4K88A

Crystal structure of human prolyl-trna synthetase (halofuginone bound form)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
497
structure length
490
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords Proline--tRNA ligase
total genus 143
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k88A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k88A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k88A02
4YREA 2ARSA 3LSQA 4YP0A 4UP8A 4CH4A 1YFRA 1NNHA 4XTZA 2ZZFA 2ZTGA 4YRRA 3P8YA 2ODRC 2Q7HA 3UH0A 5K1PA 4CH3A 2XGTA 4YRQA 4KR2A 2ARTA 4CS2A 3E9IA 4WF2A 3IALA 2CGHA 4P3NA 4ZIBA 1H4SA 4HWOA 4UP7A 3DSQA 1WYDA 2DQ0A 3VQYA 4CH6A 2DJZA 4J15A 3RKYA 1NYRA 3RGLA 2QHVA 2RHQA 3EFSA 1VQZA 5HGQA 4LNSA 2DQ3A 3REXA 3PCOB 2ARUA 3WQZA 3REUA 4EO4A 1G5IA 4K86A 1WLEA 4RQEA 1ASYA 1BBWA 2P0LA 2QHTA 2AKWA 1KMMA 2FYKA 4ZTUB 2J3MA 2AMCB 4O2DA 2DZ9A 1GGMA 2RHSA 4P75A 2QHUA 1ADJA 2EJFA 2I4NA 2RHQB 3NETA 3KFUA 2P5IA 4AH6A 1JJCA 2ZR3A 4PG3A 1YGBA 4BW9A 3MF2A 2Q7EA 2I4MA 4TQDA 3MEYA 1B70A 3RKWA 3A31A 4H2YA 4YRMA 4H2XB 3V8JA 4WI1A 3M4PA 2Q5HA 1NJ6A 2XTIA 3V7RA 1X2GA 3P8VA 4EX5A 3CMQA 1USYA 2C7IA 2DTOA 1WPYA 3BFMA 4YPFA 1BIAA 4RQFA 1NJ1A 4YRLA 2EAYA 3V8LA 4HWTA 2DXTA 1HTTA 3ERRA 3V7CA 3FJPA 4YRIA 2IY5A 4G85A 4YRNA 3VQVA 1NYQA 4XTUA 4KR3A 3HFZB 3A32A 1YFSA 3HY0A 3L4GB 4L87A 1B76A 1KOGA 2EWNA 4KQEA 2ZT7A 4YRSA 3RACA 2CJAA 4NCXA 1KMNA 2E5AA 4YCVA 2DTHA 2CIMA 4P73C 2ODRD 4CH5A 1QE0A 3PZCA 3E9HA 4P73A 3BJUA 2ZNJA 3RF1A 4P3PA 1SRYA 2EJ9A 1HC7A 4WJ3M 2EJGA 3HXZA 3M4QA 4P75C 1WQWA 2DZCA 1X56A 2ZIOA 4E51A 2J3LA 3L4GA 1Z7MA 1EVLA 4YRPA 1B7YA 3V8KA 2G4CA 4YRJA 2QHSA 3HRIA 4XTVA 2I4OA 3A7AA 4P72A 1EVKA 3A5ZA 4G84A 3W3SA 4YRGA 1PYSB 4H2UA 3NENA 4XEMA 4HWRA 1EFWA 2ZCEA 2DU7A 1SERA 4CS4A 4YRTA 3NELA 4H2WA 1WNLA 2DTIA 1LYLA 2LW7A 1SETA 4HVCA 3LSSA 1E1OA 4XU3A 3NEMA 3RKXA 5C52B 5E3IA 2ZT6A 3P8TA 1WU7A 3RUXA 2Q5IA 3HXVA 1BIBA 2E64A 2ALYB 3A7UA 1X54A 1E24A 4X5OA 4K88A 1X2HA 1EIYB 1NJ8A 2ZINA 3RL6A 1RIQA 2AMCA 1V95A 2PMFA 4TVWA 3EFRA 1H4TA 2DU5A 3HXUA 4TVAA 3QNEA 4XEOA 1YFTA 3QO7A 4RDXA 3A7RA 4H2VA 4HWSA 2ALYA 3HXYA 3OD1A 4P74A 3IKMB 4ZTZB 4P74C 2DKGA 1EQRA 4YCUA 1G5HA 1EOVA 4P3OA 4Q6GA 4P71C 1B8AA 1B70B 3QTCA 1H4VB 2ZR2A 1SESA 3VBBA 2C8MA 3TUPA 3A74A 4YRFA 1G51A 4TTVA 1IL2A 1NJ5A 1YB3A 3HY1A 4H02A 1W66A 2I4LA 3HFZA 3G1ZA 5C53B 4PHCA 1USYC 2Q7GA 1J5WA 3UFGA 3UGTA 11ASA 4DPGA 4YCWA 1BBUA 3V7SA 1ATIA 3LC0A 3HXWA 1ADYA 4WJ4A 3A5YA 2E10A 2E3CA 1L0WA 1H4QA 4DQ2A 1EIYA 4YDQA 3HFVA 2ZZEA 3L1AA 4YYEA 2ZXFA 4BWAA 1C0AA 3VQWA 1B7YB 3MF1A 2DDZA 4HWPA 4TWAA 1E1TA 2DVEA 3QO8A 1X55A 4YRKA 2E41A 4OP0A 4TVAB 5K1XA 4TQFA 3TEGA 2E65A 2IY5B 1NJ2A 2ZT8A 2ZIMA 4YROA 4YRCA 1PYSA 1Z7NA 2DEQA 3PCOA 1X01A 2RHSB 1WQ7A 2ZNIA 4H2XA 2ZZGA 1HXDA 4K87A 2ZT5A 2CJ9A 2DXUA 4H2TA 3VQXA 3TEHB 5F5WA 4TVYA 12ASA 3ICAA 3L2ZA 4P72C 2HNIA 2ZGWA 1N9WA 4HA8A 4XU2A 4P71A 4XU1A 5ELOA 4UP9A 3RIRA 2AKWB 3TEHA 3HXXA 2CJBA 4Q15A 3HRKA 5C51B 2PMEA 3HTZA 4XTXA 1FYFA 4OLFA 2EL9A 5KNNA 3I7FA 1JJCB 1ASZA 3IKLA 5ELNA 4RMFA 3QO5A 4UPAA 2E1HA 4CS3A 1E22A 4XTYA 4XU0A 3R07A 3UGQA 3IG2A 4H2SA 1QF6A 4XTWA
chains in the Genus database with same CATH superfamily
4ZHQF 4YREA 1GKKA 3K2EA 1SQ6A 1JPNA 1UKAA 1YK1A 3DEZA 2HHCA 3EIQA 4HK4A 1GZ6A 5M5BA 4DA4A 2BE7A 2J4CA 3PUJA 4MWEA 5FBZA 3KL2A 4NYMQ 4YRRA 1V48A 2IHYA 1W5AA 2AN1A 3WYEA 2ZWOA 3GNSA 2WNIA 4KJZA 3W3AA 4EYEA 2C58A 5IMSA 2ZYUX 3DBHB 3JS5A 4IXWA 1OZAA 4DCVA 2G1JA 1G6KA 2CLDX 5D3MB 3CVOA 1NSYA 4IZIA 3THRA 2C8KA 1A82A 2Q7HA 1JLLB 3EODA 2COKA 4FYPA 3WAJA 1JZTA 1RJGA 4RK6A 3TFWA 2OWEA 2XQVA 3L6BA 2AFRA 3NGMA 3PFHA 1SXPA 4DNFA 1KI4A 1OIVA 2ZSBA 3WJ2A 4S2UA 4E5YA 1JLSA 2FB9A 2YV1A 5EJ5A 1RPZA 3FSRA 4LS3A 1ZR2A 4QO7A 4QYMA 3HN6A 3D02A 2ZTVA 3WDLA 2VTKA 3STXA 5LXTA 1YAJA 4NPAA 3PDHA 1DBPA 1K4YA 2D1TA 2Q2OA 1PWXA 4LX8A 2NQ2C 3VTAA 2IY9A 2P2DA 5D6NA 1DWUA 2JLBA 1KERA 1MOQA 1QE5A 3RRMA 1AQ6A 1NY5A 2ZJ5A 3KG2A 1V1JA 1ZX1A 4BS9A 2RMKA 1Q2XA 3C3KA 4TS4A 1TU0A 2WHRA 3FI9A 1U31A 1YA4A 1ZRSA 1WAMA 1ESMA 1B1AA 3KUXA 4M1QA 5EEGA 3KBBA 1P4AA 5DYWA 3V4LA 4RPGA 4LKOA 4Q4AA 1B0AA 1RTKA 1DCTA 1OFIA 1OVGA 1QZUA 1XHEA 5F78A 4ND3A 3RD5A 3DAHA 5JOQA 5FPPA 5A3VA 3REUA 9GPBA 5L8VA 1DC5A 4DDHA 3EMBA 1OXTA 3G7UA 5IBCA 1QQBA 4D5GA 3EEQA 3VR3D 1NRXA 2P4SA 4LC9A 4B8YA 4OMFG 1PG0A 1TZCA 3E9YA 1W94A 4BMOB 2FOXA 4CFSA 5JS7A 5ILOA 1W36D 5LP6B 5G4LA 1DC4A 1SVKA 1XZNA 2ZBGA 5MGNA 1MX9A 1E3MA 3HM9A 3AB7A 1ORDA 5DLYA 5K1ZA 2PZEA 2V96A 2ZBFA 2BSQA 4WTOA 2XMPA 3PUZA 1CPYA 1G3UA 3DT8A 1KY3A 2BFFA 2P9TA 4AN0A 1EIWA 2JKYA 2O4UX 2VA9A 3FY4A 1KQNA 2JFWA 1SZPA 5AKZA 1A2QA 4UM8B 1KI7A 4P3XA 2RHQB 3QYJA 1L7PA 1HE3A 3NETA 1LF5A 3LHDA 2VP3A 3DKRA 3X3HA 4BAGA 2F43A 3G0GA 4BP3A 3LVQE 1JJCA 4BEBA 2QL6A 4FSXA 5EJGA 1ARZA 1JNYA 2X4IA 3OJFA 3LLCA 1N32B 1ZVMA 2VATA 4B6FA 1NTOA 1AT1A 5HIKA 3VV3A 3LRTA 1W88B 3ADPA 5ALSA 1AKVA 5G4KB 5I4KA 1P8JA 3VXKA 3PHCA 4U2DA 2FQYA 4X95A 3WFZA 3ZK8A 1XTRA 3JQ7A 2W6NA 3T4UA 3H9CA 3WV5A 1SOVA 1VDZA 2J9RA 3JATA 1ZU4A 4KWCA 5K4HA 2ZAMA 3KWJA 3AEKA 4KXXA 3FTFA 3KYDA 3OLQA 4IUYA 1U3VA 5B53A 3NHPA 1Y1TA 4HAVA 4OKNA 5FBHA 2JGRA 2G9VA 2KLBA 1T2NA 3NT4A 4K6KA 3G8DA 1T6BY 4M8NE 5FYQA 5B1HA 1DJQA 3PPIA 2XTIA 3GJ0A 4UAVA 3GCZA 3BSWA 3WGGA 2ZEJA 3WBKA 2ZRQA 5IAAA 2PUDA 3OZIA 3CMQA 5DSZA 2OQVA 3UO8B 3OHSX 5JAMA 4LF5B 3QU5A 4MQ5A 1ZH6A 1Z17A 4FNMA 4WZAE 3SJCA 4OU5A 2ZRPA 1WE2A 4AIIA 1J33A 4GW3A 4JVNA 3G8AA 3MAJA 3DMYA 2ILTA 4HGZA 3X1KA 4LFAB 1XAGA 1YS7A 4C21A 3NIGB 2PSEA 3KKZA 4WZBB 1NN5A 5ITWA 4CLRB 3SXUB 3DFFA 2DXTA 4GE3A 3X1ZA 2F00A 2VKQA 2EZTA 5E8RA 1CY2A 2QSUA 3RVNA 1XR3A 1RWVA 3B51X 3FPKA 3X2SA 4M1WA 1JA1A 5CDSA 1JPUA 3DDWA 2A5GA 3FJPA 1DWQA 1G8KA 2PYZA 1EG7A 1T4BA 1Z07A 3BPSA 3GOHA 5HCUA 3PEUA 1PDOA 4D97A 3TGPA 4MS4A 3U7HB 2I0FA 2J5KA 6AT1A 3DZKA 2OV3A 2OGUA 4BE7B 1Q50A 4CMKA 1T36A 4K2HA 4L16A 4Q00A 4U0JA 3VHQA 3SM9A 1WVMA 4ZAFA 3TLJA 1OYWA 3QIAA 3TX2A 4EHAA 4O3FA 5DASA 5SYNA 4RETA 1AUPA 2Z04A 4F38A 1H6BA 1V37A 1DAPA 1E5DA 1PNQA 1UAGA 2DBVO 4MP6A 1C9KA 1ZD9A 3L4GB 2FMUA 1L5OA 4JQCA 4JV5B 3TZCA 2ZSFA 4EPXA 1D07A 4EYOA 1GNVA 4Q7JB 1E58A 1Z56C 5T8KC 2WWWA 4B17A 4YT4A 2PR2A 3OTWA 4E7OA 4CEJA 4ZO9A 2I9KA 3ITKA 1ZC4A 2XE6A 4TUYA 2CJAA 1IY2A 1UPBA 2XWQA 3PGLA 3BRCA 1VIAA 5E4FA 1YVRA 5JY1A 1IBLB 4FTWA 3GFTA 1EQAA 3WMRA 1Q95A 4OVKA 1VBMA 3QPWA 1I1QB 1QHEA 2RAUA 3KQQA 4RH0A 4EUFA 3NGXA 4YI3A 5FP0A 2RGCA 1T0PA 2G36A 3FUUA 4QDUA 2EFHB 1GTZA 5M7EA 5AOBA 3IOBA 4AS1A 2P65A 1UBLS 3KX2A 3MCAA 5C18A 1ZCBA 4BQRA 4QM6A 2AW3A 2LN3A 4TZ6A 4LVNA 3V1KA 4G89A 1X7DA 3E4CA 3RFXA 5DF1A 4YACA 4EG3A 3DZCA 4QGSA 2W90A 1K6MA 4KXUA 2YJGA 4IJ6A 3RIGA 3WIOA 4GT1A 1KORA 2VSXA 3TW8B 1F4PA 1ORWA 2A6PA 3D8NA 3JZDA 5DLPA 3V7WA 2ZIVB 3E70C 5KIAA 2G04A 1V71A 2QX7A 1JP7A 4N65A 3JARA 5DM0A 5I7OA 1VFNA 3KZXA 5AVJA 2ID4A 1SFRA 4JEIA 4HZIA 2XCOA 3ZZNA 2FX2A 3EVFA 2O7NA 3KQSA 3SEFA 3TW8A 5C9ZA 3CRMA 1Q3TA 2Q6LA 4DUGA 3BK7A 2HTFA 3B1XA 4Q1CA 2OAP1 3K3PA 3OO1A 1P1CA 2W5UA 3EUAA 4FOPA 2GBFA 3OIDA 2AG5A 4MW9A 3GVXA 1CZLA 2ZB3A 4WQMA 5U4QA 2FPXA 3OPNA 5K2MA 4GKKB 3SIRA 1U1DA 2B69A 1KYIA 4NBUA 1C0KA 3EVDA 4HQRA 3PNKA 5JYBA 4GYWA 4OP2A 2R4QA 1I6MA 4B85A 1G19A 4QDZA 3AP3A 3LSSA 1A9RA 4NRDA 3A4NA 4UBNA 4C3VA 3DE6X 3STHA 4EI7A 2F1IA 1T3TA 1RJFA 2GYUA 3EDCA 3ZHZA 5JANA 1E7MA 2QG6A 2G40A 1S9DA 2LUOA 1DQZA 1W5BA 3CZQA 2DERA 5AJVB 3VR0A 5FJIA 2FMFA 4GYKA 1GLNA 4V0LA 3ZY3A 3PDIB 5KQRA 2EVWX 1K7FB 3GK3A 1X8XA 4X65B 4G07A 1HM5A 2M32A 1EVIA 1SG0A 1FUYB 3QXJA 4N5IX 3HFRA 4D45A 5K0BA 1D8AA 5A5DA 3G82C 3O4HA 2DFKB 2DH5A 4ZCMA 4RH3A 1NU8A 5B57C 3FMGA 4BQFA 1UBTS 4D81A 3FDZA 4YASA 3ZJYA 4XWTA 3IXLA 1OBFO 3HB9A 2N47A 2W0MA 3MCTA 3QELA 4R8MA 2PMFA 2O8FA 3ESQA 4FHFA 4EQ6A 3KYBA 3HXMA 5BWCA 4N4AA 4Z7JA 3RYCA 5H82A 4XEOA 1AD2A 3RYFA 1G21B 2WF7A 4OUDB 3ST7A 3T15A 3UANA 3QLUC 2W2KB 4FEYA 3BHMA 3TEFA 3YASA 1E7YA 3LLUA 4DR1B 1BSVA 2UYGA 1S3IA 1QP8A 4H2VA 2Y1OA 1D7OA 2D74A 2H16A 3ZWYA 3HFJA 4IMJB 2R6HA 4MJLA 4YAWA 1TZMA 2RHCA 4BNTA 2BEVB 3T95A 2W6ID 2V3WA 4F4DA 4ZFNA 5EHZA 3F73A 1V45E 3WIDA 3GGDA 4PQYA 4QQRA 4AUNA 4HB0A 3F46A 4F4CA 4P71C 3JALA 3UHPA 2B4KA 5HKAA 3V1UA 1SEPA 4RD4A 5DTMA 3MBKA 3S44A 4G24A 4EL5A 3FGPA 1S3FA 1H4VB 3IAHA 1Z8NA 2CMDA 1C1HA 4G1CA 3DKVA 4J0CA 3QFHA 4JX8A 1LFAA 3ONNA 3DF7A 1DINA 4CZ2A 3L4EA 4LC1A 4FQ5A 4MA5A 2X8BA 2H29A 1LLDA 2ZCVA 2DB3A 3VPGA 2ZDGA 3TTYA 2C7PA 3EPLA 2F48A 3AUYA 5KJEA 1CYEA 3F6CA 2ZROA 4II3A 1QCZA 1VFPA 5E1DA 1GPNA 1MC8A 1F5SA 3AHHA 3DSRA 1T5TA 3OX2A 3UAWA 4EPTA 4KPEC 4H1HA 4Q03A 3J80A 1N0IA 5BQOA 4AT1A 2O7SA 2J48A 1YR2A 5BORA 1WUJS 3EWAA 5HXAA 1JR3D 1CUVA 1F1BA 1K4KA 1ZI9A 3ORFA 1HDYA 2O6HA 4FMPA 3OCCA 2ZSUA 1ZD5A 1FYWA 5TQJA 1LBHA 1TPYA 3NYWA 2V9PA 1R4MB 2X22A 4M2LA 3VZPA 4MVJM 4D3FA 1IJEA 1O6FA 1SO8A 3WNVA 4CL3A 1HT1E 3AU8A 5K99A 4WNCA 1QSGA 3GH3A 1Y7PA 4BE4A 4AO7A 4ZGGA 5LLTA 1H3EA 2IGBA 4FOSA 3G2IA 4OFWA 1A4XA 3W8FA 4E21A 1KO8A 2R48A 3G89A 1CZHA 2OBBA 4JJ8A 2NO9A 4NX2A 1ZK0A 5DIFA 1JSZA 5DNAA 4NBVA 4O4IB 4OQFA 1H4QA 4OY3A 4DILA 1E3JA 1V4NA 3BMCA 5DBOA 4FBGA 4RZSA 1WG8A 1TAGA 1GL9B 1VRVA 4P4LA 3IERA 5TDHA 5THQA 3KUKA 4LE0A 1V7ZA 2GRJA 4LDZA 3PQ4A 4YDRA 5LA6B 3GN1A 4D43A 2XUIA 1S1CA 3KKEA 4MYSA 4D4JA 4DLXA 1U80A 4DNPA 5HKKD 5INTA 3NRCA 3K71B 3T0IA 3WNCA 1LPAB 2P5TB 4CQMD 1PG2A 1SBCA 1EDZA 3IDFA 4BP9A 1R8SA 1IZ9A 1ZJZA 1SXIA 5LYJA 4BLPA 2Z5VA 5LJIA 2FW9A 3HU3A 1V8DA 3N3AC 4HT4A 4NEGA 1RJDA 5LOVA 1V11B 2P2NA 5BOVA 5HGXA 4MQBA 2WAYA 4B3IA 1NLZA 4AXXA 3FZQA 2C82A 2IDKA 1GNLA 2WIFA 1N6PA 4YAUA 2I29A 3WDKA 3CZ4A 1G8AA 3H4TA 1NFHA 2V98A 2XUHA 1W59A 3Q5GA 4JJ6A 2E9SA 4ARSA 3HXQA 1UAAA 1JSCA 1NW7A 3NCHA 2Y1EA 1TQ2A 2DH6A 4K9LA 2YWDA 3O95A 4E1AA 3IAS1 4DRZA 5HVNA 5K8VA 1JVNA 5CT5A 1V7PC 5A4DA 1G3QA 2BE9A 3FNEA 3NEJA 3KTOA 4OJTA 2IYZA 4DIMA 4GAEA 1RP7A 2OT3B 3MT7A 4PPNA 3G5UA 4EGSA 5LZ5A 1G291 2DEQA 3PCOA 1J0CA 3J7AC 2ZS7A 1A5TA 3BOSA 4MUBA 5DB4A 5GONF 3WO0A 3IS3A 4QTYA 2CFIA 2WWYA 4KQJA 3BWEA 2XF8A 4L50A 4KFCA 2Y77A 3F90A 1OAAA 3ZJUA 4UAGA 1X1DA 3ET5A 3K0KA 3KJFA 3CX7A 1ZIDA 3JZFA 3GCWA 4Y0AA 1Y6QA 2XOKD 1OJLA 3P9YA 2DLNA 4E33A 3OQNA 1JHPA 1JDBC 5CCBA 1U0FA 3SJBA 2HXSA 4PLWA 3ML1A 4QT0A 1FRVA 4EARA 3TF5A 1QIMA 2I6TA 4RADA 4PZUA 3VO8A 1AC5A 2RG1A 1GGNA 3DZIA 4HXEB 2FP3A 5D51S 2HU2A 4RY0A 4PCLA 2P69A 1A76A 1PFQA 4C30A 1I2DA 3FOEC 1R5OA 2CLFB 3GJSA 4IDFA 2ACVA 1XQWA 5H02A 5CAEA 4RVSA 1WEHA 5L53A 3Q3GE 2RGXA 4W5JA 3AHDA 3WFIA 3RAJA 1K4MA 2G0AA 5TGTA 3WA7A 3QNWA 4DDVA 5LBIA 3DZDA 4TTSA 4KWTA 4O3MA 3FOBA 4HS4A 4RAOA 5DHFA 4HNTA 1AM4D 5EHQA 2ZUDA 2FSUA 4Q15A 2R97A 2R1TA 4MV8A 4Z8YA 2XH8A 3C14C 1AVTA 4PAWA 2OP1A 4WZZA 4FZJA 3SKYA 2VYQA 3I7FA 3QEAZ 3E7DA 3T4XA 1UOEA 1XSEA 5AI5A 2RONA 3IKLA 1K27A 3FJOA 2ACKA 3V4RA 3HB0A 5EOVA 2E1HA 5IUKC 5I3CA 4Z2AA 4L5CA 5HWSA 1Z68A 3VH2A 4BVEA 4S1VA 4ZQGA 4HEA1 2WWHA 5FL7D 1OKKA 4JSTA 4YIKA 1P3JA 3R3ZA 4JLBA 1UC5B 2VLIA 5MFZA 1D2MA 1VKRA 4LOLA 2I33A 4KNWA 2CVZA 4MO2A 3RIEA 1BXGA 1EA7A 1RMYA 2GEKA 3LQ2A 1P33A 4TMYA 2RGDA 5CU7A 5FKJA 2WSIA 3ZXSA 3AF0A 2BH2A 2XVYA 3UGJA 1UBHS 2BDTA 2ETVA 3K9WA 4G1UC 2GZMA 4GXNA 3FRJA 2IV2X 3ESZA 5A9SA 2DVMA 4J29A 1VIVA 1SUAA 3VTHA 3ZKWA 3AB8A 3ZZTA 4RVNA 2SECE 3G02A 2P1DA 1KFKB 3S81A 2Y1KA 1OTHA 4CUZA 5D6OA 4PZZA 4ARZB 1LS6A 1EUZA 1P2GA 2YHIB 3C0KA 1DAKA 4IBOA 1I3CA 3RLIA 4KTTE 2GBGA 2QL9A 4D0NA 2FDCA 1FE8A 3Q9LA 5KJ6A 1DV1A 4KO3S 4MUHA 4RS3A 4B6JA 1BAPA 3ISTA 4PSDA 1PN3A 2BV3A 2P9GA 4JYMA 2OGTA 4O4HA 3V8PA 5DSTA 5I7VA 1QR2A 3HLKA 5FA6A 1WXDA 3QFRA 4DQUA 1ODTC 3SJ7A 3O9MA 2DJ5A 3M4ZA 1M34A 5IT0A 5H7XA 1G5TA 4K6CA 4IGKA 3VTZA 1ZK4A 1EK5A 5A06A 3DSQA 3Q41A 3K92A 2O3JA 4W5NA 3JQAA 4GZ5A 1Z8DA 3OQHA 1JQKA 3B70A 2DJZA 3K72B 4H3KB 2GPTA 2R8RA 2VK4A 4HQ6A 4WXHA 2OB1A 3RPEA 4B3GA 4OP1A 4AIRA 3Q7SA 3OPQA 3BF7A 2VPXA 1OZGA 3LDHA 2YCBA 3FNRA 5COAA 5HE8A 4QUBA 4TRNA 2C5HA 1G8JA 4IGEA 1ZBQA 3D8SA 3EVEA 2PA3A 4D4MA 3UICA 1W4CA 1E4VA 4ENVA 4DR4B 2CLHB 1F38A 1GEGA 1SR8A 3DDUA 2FCAA 4WADA 3C4VA 3DDZX 4G5GA 4MCJA 3MS2A 1ASYA 1FTWA 2CHUA 3PLRA 4OGFA 1RJEA 3PC7A 1OYOA 3KB6A 4CV0A 4CKBA 2B1JA 3AR2A 4ZTUB 4EPRA 4EY3A 5F23A 3OJ0A 2XCIA 3E3MA 3EA0A 3CNNA 3EXIB 3QFTA 1P0IA 1ELOA 5KOJB 1KQOA 1NT2A 4ENSA 3IAUA 2F8MA 1RI4A 1XCBA 2Y71A 5GM1A 4BPBA 6REQB 1WY7A 2J0UB 3GRAA 1VKZA 3S70A 4CXMA 2YR0A 3I6YA 1ADJA 1YE5A 4BX8A 2VPYA 4QXPA 3NASA 1F2UA 2WWTA 2XUJA 3QLJA 1DC7A 3KFUA 1YCHA 2GCPA 2L17A 1W75A 3NHAA 3PJEA 5HJ5A 1SMKA 3PJGA 2VBFA 3DSDA 2AR0A 4GM4A 2Q7EA 4B5LA 3MPUA 2WHYA 3LYLA 1PLKA 3NI2A 4TZTA 4U8HA 3U3JA 3U7IA 3DFKA 2ZJ1A 1ZW6A 1OX4B 1Z5VA 4P5EA 3NC1C 5DHSA 3WK9A 4YCCA 1VBFA 2ZIUB 5JQGA 3F98A 4Q66C 2C4MA 3WQBA 4BNDB 3Q85A 5DX0A 3D2AA 1A2OA 1M76A 3O83A 5LQSA 3MJSA 1J42A 1FSFA 3E58A 2Z6QA 4RMGA 4YJHA 3ELWA 3HCBA 3UFBA 1MXHA 2EKBA 5HZMA 3AVXA 1NMEA 2A58A 3HEMA 2OMEA 1G41A 4K6FA 3KTAB 1EE2A 1MDBA 1PHRA 2QM0A 2YN0A 4AZ3A 5KC8A 2WWFA 2OEPA 5DWVA 4XH9B 2R00C 2AC2A 3KB2A 2WIJA 3EFOB 4PONA 1ILWA 2LPMA 3JWEA 3O26A 2I71A 4REQB 4UUPA 3JTMA 4IQFA 2ZZMA 2C92A 4BVLA 2RK4A 3A4LA 4LN1A 1EFCA 5FO1A 5FI0B 1SCUB 2C4NA 2EAYA 3WMWA 3PP8A 3PDJA 4MV3A 1HNZB 1RM3A 3IPAA 3O47A 3R7WA 5KYWB 3PU6A 3RSLA 4KDRA 4ZODA 3ZD6A 2EG9A 2XA2A 3GLTA 3I5UA 3OZTA 4GZ3A 1GA4A 2NNLD 4LJ9A 2HO5A 4UREA 1SXJA 2RGWA 4FM9A 4RE5A 3USZA 5MN4A 3DO5A 2P3QA 4GEKA 1K5DA 4OHCA 4R68A 5EUBA 3TSYA 3AJAA 1XPOA 3AHJA 1NUSA 3E9ZA 3BJIC 3COZA 1OFTA 1KK0A 221PA 3VTKA 1N2ZA 1XDBA 3FKSD 1IOZA 1SGWA 3DTNA 3M3PA 3WWYA 4XTUA 2V4ZA 5HIMA 4RW0A 2FN9A 2BJWA 4QUJA 2IWHA 3PLAE 1X2EA 3Q7PA 5LA6F 1IK4A 2UVDA 4M8KA 1W49A 5IXSA 1XA4A 5BN4A 4QG3A 1A1SA 3PD1A 3HCFA 2FZEA 1NFRA 2FUEA 3MJVA 4GX0A 3R4CA 1B76A 1XRJA 1KOGA 2OFXA 2EWNA 4G4SP 2WKPA 4BFZA 4I9UA 4PPGA 3RACA 4G4JA 4DNXA 4O4IF 3ZD7A 5D5HA 1VRCA 3BD8A 4XQ9A 1MLDA 3B1WA 1OXVA 4QU9A 5TS3A 1SEVA 4ZOLF 2XYVA 3EGVA 3UAZA 3A2NA 4KNVA 3WICA 2WJZB 3HVIA 4IWYA 4M7WA 5JJCA 3IUNA 3AF1A 1AGRA 4DEYA 1M1NA 3FLAA 1Q0SA 1TVMA 2VRWA 1F4VA 1ZRMA 2EKPA 2GAJA 3A6KA 1HC7A 1A5BB 4WLEA 2QU8A 2JASA 2HA2A 1DIBA 1E2PA 4ZT3A 2OCAA 2FK8A 3G2PA 4G9EA 1YXMA 1XNGA 1A04A 1IJBA 1Y9AA 1VLVA 3GWZA 3H5AA 5C5CA 2WM2A 1WQWA 1T4CB 2R7AA 2BEJA 1WP9A 3FSGD 4GX1A 4X9XA 2NIPA 5TS2A 2PUHA 3AONB 4QFDA 1NJFA 1WB6A 2PFSA 1Y0BA 4OI2A 5DHQA 2YZKA 2WHQA 3A9SA 1U8ZA 4GOLD 1WMBA 4GR9A 2YTZA 4MUJA 5EZSA 4BUZA 3D7NA 3V7NA 1H2BA 4FEAA 4ARZA 3HL0A 1KJQA 4Y9DA 1ZNYA 2HN9A 3SDSA 4C1NA 5EXDA 2PZKA 1BA2A 3D0QA 2Q9BA 1I8TA 3JQRA 3JYPA 1JU4A 2R7NA 2R5NA 1IM5A 1FX1A 1RPAA 5FTMA 4HBZA 1DU4A 4MS4B 1N1EA 1OHHD 1OGYA 2BDUA 2ILVA 2CXTA 2PMCA 5KVAA 3GRCA 2CRQA 2PAFA 2WE7A 4YYZA 3HE3A 3FPHA 4I5GA 2OHGA 2BPOA 3AOEA 4ZI3A 3S8MA 4P32A 3QWFA 3TRDA 3WLPA 2I4IA 2LWIA 4CV3A 1SVLA 2YJ5A 3SJZA 5K3CA 4CG3A 5JECA 1DS6A 5A4MS 4BX0A 1ZMBA 1P3Y1 1R27A 3RASA 4HDSB 1KFEB 1W25A 4M86A 4Q21A 3W5HA 4BKRA 1N8TA 1KIMA 2HQRA 3UJPA 1D0VA 2OMKA 1LYLA 4BKPA 1YF3A 4TWZA 5MF6A 1IB6A 5DTIA 4FX2A 5KWJA 1LDYA 4PG5A 2NAFA 3MYRA 3R7DA 5AW7A 4ZT5A 2QXYA 4UUNA 1W0JD 1JHUA 4K03A 2HLDD 2BCEA 4AQYB 1JYSA 1Z7WA 2WJAA 2AQ8A 3QV2A 1MFZA 4BTEA 5ER6A 1Y1PA 3IV6A 3P9QA 2Q0XA 1W1IA 3HCOA 3JVVA 4J90A 1AQJA 1GTRA 3IIKA 3DE1X 4DDMA 4MUKA 2GHQA 2Q1XA 3P9IA 1BIBA 3CG4A 2A3RA 3QEOA 4TYMA 4OQEA 2FJ0A 4CIDA 3HLYA 1PZEA 4YMSA 4Y9TA 5F2NA 2DR2A 4LK2A 5KEIA 1UBGA 3UPTA 1CIPA 3CZPA 1GR1A 2J6IA 3C6MA 1Q92A 2VNKA 2XYPA 3DGEC 4TKVB 1YQGA 5CT9A 3FPSA 3HZZA 2CYBA 4MB0A 2OQRA 3UN1A 2OL4A 5IC6A 2BFBA 1MNQA 1G5PA 2QTLA 5TXGA 1W96A 1B15A 2GD2A 4L0DA 3GFQA 1SG6A 3UA3A 2UKDA 4M1TA 1R4ZA 1HTBA 2JKZA 3KSMA 4R8LA 3WBBA 5E3HA 2GLTA 4HMOA 5D8DA 1ZL0A 4N01A 1EINA 2WK1A 5FUYA 2R1VB 4XPIA 1CS4C 1T8YA 1O2DA 2C4WA 3Q9SA 5BWNA 3IQDB 2XB9A 4DM7A 4EELA 1PFWA 1MIOA 4EUSA 4D0GA 5IJ9A 1QTRA 2P9BA 4Q39A 2JLYA 2WAOA 4W1PA 1Z63A 5E2BA 4TUYB 3OKCA 3G88A 2TMYA 3IKMB 4XUEA 2DWPA 1D2GA 4QUGA 1EQRA 4AF8A 3CF0A 1Y2IA 2DBYA 1BHSA 3U3ZA 4Y3UA 3A9VA 4MJXA 3GRZA 1EOVA 1TJYA 3HDJA 3VGPA 5BN4B 1JWLA 2A14A 2VRBA 1E3DA 2XGGA 3EZYA 4H3VA 1MPXA 4J0JA 1CTQA 3DFMA 5D86A 3QTCA 3F6EX 4C14A 4R8RA 4MRNA 4P35A 3IJEB 4RLFA 4Q7QA 4MYRA 1N78A 1ZMRA 2ZR2A 1QB8A 4FJ1A 5KQGA 4L9AA 1JIIA 1AHNA 2A9PA 1IYZA 3FUCA 4EQZA 3FNHA 2IYQA 3QHQA 5TEVA 3V9PA 3BKWA 3EIHA 1X70A 4A8JC 4C6TA 2ET6A 4Q4AB 1NI4A 1NVEA 3T34A 4P84A 2GTPA 1RE0A 3GUZA 3N74A 1H23A 3SYMA 4LHEA 2A0XA 3V1MA 2BMEA 4CIWA 1PO7A 1T4MA 3FF4A 4W6ZA 1PFKA 5BVGB 3QXSA 4ID3A 4XYBA 2JFQA 3NUQA 4BX3A 4DCUA 3EZ9A 4Z9AA 3KRTA 3NWPA 2IYFA 1I9CA 1V7CA 3O3OB 3TAXA 3UK1A 1CZUA 1VL0A 1YZVA 3W6PA 3RS2A 1JKFA 2VCYA 3KXIA 4PFJA 1UZUA 3DAFA 1PK7A 3AUXA 4Z0PA 3HY6A 4YR9A 3LY5A 1NE2A 1N0HA 2NV0A 4DIFA 3E48A 3E03A 3FSGA 3GFSA 1YV9A 2ZBRA 3CMMA 3GW8A 4MVJH 2HJGA 1JHDA 4WLOA 3KOYA 5ALWA 4A8PA 4BKMA 2PV7A 3AV3A 3H65A 4FFBB 1QQ5A 3G9QA 5H9WA 1S4QA 2YWEA 4MH0R 3SSOA 3IABB 2AV6A 3C3BA 1RBMA 2OO5A 4D92A 5I5GA 2ZUWA 4WCVA 1C3XA 1G42A 5EHIA 2BFEA 4RIHA 4TVSA 5C0OE 2QTVB 4MVJI 3Q0IA 2A1UA 3VZDA 4H1WA 2GJ9A 4NZNA 3GLRA 1F14A 3N0RA 3OZ7A 1M2GA 3BTOA 3BHNA 1GNRA 1DT5A 1HL7A 3NNNA 4TXHA 4WESA 3BICA 2VWHA 3LPNA 5A05A 1QRTA 2FFJA 4RA6B 2I03A 1E1QD 2NTJA 4FOTA 4OM8A 3B82A 5CG2A 2GERA 4Q1FA 4ZEOA 1B7YB 2CXOA 4JKIA 4MI3A 3VR4D 4URXR 5J4HA 1FJHA 2VSQA 2YCLA 3P19A 4JLUA 4AJOA 4BVKA 2QI9C 2VCEA 4P22A 2ZTMA 2GN8A 4ZARA 5EMJA 1XKTA 4X7RA 5C5IA 5AW3A 1ADBA 1ZI8A 2A1TS 3I9NA 2AX3A 1PNVA 2DPLA 2POQX 2Y05A 1U7ZA 3CLHA 3IFSA 4CE6A 1RRKA 4N03A 4I4TA 3GQVA 1ZKMA 2HGZA 4PRYA 4D9BA 4OHZA 3DOUA 3U9LA 5JR3A 4NH4A 1NH9A 5AK6A 3RTAA 4EZIA 3AR5A 5BSEA 2XMCA 3LK7A 4UXIA 3WSTA 4Y1GA 2BM9A 3CA8A 1E4EA 4H6PA 1NR7A 4E1BA 3SYLA 4S2EA 1QV9A 3CKLA 1J1ZA 5I7AA 3OQ6A 1C8VB 3H5IA 4HVTA 5BV1A 5BVGA 1FBNA 1PJTA 3IPCA 3MGBA 4YROA 4MRAA 4GPD1 2PRSA 2P6UA 2ZUBA 3DCJA 3VU0A 2OGZA 4R1TA 5FPYA 4AWXA 4AY4A 3A1UA 4KN9S 5E6SB 4M1EA 1F60A 5K0CA 1BA3A 2DBRA 3AGQA 1VPDA 5DXFA 1C7JA 1XAIA 3LO5A 5CEEA 3RHSA 3WDSA 4I7EA 1CQIB 3ONEA 4EMSA 1ZGHA 1BCRB 5EWJA 1XEAA 4ZMSA 5JISA 1NKTA 4G01B 1P75A 3ULKA 4ZV4A 1A2BA 4KVAA 5ALFA 1RYYA 2QNIA 2VQDA 4MIOA 4MLZA 2VPIA 3U7JA 4L8FA 1U65A 4OU4A 5B64A 2I91A 5K45A 3ILVA 3QLUA 4GD3Q 4CF6A 4E5VA 1H6DA 1L7MA 1ZPDA 1XV5A 3COVA 3UENA 1DG1G 2JI4A 1DOZA 3PNYA 2J41A 4Y6GB 7AT1A 3KQTA 4QO8A 3WKEA 4QYWA 4TZKA 2OQIA 1PF7E 4NICA 3T3OA 3G6WA 1E0JA 3VC1A 4BB6A 1M3SA 2DR0A 5JE8A 1A8UA 1ZN8A 4J2TA 1BRTA 3KEQA 4LSWA 4ZT7A 5LQUA 1EIZA 1ULZA 2FRDC 2ZI4A 3AR6A 3UJNA 3QOFA 3WIBA 4AJ1A 4P71A 4C3OB 3T3EA 1V0JA 2RG7A 3M33A 5ALVA 5EIAA 5BMOA 3LE8A 5CXUA 1M1NB 2FX5A 4PGGA 5GZ3A 4J7AA 4EB6A 3RTGA 1A9XA 2REQA 1FYFA 4BV8A 4OLFA 4P81A 1GGEA 4PS0A 1EJ2A 2VTBA 3FR7A 4GBGA 1ASZA 2M98A 4GMKA 3OFKA 2Q1YA 4RTOA 4CU5A 5DWQA 1FNSA 3GGOA 3KKLA 1XALA 3IRVA 1SC3A 4R81A 4BZWA 5BMVA 1RZUA 2QR2A 3E8MA 3OKFA 4FC6A 1SOUA 5DNUA 2FFRA 4KMMA 4UVGA 1IOLA 5ADWA 1VCMA 2GJSA 3ABSB 3SHFA 1MU0A 1EX9A 3ZY2A 3GFOA 2IEAA 3G0HA 1DBWA 4J1TA 1NNHA 3PFCA 1VSTA 4HYQA 1F8GA 4JR0A 4TYYA 1F2TA 1VIYA 3QITA 2OD7A 4HDKB 2I2AA 3DBOB 2CVQA 2ODNA 2SCUB 1U7OA 4MW0A 1X74A 3BXOA 4I9NA 2O2ZA 5IVHA 1PR9A 3QMWA 2XWPA 2G28A 3IOCA 3U7QB 2GK3A 3R24A 4M9UA 4O4LB 7YASA 5K1PA 4XYGA 2PGXA 1QBGA 4MZXA 4UBMA 1OASA 2EIXA 2CJFA 4L3WA 1HG0A 4UUMA 2PH1A 1L2TA 4B7AA 2YFHA 1NONA 1KZ9A 3PEEA 5KQPA 2H0QA 2RK3A 1A27A 5TPWA 1HE4A 3HVUA 2PD6A 4FE4A 3A2MA 4PF1A 4R41A 2J32A 3TNLA 2IXBA 4IIXA 1XDUA 1J2JA 2VPQA 3CIFA 1YFLA 1P44A 4K1LA 2BGWA 4MA0A 2A0UA 2BELA 1O6GA 2J7PA 4I1IA 4RJTA 2EW2A 2FETA 3TTSA 4CMCA 1O5OA 2EQ5A 2I67A 4HH3C 2DQ0A 1QH9A 1CZKA 3G8YA 4JKYA 1RJ9A 3VQYA 1HYHA 4NBSA 2AMVA 2ONZA 2RBEA 2ZYAA 4IDHA 5EZQA 2YDXA 1BMDA 4NPHA 5FIUA 3SFTA 3BRSA 4JXJA 4QG7A 4QPDA 1L5NA 2XADA 1AXGA 1YDHA 1ZGJA 1ZW1A 1OREA 3FWPA 3NMUF 4U7JA 2X7JA 4AMVA 4HTFB 4NZYA 3U9SA 3OEHA 5EJIA 2QAJA 5K0TA 4QNRA 1PLLA 1QYWA 3GXBA 1MEJA 2WYUA 1FVFA 5DK4A 4XGNA 4BIIA 1AKQA 2Q2NA 2H9UA 1IEXA 1Y6ZA 5EIOA 5ER9A 2GEJA 4B09A 2QTAA 3UJ9A 2FFHA 1BBWA 1UKYA 1TCCA 1ND5A 1E7SA 4YJ3B 1RYHA 4K0KB 2VF7A 3BMQB 1UEIA 3GAMA 3OHPA 2AMCB 1GWNA 3H11A 3DTVD 2JARA 5C8YA 4IH1A 5LL6P 4F4UA 4XYMA 4R7TA 2PY6A 1BMFA 3B8HA 1SCJA 3EG9B 1GAWA 1Z5OA 2BR4A 2H1SA 4IZHA 3D8RA 3RRZA 3T4EA 1YA8A 5IVDA 3A6PC 2MIIA 3H3FA 1FNBA 2GXAA 4FGZA 4J7CA 3OAAA 4ME6A 5DBFA 1SCIA 1KBOA 1MO3A 1LBEA 3OZAA 3RFVA 1G5QA 2JW5A 2OHHA 4R1OA 2WPNA 1U0GA 3FDIA 1MB0A 1P77A 3SQDA 2ECOA 1BVHA 1BS1A 1XTBA 2F3TA 3ZQ6A 1X14A 2CHFA 1WABA 1P6UA 3PJFA 1LK5A 4AMGA 3V8NA 1M7GA 1L3IA 3SSMA 4LHSA 2PGNA 3U56A 2QZ9A 1CT9A 2QE7D 1UP4A 3E8SA 1A98A 2UZ1B 1Y4UA 5FI3A 2XHEA 4DWVA 2ZU6A 4Z4HA 5JCZA 1KR5A 4QL3A 3Q8WA 3PXAA 3DDHA 2L19A 1P19A 2ZGVA 4LY9A 5E6SA 5EZ6B 2CD7A 1W85A 1XYYA 4GRIA 3E9MA 3COWA 3EH2A 5DTJA 3SWWA 4AKEA 2DUWA 3NIBA 4HLDA 1YJCA 1A4RA 1Y37A 3KLNA 3KYDB 1X2GA 2BM1A 3BULA 3OF2A 4LXXA 3IELA 3A6GA 2C4VA 1LCIA 2FYTA 4Z51A 3NIWA 3NGLA 3GPIA 3WNZA 5IM5A 1E1RA 4DMRA 2C9OA 3HKBA 3GJXC 3D6TB 4UDNA 5CLIA 2IFEA 2BWJA 1XQ6A 1CEQA 1JT9A 1IXSB 3DV9A 4JN6B 1ISMA 1XKLA 5A9TA 1RMTA 3MAAC 4KE7A 1UZMA 3FZGA 1HFWA 1JB1A 3CMCO 1G5FA 3LA8A 4CLHA 4UM7A 4DIOA 3ORRA 3Q88A 4KO8A 1WZUA 1HYGA 2ZIGA 3WRYC 3IVAA 2FNAA 2G1AA 3F49S 4HI0E 1YZYA 2O4CA 2Q3HA 3IJ5A 3ERRA 1QZZA 1IEWA 2Q07A 3EFBA 3IO3A 3QX9A 4JLAA 3RC8A 5DGXA 4LMBA 4LBWA 5AK5A 2UAGA 1WSWA 2CL6X 4EUHA 2IY5A 4NCNA 4IINA 3RSZA 1E79A 2B98A 5SY6A 2EAUA 4KAAA 4K9QA 4HUQB 4GZ6A 4TRRA 2IODA 4WEQA 1X19A 3MWKA 4LHWA 5BXYA 1QYCA 2CKDA 4AMZA 3AR4A 4H6XA 1YQQA 1RLIA 1VECA 3FVTA 4M0UA 1NYQA 3LYHA 4HGYA 3F3KA 4BAUA 3DMTC 3WB0A 2D5LA 3RG8A 4BMCA 2XCLA 3FRIA 1QH1A 2IBSA 4MCIA 3K94A 2WTBA 5CW1A 4COKA 4EABA 3EOBI 2H8GA 4FCWA 3VHXB 3SMQA 5C7IO 1DI0A 4KQEA 1EFPB 1ZK3A 2V9ZA 4HMPA 4RXMA 1SD5A 4BN0A 4Z7QB 2O8DB 4BO0A 4JFRA 4PO8A 4RTKA 3FCEA 3SZRA 5IASA 4AJEA 2WP0A 3NS7A 3IMCA 1F8FA 2BP7B 2C88A 3B78A 1W6RA 1Q6ZA 1TF5A 2JZOA 4FWIB 2X8JB 1DNPA 1P6QA 2QSYA 1QE0A 4UMFA 4DV1B 1LNSA 2PLFA 4CKBB 1E9BA 4HUTA 3H9BA 1DAMA 2PDAA 3GMSA 3IOYA 4Y2QA 3DEAA 5BWOA 2JG3A 5T3UA 2XYRA 3ZYZA 2I7VA 3P9XA 4IZ6A 1OWNA 4PXSA 4YXFA 3AHFA 1R0BA 4XZ3A 5TPZD 4ES6A 1EAMA 2O3TA 2QP9X 2NNWB 2GYWA 1SZJG 4YP1A 2BFCB 4JOQA 5CYPA 5BN3B 3PUIA 4QXAA 2EW8A 1NIJA 2FN7A 2JH9A 3SDBA 1LI5A 2F3UA 2PXHA 4IIFA 3QWHA 4WCFC 1GG9A 3DFIA 3U1VA 2DSNA 3ZG6A 3T7EA 3RLFA 3DVAB 4TWBA 4WXRA 3ZVRA 4PHFA 4ZCTA 5AW0A 3NW9A 2WVJA 5AHXA 5F4ZA 1ISPA 3DAYA 3P2OA 5TVGA 1GM5A 1XHLA 1FQKA 3NBXX 3D4LA 4OD0A 1SK9A 2BEWA 4QOSA 3V8KA 5KVQA 3SS9X 2WFAA 1I1HA 2AN5A 1RKBA 4I50A 4G1FA 2G4CA 4YRJA 2ZKIA 3RVDA 1BYIA 2KW5A 5JO9A 4BCBA 4CQLB 3MHTA 2ID9A 3DWGA 3T06B 1KJZA 2D0DA 3PGVA 4ZI7A 1HORA 3UK7A 4P72A 1EVKA 2UYOA 4L5JA 5JSFA 1FRFS 4DJJA 4G0VA 3E1SA 3R6GA 1C50A 4J2OA 1EUCB 4NZ9A 1II0A 5EHNA 1O8CA 4KQFA 1P7PA 5AI0A 3UV6A 1RFLA 3E27A 3MS7A 4KQIA 4D6PA 1ZGAA 2XB8A 3O4IA 4HWRA 5EJ6A 3PRYA 2CB0A 2HRZA 4L1KA 4N47A 3CUEF 2WC1A 1FNDA 1OA0A 3WYCA 3ZCSA 1JZQA 4YRTA 1B16A 1WBJB 3FWNA 3EQ2A 3HG7A 2G5CA 4CKYA 4TYWA 1ORIA 1QV6A 4NJMB 2V0NA 1CUWA 3MTEA 4CMIA 3UZUA 3CJRA 4B1FA 5J2TF 1PQUA 3LF1A 4H6WA 2QQ0A 4LZZA 3UKJA 1Z6AA 4M4SA 1QHHB 3JQFA 3Q6IA 4E46A 5IKXA 3EZNA 1G38A 3K6SA 2AI1A 1K66A 4NXNB 3QFCA 5SV2A 4AFNA 1WUIS 1THTA 3LPMA 3TLZA 2QGNA 1UIMA 3GVPA 1I5OA 3A7UA 3FLEA 2E6KA 5ALJA 1E24A 5AXAA 1E2EA 2GAIA 1O54A 2C9CA 2NSLA 3C39A 3L1JA 4HBGA 4GUDA 1RC8A 4MW2A 2FOLA 3L1IA 4RY8A 1Z4PX 3KPWA 1T15A 4EMUA 2V7QD 4BEVA 3EFRA 3IHWA 4ZK2A 1BE6A 4CYMA 1E4EB 1CE8A 4ZVTA 1QM5A 4TYNA 1A8SA 1K6JA 3R76A 2CK3A 3GIWA 3ICEA 1GAXA 5I8PA 5THXA 4RDXA 1HURA 2AW5A 2MSDB 1PJLA 1Y80A 2Z8XA 2AG0A 3BE5A 3DCNA 5CPFA 5LB2A 3TTUA 3W6NA 5LQKA 4IIYA 4U6QA 1N57A 2Z2IA 3MZ0A 1XQ9A 3O8DA 3CR8A 2QY9A 1PNOA 4WL0A 5I7SA 4WOCA 4L78A 4H16A 4AYWA 1OXSC 4AMUA 1JMYA 2DC1A 2YQ5A 2RHHA 5JFGA 4S1TA 3MAGA 1J2EA 3EASA 2VAWA 1Y5IA 2WMYA 2NTNA 3JQ7B 3L6DA 3PWSA 4QEKA 5A2GA 2PSSA 4IUDS 1DEXA 1HLFA 1RC1A 2ETXA 3OC6A 4H59A 2QRJA 1ZNZA 3DJFA 4NBNA 4P58A 2P5UA 1B3BA 5JMOA 1R3DA 2OHVA 2ZUCA 4GMHA 1DBVO 3ODGA 3WKAA 5MGBA 5L3QA 3KTFA 1EHIA 2DTXA 4Y2XA 1MOSA 2QPOA 4GOKA 4YQEA 1SELA 3IE2A 1UMKA 3O3CA 4QEDA 4Y1RA 3R8CA 2M1XA 3L41A 1CG6A 4D0SA 2LDBA 4WK2B 5I5EA 2IE8A 3EDOA 4FPXA 2IHKA 4C0HA 4L9RA 2Y0CA 5A1TA 2O0HA 4GXRA 2JEOA 2PO7A 2EX0A 3K1YA 4CFYA 3PNLA 1O77A 5C53B 2OZKA 1JFFA 4UJ5A 4KO2S 2GXUA 1XL0A 2WA2A 4GR5A 1UKZA 4OHKA 1Q14A 4RQAA 5DHTA 3QKTA 3SQNA 2I5PO 4NE2A 2IDZA 3GCXA 4YRDA 2PT9A 3UBMA 2NO5A 1II7A 3AXTA 3BBPA 3IR5A 2FPLA 3G49A 1RAAA 2VCHA 1BBUA 1BS2A 4Q3CA 1ECJA 2P90A 3CNHA 4OLHA 2H3EA 3BWYA 3P5SA 4II7A 4RMJA 5CB4B 2I8AA 4J0DA 1ZS9A 1V2HE 4NU5A 2EYUA 1KRWA 2X86A 3DAPA 2WM9B 5CMLA 1W2WB 3DVQX 4MMYB 2DYKA 3D5EA 1AHHA 3DTTA 5JC1A 1MX1A 2CJWB 1ISGA 1RYDA 1UKVY 1K86A 1KMIY 3L6RA 3LUDA 2JEYA 2QRGA 3G1WA 1Y3FE 3CH7A 3RUDA 3RAPR 4KC0A 2ZSAA 1UBNA 2A5FA 3O8CA 5BURA 5JWOA 2G9RA 4Z3OA 4MV4A 2CKMA 4UVDA 1SBYA 4HC4A 1FA9A 1VGRA 1CY0A 3BGVA 3BMCB 1CRWG 1T9HA 3OOSA 4ECAA 4LECA 4I5EA 3VVCA 4HLCA 2NUTB 1QIEA 3A7DA 1SHTX 1B14A 1XKQA 3SOZA 3KB8A 3SFZA 4XASA 2EF0A 2QX4A 3BCSA 4RORA 3DPUA 2C1XA 5JSZB 1YQUA 1O97C 1X55A 1XZKA 3AINA 3TRJA 4F4HA 1X94A 4B2LA 4UNPA 2VEOA 3NOVA 2ACWA 3OT5A 4WLNA 5ERXA 1TKBA 2GUGA 5D3MA 3ZLBA 1NMZA 1J23A 1V5IA 3DQQA 4ZRDA 1M1XB 1W581 2OLEA 3T52A 4LRUA 5CIWA 4B35A 2XUKA 1ZICA 2J9FB 1JTEA 3LKDA 4V1CI 5JAOA 2DQZA 2V7BA 1W4AA 1V8FA 3DE3X 4MRPA 2AF4C 3UKDA 1E1CA 1KJNA 1TIPA 3MUOA 3KT6A 1DO0A 4RL6A 2Q2VA 4MP8A 4YLYA 5CB6A 1X7ZB 3GLSA 4A1OA 2J30A 2Z09A 3UUEA 4NHOA 5EPEA 2IPOA 4NNOA 1D1PA 3DGFC 4KODA 4YLEA 3DFUA 4BGDA 2Q5CA 1XK7A 3MHPA 4EG7A 5H3CA 2I87A 5BW8A 1JR4A 1KU0A 4MPTA 3AX6A 4DLSA 5BUQA 5E0KB 1X13A 3HBLA 1N2CB 1DUVG 1I3MA 1KKLA 2GKSA 3JRNA 3KFXA 4GFDA 4KCGA 4X45A 1OLXA 2AFHA 2PFGA 5L4SA 4P83A 1YCDA 2BMVA 4YCDA 2O8EB 1Z8HA 3WMFA 1U3CA 2FSFA 2XGJA 3THYB 1AZWA 1HLGA 3OQ1A 2IYTA 3PR2B 4TGLA 1XG5A 4MP3A 2ZWMA 1X6VA 3PNBA 1JFSA 4PZYA 3D3WA 2YUTA 3I04M 4A0GA 1O6ZA 3N8KA 3PVZA 3L2ZA 3CVVA 2JLZA 2HNIA 1VKOA 4KHZA 3C7DB 4FBKA 2HLDA 3M1YA 3OE5A 1T0IA 5HM8A 4TTIA 3OP4A 3BBLA 1N34B 3W04A 1R0ZA 3OM8A 2ZANA 2W4QA 2B1IA 3N3BC 1KQPA 2QN8A 1VPLA 4QUIA 2WSSD 3G5LA 4D4IA 3KKKA 3GCDA 2PXXA 4UZSA 5C51B 3C16C 4RGVA 3HR7A 4EG4A 1UJ2A 3KLPX 2Q7XA 3OQBA 2Y1WA 3QE9Y 3GCGA 1E2DA 5DTRA 6GPBA 4BJ1A 3LUHA 2VDUE 4D74A 1LH0A 1BFUA 2G08A 3VZQA 2DOKA 4AQ7A 1OXUA 4DLUA 3S2SA 4YQFA 4GBMA 4GMXA 4I08A 3LC1O 4HGRA 2IS2A 1E3QA 1RWOA 3UGQA 2F90A 3QSYA 2A9QA 3OTQA 4RZUA 3U3KA 4UUBA 3O8RA 1M2FA 1XRNA 1Z13A 2JLWA 3R5SA 2ZBPA 1MO2A 4LDNA 3T1QA 1O6BA 3ZX5A 1UADA 4JVOA 4J1TC 5CB0A 3C7TA 1BG6A 3G9XA 3OIWA 3T3NA 1U2QA 1JMVA 1UBUS 2PKQP 1Q7BA 1EA5A 2YC2C 3S1AB 4RTNA 2XI4A 1GCUA 4BO7A 2X3FA 1FFWA 2H63A 3HDQA 3W06A 3WGJA 4JC4A 4JL5A 4AD8A 4MKGA 5LR6A 4F6RB 2EXXA 1Q1ZA 3L07A 1DX4A 2M2IA 4EF6A 5I7HA 1ESNA 1DCJA 1XEFA 2XXBA 1O94D 3O31A 3S1SA 2V4MA 2C5BA 3FBWA 1ETUA 3OBIA 4HTFA 1E98A 4N3BA 2XGTA 2ZJ8A 3DNMA 5KSOA 4J2HA 3VPCA 2A5YB 2IUEA 4X97A 2ARTA 2WOJA 4EA9A 1UXKA 2QZPA 5CT4A 1JLMA 5DLDA 1VPTA 2B30A 4X1IB 5CCDA 4DV3B 4AICA 4LJRA 4BXOA 3DO8A 3DZGA 3SQXA 3NTLA 3AJEA 3SLGA 3WB9A 1OFVA 1RSZA 5A9SB 2HSGA 2J4DA 1T8TA 1Z0FA 3G5AA 5EXSA 5EE1A 2HNKA 5JVDB 2NLOA 5T4HA 4GC9A 1VYHA 2I54A 4X3OA 3PPXA 2V6MA 3ENKA 2WT9A 3N87A 1P0FA 4OSOA 2ZREA 4TL6A 4EOGA 4WUTA 4CH6A 3M5WA 3RFTA 1Y7TA 2ODAA 3WY9A 3HCWA 2XT0A 3DKKA 1UQUA 3HCCA 4EHBA 4KSCA 2Y4NA 2I66A 4RA9B 1GTJ1 1OYVA 4WK4B 2XWJI 4R9VA 4LNSA 3HTXA 2MMGA 4Q0MA 3NTRA 1M5UA 2BT4A 2CSUA 1W76A 3M6IA 3L0BA 5E38A 3UG6A 4CPDA 1RVDA 1TMOA 1YZFA 4RQEA 3H9QA 3AJDA 2ZBVA 1GSHA 4C1BA 3E8XA 1VTKA 5LN1A 2B1QA 1KGDA 2V8BA 2VP2A 2JBAB 4X8MA 2RI0A 1MUUA 3CX8A 1JR6A 2FYKA 3EGDA 4BLRA 2GCOB 2SCUA 1NJSA 1OSNA 1U02A 3MQZA 1X7HA 1ZSVA 2GFQA 2PUWA 2R7LA 5FOTA 3CUUA 1A7UA 3WL5A 4FDTA 5F2KA 1DP4A 1EH5A 4ROTA 1EM8B 2WYHA 1RKUA 1U2PA 3A14A 4GPTA 4NQZA 5DI3A 2M71A 1UJ6A 4GGOA 4R98A 3T9BA 1WUYA 3ZY5A 4DLBA 4EBFA 3EOAI 4JEUA 5JAHA 4R54A 5DGDA 1JHQA 4I0WB 3NO4A 4XJXA 3IURA 1E0KA 2BEUA 1SM4A 4RNCA 2AZXA 4B44A 1TUEA 2NUPA 2ZRAA 3O8LA 4B7UA 2OHOA 2QKYA 5CFQA 4HT3B 2OO5C 1U4NA 1D0IA 3CNOA 4LJLA 1SIBE 2XQGA 4Y2JA 1IAVA 1DG3A 1PQWA 5HOEA 3WWZA 1LK0A 3FIUA 4KX5A 4LMPA 1B70A 1N75A 3CNEA 1BVUA 1J7KA 2FEAA 2XA1A 3OSZA 1M7HA 3V4SA 1M8FA 1JFVA 3ZV4A 1V1MA 4EKIA 4D9GA 3ZN2A 3V8JA 1AQIA 3MINA 3T9FA 1EG2A 1MA3A 3WGKA 5MN6A 5E9AA 4J0EA 1YZGA 3G2LA 1X2BA 1KEZA 1SC9A 1JVBA 2H4YA 3NANA 3B2QA 3HABA 3REOA 1EUDB 3ZDEA 3GLIA 1G6OA 4XIGS 1T5SA 3O5AA 1C1XB 3R0XA 1PAVA 3S7ZA 521PA 3WSWA 4UOEA 3DXFA 2H17A 3EUFA 4RVCA 3DTVA 4JBNA 1PX2A 4XFKA 3HRHA 3W1WA 3HNPA 2XDQA 5AVOA 3EYAA 3O3NB 1IN8A 1GN8A 2PVSA 3P9SA 2ZXUA 2WJ6A 3H5TA 4IMIB 1BIAA 1WXQA 4OKSA 1BE1A 3LY9A 1H85A 2VN8A 2X3YA 4HLUA 3RSOA 3FDXA 2PUFA 2HJ9A 3W0LB 2JVKA 3AYXB 1RR6A 3WISA 2Q3LA 3A1WA 1R6BX 4WCDA 1N5DA 3EMVA 1TADA 2X2EA 2G83A 3TQCA 1PYDA 2P8SA 1JJIA 5JROA 3H5VA 3JAMA 1RIFA 3K0AB 3EWSA 1DAIA 1PZMA 4HEQA 4JR2A 4KK4A 5CBPA 1E9AA 3PZBA 2ID8A 1PK8A 2W00A 4E5PA 3G5MA 3ENZA 1DOHA 2FGKA 4GPAA 4AZSA 2HWYA 3UAOA 1IQRA 2JK1A 2HMAA 2HSZA 4G85A 2HJRA 2JGAA 4D8WA 1WBBA 4PEVA 5IW8A 3RREA 4CVNA 1LBQA 3EZ7A 1NUQA 1R4AA 1SWVA 2WVHA 4JT4A 4RACA 3SYTA 5JEDA 2XXAA 3USES 3NALA 2C7BA 2VTVA 3MGAA 3HFZB 1EB8A 1M2JA 3HV2A 3ER8A 3L79A 1VIDA 1VHQA 4WUVA 2RC5A 5KYVA 4DGSA 1AF7A 5BR8B 4MSUA 1QAQA 1AN0A 2P75A 3G17A 3V1NA 5EJEA 1PSWA 1ABBA 2YFQA 3L7KA 2E82A 5HW0A 4P9NA 3NWEA 1SCKA 4BVFA 4LVMA 1NASA 5A0TA 2AN9A 3RO7A 1D0SA 4QARA 4X7PA 3QYPA 4QXMA 4AG5A 1LGYA 2O5EA 1FFXA 1URPA 3E22B 3Q87B 3T1VA 1UFKA 5KQMA 3RWOA 4AAYA 1Q0PA 2O07A 3QXXA 1KBQA 3H1FA 5AM0A 4CH5A 5BQFA 1KWGA 3MQ4A 3TDNA 4B8ZA 2QN1A 3NAZA 2J0SA 3FJYA 5IK2A 5AVXA 1SOMA 3RUFA 4E5DA 5KYYB 1FXWA 2BFEB 2WLSA 4IHAA 4M87A 3GYBA 1MN6A 2X40A 1LY1A 3UB2A 1MRSA 4OGKA 3KUUA 3KFVA 1JEDA 3DF9A 3E23A 4Q6BA 1BVRA 3EIFA 3IMEA 3ASUA 2UUBB 1BGWA 1PVDA 4C7OA 3LT1A 1K63A 1GDDA 4ATNA 1WXXA 4I55A 4ZAZA 3LO8A 2FUCA 4TMVA 1U2GA 4BGIA 1BC5A 1JBEA 4X92A 3DNFA 5B12A 3VKWA 4EQ6B 2VJMB 4EF5A 2G8NA 2PS0A 3HK2A 5DN6A 3WJAA 4EP1A 4ZVVA 2NVWA 2P6PA 1POXA 2W6PA 2W8BB 3JYQA 4M54A 5DLQC 3KUCA 3ZYCA 3BHIA 1NBAA 1WSDA 4M0EA 3WDMA 3CLRC 2IW3A 3RSGA 4F1JA 4M36A 3QF7A 1X9HA 4LFCB 2QAIA 4MUMA 5C4IA 3QX3A 1VJ1A 2NU9A 1P81A 4UM9B 1VI2A 1EFPA 1ZHOA 3NBQA 3QEMA 2EWMA 3KFLA 3KZNA 1R4NB 4Q4JB 3ZWCA 2ASEA 3MQ2A 4BMNA 1S3SA 2HUPA 1OI2A 3AF5A 3LU1A 3DW1X 1NBME 2BAGA 3X1JA 3E3AA 1XELA 1WNLA 1YVPA 4BMVA 3B6ZA 1HQYE 2PYDA 4KQ1A 3WOHA 1KO7A 1N7IA 2QVLA 4R1MA 3I1IA 3DT9A 3TRIA 5LM3A 4JU9A 3K70B 2PKEA 3WQQA 1BWRA 1KKUA 1NE7A 3KE8A 3OLCX 4JLJA 1T34A 4JK3A 4OIMA 4PX9A 4UHBA 1XGKA 5GONA 4HRVA 3IEIA 1TEHA 3LA6A 3SHOA 1E32A 3WNQA 1FW6A 3PS9A 1G6HA 4LVKA 3ZI7A 1U7HA 2CF5A 3JQFC 3RUXA 3EB9A 4PSUA 1YDGA 4CM8B 3JQ9C 3R77A 3GB9A 4ND1A 4FKZA 4HL6A 4M0KA 3AIOA 4R1PA 4TT3D 2ATXA 3K4QA 5GONB 4GU5A 5AW6A 2ORYA 2WTNA 1O58A 4H18A 4I6GA 1SUBA 1C0EA 2JFBA 4JBYA 1M5TA 1NI3A 3ZK9A 1D2RA 3TLBA 1UWLA 1WIWA 4K88A 1KA9H 1K75A 1ZY2A 3K96A 3SSAA 3TH5A 4BRWA 4Q4HA 2UDPA 3PQ5A 4HDNA 3N2KA 2NO1A 1KE2A 4UFNA 1H4TA 3HXUA 2ZVPX 5KX5A 2QU7A 4PN3A 1EVZA 3KXKA 1MHTA 5ETJA 3VR6A 3BZUA 4H3HB 3C3CA 4JMPA 4P7BA 3OOHA 4ESVA 3V80A 2FR0A 2P7HA 5EPOA 2PLAA 1JLHA 1J07A 5TLSA 1ZHHA 3U7FB 1FUKA 1OV4A 1SBHA 2G76A 1ZU5A 2QSJA 4H4DA 4TT8A 3TWOA 4EFKA 5IAKA 2QZSA 4LYHA 3IEKA 2H1FA 1BX0A 5JAIA 4LAFA 2E89A 2PSFA 3E7XA 4PS1A 5EYPA 3TCNA 4KX3A 4XYLA 2VBCA 2FUG1 4L3OA 2HSJA 5H9VA 5HA5A 2JHFA 4YX9A 3ZV7A 4P3OA 3JQQA 3L7IA 4Q3EA 2XBLA 1EBUA 3HI4A 2G5TA 3K1JA 1FQJA 1OI4A 1NVAA 5F2OA 3BE4A 4Q5IA 3Q98A 1GNSA 1QFSA 3KKNA 1ENZA 2WAXA 5I9SA 3EW9A 2JPDA 2QN2A 3ELYA 3L8FA 2O57A 1PV2A 2WIDA 2P9YA 4PO3X 4Z9BA 4DIKA 3OPYB 4ZEMA 1C7FA 1NG9A 3R3WA 2HWXA 1H8ED 5AM3A 1YZKA 2IP2A 3RHZA 4QJIA 3FX2A 1NXQA 3C3EA 5F7ZA 3GRPA 2VBIA 4CQNA 3WNBA 4PW0A 3WYBA 5CLLA 4Z1OA 2V45A 1Z2PX 4EVQA 3I62A 1D5CA 4MR7A 5AICA 1MQ9A 4RD1A 4XVRA 1I6KA 4UHEA 2ZRCA 3HCPA 1CP3A 4P7JA 3WLQA 3PUWA 4DMFA 4NLLA 4UPEA 1LJLA 1KTIA 1Y3AA 3AEZA 3BA1A 4OJKA 3GD7A 3LYUA 1ODCA 4N0EA 5LMZA 4L85A 1NATA 1YU6A 2I1QA 1WCWA 4L2IA 4QECA 2AVDA 2DTDA 1Z2EA 4DARA 2NUAA 1IN1A 2VIIA 2QAGA 2QBYB 3TOZA 2AMLA 1VP3A 1SY7A 3F8WA 4LI3X 3DV0B 1FPQA 3BKXA 1I10A 1ADYA 1XEZA 2G1UA 2CLIB 3MVEA 2Z2YA 3TL2A 2R1ZA 3PFIA 3R8XA 4DDKA 5CX1B 3ZDRA 2E10A 1IE3A 2B82A 4QQNA 3QE4A 3H8SA 1GPUA 1DADA 3L1UA 1X8KA 4G5QA 2ZVQX 4NOJA 1H6CA 1KDTA 2HF7A 3OLZA 3A04A 1J49A 3OCWA 2GZ2A 2OCKA 1S0UA 2APJA 4CQLA 9ABPA 4NS4A 4ZU1X 2GKOA 1VLQA 5HK9A 3AF2A 1H3NA 4L22A 3MWGA 1IHYA 1IOWA 3G2HA 4LY6A 4V38A 5EHGA 1JXAA 4B6EA 4ENRA 3PTAA 1JL3A 3PIDA 4Q4DA 2M6SA 3FCAA 4Z2YA 2ZR9A 3D6FA 5HFJA 1C8BA 4YJ2F 5DOVA 3SQMA 3TKLA 2QPAA 4IG9A 5J43A 2W2LD 1ZQ1A 1U8UA 4F0JA 1CHDA 3B5EA 1XMVA 2Y8EA 1K0UA 3BH6A 3STTA 2M1ZA 4M88A 4Q7LA 3VU9A 3KVRA 4ZQCB 1I80A 5FOUA 1XZBA 3LRXA 1NT4A 4OP0A 1XBTA 1QCCA 5T7BA 5K1XA 3CURA 1BXKA 3TEGA 1I3KA 3JASB 1UQTA 3QYFA 1QRSA 3L0DA 1OFUA 2WINI 3EY9A 2CJXA 1XTTA 3KDAA 4NOLA 2XQIA 2NU8A 3A7EA 5CFNA 1JKXA 1NVGA 2O8CB 3HKDA 5FD8A 2BKXA 3ASVA 4PBSA 5EJ2A 4ZA2A 5FPQA 1Z7NA 2FPMA 5IYZA 1H2WA 2BM8A 4YBRA 5I9TA 1G3MA 1Y8CA 4B3HA 1MBZA 3B8EA 1SD1A 2B8JA 4IS2A 1ZO8A 1KI6A 1RQXA 5CCEA 4KP7A 2PIAA 1HDXA 1U0EA 4IDEA 4V02A 2F3RA 1I7LA 3M6VA 3RSSA 4CRWB 4KAXA 3N5KA 2AD5A 1U3WA 2VF4X 3H16A 3P2YA 1KEEA 4C0JA 4V1CB 2WF6A 4TQ9A 3FUVA 5DK6A 4IJWA 4ZZ3A 3CLTD 3TEHB 2XD4A 1YR7A 3IIEA 2RH9B 3RTBA 2AH5A 3CEHA 3FVRA 4J7UA 5IDVA 3MRTA 4EO9A 2YV4A 3DL7A 1N5OX 5F52A 2ZYWX 1SXHA 4FOLA 1ODIA 3HZRA 4ZVPA 4NZOA 1ORVA 2LDXA 2PT6A 3IUBA 4CI0B 2XVMA 1XP8A 4Y2RA 2VWQA 5LC1A 1MAAA 3DLBA 4LQDA 5DIZA 4XSGA 1KAGA 1UJNA 1STOA 1UBFA 2EFGA 4OJNA 1I9GA 4CEJB 2XODA 3TDMA 3EF3A 4FE3A 1J8QA 4YN3A 1BWPA 1E1QA 1M2VB 3R5TA 5JCJA 1ZJJA 2OCDA 4B5KA 5F9HA 1XCPA 1CQZA 3ITNA 1QB7A 4I1YA 3FTEA 4AUEA 3EGDB 2IQIA 3UJAA 4M6WA 1DOAA 3R5FA 2AKWB 5TJHA 5LVAA 3L8HA 3HTZA 1BDBA 2ZRDA 3QBVA 2A8YA 5H70A 4NFLA 4EBBA 3DD1A 2TECE 4HO1X 2Q3JA 5FADA 4RVDA 3K53A 5GV8A 2O5RA 2MCFA 4GI1A 3TVTA 3U40A 5EJFA 2BN4A 5KOHB 2O48X 3OEED 4L5AA 3AHIA 3INNA 4LNAA 4Q01A 3C3PA 4RV4A 1FTYA 4HX5A 4S1OA 4XRGA 2V7QA 3V8BA 2MSCB 4FKMA 4BX2A 4FBMA 4KVZA 4DG9A 3OJEA 4WVFA 5JD3A 3B3FA 3VUEA 3EAFA 3ASYA 3N6XA 2HWUA 3V3TA 1PR3A 2Q4DA 3SXUA 2YASA 3QPDA 1TF2A 2Q5EA 4MVJF 4TXJA 4Z0NA 1Y3BE 3NDRA 4C05A 3RVRA 5J2UF 3S2UA 4XQGA 5TY0A 5LP6C 4HGNA 4N6GA 4E09A 4I4LA 2VLBA 1QF9A 4DF3A 1XTJA 2W8BA 1ZD3A 1XD2A 3DUFA 3IOMA 5I48A 4BEWA 4RIIA 1NGSA 4M0DA 5KDLA 5HZKA 5TX7A 1NW8A 3HLTA 4BVJA 2QTGA 2OECA 4X8HA 4DV7B 3PHIA 2J3DA 1DRVA 1CY8A 5CH8A 5IWAB 4N7MA 4RXUA 2XBMA 1NG1A 5LQCA 2WKRA 1AO3A 1Z39A 4W5QA 1KETA 3ANSA 4ZOLA 3VR5A 1ULUA 4TXLA 1F0KA 2EP5A 1HDIA 2PPVA 1RADA 2HRCA 4Y2VA 1VL2A 5HCIA 5ITZA 1A5ZA 3IBSA 2H0AA 3PXXA 2V0CA 4FR0A 2ZWAA 4FILA 1KDZA 3ZLVA 1A9OA 4NCIA 4C7MA 2Z3ZA 4Q9LA 3CF2A 4IOKA 4U7PB 1Y48E 3LWNA 1Y6JA 4WESB 3IHTA 3E3NA 2H59A 3MD0A 5C8YB 1XEXA 1MV8A 3I2JA 2ODPA 1CUSA 2EERA 2VSFA 1Q2UA 4BU1A 1GHTA 4MVCA 4JT9A 2GPYA 3B2NA 1NBMD 3T3PB 3ZOZA 3IUPA 4OBXA 2R79A 1QLJA 3TPZA 3VNQA 3GLGB 1OB2A 4WD3A 3ZDBA 1OXMA 4YAEA 1RIIA 1Y5MA 1USGA 4PZPA 2C5FA 2M6LA 4ZHQA 5F4BA 2FPPA 4P6VF 4LCJA 3DCIA 4QTTB 3O93A 3MT9A 2P4HX 4RL4A 3EAQA 3N0VA 2AFIE 4DLPA 1CJKC 1DVRA 1Y9DA 3F1KA 2KMLA 2LTAA 3IO5A 4IEFB 2XNKA 3D6AA 3IA2A 3GC6A 3KR1A 4QYTA 2VHXA 4LJ4A 3W8EA 1KYYA 4O2AB 3VNAA 3P96A 2D1QA 2QQFA 4BDTA 4ZI7B 4ZJZA 4GL4A 3MD9A 1N2XA 4N40A 4NU0A 4JLNA 1QHFA 1K7YA 1TI7A 2A59A 1RM4A 2BD0A 2V9CA 3IE0A 4B33A 1PR0A 2XWSA 2V65A 4QU0A 1RJ9B 1LDMA 3F7TA 3RDPA 4A0FA 1X1QA 4KWIA 1C9MA 3GAZA 3DHEA 2WNHA 4BVBA 1FP1D 4AUMA 1DO2A 5FI5A 3VX3A 1JW9B 3QPAA 1K5GA 2GNAA 3HB7A 3H5LA 3PCXA 4WCFB 3VBCA 3LC2O 4I66A 1YJBA 2Q3DA 4D42A 1WB9A 1IHDA 1P80A 4C4XA 3PVCA 2XEDA 1XF9A 3U6YA 3IBGA 4N8DA 3ADCA 4JXXA 1EGHA 2XCUA 4Z3KA 2P5IA 1QIGA 3CKKA 4I5FA 3LZ6A 4RKYA 1NLMA 1LV8A 1W73A 4BW9A 3ETLA 3JD4A 1I3LA 1XU7A 2JBWA 3V46A 2FKNA 1OLXB 3JATB 3NR2A 2XRYA 3CUSA 2PVPA 3JSXA 4ZOCA 3WJ7A 3A27A 2ZUFA 1LXCA 2C1ZA 1EPUA 1Y7HA 2BUAA 2JAPA 3DE2X 5B4UA 2DUMA 3DLPX 1A95A 4EA7A 5E95A 3TTCA 1U6JA 4FZ3A 4PNHA 5AW2A 5K0GA 5LP6F 3SZGA 1QIJA 1M0TA 2J7PD 4MDYA 2VQSA 1CF4A 4EYSA 3HSKA 4PLYA 4NMMA 4LZNA 4TWIA 3AUFA 5I7UA 3ZDZB 4U3JB 2Z6AA 3ACBA 5JCJD 3OPYI 4Y6SA 1DSSG 1R00A 4LV8B 1GG5A 1F7UA 1Z4MA 3KLOA 3DPIA 1Z5GA 9MHTA 1NSFA 2VAMA 1E1MA 2WZQA 3M9XA 2HMTA 2O8VA 4CFZA 4HATA 3K35A 2GZ3A 2C42A 2H2AA 2XB6A 2Y2UA 3CB4A 3V2IA 1A7AA 2H4XA 4YEDA 5FOQA 5JALA 4K26A 1JEQA 1XLUA 2JIBA 2VHQA 1CUCA 2GCNA 4JKOA 4RD6A 3MTAA 3B7WA 5EC8A 5TPWB 4XYEA 5A71A 1EWTA 4K9SA 2QJOA 1PJ2A 2QMQA 3H1PA 4LBYA 3N2LA 1WOYA 3DQZA 3VSEA 5K7SA 5FI1B 2MYPA 3KSDO 1RYMA 1OAOC 3L0OA 4J7XA 3RUIA 2R6R1 4DWWA 1HTTA 2YRXA 2RJNA 3DYBA 3DCYA 4AK9A 2YZ2A 4PLCA 5JXGA 3LK6A 4IFIA 4RV9A 4R2IA 1JIUA 5AXBA 3GLHE 3IV9A 1EYZA 1IC6A 4JI1B 4O59O 1AKYA 4Y6OA 1KO5A 4MW6A 4Q7EA 4C2UA 3A9WA 3FPEA 1PW7A 4A0SA 1QP0A 1DLIA 2H7XA 4LJSA 4MPJA 5JRJA 2G5GX 1WP4A 2AEMA 3C45A 5DBEX 2BMAA 2YUIA 1FYXA 3DE4X 2OZEA 3PGJA 2D1RA 4V24A 5JBNA 1D2EA 3DHYA 2OFFA 3AVYA 1BD4A 1GGJA 3DMNA 1NA5A 3HY0A 3JAKB 1DAGA 4H3SA 5NULA 1NDHA 1A8HA 4YTEA 1USVA 3DOEA 2XUAA 3LDFA 1WV0A 1T5BA 4ESHA 3GDFA 1VYVA 3HWX1 4CF4A 1FMLA 1CIJA 3TTVA 2A9VA 3ZHSA 5CDFA 3PZRA 1XHFA 2NXWA 2DHEA 3LBNA 2PT5A 3TRFA 4C0LA 4HNGA 1Y6GA 3JVUA 4PZEA 3CX6A 1JLLA 2GO7A 3AUUA 5C4GB 3WXBA 5TGZA 4BJ6A 4ZJYA 3WAGA 1XYVA 3U3DA 5H3HA 2IHVA 2NQTA 5JSHA 3GUUA 5CD9A 2AI3A 2FW7A 2YWXA 2JJQA 2TSYB 5KNCD 1VI5A 1MC5A 1SVUA 2J0EA 2EJGA 1JYEA 5B3JA 4MUGA 1X1BA 2OBYA 3RUHA 1I2BA 1SG9A 2OYSA 5K4GA 1DAFA 2IYLD 2O2DA 3EQZA 2CDAA 1HQDA 1QHXA 5AQ1A 2IBTA 2WSBA 3ZEIA 5IDQA 2PJRA 4Q82A 2H1LA 3FSJX 2YY5A 5AKLA 4YY3B 4G8BA 4DUZB 3C5WP 3IQGX 3IX7A 1VPVA 3WWDA 3QBDA 1Q20A 1LC0A 4I2VA 2QAGB 5CR9A 1U0RA 3ZWBA 4BPRA 5A3RA 4L4XA 3GFRA 1W19A 4WXMA 5B58C 3NC0C 1DRWA 2LP4Y 4W5HA 4NAUA 1NW6A 3CZ9A 2BLNA 3U0VA 4HAIA 1RLTA 2CN1A 4XTVA 1QJ4A 1T9KA 2PO5A 3DB1A 2PX3A 3CSSA 3EC2A 4UEKA 1N5RA 5DULA 3BB1A 3SM3A 4WAUA 2A9KA 1H2HA 2OM2A 3FHLA 3WIEA 1G21E 4XCQA 3IQZA 2PXCA 1UPFA 3H84A 4BKQA 2HBRA 4FJ2A 3AEQB 1EESA 1O96B 1XL1A 4TKUA 5IKMA 1V3VA 1CUIA 3QOYA 2MDTA 3QHPA 3T54A 5ENZA 3VAZA 4US1R 2ZCEA 2DU7A 2W6JA 4QATA 2BC9A 2IXAA 2GVDC 5FBWB 3ZE1B 2GB4A 3I9KA 3RBXA 4RPJA 4P92A 1VSVA 1EX7A 4M53A 1KVTA 4TMTA 2AE2A 2ZW9A 3MBIA 1NQVA 1EAYA 1D9XA 1R0RE 3L0YA 1KVQA 3WOVA 3ZIDA 621PA 2JD1A 1RI1A 4HYTA 1U63A 3DZHA 2KYRA 1IHXA 3L4KA 2BEWB 4GWLA 3L0PA 2OZPA 3MXTA 1HL3A 3S29A 3SF0A 3SZLA 3N59A 4ZZ0A 3OY7A 1N3BA 4S3MA 2X5XA 3EBOA 4RWEA 4G4IA 3ZI4A 3LGXA 1HE5A 3AB3A 2ENUA 1MB2A 2PCLA 2ZSHA 3NHSA 4O0MA 3PYMA 4REMA 2B35A 3VKHA 2WWXA 2OESA 3F9CA 4PYQA 1IEQA 3RYCB 4PFKA 1PD1A 2JAOA 2J85A 3DZBA 1OGJA 1Z18A 4P36A 2Q4TA 2AMCA 1BFDA 4WOKA 2BTQA 2O8NA 1FMJA 2MINB 1VJCA 4FYMA 4R84A 5CITA 1CW2B 2GK7A 1TDJA 3ZJTA 4AJ4A 3WYGA 4HTAA 4XQCA 1BQ4A 3CRZA 4UD6A 2OYCA 2XE7A 1E20A 4JOSA 4BFSA 1XLTA 4G67A 4HWSA 4TV9F 2DSTA 4JP1A 3G0DA 3IKJA 3N7AA 1N25A 3ROKA 1E1DA 5CNMA 5I01A 1NPDA 3RKUA 4IWXA 4AZ0B 4BFLA 1K97A 4ZTZB 2BHLA 4FLFA 3OQVA 1TD9A 4LWZA 4D9CA 1JEQB 4ZI5A 4MWZA 3OTHA 1A88A 3T3HA 4JH0A 1RXCA 1UDWA 4IS3A 1CUAA 4NI5A 3HDVA 3JD1A 4QQKA 4XB6B 1LSJA 3EVGA 4P98A 3RJMA 1LNQA 4WBSA 2WTEA 3ZQ4A 1GPBA 2H1OA 1NW5A 4L4SA 4QFMA 5COQA 1YMUA 1DRUA 3ESBA 4OMDA 3CT6A 2IOHA 4HDMA 4HH1A 1Z6ZA 5FO0A 2C7GA 3GJ8A 1YDFA 2PJZA 3NJ8A 1IUNA 5CNKA 2QXUA 3X1MA 4A92A 3A0RB 2E4YA 1F3OA 4BC1A 1ZUNA 2QN9A 4MWCA 4QM7A 3HVJA 1NFQA 3TYXA 5IRCD 2WBLC 4OHBA 3PENA 6REQA 2FMTA 2I2WA 4QOEA 4R16A 2C20A 3AETA 3L1KA 2VG8A 4ZCPA 4TTTS 4BFYA 4AY3A 1K89A 2CSXA 1JI3A 2Z5LA 1Y89A 3R0ZA 1EXDA 1T8UA 1J39A 3NM5A 3QTTA 4MLPA 1KJ9A 2YJ4A 3BJEA 3CYFA 1XF1A 1CVRA 3OEWA 1TQ6A 3C3JA 4FGLA 3UFGA 3KHUA 2JGDB 2BGMA 3HL4A 4D4LA 2GCGA 5C34B 1QTNA 1YVDA 1Q7TA 3BD6A 4DPGA 4EHDA 1T35A 2G5PA 1J0XO 4C78A 1SZDA 1N92A 1P2DA 1VB3A 1XUOA 1I3OA 1L7RA 3DA8A 3TOEA 3NUZA 4OHOA 3T0GA 3WKBA 1ZXLA 5K3DA 5B3LA 2QN7A 3V4PB 4E88A 5IG2A 2ZBUA 4WKPA 3FKJA 4V2UA 1OUMA 4WKBA 4ZICA 4FBWA 3CSDA 5KTYA 4DKJA 3VC7A 5LD2C 4BWYA 4JASB 3F3MA 3BJRA 3AQ4A 2V7XA 1ECPA 4ND5A 4ZT6A 2P0EA 4IAOA 4MQUA 1TM2A 3EDRA 3O4FA 4W1RA 2B3TA 2ICAA 2OV8A 4TM7A 2M9MA 5REQA 1V25A 4YP9A 3SKVA 5KU7A 1H8EA 3U37A 1GQSA 1TJNA 4OJQA 3AKEA 3BMOA 1N5KA 1D1QA 1YL5A 1OC4A 4YVFA 3LQ1A 3RB8A 5ADVA 4BTLA 4F9EA 3OVMA 3BWXA 2VF2A 2DPXA 1PFGA 3P71T 2W4IA 2X76A 3TQHA 1EXVA 4FN4A 2PGIA 2DDZA 2HRBA 2R11A 1W8DA 2Y0BA 4ZI2A 5F5NA 1PTJA 2HMVA 2IT1A 3DV0A 4RCYA 1MQAA 3KR0A 2AZTA 5T64A 1PG5A 3UMJA 4KL8S 1XTPA 5KOYA 1E0SA 1A96A 2H4JA 1PR6A 1ULAA 4QLAA 1I7NA 1IPHA 4WXEA 4DADA 2D5CA 1WW3A 4RHXA 4YO7A 3NT2A 4GC5A 3U6BA 1XEXB 2W6OA 3ZH2A 4RK7A 1G55A 1RAIA 4EY4A 3PWZA 5FUVA 2C78A 2HJHA 4XB2A 5LDGA 3UJDA 1AOXA 1B41A 2C2HA 3DAOA 3FD8A 3FVVA 3ETHA 3I83A 2V54A 3ITDA 3R0VA 4FQ8A 4Z1MA 3JQ9A 3HY4A 2H4FA 1VKJA 2XTAA 4KRYA 4AB1A 4PX2A 1HYEA 4UD2A 3THOA 2J6BA 1JEEA 1CX9B 2VHTA 1OU4A 2ZIZA 3PCTA 3PICA 3C3DA 4P86A 1O9HA 4F8EA 3PX7A 4KYTA 5G2OA 3K0AA 3LQRA 2R6CA 1D7AA 1KXZA 4D8TA 2I22A 5CB8A 1Q11A 2OY0A 3JV7A 1FMCA 1K3TA 2CNKA 4HRAA 1J1IA 4PGHA 3ZCUA 5CBPB 5KU1A 5IDYA 4F56A 2GEDA 4QFCA 3UOAB 5FPSA 4G0UA 1V8PA 3QMPA 3ZGZA 2P8JA 1Q1GA 2C04A 1TVKB 2CXXA 3HPRA 2XMSA 3I6IA 3OSUA 1OX5A 4QYXA 2B4YA 2KSQA 3BXXA 1TM3E 1KI3A 2JI6A 5KNDA