W76A 3ZDZB 1PLKA 1V8FA 4QRIA 4PLYA 4MGYR 4WXPA 2R48A 2K6GA 2P9QA 4BX9A 4EY8A 4ZOCA 3I1JA 4R3UC 1O96A 5MGNA 3UMCA 2DPXA 3E15A 4OGGA 1QDUA 3L7NA 5DW0A 4RTQA 3MWLA 3LBAA 5CA0B 2FPPA 3F8TA 3GUUA 5LDHA 4KJXA 2HT1A 4CQMB 4QTXA 2OLJA 1GAXA 2EJGA 4AJNA 1WS6A 1PWHA 5COQA 1N32B 4FCWA 3CX7A 3CGGA 4TMYA 2ZAIA 3U4QB 4UUNA 3NEMA 3EFBA 3EEOA 3NDJA 1SY7A 1FFXA 2O2YA 2GZAA 4KNYA 3MCAA 3PSHA 4NABA 3UHOA 1TJYA 4KHPB 1KTVA 4RK1A 1HE4A 1R0SA 5CA1B 5CD9A 1KVSA 3TB6A 1PRYA 1U8UA 5C7OO 7GPBA 3VJLA 1ZOOA 2HMUA 4L50A 2QX7A 1TQ4A 3B8EA 3K0FB 4HQOA 4TTVA 4U5QA 2D4HA 5E4YA 2FWMX 5HDQA 3KKZA 1M1ZA 3K1YA 2C5FA 2Q6VA 2P65A 1Q11A 3EN0A 3JYOA 3DHNA 3WNVA 1DBVO 3WK9A 4ZZ0A 5DOVA 2BN4A 2KLHA 3ZNQA 2R1ZA 3B70A 5DNEA 2AQHA 3CRRA 1STOA 5K20A 3W9BA 3BEDA 1LPNA 5I7SA 3HN6A 5K8LA 1ZUNA 3VNUA 2VC2B 5A5VA 2BEVB 4CS2A 1PYGA 2C0QA 1NP3A 3C3XA 3QUAA 2GUWA 4NBWA 2Y9MB 3K5IA 2XMBA 2AYZA 4LQ4A 4RM2A 4H1VA 1E66A 4KQ2A 1VB3A 3W5AA 1SXJB 3UGKA 3WQBA 4PR3A 3VR5D 4A8TA 4F9GA 3AETB 5L7TA 3HYTA 1YL7A 1N2CA 1M1NA 2WUGA 2O5VA 2D2XA 3NOOA 4BIIA 4QG3A 1ULAA 3DAPA 1UJ4A 3A4MA 1DC7A 3LRXA 1Q0LA 2YWJA 2VYND 3ZH9B 1ISGA 3TOCA 4FX5A 2ONCA 3MJ4A 5DBGA 3ROZA 1KNXA 1QKKA 1R18A 1ESCA 2QU8A 1AQ6A 2CL5A 4Z7JA 3LPNA 4R3WA 1U0SY 3AQ4A 1OVMA 1R6DA 2C5AA 3AR8A 1VYUA 4E14A 1XD2B 4FGWA 2PJRA 3H2BA 4X6UA 1Y9DA 3RTCA 1FRZA 3VVCA 4JI8B 4FR5A 1BXGB 2PV0A 1EUDB 2Q5CA 3I1FA 4NHEA 2YN4A 2WF5A 2Q9AA 3A36A 3ZD7A 1N2CE 2X2FA 1UBSB 3FNBA 3H18A 1T6XA 1C7ZA 1E1NA 1AXEA 2ECOA 3B36A 3JWHA 1ECPA 3K35A 5BMVA 2F9FA 3CN7A 4M1ZA 1VTKA 2Q4BA 3LUCA 2OAGA 3ZHOA 3SYLA 4W5TA 4FHEA 4K6GA 2HRRA 3ZDBA 4KXWA 5K0GA 4WI1A 1K5DA 2Z56A 4JLNA 3ZWXA 1Q1AA 1P2BA 4H15A 5DCYA 3FSRA 1P62B 1RKXA 5AQ1A 1E0AA 2ZYGA 3UMMA 2J0QA 1GUAA 1TZBA 2ZRDA 3MLBA 3AR4A 3JQFC 1CQXA 3OY2A 4LHEA 4PIVA 5AK0A 2XB2A 1EDZA 5HGQA 3V8KA 2EF0A 4TZ0A 3P2OA 2V4ZA 1JBKA 3KXPA 3RPEA 2ECQA 5K05A 1C14A 4L0DA 4ZCTA 2AMCB 4HMQA 1ULUA 2GBLC 4X66B 4X7PA 4KU4A 3NWJA 2FSGA 4B2LA 4HUQA 3HY3A 2VCYA 4QOFA 1NNUA 3IPRA 3SXUA 1PFUA 3RACA 1SA0A 1RQGA 4UU7A 3L7IA 3EOBI 1I13A 4MQEB 3ME5A 3NATA 2EXXA 4PNPA 4II3A 2KBFA 1IY1A 3FVRA 3GGJA 3IBYA 3R3UA 2EW2A 3U26A 3A1VA 1RI4A 2YVUA 1TFUA 1ZCZA 1QC5A 4KN5A 1UPFA 2FPSA 4RTRA 2Y93A 3OQPA 1L4KA 2XMRA 2XTZA 5IAEA 5F21A 3GMSA 3AHDA 5KTOA 2V3VA 2VQFB 1F8UA 1XX6A 1YI8A 4D3DA 3L46A 1L4HA 1VLMA 3L1AA 2ADFA 2I76A 3MFYA 3IQHX 4NZZA 1NUHA 3B3JA 1FP2A 2NQ8A 3P9IA 4V0KA 4JV5B 2FPUA 2ZGVA 4HEJA 5BOVA 5I7RA 3GJRA 4OL9A 3FCXA 4WZAB 1YFKA 1LW6E 1V43A 4S1NA 1Z7EA 4WBNF 4UATA 2R4UA 3EEBA 1XR3A 3AJRA 1U2RA 1PFWA 3P0RA 4FYPA 2NSJA 2DQ4A 1NR7A 4RKFA 3AEYA 1SCJA 3FWNA 2E4UA 1DAMA 5DHPA 4CL8A 2XCRB 4LFCB 3UB4A 1QGZA 2PUHA 1OTYA 2NSLA 1WB4A 4GZ5A 4B35A 3D8RA 1P1BA 3W2HA 1MA3A 5JANA 1WDWB 3N2GB 3P0FA 2PJZA 3VYTB 1PK9A 2P5IA 2WABA 4OFBA 1SXGA 2RFLA 4I1VA 4KUGA 3DM9B 1EIYA 2BWJA 2K5UA 4BVAA 3W79A 3HN2A 3OQ6A 4P7GA 4ZEWA 3IAXA 1XZQA 4Y0NA 1CQIB 2XMDA 4I5FA 1C81A 3QFRA 1SBIA 2R8XA 2G8NA 4ABTA 2JFBA 3K1AB 5L6LB 5HZMA 3GCWA 4UD2A 3TRKA 4HTFB 5BNIA 2QTMA 4XFDA 4MIYA 2EFCB 2QE6A 4QUKA 4GMDA 3V6MA 2MTBA 3AEQB 3TNJA 1KI6A 1KYTA 3TMKA 3HSYA 3KRTA 1G6HA 5KSZA 3OF5A 3EXEA 1AQIA 4PO3X 5EIHA 4ED9A 1VE6A 3RYHB 2AT1A 3G23A 3NP9A 1GTG1 4JELA 2C04A 1E20A 1VBMA 4L5BA 2YNMD 2CUZA 2AIRA 1GTMA 2QX6A 2I1WA 3D59A 1GZHB 2UV8A 3EVDA 2GM3A 3E1KA 1A9XA 1B70B 2Q2QA 3HWRA 3JZDA 4JYBA 5F7XA 2DQYA 1QX3A 3FIUA 4TRMA 5EXSA 4OGFA 1HDRA 3B1VA 4LFBB 2W2KA 3QXJA 5TS3A 1VL1A 3BHJA 5EE3A 1G7CA 2GRAA 2VTBA 2E55A 3GEMA 4IZOA 3JQRA 5EJ4A 5AJXA 4CFZA 1CEQA 5CB8A 3A9TA 4V3BA 4NONA 4ZC8A 3NS7A 1G20B 3F9CA 3M5DA 4QOIA 2PL3A 3PI6A 1QHYA 1SU8A 4XIJA 5C52B 1YA4A 3FIJA 2ZUBA 5IAGA 3CZMA 3IBTA 3BWEA 4IILA 5BQ3A 4TUYB 3OQJA 3TOVA 2AN1A 4HGPA 4UUAA 5C51B 4Q02A 5I9TA 4FP9A 1T2UA 2ABWA 1EINA 3TL6A 3U81A 4ENPA 4XD7A 5FEUA 2OV8A 2RONA 4IIYA 5DE3A 1SHKA 2Q4EA 1XEWY 4QFCA 1HURA 2BFOA 3C7TA 1D2GA 1YQQA 2FOXA 3ETDA 3K15A 3NXSA 4JJ7A 1HKHA 3B1JA 1V25A 3OPNA 2AFIE 3GRRA 1BGWA 3ETCA 4CKEB 2MSCB 4R54A 3V34A 4L5AA 3B5IA 4QU5A 3VU9B 4RV4A 2DXTA 3LGSA 3NRBA 1UT5A 2H92A 2VT6A 3GT4A 3I6YA 3K2BA 4W6QA 3WQQA 2HWYA 1OUMA 1C3EA 4MGKR 1BS1A 3BSYA 1ST3A 4EYSA 4GEGA 4OUKX 4EM6A 2GVNA 3BIFA 1T4CA 3U80A 3SG0A 4MWBA 4BFVA 3C6KA 1QXSA 2NU7A 3IKMB 3HA5A 2GN2A 3HZOA 2IOYA 2FFBA 4JBNA 1N1MA 4NDZA 4YCDA 2BTQB 1RQ8A 1ZISA 1ZIDA 3BK7A 4DJ5X 4PG8A 1KS2A 3FHJA 5K3FA 1MPXA 3CO5A 3ZNNA 4ENVA 4N7RA 1V5GA 4WJLA 3C4QA 4XYLA 2Y0EA 1IATA 4Q3KA 4GM4A 2BMVA 2ZKIA 3QELB 4I19A 1BROA 3A7RA 3QOXA 3T0GA 1UJ2A 3V1MA 2P5YA 4CEJA 4YC7A 5BQXA 1XLWA 3L7OA 2H51A 1GA4A 1EQAA 1SC4A 3GP3A 1C9DB 4IRMA 3CW8X 3KB8A 4JBIA 2CUTA 4FYJA 4ZHQF 1U04A 2VHUA 3FGPA 3QWIA 4PNEA 1LN4A 3INRA 1ISRA 2BKEA 4XU0A 3IE0A 3PPIA 4W4TA 4C5BA 4NCIA 1BQ3A 4R8RA 3AKYA 2C00A 3R6TA 5K3OA 4JXZA 3KE9A 4M8SA 1O6BA 5AUNB 3GFQA 3O8LA 2OTCA 4ZTZB 2HLHA 3DE3X 3NDPA 2X8AA 1KO7A 3O8BA 4JT8A 3GGCA 3V4FA 1H0XA 2DU5A 1DAHA 3D02A 1R8JA 4OJMX 3V55A 1KEWA 4MV4A 1BS2A 2VDQB 2L82A 2M1XA 2QG9A 2PZEA 2AZ4A 1FRFS 4RZ2A 5F1PA 5LP6A 3IUEA 3JS5A 4YV7A 1E6EA 1BGVA 4FVTA 4FZ3A 4Q4JA 4K88A 2PO5A 3HLYA 4MDHA 5BSUA 1RI2A 5JATA 3ND6A 2Y0PA 4WN3A 2WJ3A 2ERXA 1KIFA 3LUJA 4C6SA 3CNQS 1Z68A 1THMA 1XPUA 3BD9A 5IDVA 4QUAA 5I6DA 2EFHB 4C87A 4V2UA 2VRWA 4H7HA 3V1TC 1XXLA 4LC0A 5BN4A 1G7RA 2WOOA 3ANTA 2RHRA 4DMMA 2IOHA 3B3FA 3CU5A 3D81A 4OK3A 4DCGA 1ZOSA 2W11A 3SDSA 2PSEA 1Q74A 5BUQA 5EP2A 4KOAA 3M9XA 2JLQA 3MF1A 2WYIA 2Z8ZA 2LBPA 4NIMA 4NU0A 3EIFA 4V0LA 2ZYWX 1XSEA 5LU9A 4J07A 1OIVA 4X9XA 1NJ2A 2ZS7A 3BEOA 3SWWA 2X14A 2FLVA 3AY6A 2CE7A 1MABB 2DFVA 2B3TA 4FSDA 1NW6A 4LXGA 5TT1A 3U4AA 2RJ3A 4AZSA 5KYYB 1RI1A 1Z4JA 2DQSA 2XMCA 4P6VF 4PAWA 4US1R 5IT9A 2WD7B 4OHZA 3OLZA 2G0TA 3B12A 1UK8A 5A9SB 1DZ3A 2CYCA 1G0NA 1B7YA 4RGBA 3UXEA 1DKOA 1M8FA 1VPVA 3A6EA 4NMXB 5ALWA 5HF5A 2VHTA 1A88A 4C01A 5CDGA 2PBZA 5LOVB 2ZZKA 3K6KA 3IO3A 1Y33E 1IBCA 3O21A 1AKTA 1NNI1 1GLGA 2I4RA 4NZPA 2XDAA 4KBGA 5B1IA 1L5WA 2MINA 4O4LF 1CXZA 4OEHA 3TM5A 4RNCA 1GRRA 2QD2A 3BRQA 3WRXC 3L1VA 3OEYA 4LYFA 4D8XA 1MAHA 2QMZA 4G63A 2WTEA 3USCS 1SC6A 3M4NA 4LGYA 1BW9A 1AE1A 4JBXA 5L3VA 3GU3A 2VDUE 1OAOC 4EEZA 4EDFA 1RRGA 1A2QA 2QB5A 4K9LA 1YU9A 3EDYA 2IU6A 2CCGA 2IXTA 4O4IF 4ZT6A 1U8XX 4AWBA 2C5EA 3ZHXA 1JJ7A 4EG7A 4YP9A 1MZPA 2ZJFA 2X7HA 4LTMA 5M34A 5E9QA 1V26A 4POOA 4TSKA 3AF1A 3M1YA 4WZZA 5E6RA 5AM0A 1G9TA 1RZVA 4M0CA 1CW2B 3I4FA 5AYVA 3VZCA 1A0OA 1ATZA 4EFLA 1XE3A 2X8BA 1FSFA 1Z13A 3NAZA 4US2R 4RELA 4GNRA 2PFSA 4LJKA 2W9XA 1A7AA 2ZEJA 5CHEA 4A1OA 5ADHA 1YZQA 3ZLUA 3KG2A 2AEMA 3EZGA 2E5LB 3FPAA 1TM1E 4EO4A 4BUZA 2BKLA 4F6LA 2J3EA 3TLZA 5LM3A 2ALJA 3GY0A 3AEKB 2WQ6A 4BEBA 1XDSA 3GDOA 1BE1A 2YRXA 4FBKA 3VYVA 4O2BA 3D3KA 1FZQA 4W99A 2PVSA 1DCFA 2J5XA 2HSJA 3PQCA 3KUCA 3HVHA 4R8VA 3PHHA 1YV9A 1X2GA 1P4HA 4H9GA 2OK7A 1ZEJA 4W5HA 4DLXA 1C30B 1TD9A 5HJ2A 1TPZA 4RF2A 1G3MA 1MXFA 3L84A 3UM9A 1HY3A 2B4QA 3VVMA 3W7BA 2HBYA 1UBMS 3N2ZB 3LKZA 2WUEA 1F14A 3EB9A 2OPHA 1CZHA 1RYZA 2RKWA 3UT6A 1L7XA 4E5YA 5CXSA 2CNOA 1NBOA 4IZIA 3UMSA 1UXOA 2QN9A 5F2EA 5KC9A 1E7QA 3O03A 2OM6A 4QKQA 2DP4E 4DMKA 2PX3A 1TO2E 1YR6A 4O2RA 4CIYA 3VKUA 2OMEA 2VI5A 4JVNA 3VOSA 1ZAYA 3H1FA 4I55F 1W75A 3II6X 4LPSA 1N5DA 3GCDA 2GEUA 5IJWA 3NVKI 3HXZA 4TQAA 4GU5A 1DGQA 3DG9A 3N5CA 4K9SA 4ZEXA 5KWIA 4CR7A 1WTCA 5CDFA 2JATA 3VHQA 1OV6A 4RFSA 4AY4A 3LUFA 2ATCA 2CNNA 5B4VA 1CRZA 2ZB2A 2NZ8A 1D0VA 3MQ4A 3P0HA 4BHTA 1QLJA 3BGDA 3DXYA 2Q7HA 3CB4A 5HS6A 3KNZA 4B3SB 1CRWG 4D9CA 1OWMA 3MRXA 1Z0IA 2ID7A 4QUEA 2R1UA 3P2MA 1YMVA 2ON6A 4A0SA 2OYRA 4EKIA 3HO1A 4IGEA 2X41A 1G5PA 1QGUB 1U2ZA 1RTTA 2EFGA 4Y2HA 3U3JA 3MMNA 1OFTA 3W0LB 5CDUA 3A1WA 3FZYA 4MUEA 4UARA 2YFHA 3WRWA 5BSVA 1G8MA 4NOLA 4MULA 5CGZA 1YGBA 1VGRA 2B7CA 3ASZA 3K0CC 4KO1S 4H2DA 4MYTA 1PGOA 2FU5C 1CUZA 4PCLA 2OEPA 2PWBA 4QQ8A 2GWHA 4L1KA 5CT9A 2BCJQ 3SZGA 4ZEVA 2Z6UA 2YOHA 1WHTB 1ZH6A 1KEUA 2E6UX 2J9FB 2ANBA 2O3TA 3CLHA 3CLVA 4XD7D 4MB2A 2ZRNA 3GK3A 5B1DA 4Q19A 4B6RA 1GA6A 4ARZB 3JARB 3DO6A 3G02A 3SOPA 2ZWPA 3WL3A 2ZIAA 1SIBE 1SXIA 4M49A 5EZ6B 3TZQA 4KHZA 4C2TA 5F77A 1GL6A 2BJVA 3BDVA 4QEZA 2ALYA 5LKRA 1ECBA 1TECE 1I4TD 2FDXA 2YHBA 1T9CA 2FRXA 1E77A 4MKZA 3IIEA 4QPCA 2XXJA 1QHXA 2EX4A 4QFBA 3EVTA 3A6FA 2C84A 3AHCA 4JKYA 3S68A 3CRZA 2AC4A 4DCOA 1X7GA 4UHKA 1NMZA 3I30X 1E63A 1ONOA 1ZIOA 1XNQB 1L7BA 1QNLA 2W58A 2DX7A 3WWEA 1YULA 1UBEA 2CGEA 3UGJA 4Z7QB 1V96A 3PGLA 4BFSA 1I9GA 1PS0A 3K31A 1OB5A 1UKAA 2BCEA 3HR4A 2C7OA 2GI4A 4MARA 2PPLA 3LQ4A 3R77A 4Y2GA 3V8QA 5KQGA 3ER9A 1PNRA 3EHEA 3CMCO 1ZESA 1JECA 1U8EA 1YZYA 2G9RA 1GHTA 4F9EA 1DX6A 3IP7A 5IJZA 2AF4C 4K9PA 4DLBA 4UTXA 1QHGA 3FPBA 2OHXA 3L8CA 5KQLA 3K1TA 3Q9UA 1E69A 5H0IA 1O87A 3VSAA 1TLLA 421PA 3LLMA 1SVLA 4EUNA 5TQ0A 3ESRA 4BQEA 4YMHA 3R5HA 2WR8A 4JI5B 1YVUA 3ZCXA 4LX0A 2I7DA 1N8NA 1TZ2A 4Z54A 1U99A 1EVYA 3NHSA 1H0RA 3PNOA 1OV4A 1GKUB 2AN9A 4K6OA 1WQ3A 1DC4A 3T5DA 4W1SA 3X2EA 3GA0A 3N0RA 1OBCA 2IZ7A 3KEMA 2QHVA 1IHOA 2W4MA 3DV9A 5I4KA 3I2YX 5ENZA 4E12A 3ICEA 3PR1A 4EA6A 4DLSA 2P68A 3JW8A 1FW8A 2XJ4A 4B76A 3JQDA 3L8HA 2MDTA 3PF8A 2C2GA 1YS2X 5IBQA 1EDBA 1MVLA 3GIDA 5DBOA 4D79A 3BCSA 4PX3A 1MJHA 1ZW6A 2AG6A 2WDZA 4G24A 4MROA 4QHTA 1D2AA 4WADA 4RIHA 3RRFA 4CU5A 3I0MA 4DSUA 3TFOA 3PCOB 1TD1A 3OA0A 2VJKA 2C9DA 4HEA6 5B1SA 3PGKA 4MTCA 4BYGA 4DJDC 2TMDA 2F3QA 2O8VA 3IUJA 1UC5B 3B6EA 4WXHA 3P27A 4E30A 2WM9B 3KR2A 3GQVA 4LSMA 5IS2A 1VE1A 3DGEC 3LOUA 4XTRA 1GZ5A 1TJ4A 4GQBA 3RSCA 1Q20A 3CG0A 1Q3KA 2ZUTA 1XYGA 1ZMBA 1QH8A 2CEKA 2J1LA 3IEIA 5T6MA 2ECPA 2X8LA 4UEWA 2G83A 1VGVA 3RBZA 3KFLA 3LGAA 4F8YA 4PYIA 3NHYA 4M83A 1WR8A 4HJRA 2JDIA 3OO0A 1E2EA 2XZLA 3O6VA 4UD6A 5JBIA 2XYGA 5JSFA 2CLCX 4EB6A 4F8JA 1PAUA 1TGVA 5JS8A 1B4DA 4LVIA 1KKLA 3F6EX 3N75A 3QEMA 3I09A 2IBTA 4JROA 3C1AA 4LVLA 4RO0A 5LVAA 2BFBB 2ST1A 4EW2A 1NC1A 5CLLA 3I39X 4C76A 5KOHA 3QOWA 1NI5A 1Z33A 1RHJA 1IY9A 3PQ5A 3I83A 1E2KA 1KRXA 1ZJJA 2QLLA 5MF6A 4OJQA 3U7QB 3N6XA 2DOKA 2PLWA 5K5EA 1XNHA 2VDVE 4DWOA 1P5ZB 3B52X 2UYQA 1KEZA 2PGOA 3QQPA 2H4XA 1UMCA 4G0NA 4B7ZA 2Z43A 4HNVA 2QV0A 5FX2A 2NP6A 4D42A 1OXUA 1T2AA 5GJWC 5CLHA 1GUYA 2D1RA 4EZBA 5IZCC 4N3NA 1LKZA 3SQNA 3T12A 3UANA 5KS2A 1HETA 5K1PA 1ODIA 1PG0A 3LHKA 2WZBA 3QU2A 2QRVB 4C0AC 2OHJA 5DCLA 3KPWA 1T26A 3VU8A 1AC5A 1AURA 1GG9A 4KL8S 2BE7A 3THXA 3A31A 1GCGA 1Z7NA 2JBAB 4YX9A 4XTZA 2VUIB 1IOLA 5EJMA 3E9HA 2FYKA 3COPA 3HU5A 3LCVB 4ZQIA 5ENVA 3DUFA 3F5QA 3LC2O 4ZTBA 1TQHA 3UT5B 3HYCA 3ZLTA 4D3ZA 3SX0A 4AJHA 2GM4A 3ZGYA 2ZYIA 2CXUA 2O2JA 3BTVA 4KDRA 3UHPA 4DDTA 3A26A 3COVA 3X0DA 4GGMX 2O0JA 1U2QA 4KFSA 2GR9A 5TGZA 2I8AA 4I1SA 3L9WA 4LPKA 4XQGA 1DC6A 4MHSA 4TQUS 3C3PA 5DI3B 3VNAA 2XNSA 3G2KA 4ZO9A 3ED1A 4Y0AA 1GGVA 3KOYA 4WGFA 2WIAA 3G0CA 2X4IA 4QHYA 3OLWA 3TIXB 4H2UA 1H42A 1E1MA 3UT0A 3HB5X 5TPZA 1XC7A 3IXLA 4BE4A 3G17A 3HJUA 4PIMA 3HXWA 1ZW1A 1S8NA 1NPYA 2VYVA 3V7YA 2I2DA 5K6TA 4M8IA 3TSOA 3W4KA 1FF9A 2QMHA 4Z4HA 1UBOS 4G0WA 4UUMA 1Y8CA 2D8AA 5KWVA 1NJ6A 1R6AA 4G5YA 4J8PA 1W5SA 1Z4KA 2ODWA 2OOSA 3D64A 3GP5A 4IIJB 4J4TA 3MWEB 2W6OA 4Z4GA 5CCBA 1YKGA 1OZAA 3EDQA 2C57A 2Z04A 1AQLA 3RYIA 1OGJA 1X8KA 5A71A 4CF3A 1NW3A 4HXEB 4BCCA 2P9YA 2FCRA 4YEDA 4I6EA 5IXJA 1Y3HA 3GNLA 4HRYA 5BP7A 1N9GB 3G13A 5I01A 2I3AA 4GP7A 4JLPA 1EGMB 5FYDA 1P4SA 1T6YA 3IP3A 2NQTA 2QVGA 3HB4X 1T35A 3KXKA 2VQDA 4ZK2A 3IOEA 4ZHSA 3A7EA 3VTIA 1EWYA 1YB5A 2YC2C 4FS3A 4HQNA 3ST7A 5JJBA 1BN7A 2O0LA 2VOJA 4OHOA 3SFTA 5A0TA 2COEA 1DIAA 5FF9A 4CWAA 1SFRA 1DKLA 1YGPA 4RTSA 2ZSHA 1DQYA 1M2HA 3UTCA 5KTSA 4MO2A 3KLMX 2P5UA 2BDTA 3W6UA 1F2UA 1RHKA 2ONKA 1LRKA 4Y2SA 1P5HA 4B6JA 1ZD8A 2WIBA 1OI7A 4MPTA 4IVRA 3DDWA 4K6CA 3PJGA 1NFQA 2Z98A 5F9HA 4JUAA 1KPHA 2OBLA 4IOLA 4Q1BA 1JDBC 2NO5A 4MS1B 1IK4A 4KMOA 4N5HX 3U3DA 3VNQA 4CTJA 1C80A 2Q1XA 3BWXA 3A2LA 4QL3A 5ESWA 4CGYA 2IZOA 5LQKA 3CUVA 4KG7A 5M5BA 1YJ8A 2DWCA 2PUAA 2AD1A 1CU1A 4UAVA 1I2DA 3PGVA 2BUAA 3SSOA 4DCPA 3CBQA 1UM9A 4TN5A 1KYYA 2XUZA 5HP4A 2B8EA 1EQRA 2YYAA 3K96A 4DEVA 1QBKC 1EUZA 4IDFA 1GLNA 3ANYB 4QT0A 5BR4A 4C7JA 2HOQA 3QLTA 4TTSA 2Q8QA 4Q16A 1AHPA 3CRVA 5TGDA 3DD5A 2RAUA 2XDQA 4NARA 3VTAA 4DQ0A 1J2EA 1OCEA 1UOPA 1XU7A 4BWAA 4UAUA 5BPFA 5CDSA 3A1FA 3ZU4A 4DIEA 3L2ZA 2XCLA 1DTEA 5K3BA 3FZQA 3C4VA 2AZTA 5DK4A 3RFXA 1EK0A 4X54A 2F90A 6CHYA 1PBNA 5J63A 4ZVSA 3OH8A 4NNOA 1YS6A 5EPUA 5M3BA 5TR9A 4IHJB 4BN0A 4MUJA 4ARIA 4TM7A 5HFJA 1CWUA 4CV0A 4AX8A 1UZAA 2V8BA 1OHHA 4C1NA 1TF2A 3AJ8A 3UJDA 2WAAA 4BNNA 5B3JC 1FFEA 2EJVA 1GFZA 2OENG 2Z3VA 3IEPA 3IQEA 3AJ9A 3E9YA 3QMPA 5T5QA 4QXAA 4OJTA 5DIZA 3UAZA 4O1IA 2JLRA 4RACA 3AI2A 3A9RA 2XLCA 4JLSA 4TVAB 1OOEA 1DXYA 3BL8A 4QTTB 1DAIA 1RAHA 1NVMB 3PX7A 1QHNA 1TUIA 1ZBQA 3TRDA 1SCQA 3EFOB 2ZBRA 1HGXA 2OBFA 1ZKMA 4LOJA 3EFEA 4M89A 5ARCA 3DKPA 4D3SA 1U7XA 2E49A 4CH4A 4Z0NA 4DDUA 4FFMA 1G1AA 1MO5A 2I6UA 4N0DA 2E21A 2PT9A 5FORA 1SB8A 1JKIA 2II6A 4Z7NB 3P52A 4RZIA 1I94B 1UBCA 2AJDA 3NAMA 2WIFA 1L6IA 3P71T 4P4TA 5ITZB 1HRDA 1TMOA 4BIMA 4H17A 1ZCJA 1EHYA 1K27A 1J9GA 1ULHA 3H8JA 5EIXA 5EJIA 3W04A 1RIQA 2H9YA 1NXWA 1XJCA 1PJ3A 3QNWA 5CB4B 5EVJA 1L6RA 1X1BA 4K86A 5KIAA 3FYUA 4R2WA 2R7AA 1M6HA 2CLLB 2OR3A 4EY7A 2ZAOA 4FOLA 1K3FA 4Y7DA 3E9IA 2OV6A 1Y98A 4Y1RB 3RQSA 4Y9UA 3ZWKA 9GPBA 3I37X 2C8JA 3A3PA 6ABPA 1SUCA 4I2VA 3UJHA 5TQJA 1D6SA 2PS1A 3J7TA 3Q0TA 4YI3A 3MK31 3FWKA 3WKDA 1DFHA 4Q3CA 4HH0A 3D8BA 4K46A 5JAIA 3ER8A 2ZYDA 1JDQA 3ORHA 4M6WB 1I3CA 2DUUA 3SSAA 1RWXA 3SZMA 4CODB 4YP6A 4CN8A 3GXBA 2DPYA 3FUXA 3GEDA 2C8MA 2QIOA 4AMGA 3OM8A 4L0CA 4JJIA 4JIGA 4TMTA 4KR6A 3PWTA 4QGHA 1V9SA 2V7XA 4AG3A 1GUBA 1ZLXA 1QFMA 3GNSA 3QFSA 2V7BA 3DGFC 3MNFA 4P4GA 3IESA 1TYAE 4BPBA 2FSHA 2FPGB 2PZLA 1SKMA 2WBLC 2YJNA 1OXSC 5BMVF 2GVZC 4PG4A 3HE3A 4QRHA 5HS4A 2NTYC 4E5KA 3F3YA 4A0FA 3DTTA 3EUWA 2CKMA 4C6RA 1U4SA 2HMAA 2CJWB 2B78A 4CMIB 3FMOB 1D6MA 1ZDMA 4FCXA 4MLPA 3HM2A 1WY7A 5KU1A 2JDID 2YFKA 1S2IA 1R4MA 1S5PA 2EFEB 3B8HA 3LO8A 1KR2A 1TVKA 1KQGA 3U7IA 3ZKWA 121PA 4A5SA 4ISCA 1IEXA 2GO7A 1GKKA 2P7HA 2JGRA 3SJUA 2FZWA 4DMFA 2OXEA 3ZD9A 1W0KA 5I45A 3QBJA 4LWZA 1SAYA 3RS2A 3A6PC 1KK1A 3LVJC 4LY3A 3W8DA 3RGGA 1W59A 4LBWA 1ADFA 1ZGBA 2VWHA 3HWWA 3UAXA 2OCBA 1CE8B 2YTZA 1QHHB 1N33B 2F43A 2QNIA 4HAVA 4ZAYA 2G0AA 3LUGA 3WV4A 3GNQA 4CM4B 5C31A 1T9HA 3KX2A 4KB5A 4FHFA 1E7YA 4MA4A 3TEHA 3W7AA 2O7NA 4Q48A 4AP9A 1W87A 4X8LA 3NO4A 1RC1A 2D8MA 4IH4A 4JP5A 1R2QA 3ZDYB 1ZMRA 2ADOA 1WPRA 2ODBA 4P92A 4QGFA 3EBLA 1SUAA 3PE4A 4PPFA 3KJZA 3B85A 5JSUA 3NV7A 1ONPA 1VHTA 1SJ9A 1F2TB 4TXJA 1U28C 1LLQA 5GGXA 2Y05A 1XVUA 4P38A 4AJJA 2ZI3A 4EG4A 2V4MA 4HLCA 3GVXA 4FT2A 4OIFA 3ZQUA 2NP7A 3UK1A 4CKZA 2TMYA 5G4KB 3PA8A 1FUYB 3H1TA 3F9IA 1Z9BA 2MR6A 2W93A 4JGBA 3QU7A 3HJNA 2KBEA 3GRPA 3O1HB 5F64A 1W8DA 3CLRD 4I1OA 1DE0A 2Q7XA 1NVEA 3RRBA 1AZSC 4B5KA 5E0OA 3KOZA 2ZYUX 3NUQA 1NAHA 4L08A 5HDBB 1YQTA 2HQOA 3T1QA 4M9ZA 5FWXA 2ILTA 2A5FA 2FQWA 3W9UA 3OFSA 4H0CA 4RD1A 1BD3A 2JL1A 5CIYA 3IT3A 3V8NA 3NHJA 4U2GA 3V48A 5FWYA 2J7PA 1PL7A 2BUCA 2YXBA 2JZCA 1T4BA 5LUBA 1U5CA 1U1IA 2XQFA 3TGWA 5TPZD 3ZWNA 3QE9Y 1EE2A 2WSBA 3HB1A 2VYVD 1O0BA 1VDMA 1XVAA 3ROGA 2JFQA 1AKRA 3QZUA 3WLJA 2B8TA 2JIQA 4RCYA 3ETLA 3JD4A 1I2AA 3G7SA 2DWPA 1MGPA 4IINA 1B73A 4FYIA 3SDBA 3VUFA 1HNZB 4HD0A 5FBWB 3HC7A 1ESZA 1CUSA 4QJIA 2KJQA 1UWVA 4AQDA 3RDPA 3A32A 3J80A 2GGSA 4J1NA 1HNXB 4GX5A 1T0JB 2GLUA 3AU8A 2YJZA 3NR2A 3BE6A 2HNIA 5BSEA 3ROEA 1IRXA 2V7VA 5IJ9A 1D2NA 3PFFA 5HJEA 3MSCA 3G8DA 1E96A 5HMMA 4KDEA 3HXUA 1UKCA 2IYUA 5HIIA 4HS4A 4MQMA 1WSDA 4QT4A 3G7UA 4MP6A 4C6TA 4FFBA 1S8EA 1AGYA 5DNVA 5D2CA 5DGTA 1V48A 3T52A 1G8GA 1K97A 2QL7A 3OZ7A 4QAQA 5CPFA 4F4DA 4ZYTA 4EX6A 4XWWA 2JJ2A 3CXUA 4C3UA 1E7RA 3FMPB 2JGIA 4LZOA 4TQGA 1VLZA 3ACCA 2ZBEA 3AR7A 4R51A 4OAOA 4CCWA 1RWPA 3PE3A 3PKJA 1CHNA 3EGDA 1KXZA 3QO7A 3N7AA 2X6RA 4DIOA 1SBNE 3AVYA 3HKCA 1L4UA 1I14A 1UADA 3C87A 3ZBPA 4RFVA 1ETHA 5EZQA 3DDOA 2JIDA 2ZU6A 3AIMA 1VIYA 3C39A 4LYAA 2RHTA 2B6NA 4AS1A 4LJYA 4JK3A 2L69A 3PUIA 2DVEA 1C0KA 4R0VA 2EJUA 5J4YA 4YRLA 2GN8A 1N77A 4MI1A 1AXRA 2PZBA 4I4CA 1S8AA 4U0KA 5ALSA 1HDZA 4F4CA 2BHTA 3Q7TA 1JKJB 3H16A 1EFDN 2XQJA 1D03A 3VZPA 5TEWA 1QRSA 2C3PA 1E2IA 4CKWB 1Z63A 1Z56C 1FX0B 3FNHA 2E7ZA 3H13A 1REQB 3ND8A 3OIYA 3SU8A 3BE5A 5KPDA 3JV7A 4MW4A 3HA3A 3TO5A 4BV9A 3U1BA 1PR2A 1S9DA 2ZE5A 4Z9AA 2BMEA 2R6DA 5EZYA 1TEVA 4IWYA 3SCZA 3TQIA 5C1OA 3TF5A 1OE0A 1RD4A 2OZLA 1HLFA 1PR3A 4RTLA 1XB2A 3EMDA 1OHHD 3A9CA 2WJAA 2Z4RA 5JS6A 3TVTA 1DB3A 4EHAA 5HW0A 3RIYA 5IJ0A 4OM8A 3CVYA 3HTXA 4J2HA 3RC2A 1K5PA 3HUDA 4MRSA 4NYMQ 5T8KC 3TZEA 3LY9A 1Q0PA 2FWJA 4ZI3A 2QX4A 3CZ5A 3IODA 5F5XA 1OWOA 5FPHA 1QYDA 4EKNB 3LYHA 5HIKA 2XKKA 5DCUA 1QZ3A 4GMXA 3IVGA 3EWIA 3CH5A 3TDMA 4R71A 2CSXA 3SFZA 1UFQA 1IPFA 2H2AA 2QUKA 2R751 4IZHA 5KYXA 2ZU0C 4FQ7A 4KQFA 1JJFA 1B23P 1FDVA 4HNSA 4NAHA 4U02A 1KPGA 3QG1A 1ZOIA 4NV1A 1R9GA 3EXIB 5FI5A 4L16A 4DSOA 4ZOLB 5AXDA 5C0OE 3T8YA 1UBFA 5THQA 1KH2A 4F9TA 1JI0A 3D6AA 5IBPA 1EWQA 2C99A 3D4IA 1QJCA 1B41A 5IULC 3HCWA 5KB3A 2PZAA 2F9MA 1JXOA 2LCFA 2L18A 3AZOA 1LLDA 2H1FA 4FLEA 4KH1A 5FWNA 4UOZA 3NJ8A 5KYKA 2Q5HA 1O57A 2BD0A 3OICA 2QW8A 4L5YA 4QAJA 4TX1A 3V3KA 3LYAA 5AWFC 3VJMA 4DYHA 1T9KA 4MH0R 4ZZ2A 2PM8A 3DMFA 3MLAA 4HQRA 1P2VA 1DIGA 5FPPA 3D6TB 1CJKC 3JWGA 2A58A 2NX2A 4BX3A 4DABA 5KYWB 1AMOA 1BWPA 1I3OA 2CBXA 4DBLE 2GT1A 4OSPA 5A1TA 2P3QA 3HNRA 4YCUA 3OX4A 4IIFA 2QTBA 4N3AA 3JALA 4FE3A 3GJ3A 1J8FA 3RKRA 1TM5E 2ACWA 2A3NA 2Q5OA 1G21B 2CZCA 3ICCA 2KWIA 1N1DA 4MW9A 4RDCA 2DWOA 2QIPA 2QJOA 3T4UA 3HTZA 4OUDB 4XPZA 3W5CA 4E4RA 1Z8DA 3VQYA 2J8ZA 1RRCA 4I9FA 1E79A 2CLFB 2YDXA 2D2VA 3GGSA 5FTWA 1M2NA 3NPAA 4KFUA 2AFHA 2ZSDA 3GLHB 2PS9A 1WW2A 2I3DA 1OLOA 5EEHA 4D46A 1CP3A 1UIMA 5C4IA 1Z2CA 2QBYA 3ZWCA 1ABBA 1B2RA 1BHO1 1EUCB 1ECLA 1V9LA 5IMSA 1IZ0A 3OFND 4RSRA 4B09A 4BKOA 1SUBA 2VBCA 2FRDC 2DJ5A 2QRLA 4ZA2A 4QQKA 1Q6ZA 1Y4AE 1M5RA 1H2RS 2NZYA 4Z6KA 4M8LA 1SCAA 5E4TA 1TU0A 2XRMA 2A1TR 3TLJA 2X4LA 4ZFNA 4YHBA 1J2UA 3G5TA 4OBBA 3L93A 3WLSA 4C3VA 1W0KD 4MINA 1I4EB 2EK0A 2J3QA 4IUYA 4N54A 1QH1B 1ZGGA 3IPXA 4EPYA 5ITVA 1KFBB 5FBVB 1XTTA 4WCFA 1KXJA 3U7HB 4UDXX 5IT4A 4N6GA 1P5RA 1RPZA 3L0PA 4CM8A 2WJPA 1FUUA 4ZKDA 1V6SA 1J8MF 8GPBA 4P3NA 1LX7A 8LDHA 3MOSA 4HTAA 2Y3IA 2J59A 3TOXA 1THGA 2ZJBA 3PPVA 2IWRA 1TMYA 3DONA 5IAKA 4EW6A 2C92A 5ALJA 1OFUX 3TUJC 3SOZA 4MS3B 1QIJA 4OQYA 5TQ2A 4QJ3A 4ACBA 3PC8C 1PNQA 1J25A 1MC4A 1UKZA 3AVOA 4RVDA 3G0GA 2GRUA 2XD9A 5E2AA 3F7OA 2X19A 1KGDA 4QARA 3BJEA 1AQUA 1Z0SA 2YFQA 2ZULA 4DYDA 4DRXB 3CPSA 1SHJA 1GDHA 5F78A 2AHOA 1R7RA 2HA4A 3GFFA 4HDQB 2RH8A 3EXFA 2VPWA 1ZNWA 4DG5A 5IBCA 4ND2A 4B34A 1IUPA 5BVGA 3U19A 4KXFB 3FFAA 1A04A 2ZVDA 3L3BA 5DHAA 4FBWA 3TAUA 5ANRB 1A2BA 1DHTA 3O8DA 2F3PA 3O91A 4AD8A 5JTTA 5G02A 1DAOA 4TMXA 4B3BA 2JCXA 2X5KO 3F97A 4QA9A 2B36A 4A8HA 4EG3A 4KAAA 1CIPA 4DN6A 1E1DA 1JHOA 2IZ0A 2GK4A 4QXPA 5JPIA 3OEHA 2VKQA 4IQ0A 2Q0SA 2XY4A 3C85A 4JDUA 1TUEA 1EU1A 4G1BA 3MCZA 3ZQJA 2XAUA 4O2BF 2H9AA 2J7PD 2C4NA 4R68A 1DHRA 2BMJA 1D0SA 3R0QA 5GZ1A 3PFNA 5AD1A 2TMGA 2C7IA 3RWOA 1PQ4A 2WKPA 4ZV4A 1Z4MA 1OWNA 2C2HA 2GLXA 3VI4B 1CJSA 4UEKA 4A36A 3PDHA 4TV8A 3ASYA 1XA3A 1WDKA 1KYIA 1ZK1A 2BF7A 2HJRA 3FAZA 3M70A 1BFKA 4XQ9A 5AESA 5BOSB 1L8OA 1U7OA 2CVFA 2GERA 1IHXA 4J1SA 2PEZA 5LDGA 1JWLA 3U3MA 1B6SA 2VQ6A 1JKFA 1H94A 2Y1DA 4YWJA 4GDFA 3D7LA 4QJBA 2IDJA 3KTOA 1YJCA 4RVCA 1XQXA 6NULA 3N05A 1SNYA 1OASA 1HBJA 2PUEA 1Y1QA 2ZG6A 5AI9A 1PJBA 2ZI6A 2OSBA 1AB6A 1DLJA 3TIGA 3I6IA 5KKNB 5IC4A 2ZS9A 3PR3A 2H85A 2P77A 4PYRA 1XT6A 4HDMB 1RWQA 4YGXB 2G1AA 4N8EA 4DXHA 3HM9A 3CRQA 1GARA 3KYJB 1L0BA 4QGGA 1QYXA 1KI1A 2JB9A 3M1IA 2H5LA 2WD8A 4M9XA 4DAEA 3NHFA 4K8OA 4OSOA 3TNYA 3GHHA 4IF6A 3R7WA 1A1SA 3L4GA 2F55A 1KH1A 4ZANA 2JIMA 3QFTA 3PFBA 2B35A 3UJ9A 2XXAA 1WU8A 4NAUA 4XDYA 2ODAA 2ZPAA 2WFAA 2JJ2D 3I34X 4P74A 1FYDA 3K4PA 2BR3A 3P9NA 5DPMA 4MR9A 3I9V6 4ZVVA 3QBVA 5L3RA 3KXLA 4AJ9A 3OCYA 2QX8A 3H3FA 5EJ9A 4PGGA 3QE4A 3EIWA 5FQNA 1GDDA 1Z0JA 1RC0A 2H5JA 1V16B 2WDPA 4JFRA 4V0OA 4B45A 4CIXA 2XGTA 2R4TA 4NATA 1G5HA 3K8ZA 3PQFA 3PJDA 3BH0A 1E8NA 4A7PA 2HUPA 3UNXA 5DI9A 4UFPA 1Q0QA 2PA3A 1PR0A 2XUDA 5E1OA 4D6XA 4WBXC 3M34A 5EHIA 1KDTA 1QVWA 1WNTA 4UOEA 4Q37A 5G1NA 3CURA 3ONVA 1P6XA 2W00A 4QTUB 1GQOA 5CW2A 4EMSA 1KMCA 2ZDGA 4V2IA 1D04A 3EVAA 3TNLA 3UV3A 2QYHA 1SZCA 1YZTA 2GX6A 3EQ9A 3TSAA 4W9MC 2QQ0A 3E3OA 5EJEA 4R83A 4DCUA 2OUKA 4JS0A 3EA0A 2QZSA 1Z4LA 5BR7A 2QUHA 1A9TA 3OFJA 1AT1A 1E0JA 3L6EA 3O5AA 2VJYA 4DFDA 2XLBA 3V9PA 1OAAA 4KLZA 5KCZA 3BRCA 5ICGA 2DG2A 1F0YA 2WYHA 3EXHB 3NEPX 4D9GA 2CMKA 4FX2A 2QMUA 2CYBA 2QVYX 5AHKA 3WGUA 4M0PA 3VC2A 1D5CA 4W7SA 3T9DA 4FFSA 1ASZA 4N5IX 3GPIA 5T67A 4WVFA 3ZCVA 5C18A 1GQYA 4WY8A 4NEQA 2C59A 3PNKA 4P22A 3ZQKA 1NRJB 3RIEA 1BDIA 3M8KA 1TT7A 3OZGA 4R2LA 3RW9A 4NU8X 5AT1A 3WZMA 3IT0A 2BRUC 1UZLA 3RTGA 1R00A 1IVYA 2G8LA 3QFCA 2ZZMA 3LU1A 1H2FA 2RHSB 4EI7A 2GBGA 2XIQA 4HAUA 4YUVA 3ZHSA 1N5OX 1OX4B 4MMYB 5C7IO 1QAMA 1YJAA 2ACEA 2BBOA 5U1PA 4C07A 1ODFA 4TGLA 2FEOA 1SR8A 4HX5A 8OHMA 1JS1X 5BW8A 5HRCA 3PXUA 1XNJA 2ZJ4A 3PFIA 1WEKA 3PXEA 4RUKA 4ITVA 2H08A 3BMOA 3H19A 3EPLA 4AKHA 3OE5A 4JODA 5I7AA 3EY4A 4TLMB 2XMZA 2ZRPA 4UNNA 2DKOA 3BIXA 2PWPA 5FI3A 3R24A 4BWYA 4CKYA 2NIPA 3F1LA 4J2TA 1HTWA 2QN7A 4M0KA 5B7NA 5ALZA 3X44A 1NKSA 2WWRA 1EZZA 3LT2A 2BH2A 3UJ7A 1ZM3A 2YWCA 3QPAA 2YJ6A 4HQLA 4C4AA 2P41A 2VH5R 4IIBA 1Y8QB 1FSPA 2QPLA 1YI0A 2A9QA 3GCGA 1ZJ6A 4OQDA 9ATCA 4CEHB 3VR6H 3ZKAA 1SC9A 4EPXA 1EBBA 1HR0B 1K7FB 4OHWA 4Q9JA 4BO1A 3DMRA 1II8B 1GWNA 1C29B 2E5WA 1GQRA 3MW8A 4EPTA 3T0FA 1O54A 2AI3A 4N03A 3LWNA 4E1AA 1XMQB 2E1RA 4MVXA 2R2AA 2C5LA 4DR1B 3FNEA 1QM5A 1TL7C 2WKQA 3QXCA 3KUKA 1F9AA 4HS9A 3VO2A 4AZWA 1E79D 4YJGA 5EMHA 2HDOA 3WGYA 1T9DA 2CMDA 2ZRBA 2PKCA 2ZJ2A 4RWEA 1CJVC 5DX0A 5CU7A 1G4HA 4YT4A 4TMVA 1K68A 1NVTA 4LXXA 2X0JA 2AZMA 3ELWA 4FZJA 1BU5A 2REQA 4FDUA 4G86A 1JI3A 2ZTGA 2UZ1A 2VAVA 2WJVA 4JSTA 4Q39A 5ALLA 5DT2A 1X74A 5G0TA 5AW6A 4YPFA 1YFRA 5AKGA 3HJTA 3FJOA 5HKOA 2Z08A 3TNFA 1RWMA 1YJXA 2XCOA 3EQ6A 2RKBA 1FFDA 2P0EA 4IJWA 3S5UA 1H1DA 3HKBB 3P4YA 1WVMA 2IHUA 3ZTTA 2VT2A 3PT9A 4X6YA 5ED0A 3ZHVA 3JRWA 3GN2A 2Q5FA 4MLZA 1RAGA 4N6NA 3I0ZA 1ND6A 3AFOA 2P67A 2YDYA 2WNIA 1LPSA 3WXMA 4KE7A 3F3SA 4CM7A 3PNQA 4P3YA 2AVDA 1CUHA 4NJEA 3M6LA 4JI3B 2PZFA 4U4AA 2X9GA 5LQCA 1M6YA 5GV7A 3OG9A 3H84A 4MV1A 3FOWA 1NW7A 3TQRA 1OFVA 4CMHA 4DR7B 3KEOA 1CD5A 4G65A 4A4DA 2RARA 5HCIA 2G5PA 1E2GA 1T0UA 4BO5A 3A4IA 1KAQA 1S0UA 2JVJA 2C3OA 2NNWB 2RGEA 4WZBB 1V8DA 5AKJA 4BE7B 1HDYA 2B3DA 3CIOA 3DEYX 3ONEA 2CXPA 3N5KA 4AFNA 3AB3A 3K0AB 1DRUA 2FYTA 1EM8B 3AF4A 4PC2A 3IAEA 2ZJ6A 2C4HA 3H3JA 4KC0A 1KAGA 4MR7B 3CVXA 3ZIGA 2GPTA 2GYYA 3NKLA 1P61B 5JSQA 2DECA 2ORED 3CINA 3I73A 2W6ZA 4TXMA 1E1TA 1EWKA 3UA4A 5JCJA 4L02A 1RWNA 1XVTA 1QJ4A 3ZHBA 4MOWA 1E94E 4YTEA 4XCVA 4DQDA 3VKWA 2E9SA 4HB3A 1OF1A 3U3ZA 1ONNA 5HF9A 1V1MB 4BDTA 3VDRA 4LRXA 1JLSA 2DTEA 2ZBGA 3S99A 1DTWA 4QTZA 2ASVA 3WGOA 2XYRA 2DQ3A 1IAQA 4IXTA 1A4UA 2YHAA 2N46A 1YSCA 2A7XA 4FGUA 4LRQA 3FUVA 3UHJA 4NZ9A 1I4WA 3FYDA 3GBSA 2NO9A 3OEHD 3K7EA 3PC7A 3PK0A 4QGBA 4ZZ1A 2B4RO 2AXEA 1T3TA 1KO4A 2B61A 1J0AA 1PVVA 4EECA 1KDVA 5KNBA 3GLUA 4KQIA 2G3YA 3ANSA 3L1IA 1EP9A 3LUKA 4HEA1 5SZJA 4AKEA 2J08A 2P79A 4AUKA 2NNLD 2L17A 1PV1A 3GT3A 1TIBA 1UEXC 5CIQA 3AVXA 1PAVA 2A7QA 4JJGA 1M7BA 2HSDA 3MS4A 3O9ZA 5BR1A 1JEOA 5BQPA 4KQEA 1SBQA 5BSHA 5DM60 4B82A 2BEKA 1E99A 3GCXA 2O48X 4DR6B 1AM4D 3BK1A 5TMPA 1GGNA 1NF2A 4EJSA 3CNLA 2OQRA 4FK8A 1KWKA 4HUJA 4GYWA 1O89A 4UTRA 5KNBH 5AKHA 3QEBZ 1Y1RA 4HVCA 5CX1B 3OP1A 5JDIA 1YDHA 4EHHA 3VGJA 2ZIXA 1CUVA 3DKVA 4LE2A 3FOBA 3DNFA 3SEZA 2YCLA 1C9KA 1QF7A 5DULA 2HQBA 3KVVA 2ZRIA 1KIAA 4DADA 1BOOA 4JVMA 4K81B 1W66A 5JZBA 4QECA 4OX9Y 5ICEA 2W2QA 2VUSA 3R3JA 4ZQEA 1M5UA 3RYFA 4MVJM 1PT9A 1H6CA 2Q7GA 4MQ6A 3TCKA 3UK6A 3CWCA 3PL5A 2Y77A 3OEEA 4Q5IA 3C45A 3PGJA 1OXMA 4A2PA 1B0AA 3QXXA 1W581 2B9EA 3BXPA 1DDOA 1IBSA 2GAIA 3P9PA 2BM0A 2IZZA 3ZW8A 2BFPA 5IKPA 2WT4A 4I9HA 1QHIA 4E5UA 5A4MS 3CX6A 3WIOA 3RAFC 1J0XO 4Y9TA 5FA6A 2ENUA 4FN5A 4KVZA 3LPDA 5AHRA 5ALGA 5AKKA 1S7CA 1VHWA 3IP9A 1Z3CA 3D9QX 3DLAA 3EUEA 3T3GA 3F2VA 5K8UA 1QK5A 3LA6A 4U63A 3Q88A 4B17A 5J59A 1WMEA 3T5MA 4AJ1A 1X7XA 2WAMA 4M2LA 5LIRA 3D3JA 4E46A 3P96A 2QNBA 1ODKA 4Y1GA 1AKVA 4F71A 5E4JA 2DCMA 2FFQA 1H1TA 1U8CB 1ZSYA 2IJGX 1UEIA 2GKGA 2JI4A 1HDGO 1NP7A 2QRQA 4OD0A 5ALKA 4B3TB 4R2XA 2V9PA 1DPGA 2OD7A 2D5CA 3LOPA 3U44B 4LF4B 1HXDA 3A2NA 3U7FB 1N2XA 3C4JA 4BNKA 4JNKA 5PGMA 1A7KA 4MUBA 3EASA 4C7OB 3T1TA 1VI5A 1JQ5A 2CHGA 3EVFA 4DMHA 4H4CA 1E9AA 5F3RA 5BMOA 2FG5A 4QODA 3AW9A 4FINA 4E32A 5BNZA 1I2ZA 1GYQA 1N6OA 2Q1YA 2C31A 2RMKA 3K9QO 2XT6A 4IDDA 3S55A 3MUFA 4ENTA 1QQ7A 2DTXA 4YUAA 4PX2A 4NCNA 3BTSA 2JAPA 5DH9A 1PFYA 4N9QA 3TD9A 1SIOA 1C8KA 1K7CA 3KQKA 4HP8A 2DY1A 1I3LA 4P5DA 3HU1A 1P8AA 3RSZA 2R86A 2IXGA 4Q9AA 4PG5A 1KQOA 5HNKA 3TJZA 3P0EA 3JPWA 4KPFC 5I9SA 1YR3A 2EQAA 3ZY6A 1XD2A 2WTMA 4WN9A 2ATIA 1Z36A 2D3TA 3NFRA 3PLRA 2VHZA 1HEYA 3SF8A 2IA5A 4INAA 4ENRA 3HPRA 4XTWA 1H2EA 1Z75A 1RYEA 3ZOZA 4QPJC 2VSOA 2CIMA 3CW2A 3DMGA 5D5QA 1JTVA 1V6CA 2C8KA 2ETXA 2OCAA 2XTIA 2Q99A 3ESBA 3P9RA 4RMJA 4X1KA 5FBLB 3ORQA 1L4FA 1ID1A 3OIVA 5J2UB 2WJ4A 4Q4AA 5DP2A 2R65A 2GB4A 4I3FA 4DA9A 4GOND 3UQZA 1L5KA 3DFKA 3O94A 3HMQA 4PEVA 3KYDB 4C4TA 3HJFA 1LW7A 2G7MC 2QAGC 2XKBA 4Q4HA 1G5FA 3IAS6 1VQ1A 2JAOA 3AJDA 5FB3A 1P8JA 5SZHB 1TIKA 1W5BA 5EUCA 3FDZB 1EFUA 1ST2A 4JXKA 2YXLA 1ZU4A 2OWDA 2PKEA 3EIXA 5A7FA 1MGOA 3HJHA 2JGAA 3BXXA 4ZYZA 4P72C 1Q0UA 2VZ9A 3KLOA 3P8YA 1BS9A 3QO8A 2GM5A 3OLQA 1YBFA 3JAWB 4HRAA 5ALYA 3O3CA 4PS1A 3RUXA 4TKVA 3PD1A 2G1KA 2J3IA 4X90A 2ZM6B 1QO7A 2NSHA 3IVCA 5SY4A 4BTVA 4CTKA 5LZ9A 4CEIA 1DJOA 5BWOA 1IY8A 4Q3OA 2GNOA 4FBGA 3JQBA 3ZJYA 3U49A 5GOTA 4BLWA 5DM1A 2D54A 1FNMA 2FMTA 5GAJA 4FDLA 5KOJA 2GK7A 1M1YB 1CVRA 1VE5A 2IEBA 3KKPA 4GWKA 3U1VA 1T5DX 2OG1A 3OU7A 1Y6FA 1G5TA 3D2AA 3F4KA 3MRTA 4GOKA 4KLAA 4FOSA 1L7RA 4CH3A 1Y4ZA 3QE2A 5JZVA 5A2QA 1QG6A 1QG4A 4YJFA 2R7MA 5EQJB 4GPEA 4NECA 4KDCA 2JIZA 2WKWA 4Q6WA 2F4NA 4Q7MB 2VF5X 5HRUA 4QGSA 3NKFA 1O95A 1WL8A 3T9FA 1T2CA 1XZFA 4HWKA 1YASA 2EWVA 3OIFA 4KQGA 4NG4A 5KTPA 1I4LD 1H9CA 2Y76A 2X13A 1D07A 4LV8B 3KSRA 1PTJC 3LOQA 5ICSA 3UMJA 5KNCH 4E3ZA 5LMZA 1Z5UA 4G4SO 4JC0A 3CE9A 3FMGA 2Z83A 4XGRA 2AJ8A 2O9JA 4I1UA 4KWCA 4MUYA 2MU1A 5CBPA 4XGKA 1NY6A 4BZQA 3DFMA 2D2EA 1NVXQ 1Q15A 1KOLA 5HGJA 3QGMA 4JB2A 4CVNA 2HU2A 5DGHA 4FQ5A 5AM5A 3BMQB 2IYYA 5D3KA 2VS1A 5ALQA 3ZJ5A 1VC2A 5DNCA 3O75A 3LWBA 4PGFA 3INNA 4EKGA 3Q4GA 3BGOS 4HDCA 4ERXA 1DTSA 1ODJA 1KNQA 3PDIB 3MTAA 3E8SA 4D0NA 1JHXA 5DV9A 3WKAA 3TXXA 1CQZA 1KZ1A 1U9IC 2GK6A 2V74B 3ZXUB 4OHVA 2XCQA 1Z06A 2IZ1A 3EVGA 1NJ8A 3VMMA 3P0JA 1HI9A 3AQIA 4KVGA 4V1CI 4OA5A 2W37A 3UUGA 1IBLB 1A5TA 3OJ0A 3GJTA 3C6BA 3VKHA 5IK2A 3BBPA 3EZNA 5JCJD 1DU4A 4KWTA 1BXRA 4LVKA 2QVZX 3CF6R 3HU3A 3H5RA 5LYJA 1KKMA 1QZUA 4HO1X 3M6FA 2AMJA 4H6VA 4YJKA 1J5PA 1TGYA 1MRNA 1S01A 2J07A 5MN4A 1E0SA 3LL7A 1EUQA 1BX0A 4EUEA 3ZDCA 2WG2A 2VUHB 2VWGA 4PXYA 2FVYA 2NZXA 5B55A 3O74A 4KN8A 5EWJB 3PHBE 4H7KA 3CT6A 4I50A 4KX5A 3G5LA 1Q57A 5KNBD 3E9QA 1CUXA 3H2HA 4KO4S 4AWAA 2ZVPX 1VIVA 3GYBA 4YRKA 1N0VC 4R98A 5TC4A 1T4DA 5JE8A 3QI2A 2YVKA 4M1YA 4OJYA 2CMGA 1O5TA 1K6IA 3BB3A 2EAYA 2VJNA 3KL2A 3DHWC 5CH8A 3EOZA 5G3YA 5TEVA 5CLFA 3VXKA 1XZJA 5KMGB 4NENB 3IUNA 1S2GA 2VJBA 2PT6A 1L3IA 4INPA 3GJSA 4B6EA 4CF4A 7YASA 4UP8A 4TUYA 4MGEA 3F9RA 4ZO4A 3BSWA 2G36A 2PGDA 2X77A 3A1EA 1FU4A 2OHGA 4ACAA 4GEKA 4RJIA 2WT8A 2F9LA 1T10A 4OHPA 4E2FA 4PSKA 1DV1A 2PSJA 2XNCA 3A0UA 1EFAA 1XLUA 2GAFA 2RGRA 3QMVA 2O5EA 2AVNA 2TSYB 2E41A 3C7CB 3OLVA 2A2YA 4PV7A 5HQJA 2V6MA 1GNQA 3CYFA 4COOA 4EHIA 4FB5A 4LF9B 3JU3A 1HDEA 3SJ7A 1EVKA 4J43A 5K0TA 1VZ3A 3UFBA 4J3JA 1H4TA 1IQ0A 2ODTX 3QI7A 4CE6A 1WLYA 2A1TS 3A8TA 2RH9B 1BKSB 3R0ZA 1IRIA 2IEDA 3AUAA 3KKKA 4D7AA 3WK8A 1NBHA 1GUDA 1F3OA 1CIVA 3BJMA 3OEED 4IMPA 4RJLA 5CDFE 3EBOA 2OYSA 4L4UA 2JHGA 3LVQE 2PVCA 1H1LB 5LR6A 2YJGA 4LKRA 3TW8B 2Z8YM 4BBPA 3EZ6A 1G8YA 2F64A 3V80A 3IALA 2IOQA 2QTRA 3PD7A 2GCOB 1L7QA 1K88A 1P72A 3Q12A 4RZXA 4LQLA 4CTOA 5HMLA 3MMZA 4D4IA 2GN6A 2PANA 4WUTA 3GZNB 2C7QA 3KPUA 1MIHA 4EQ6B 3D4NA 4BP1A 4WASA 3O1IC 5EJAA 6YASA 4KW7A 1N75A 3REGA 3I45A 2QTHA 5ILGA 1G8PA 2C07A 3F49S 3NZEA 1MB2A 3FDFA 1N2JA 4I4TA 2LIVA 5DJ5A 4TVSA 1FRNA 3N76A 3PPXA 2E85A 2ISQA 1HNWB 5KNDH 4MDYA 2R0QC 5LYYA 4QXQA 4V24A 1QO9A 4M7OA 4IJVA 5JD6A 4QUDA 2EBFX 3LQFA 4F2PA 3FLBA 3PNPA 2HREA 3HZZA 4EJ2A 1TEZA 4QXOA 4QM6A 2PKXA 2FZGA 1WPXA 3B3QA 4W6ZA 2H1SA 3C3CA 4L57A 3JQPA 1SXJD 3HDQA 4QRDA 4CR8A 4KFCA 4HDRB 5EZYF 3U5ZB 4XEMA 4KTVE 4MKHA 4XARA 4Z9EA 5F4ZA 5KCMA 3O1LA 3TJMA 2BHLA 4M9QA 5FD8A 5M04A 1D4FA 4ZEOA 1H85A 2VZEA 1PS9A 3EVEA 1XTIA 2AOTA 1CNFA 3IH5A 4FZVA 5J5CA 2QDXA 5KX5A 1R4NB 1W36D 1XRRA 3VC3A 1HOTA 1XKQA 5K6AA 1QQAA 1KI8A 5IDWA 4A8JB 1XBTA 1W0CA 1JFFB 2OXCA 2W2OA 4J0JA 1JFVA 1YQWA 2HA3A 4BNWA 3U62A 5FPKA 1PDWA 4ZRDA 3LM8A 4YB8A 3HUEA 2HIGA 3N6VA 3RRZA 4DPLA 1KZ7B 3U17A 5JNSA 5JD4A 3VOTA 3BJUA 4C0KA 3L79A 5FR2A 3ERRA 4ECEA 2ZSIA 4Y0VA 3WQRA 2I7XA 3GFBA 3QENA 4FUQA 2C2YA 2N1MA 3IEUA 3PDCA 3UB2A 3P9CA 5L3QA 3DCJA 3Q9SA 5H4HA 3G1WA 1YRWA 5JZSA 5JYBA 1CJBA 1G2PA 2CJFA 3ZUGA 5C34B 3NNSA 3AFMA 1BYIA 3FPJA 1GV1A 1O6ZA 2CFSA 2H6EA 1RKUA 1EA7A 4KVAA 5FFMA 5C8YB 2PUDA 3T5BA 1ZK4A 2BFCA 4TRNA 5KYYA 3DBLA 4LVNA 3S1AA 2WUWE 4EFNA 4I46A 2H1HA 5EQDA 4US0R 1M1YE 2HADA 1XELA 1CUGA 1GTRA 3KFXA 3GFSA 2JLWA 1I3MA 4LHSA 2QMQA 4AMZA 3RC7A 2HUNA 4WE3A 5E9JA 3TL3A 3U3XA 4PWYA 5JAOA 3WTCA 2FKAA 5K3EA 3B38A 4HH3C 5FUWA 3U9LA 2OT3B 4MX8A 3I2GA 5IHPA 4P93A 2IY8A 3TSPA 2R8YA 3SN6A 4BQSA 5EIOA 4P71A 3KQPA 1YDEA 4ZI7B 4YRFA 4MW2A 1B6RA 1BGXT 2BGMA 4YT5A 2IBSA 1YC5A 1G17A 1YL6A 4KPUB 2O8EB 1ECCA 1BXKA 4LXYA 3ICAA 3IDAA 1ORIA 1QDLB 1BYUA 3HY1A 3NT4A 3MGCA 1NVUQ 5U4XA 5FH9A 3JTMA 1R8QA 1LI4A 1SO8A 2I1VB 3PITA 2J0UA 5LZ8A 3EMVA 2Z5VA 3BKXA 3L6RA 5ALOA 3TEMA 1G291 4FE7A 4FDAA 5JMPA 3ZXIA 3HZHA 2NGRA 2RKOA 1CQJA 3KHKA 4O4JA 2Q6OA