4K88A

Crystal structure of human prolyl-trna synthetase (halofuginone bound form)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
497
structure length
490
Chain Sequence
b'LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proline--tRNA ligase
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 143
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k88A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k88A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k88A02
4TQDA 1ADYA 4H2VA 1QE0A 2RHSB 3HXYA 2CIMA 3ICAA 2E1HA 3UH0A 4XTWA 5HGQA 3QO5A 1KOGA 1NJ8A 2AKWB 1NYRA 4LNSA 2EWNA 3IKLA 1FYFA 2DTIA 1ASZA 1EOVA 1X2GA 3QNEA 4YCVA 1NJ5A 3NENA 3HTZA 1BBWA 1ATIA 3IKMB 3RF1A 3A7RA 4YCWA 5F5WA 1B76A 4XU0A 4XEOA 2G4CA 3LSQA 4YCUA 4P3PA 1BIBA 4CH5A 3A32A 2DU5A 4TQFA 2P5IA 2ARSA 4EO4A 3NELA 2ALYA 4P71C 4TVAB 4HWSA 2QHTA 2DTOA 1E1OA 2DJZA 1WU7A 2ZT8A 4J15A 4YRPA 1SESA 3L4GB 2ZIMA 1WNLA 4BWAA 4XTVA 1RIQA 2PMEA 2ZT6A 4AH6A 4DPGA 1ASYA 3UGTA 1H4QA 1J5WA 3VQXA 5KNNA 4YRNA 3REUA 3REXA 2ALYB 4YDQA 2DDZA 3RACA 1NNHA 3BJUA 3HRKA 4YREA 2AMCB 4WI1A 2P0LA 2I4LA 3V7SA 1HC7A 4YPFA 2ODRD 2J3MA 4DQ2A 4OLFA 1WQWA 4Q6GA 2E5AA 1B7YB 3V8JA 3G1ZA 1YFSA 1YB3A 3OD1A 4CH3A 4OP0A 4P73A 4YRJA 3HFZB 4UP9A 4CS2A 1HTTA 3EFRA 4HWOA 4RQFA 2DXTA 1GGMA 1B70A 4CS4A 3QO8A 1USYA 5ELNA 1N9WA 5C51B 4UPAA 3DSQA 2Q7GA 4YRTA 3A5ZA 3RUXA 1YFRA 4YRGA 2EJGA 3I7FA 3RGLA 4TVAA 3RKWA 4YRIA 4TVYA 4P73C 3LSSA 4RMFA 1NYQA 4P71A 4XTZA 1NJ2A 3L4GA 3HXZA 1B8AA 3E9HA 3RL6A 4P3OA 3V7CA 4CH4A 1E22A 1USYC 4UP8A 2I4MA 3V7RA 1B70B 3RKYA 3V8KA 4YRLA 1JJCA 3FJPA 4G85A 2ZIOA 2DQ0A 2I4OA 3MEYA 4Q15A 2DTHA 4XEMA 1WPYA 1EIYA 4YRKA 3NETA 4RQEA 2ZT7A 3IG2A 4H2WA 2ARTA 2E10A 2LW7A 2AMCA 1X2HA 3A7AA 3UGQA 1WLEA 1X56A 2DEQA 4YRMA 4L87A 2CJBA 2EJFA 2PMFA 1B7YA 1JJCB 4YP0A 3TUPA 1NJ6A 2C7IA 4H2XB 3HFZA 1SRYA 1PYSA 1EFWA 4P75A 1EIYB 4P74C 2IY5B 4YRFA 4H2YA 1QF6A 1X55A 5ELOA 2ZT5A 4XU3A 2ZZGA 5K1PA 1C0AA 2E64A 3A7UA 4WJ4A 4CH6A 2CGHA 2I4NA 2ZR3A 1YFTA 4X5OA 4UP7A 2CJ9A 1G5HA 3PZCA 2Q5HA 1KMNA 2FYKA 3L1AA 4XU2A 2CJAA 3HXXA 3HY0A 5K1XA 4P75C 4YYEA 4E51A 3LC0A 4PG3A 1PYSB 1NJ1A 4H02A 4TWAA 2Q7HA 4YRQA 3UFGA 4H2SA 2DVEA 1L0WA 3TEGA 4P3NA 1H4TA 1ADJA 3PCOB 2XTIA 4CS3A 2E3CA 3MF2A 3TEHA 2ZR2A 4P72A 2E65A 3KFUA 2DKGA 1HXDA 3VQYA 2ZINA 1EVLA 4ZTUB 1KMMA 1X54A 3HY1A 4HWPA 3QTCA 2E41A 4BW9A 4TVWA 2ZXFA 3A31A 1G51A 3CMQA 1Z7MA 3V8LA 1YGBA 4H2UA 1X01A 1V95A 1Z7NA 4XTXA 3VQWA 4P72C 3P8TA 1VQZA 3TEHB 3MF1A 2QHUA 3BFMA 2RHQA 4WJ3M 4H2XA 3EFSA 4KR3A 2DQ3A 2C8MA 2IY5A 1BBUA 2ODRC 4HWRA 2ZZFA 2XGTA 4P74A 2ZNJA 3RIRA 1E1TA 4WF2A 2QHVA 4G84A 4NCXA 4TTVA 2ZCEA 1IL2A 2Q5IA 11ASA 4K88A 2EL9A 1SERA 4O2DA 2ZNIA 3NEMA 1SETA 4K87A 1EVKA 3L2ZA 2RHQB 3HRIA 4KR2A 4XTYA 12ASA 3R07A 2EJ9A 3IALA 2ZZEA 2DU7A 1EQRA 2HNIA 2DZCA 1H4SA 3M4QA 1BIAA 5C52B 3HXUA 3PCOA 4KQEA 2ZGWA 4YROA 4EX5A 2QHSA 4ZTZB 5E3IA 3W3SA 3M4PA 4K86A 4YRRA 3RKXA 2Q7EA 4YRCA 3VQVA 1G5IA 2DXUA 3A74A 4RDXA 3P8YA 2EAYA 1H4VB 2ARUA 3ERRA 1E24A 1W66A 2J3LA 1WQ7A 3HXWA 4YRSA 2RHSA 1WYDA 3HFVA 4XTUA 2DZ9A 4PHCA 3HXVA 2AKWA 4HA8A 1LYLA 4HWTA 3E9IA 4XU1A 4H2TA 4ZIBA 5C53B 3VBBA 3A5YA 4HVCA 3QO7A 2ZTGA 3P8VA 3WQZA
chains in the Genus database with same CATH superfamily
4JT9A 5LU8A 4WVFA 1B42A 1U3GA 4DUPA 3K09C 1BROA 3O7WA 1JA1A 1GZSA 3BD7A 3M1LA 4Q3LA 3KBOA 1J5EB 1V8FA 2J6CA 2V7GA 4MYDA 1VR4A 3WWOA 2CNWA 1WEKA 1KMQA 4DQ0A 1SUCA 3C6ZA 3UUEA 3K6SB 1I6MA 3BC1A 3E48A 3GJ7A 3R41A 5IX8A 2WZCA 3S1SA 3MWEA 1OTXA 3KHSA 4GL4A 4WCVA 5FAKA 4MHOA 3VHXA 1UFVA 2WW8A 4HYEA 1XQXA 1Z37A 2EWNA 2QMYA 2SECE 4KAAA 3TTTA 5D8DA 3PX2A 4CMGA 4DR6B 2II6A 3S27A 1MDBA 1OYOA 3BWVA 1XMVA 1JBEA 3GRYA 4YP9A 1YI0A 5EVCA 3U49A 1L4NA 2QG6A 3NENA 2OV3A 3ISVA 1EB8A 4D4GA 3IAHA 1Q5PA 2XEDA 5KIAA 1E9SA 3VPFA 1R9GA 2QG9A 1Y6GA 5IAAA 1VRCA 2QXUA 4DR5B 1IN4A 2OCYC 1YL5A 1MKYA 3K0AB 3JWIA 1FJ2A 4QXRA 4EEZA 3CRNA 1KL7A 2WYUA 4MWZA 4TLAA 5EWMB 5TXGA 4CPDA 4F6CA 2GT1A 3UMYA 4RTOA 3MT8A 4IDCA 2J9YB 1JILA 1XLTA 3F9CA 1H2HA 1XQWA 2I78A 3B48A 1OROA 4L85A 5IEBA 5HZKA 5GJBA 3RLIA 3R6WA 1JHQA 3IMEA 3TTVA 4NOKA 3N7AA 2BMDA 3I2IA 5KTKA 3F73A 1JB1A 1VLMA 2VHYA 3RBZA 2EK0A 4F92B 4KQ2A 4NU6A 1A69A 2EEZA 1PI3A 1OWPA 1H2AS 4NX2A 4WNAB 4YEDA 1C3LA 2FMUA 3FTDA 1UWLA 2WUFA 3A6ZA 2P5IA 1WB9A 3UW3A 3MLAA 2HPHA 4IYRA 4XVCA 1GG2A 3QSGA 4X8LA 1KR5A 4QA9A 3K0SA 5EP4A 2OEPA 3ICCA 5JD3A 2QHTA 5EHGA 1TUGA 2TMYA 1E60A 4LDAA 4HGYA 5JTTA 2O0LA 2QQ5A 4F2DA 4DG9A 1EKXA 4S12A 4JXJA 1LKZA 3LPCA 2P11A 1NU8A 4BNJA 5CB8A 4JB3A 4JJAA 2YWBA 4IKEA 3KEQA 1GNLA 1VG1A 2GERA 2VAWA 5JJLA 4BLSA 4BKQA 5KYWB 2M32A 2BONA 3OAAD 3AL3A 4EG6A 3CVXA 2YMLA 5B1DA 1S7GA 4PYIA 1VE9A 1YULA 3E5NA 3OPXA 2WR8A 3O82A 2G6TA 3IVAA 4GGOA 1UBUS 3OJOA 1L8AA 1YUNA 3ER6A 1IXKA 4J0GA 4X1YA 3TCKA 2A8YA 2Q9UA 4ZANA 3L6EA 4CMAA 3P9ZA 4CM3A 1JV2B 2HHCA 1V8BA 2F3TA 4Y2YA 1YS1X 1ZL0A 4H35A 4A10A 2BGJA 4G0XA 5WRFA 2I29A 3TR0A 2C9YA 3OHMA 3A1VA 3L7DA 5KO2A 3RTDA 3W8RA 3USCS 2CB0A 3II6X 1W2HA 4G8DA 5LBUA 4AJLA 4BGIA 4O2BB 1N5DA 3TZHA 3UGKA 3UOWA 1XSEA 1YA8A 4I6JA 2E55A 4GZ6A 1UXHA 1JU3A 2VDJA 1MNAA 4RVUA 4HQFA 3JRWA 4YPFA 3FCXA 1RFLA 4HRYA 2R4TA 3BN3A 2I6XA 2A78A 4J90A 3RJ5A 3TS1A 1G8SA 5I51A 5FWNA 4I36A 4WTOA 3HY6A 4KWEA 4CEHB 2C5LA 2VNSA 3NH9A 1WW8A 1E62A 1KJZA 2WD7A 1CUUA 4QYSA 1XPRA 3Q3JB 4B6GA 2I76A 4U2FA 1TLLA 3TVYA 1M2VB 4ZHQF 2RK6A 1MO6A 1M6YA 2R62A 2Z3ZA 3IH5A 3CMCO 2VBGA 1Z5UA 4D42A 1NRWA 3GL9A 1RACA 1NLYA 2FSGA 4CIYA 1I5EA 1LRKA 2FZCA 3QWIA 3O92A 3MF4A 1T6ZA 3TX2A 2BFMA 1PZMA 1G2OA 4YMUA 3D7LA 4AWXA 2GEFA 4ZU1X 4QBFA 1N9GB 2YJGA 1U8XX 4EB3A 4DV2B 1Q50A 5HYVA 4CQLB 5IVDA 3TZBA 2NM0A 1ESCA 2OZLA 4KMRA 4RWEA 5HTOA 4NLLA 4YY3B 2DG2A 4H4EA 2GM3A 2JLCA 4P7JA 1Z34A 3WSVA 5KHLB 4X7MA 1QANA 1RSZA 2R8BA 2YBEA 1SBIA 4UU7A 2B6HA 3GG2A 3GAFA 3SCZA 4OAQA 1KU0A 2OO5A 3M89A 4Q21A 3CEPB 3V4FA 4BB0A 2JVIA 4EM6A 3QVUA 4NFHA 4PPNA 3P9PA 4QXPA 3V8BA 2SCUA 4OQYA 3KQWA 1IULA 3UWOA 3R77A 8OHMA 1ORVA 2JI4A 3I4FA 2JZCA 1KZ9A 1F5NA 1ZXXA 3CLRC 4QDOA 2D3WA 1T0BA 1M6HA 2ZSJA 5BQOA 2ZBDA 4RTKA 4LCBA 4RTNA 4DG5A 2QTCA 3MM4A 1GAXA 3QPAA 1NIJA 4YRIA 3VNAA 5ENDA 3M6LA 4JC4A 3UENA 1M5RA 4XVRA 1WMSA 5KU1A 3MHTA 3AF5A 1JALA 1EM6A 1SN7A 1U0TA 1XA3A 4L51A 4PQRA 2PVPA 4DM3A 4IDHA 1LJLA 1GNQA 5CCEA 2PX6A 1W36C 3EJ6A 3TLYA 3WIBA 5IAOA 3ZI7A 1BQEA 1N33B 2PLNA 1T9ZA 2X6QA 2XEXA 3ZU6A 4EPVA 3U7EB 1AXGA 4N0EA 3EDMA 2B8NA 3QV2A 7REQB 4HD8A 2IXEA 5D6OA 3U9SA 5BQ3A 3TE6A 2D7JA 3ZZUA 3WGVA 3SE7A 3SIWA 3FOEC 4PPGA 2C3UA 5BMOA 4QEZA 3GZ4A 3PUIA 5BO5A 4M53A 3GNSA 5EIEA 2WC1A 3D7MA 5AVWA 4H7IA 1JXQA 1KFBB 1HFWA 3I72A 4OQQA 3CY6A 4ABYA 3ZDQA 3HYTA 3A2KA 2H9UA 5JQGF 1EIYA 1CW2B 1O95A 5JSZA 2HBRA 1ULTA 2V4MA 2Y2VA 5IM4F 3NETA 2DQSA 3LHDA 3EZ6A 4JSYA 4KIUA 3NO4A 4HCJA 2VTBA 4BVFA 2JAPA 1XNRB 1X1CA 1VPVA 2WHRA 2IYWA 3FYUB 2G0TA 2XPCA 1GU0A 1D6MA 4JR1A 4LOIA 4Q3OA 4ALLA 4R31A 1YR1A 3UMMA 2C8VA 4ZYTA 3D8SA 3VDRA 1NVKA 4H6XA 4UJ3A 1B1CA 1EJ6A 3JD0A 1ZL2A 3PNYA 1BYIA 3L4BA 4W7IA 1KA9H 3M6MD 4DSUA 3K70C 3MSXA 4KQIA 2Z3WA 3RK0A 5K3AA 1KO1A 1GPWB 5AJZA 1U3VA 2J4DA 4YA6A 1N2EA 3FHLA 3SKYA 4DJJA 3H65A 1N2IA 4M99A 4KXVA 4MP3A 2P41A 5EE9A 3QVLA 4RJKA 4JLAA 4RK5A 2CYCA 3H1TA 1V71A 1AN0A 1NJ6A 1O1YA 2O05A 2P9TA 3QU2A 1R8SA 2O3UA 3BMCA 1TD9A 1GWNA 2JIZA 4ZVSA 1GCOA 4W7HA 4V1CA 3U4QA 3NT2A 3IAS1 1HK7A 2ATVA 2FRDC 3PGVA 3B6KA 3B6ZA 3NEYA 4X71A 3VR1A 4LYHA 2UUBB 1NMYA 5KTTA 5DNDA 2WAMA 2V97A 4F9EA 1O03A 2CNBA 1BH2A 2ZT5A 2H1SA 4HPWA 4L75A 4WQMA 4DZRA 2DF8A 3OD5A 2J4FA 5ED4A 4FKBA 1YRQA 4TWBA 5I01A 3QMPA 4KR6A 2IJGX 4UTXA 2AX3A 2EXXA 2V0CA 2B1GA 3AGQA 5IAGA 4V39A 5F98A 2VNIA 1H3EA 4RMHA 4DSZA 4CNQA 3PKJA 1PGPA 3S2ZA 4JK3A 2X19A 1DHTA 2YXEA 1XWFA 4EKGA 1TFUA 1FC0A 5F76A 4CKEB 1VMDA 3D43A 1LBSA 5JPDA 1CCWA 2ST1A 4FQ5A 5BNWA 4B3GA 2Y1CA 4UE2A 4FM9A 4G86A 3K0KA 5FFFA 1MAWA 1V7QA 1M2NA 2HC9A 2YJ5A 2CJAA 1BD3A 3LZ6A 5K1XA 4WASA 5A3QA 5IDQA 4FGWA 3OE4A 2ZDGA 3LC0A 13PKA 2K4MA 4NCNA 4U3JA 2PS9A 4CWAA 4XJVA 4TWAA 2I71A 1DLIA 1YOBA 2A1UA 2BF7A 2B6NA 1KE2A 4TMVA 1TJYA 4D0RA 4CKWA 3TEGA 2IEDA 2OLEA 4RZ2A 2QKYA 2XUOA 2V4UA 2QD1A 4RO0A 3WRYC 1P4GA 2XMSA 1L3CA 2A8EA 1C1YA 3OE5A 3I76A 4IMRA 3KL4A 1OVMA 4IY1A 4E2ZA 1DTEA 1I94B 1WY5A 3TEHA 8ATCA 2NP7A 1A9PA 1AGPA 2JVKA 4K9RA 4DIFA 1CZRA 1R18A 1YR3A 2RG7A 2EX0A 2V7TA 1H2RS 1SG9A 2HJRA 2Z5GA 1QE5A 4EW1A 1XZBA 1SOMA 2O3SA 4NCKA 3THWB 1ETHA 5BQPA 1GN9A 1OVGA 4ETNA 2XUQA 3CNOA 3NEPX 1GUYA 2GBLC 4YCNA 4Q00A 2FWAA 4KITB 4H4DA 4PIVA 3D0QA 2FPKA 1BJKA 4MUHA 4GDFA 4NONA 5ILOA 3LKBA 3DHWC 4KRFA 4Q4CA 2RG1A 3WYEA 3TTCA 4LS3A 4M1WA 5I7HA 2WJAA 2VDUE 1YR2A 4GSLA 2BFFA 3ZU2A 2P2SA 3EQZA 3KHTA 5AIAA 1DC8A 4HYQA 5AO9A 3GD5A 2HEIA 1F48A 4ZQFA 2QIPA 5EZQA 3W79A 4Z2AA 3OQ6A 2QVZX 4FUTA 4L57A 4PCLA 1WXGA 4MXDA 1JXMA 3NATA 3ZY6A 2B4YA 2C9OA 1JEJA 1V95A 2FV8A 2JBWA 2OBXA 1EJ2A 2RHTA 2VRNA 3EULA 1Z7NA 2Q4TA 4IZIA 4KWIA 4V0ME 5DLYA 3TRFA 3GRKA 4P72C 1LCIA 1RYDA 1D3AA 1G5TA 2FRXA 2QG4A 1Q22A 1JMVA 3E53A 2VNKA 4HK4A 5HS6A 4XX0A 4D3XA 5C18A 2PXCA 3N2GA 1K3UB 4JN6B 1CUWA 3TOSA 3SQWA 1YL6A 4W1SA 3LQFA 5DJ5A 2ZWVA 5IXJA 1K06A 4M1OA 3U6KA 5DI9A 2AFHB 3VPHA 5H3CA 4DV0B 1OFGA 4HWRA 5LU9A 4NU5A 4KSBA 5I4IA 3KEFA 2AX4A 2PBLA 1AMNA 4G25A 3RYFA 3QVMA 1IBRA 1OD6A 1YVUA 2Y1KA 3D59A 2VZEA 3CNQS 3FZQA 5CLHA 1ZVMA 3J80A 4NCXA 4BFZA 4Y3UA 1PWXA 1XZAA 2JIDA 1G4HA 1E3LA 4PINA 3FFAA 1DCKA 4TWIA 2Q5IA 3OZVA 3S81A 1N0HA 2G0AA 4HAVA 5B3JC 4URXR 3E84A 1K7FB 5SV2A 3MBKA 1B8VA 3ZXSA 1UOOA 3S2UA 621PA 3ZIGA 2X9LA 3FZEA 2QLNA 3IP8A 3OIGA 1C9YA 3NQ41 2AD5A 1CJVC 4KKVA 3GLHA 3DM9B 4ZOEA 5I8ZA 3ZJ4A 3PDJA 1EVKA 1XRMA 1VJRA 4AMZA 3A9TA 3STWA 1NZJA 4R6WA 4EWLA 3E03A 4M98A 3Q15C 3W5UA 3J81A 1F3LA 2ILVA 1LPSA 4HO1X 1SOAA 4UHCA 4IH9A 4YMTA 1P72A 1XZLA 3SEZA 5IJWA 2DWOA 3AC0A 3E1KA 3EAGA 3WK4A 1ZD1A 3UCFA 4IVPA 1WDLA 3CN9A 2Q46A 3B52X 4X8MA 3GNTA 1NY5A 3UJAA 4MJ7A 2V7WA 1P18A 2CD7A 1OIWA 1BIAA 1JPJA 1CUXA 3OO0A 2OBLA 2VZLA 5K0FA 3SSAA 1JG2A 2VQ3A 4LMAA 1ADFA 4PRLA 2F7SA 1EEHA 1QZTA 1E1QD 1VYUA 5TEWA 2J45A 2GN8A 2HJ9A 1PR6A 2ZQ5A 2FPGA 3HO8A 3N2ZB 4KIWA 3DAPA 3NHAA 4X9XA 1KEZA 3VH4A 1KSFX 3O5AA 3TSCA 2HIGA 5JD6A 4URVR 2IS2A 4DBLC 2CXQA 1AUQA 1ULUA 2GCIA 3JVDA 4OKNA 4QDUA 3UGJA 3ERRA 3L7OA 2BY4A 2QSJA 3GFOA 4FDVA 4KW7A 4D43A 1J2JA 4MV7A 1KDYA 2GHRA 3S8MA 4TXJA 3M5PA 1XQVA 3HUFA 3B6MA 3JV7A 2RI0A 3B12A 3HFVA 4AVYA 4BFXA 4C0SA 5EFZA 4C21A 5FTLA 1A4UA 3SYLA 3S8YA 3OT5A 4GMHA 4M87A 1FSGA 1ZGBA 2P4QA 2Z83A 3D6TB 1VFNA 3G89A 1J5XA 1ZSYA 3PKIA 5IYZF 3C7DB 1J2TA 5JYCA 1X1DA 3MZ0A 3WRVA 4HQRA 1NFFA 4GDMA 1DP4A 1N8TA 2VHQA 3EH1A 3STYA 1IE3A 4BQRA 2HMVA 5JECA 4B83A 1SUFA 1DKQA 5E4JA 3K9QO 1K88A 4QOJA 1SKAA 1GVHA 1MRSA 2ZIAA 4LRTB 2WILA 3I32A 4EF4A 2VHUA 3CLHA 1BKSB 2RHCA 1C0PA 4LCJA 4REOA 3SJAA 3VR3A 1BXZA 4IIJF 1FNBA 4X41A 2ONJA 3PDHA 1XRQA 4AQDA 1E8MA 1X7XA 2GYYA 4BWVA 3CUTA 2GCGA 4IUYA 2A9QA 4YR7A 1D7OA 2B4QA 2FR8C 3VR4D 1UOPA 2D2VA 3UXMA 1Z8FA 4RE6A 1P45A 2A9FA 1VDMA 1DAMA 2QQFA 3FPKA 5DCYA 5LB2A 5B55A 2BGGA 1JBQA 1P7CA 3PFWO 1FRVA 4R1SA 4FQ8A 1VKNA 3AEYA 4GP6A 4UEKA 2QZ9A 3EIEA 1Y3HA 2QDXA 3I12A 1FBNA 3UFXA 4F72A 1OX4A 4I55A 5IAEA 2Z57A 2B20A 3BG5A 3B3GA 5E8RA 5E9WA 1ESDA 5KQLA 3EXHC 4Q12A 2DBRA 3VM6A 4YB8A 5HX7A 1U9JA 1HZZC 1HT0A 1MVNA 4QHSA 3NT5A 3BB3A 4QDZA 1OC2A 1DIAA 2E87A 2VP9A 2WD7B 1U9ZA 1A95A 5JDCC 1N2ZA 2PE5A 4D26A 1SKBA 4HVZA 2DBVO 5D1NA 1I3KA 1SB8A 4RF3A 5T5QA 4MHTA 3KTFA 2GEUA 1UKBA 2PUVA 1UC9A 2ZXEA 3V8RA 1W5SA 4NR0A 5AVJA 4XW2A 4XUEA 1KMIY 3CN7A 4EKEA 3I2JA 1ISRA 3CVWA 4O33A 4PXSA 3DV9A 2F1KA 4KRYA 4QUHA 1UWCA 1JVNA 4J1TC 4OI4A 4TMFA 4G5OA 3CB4A 3IBFA 4FVTA 5FADA 3EA4A 1RLTA 2IEGA 1R88A 4RL6A 5I45A 2VQFB 3REQA 2C8JA 1L7OA 1Z5OA 3GJ8A 5FNVA 3TLCA 5TIIA 1N2CB 3PXAA 1MD9A 2NZXA 2UUOA 2LWIA 2XTAA 3GNQA 4DLPA 5C5DA 4RCVA 2PH3A 4AKGA 3ORYA 1JPNA 3GLRA 3I9OA 3N86A 3QKWA 1PNVA 1YCGA 3M1YA 3GLIA 2RONA 4PQEA 2Z3VA 5FBHA 2I7CA 4D9KA 4Y2QA 5EESA 4JSRA 4GOKA 2SCUB 4EGSA 5K0TA 3INNA 4F8YA 1F7UA 2HT1A 1UM9A 4TZ6A 2ZREA 3BH0A 4C4ZA 4MKHA 2ALYA 1GRQA 1L7MA 3SHTA 4MHSA 4GKJB 1Z5GA 2WLTA 5CYPA 5T67A 1THMA 4EUNA 1X15A 1KH2A 1MJHA 2FW9A 3CX8A 3T7IA 1IB6A 3GDOA 4PG6A 4J15A 4TXHA 3IILA 1KH1A 4MI6A 2QJOA 3G59A 5GM2A 4OI0A 3UQYS 1GSOA 4KI7A 2TRSB 4FFBA 3MWFA 1QO9A 1G59A 2YUIA 1RKUA 1EJ0A 1FTQA 3QTBA 5DSZA 4JP1A 5MN5A 3T7TA 5BV2P 1F12A 1NUUA 2JFUA 1C5KA 3H18A 1RIQA 2JJ1A 3PYXA 1LS6A 1XTZA 2YWXA 3I6IA 2IYNA 2HRQA 3E3MA 2HY7A 4KSYA 4Y0AA 4ZA2A 4LX8A 4BGEA 1AQ6A 1B8OA 1UBRS 2ONZA 2QB5A 4Q1EA 4RMGA 3LX6A 1H4QA 1OFTA 2ZWOA 4F46A 3JWPA 5EIBD 1SCUA 1ZWLA 3FSGA 3VQXA 2JASA 2F3SA 4LF6B 2AXQA 1EB9A 1VMAA 2H1CA 4YAUA 2WA1A 5BURA 1SKYB 3OWHA 2VTBB 2B34A 4EVSA 4RANA 1A5ZA 4M9CA 5JRDS 1TAUA 3QWAA 2BGMA 4U5XA 3EISA 3NGMA 2IQ5A 3HRKA 2ET6A 3AIKA 5M29A 5DLDA 1Q16A 5ECWA 2C4WA 3KR9A 1IN8A 3LO5A 4H3VA 3DW3X 2CSXA 4V0KA 1S1MA 4FX5A 2WJZB 5BYBA 4DIBA 5DBFA 1RKBA 1A5BB 2ZRCA 1RE1A 3EIUA 1GARA 2QTMA 3A6EA 3LYUA 1J0BA 4UD6A 2EHJA 4TMXA 1IH8A 2R79A 4DCNA 1VGVA 1SXPA 3O4RA 5T4HA 4ARBA 4LISA 5LOVB 1HDOA 2WAOA 4ZVUA 1J09A 3ZKWA 4LOKA 1QKJA 4QJBA 4PAGA 3VU1A 3WJ7A 4F5YA 2O0MA 1W76A 4I50A 4F6RA 1R6XA 2BCGY 3WV4A 4B73A 4WEQA 3TJMA 3KTOA 5HQJA 2C8LA 1FVHA 2IP1A 4G5GA 4HDCA 4YDSA 1E1YA 5JPIA 4V1CB 3U4QB 1NMXA 3GX1A 3T3PB 3WLEA 1SKMA 4HWOA 1ZGZA 1XU4A 5H0IA 1SEPA 3H3XA 4DIKA 4DZTA 2I1VB 2VF5X 4LY3A 1RKVA 5J4VA 2AXPA 1TW2A 1IJBA 1AKMA 3K5HA 2C9MA 4PC2A 1B70A 2XB6A 3ESAA 3PGA1 2ADOA 4AO6A 3QELA 1KORA 2KYRA 4JB2A 1XQ9A 2D5BA 4GBGA 2G3YA 2ON6A 5K01A 1T3TA 1L5OA 1T3LA 4EG5A 2AD1A 2QN8A 2PMDA 1V4BA 1RTTA 2O8VA 2XRYA 1AD2A 1C30B 3A4IA 3OZDA 4PFQA 4U0JA 2TMGA 1M8PA 3OSUA 2HQ1A 3DZCA 4GICA 4PZCA 5AICA 1RPZA 3KEGA 2NUPB 4CL8A 3LCUA 2YQ4A 2DP4E 3BD9A 3FSEA 1XDSA 1E2MA 1JHYA 4J94A 4LJ7A 3T41A 3TZLA 4B4OA 4D57A 2DQKA 2IODA 4D4KA 1J24A 1KERA 2G4LA 3IS3A 4DFDA 4BQEA 3FHCB 4K9OA 4NCAA 1RM4A 2IXTA 4G5HA 2PNJA 3PI7A 4L4YA 1JDUA 3ZWOA 3L1HA 1HR0B 3MTQA 1CXZA 1FYEA 3ENZA 1PT7A 4XFDA 4AUKA 4U3JB 1RLJA 4WH0A 3CIFA 1K9VF 1VP3A 2R1TB 3W6ZA 4ARUA 2A1UB 1FYDA 4F1JA 2V5AA 1PK9A 1A76A 3UMBA 5AQEA 1EH5A 4C2AA 1M5UA 2Q5LA 1UK7A 2QV0A 1N78A 4UNQA 3NVKI 5FB3A 1E0KA 4CKWB 4I4TA 4UXIA 3DM5A 4CQNA 2VG8A 2XF2A 3PRJA 1FLAA 5HJ7A 1R0YA 1XQYA 5B5SA 4YV2A 5CD1A 2HMSA 1UL1X 2X9QA 5BSWA 3WY9A 5J4KA 2KBEA 1G16A 3M6AA 2PXAA 4G85A 4RY8A 4YAOA 3UMFA 4AC9A 2ZIOA 4EI7A 4CIAA 3EVEA 4D9JA 4JOBA 4L78A 1PTJA 4OVKA 5M5BA 2FMTA 3O3CA 3X1XA 4WOKA 3ZE6A 2O06A 2QYSA 1QG0A 5J4YA 3SSMA 5ESXA 2P79A 5TDHA 4OHBA 1YO6A 2ZYUX 3QE9Y 3RTCA 5DU2A 3OT1A 1E66A 4Y7CA 2IDKA 2X8LA 2IC5A 3WGGA 3WGTA 5A7FA 3IIIA 4X90A 3LSYA 1O3YA 1S2LA 2FSVA 3VFDA 3BJZA 3FJOA 2YUTA 4RAOA 2ABWA 3KUXA 2J9GA 1RP1A 3S2IA 3SFVA 2BFFB 1WUKS 2GFIA 5AM0A 4B7ZA 2JZNA 2WA2A 4LDZA 4BX2A 4UHJA 1C3XA 2DEQA 3SOPA 5ARCA 3LBIA 1YQDA 4Y0NA 1QTNA 1R1DA 1RWWA 2VUTA 3GDGA 4Y2SA 4OXXA 1S1CA 5C34B 3ROEA 3L7NA 4JI1B 4FLEA 5GAJA 3SR3A 4EPRA 3OF2A 1TZCA 2WV7A 3NHPA 2J07A 4XB6B 1RWPA 3O4HA 5F5NA 1SHLA 4GZLA 4MB6A 3RS0A 3I92A 5KCZA 4J0HA 4YK7A 2FLKA 3RM3A 1JEDA 1UAGA 3QK7A 4ARZA 2RC6A 1VM6A 1N77A 3HFZA 5C32A 4QATA 3SYMA 4R2KA 2DWUA 3CGWA 2J3JA 3M4XA 5MN4A 2WG1A 5BP7A 1I2AA 2GKOA 3AF0A 3D64A 4IGAA 1N4AA 5HIKA 3I42A 4AKHA 3CONA 1LPMA 3DBVO 3FHOA 2AKYA 2OR3A 2ZSEA 3HKDA 2HB6A 3I34X 3PK0A 4P35A 4PGAA 3SC2A 5JHGB 3RAFC 1XMSA 5FEMA 3O7MA 1DFIA 1AKUA 5LPNA 4HBZA 1A5SB 4PWYA 5LMNB 5HP4A 2R7NA 3AM1A 2AR7A 4MGEA 2ODQA 4KB5A 5I3CA 1JKJA 2W42A 3A7UA 3OBBA 4A0FA 4R2LA 1Q1GA 2C7VA 1WVMA 2NADA 1ID8A 1L9XA 1T35A 1MHPA 1NW6A 2A5YB 3SQDA 4YMHA 2HQBA 5HM8A 4CEJA 3B1XA 1CE8A 1PVDA 1J8YF 4N7RA 3OM8A 4MVWA 1C3OA 2Q5CA 2WG0A 2ZJ1A 3B3JA 3FFXA 4KLRA 4K9DA 4U2KA 4I1PA 2BFAA 4QTXA 4CETA 1MAAA 2O8FA 3V2UA 1J22A 3LX8A 1V1MB 1KHTA 1XWWA 2GCOA 2JGDB 3OAAA 5TGTA 1IZYA 4P53A 3L0SA 1PYSB 1Y42X 2H1WA 3DO5A 1RCTE 1JG3A 3JVIA 4F56A 2RGNC 2H48A 4OKSA 1CQPA 1K97A 2W6ZA 4RD3A 1DDGA 1L0WA 1J8MF 3DXXA 5ALOA 1B6GA 3SE0A 2PUGA 2ZSIA 4BE7B 1CY1A 2QX6A 1ENPA 2JD0A 1VIYA 2ZTLA 1J00A 4BPRA 2Y92A 5AVXA 1PUJA 3D3KA 3KIPA 6REQA 3GLGE 1RM5A 1TPYA 5BN4A 3EA5A 1GLVA 1XXLA 3EC7A 4C4RA 2QR5A 6GPBA 5EIXA 3C8MA 1YASA 4UAGA 4IQ0A 3KFUA 2JIBA 2V6GA 5CR9A 5I5GA 3SS7X 3UK0A 2VLIA 3DL2A 5K8CA 4IZHA 1IM2A 4LV5B 3JR7A 1AM4D 2J87A 2OECA 5CM9C 3NWBA 1WHTA 4YV7A 4QYMA 3ZW8A 2RB4A 1LSSA 3A6LA 3CRRA 4CLXA 3DZIA 4QVIA 1HG1A 4RD6A 3G0GA 4E31A 4HX9A 5B2FA 4W5NA 4TYQA 3K3PA 4EYOA 2H63A 2E41A 2W2KA 1P7VA 3PR3A 1KU6A 3DTVA 2ONKA 1P4JA 3VHQA 4QPPA 3SQOA 3VDQA 4F3KA 3VKWA 4F3YA 1YGBA 4H2UA 1FE8A 2RHJA 4OK5A 4W63A 4BFTA 1DWUA 1FXSA 3X1KA 1E2NA 2ZUWA 5SZJA 5JC1A 2VJMA 3DONA 2FZEA 5F9MA 4C2TA 3PSAA 1TLFA 1S7CA 4O1MA 1ZGHA 3FFBA 1UBGA 5CGZA 3W8DA 3ZWCA 1KVSA 3OX4A 1XHEA 4UZSA 3L7IA 1IK6A 4LHSA 1SVMA 3H3FA 3PDCA 1R0BA 3TLJA 4E4TA 3TDKA 3JU3A 1DZ3A 1NR7A 1WR8A 4DC0A 5LLTA 2R0QC 4DV7B 4KR3A 4HLUA 4FDAA 2WF9A 4LHZA 3SZOA 1FSFA 1M76A 4UREA 2R47A 3GR6A 4F3RA 3EUWA 4FMDF 4UEOA 4BNUA 1DAGA 1E1LA 1HEUA 1JFLA 2EP7A 3FNGA 3KAQA 2G9VA 3RIRA 1XVIA 4B8YA 3CRZA 1QFXA 2VYCA 3ONDA 3WS7A 2OFFA 3KSBC 1WO8A 1DEOA 1XBTA 2WT4A 3UFXB 1LDEA 2XUDA 1PV1A 1H66A 2OWDA 4I55B 4ND3A 2GHIA 3EZ2A 3RFUA 5IZCA 2GEDA 1V11A 1U4SA 3HXLA 4JP3A 1EYZA 4FYYA 3VSCA 4GRDA 3RWMB 3EASA 4ARAA 1SERA 1X3SA 1Z47A 4RF2A 4BQQA 2WJJA 3MCZA 3NASA 4C6RA 2R00A 4L15A 4PXAA 5KJCA 1FPQA 2GB4A 2RHDA 1NONA 2QRKA 1W87A 4RZ3A 1HQCA 4MVJE 2FSFA 1IN6A 3EVAA 1Z3IX 5IJ9B 1A2OA 1XJWA 5FWDA 1MX1A 2OB1A 3O1IC 4FHFA 1G8AA 1RWMA 3TBKA 3IEXA 3B8EA 2UZ4A 2XBUA 1AKQA 3K32A 1AUOA 5H68A 4QJIA 4W6ZA 3PHIA 4XWYA 1EQRA 2E4AA 2VOEA 3REQB 3X1MA 1EP1B 2WU8A 3UQZA 4RY9A 4ZAVA 1ML4A 1UK9A 1O87A 1XVVA 1P4SA 4QARA 5CFMA 3AKZA 3EPJA 4F45A 1TQ2A 3MGBA 4OXKA 1NJGA 5K3CA 3FYSA 4IAOA 1R5BA 3OCYA 4DRXA 3BT7A 3DMHA 3IUPA 4IDNA 5BMVA 1I4DD 2JD1A 4FI3C 3GLIB 4BO1A 3PFKA 3ETDA 1BCSA 3IBGA 3ZK9A 4D9GA 4DJTA 4I66A 1B93A 3W3SA 1TYDE 2VVTA 2ZUCA 5EWJA 5P21A 4A82A 1QJ4A 1KH3A 4Q9KA 1SVLA 3VVCA 1ZH4A 10MHA 4E03A 1SK8A 3RC7A 1LVGA 4DLVA 1C8BA 3B36A 2Q0SA 1SZCA 1LN4A 1HT2E 1G55A 5L7TA 4B6QA 4HFNA 3T1OA 1Z16A 3CLSD 3KDPA 3RSZA 4W5WA 2JFXA 1ABEA 3G17A 3CWQA 4YX9A 5A06A 4M49A 3RUAA 2P6MA 3DQPA 1NWHA 5GGYA 3IMCA 1Z83A 4PYJA 4FWBA 3N3BC 1OYVA 4AK9A 1WYDA 1X9GA 3CTMA 4FFBB 1CS4C 1G3RA 3B38A 1U90A 2Y2UA 3GGOA 1AIPA 1HRKA 3IBTA 4PZDA 4KWHA 4V38A 4BUCA 3JAMA 1E7YA 2RHMA 1E1DA 1Y37A 3E7WA 3FFWA 3GGDA 4NU0A 5CHYA 4LXHA 1MHTA 3WRWA 1GFSA 4EW6A 3V7YA 3RFXA 4HZUA 1YBMA 4IHJA 3T5DA 4BMVA 2RJ3A 3TQCA 4IH1A 2JAXA 1YNOA 3HRHA 3LIPA 1PR2A 5E7JA 3W2FA 1SCUB 3A10A 3BMOB 4JZYA 2RK4A 2XUAA 3D8UA 3O2NA 3DC7A 2FWIA 5JSFA 4HPJB 2AZXA 4JC8A 4WOPA 1TA0A 2KI5A 4HVCA 1J97A 1KYYA 2ZTHA 1V3VA 2XJ9A 2ZBRA 4BXOA 1LPNA 4EVRA 5BSTA 3UWDA 1GO2A 4ZQGA 3JYOA 1ZK2A 1V8ZA 2EH1A 2XRMA 2QMHA 4JBLA 4MIEA 4NFSA 3FPAA 3THYB 4K1XA 1LJ8A 1LLQA 3CJRA 2BFCA 4CM1A 4UVIA 3LCRA 5TPWB 3I45A 4OHXA 4J29A 2L0XA 4LSGA 2IHBA 3DMTA 3HVUA 1JTEA 2FZLA 3EEBA 4OHYA 5LQCA 2P5UA 3LUPA 1CRZA 4G1CA 4K9QA 2CL7X 2IEIA 1SOVA 3HA2A 3HJNA 1B8NA 4I46A 4UDXX 5CNMA 2AKWB 4ZVRA 4ZCSA 2Z8YA 3VC3A 1T8RA 3GP5A 5I9IA 2NXJA 5HF9A 3VR5D 3HN7A 1XZQA 2E4UA 2J9ZB 3TGWA 5JALA 1KI4A 3ZKWB 4M0PA 3ED1A 5HUQA 3WWEA 1QAQA 1KMCA 1EOVA 4J3NA 3WWPA 5KZMB 4RQAA 3BA6A 4F6RB 3KQHA 2VDMB 1F2VA 2NVOA 1U8AA 4L07A 2HA0A 3GJ3A 3QENA 4NECA 4NIMA 5F5LA 5FD8A 3DD1A 4NZTM 2IYEA 1M7HA 3M49A 4RM3A 5K3SA 4D9EA 2ETXA 1RHKA 2FZWA 3JSAA 3Q3HA 1W9HA 3KWLA 4PZLA 5NLLA 5JWOA 4YPOA 2FZVA 4YCWA 1HEIA 1YGPA 2ZB3A 3CX3A 3PPXA 3G85A 1ZINA 3ZCUA 1QIMA 2ASEA 2FG5A 3A4MA 5CYFA 5KDOA 3CBGA 3UTDA 2O52A 3PX3A 3NAZA 3RT7A 4KHPB 2ORYA 1P0PA 1M2KA 2XCIA 4M76B 4O4IF 3RIXA 2QLMA 3IRUA 4MCAA 2RGEA 2WJYA 3WQBA 3ZE0B 1JJAA 3K9BA 4B7CA 4L02A 2A9JA 4C1BA 2AJTA 3O74A 2VJAA 2XVZA 3KT6A 3V80A 3W9SA 5BN3B 4RTJA 4ITVA 1Q0LA 2VXCA 3QJ5A 5L9AA 1KPIA 3DH0A 3DV0A 3H13A 4B3SB 1FFBA 2GBCA 5E7MA 4BIIA 3ETEA 1S3SA 1MPXA 1G21A 2BJHA 2W83A 3DDWA 4LSWA 4Q1DA 4WJZA 3BKWA 3C3JA 2N9UA 4ZOLF 2OY0A 4NNOA 4D8VA 3LXUX 3GUYA 4EMBA 1EZ1A 1NOIA 1ZUNA 2BFWA 2IHYA 5H02A 4E7PA 2PGLA 2XQVA 2POQX 5IS2A 4OHRA 3DMGA 1XJ0A 3M6IA 1DKOA 1E5TA 4RL4A 2KLBA 1H0RA 1TT5B 3KXLA 2A9PA 4OG2A 1BN6A 5DI3B 3RHTA 2HWYA 1OWMA 2JJYA 2QEQA 2DPYA 2O9JA 4PZPA 3PUKA 3ZOKA 5AJTA 3AESB 3CLRD 4Y2GA 1YB4A 3RYIA 3VTAA 1HO3A 1S5PA 4WJKB 4YONB 2P90A 3EFOA 3IUSA 4L08A 4OM8A 3TECE 3IBYA 4ZI7A 4K9KA 1BSVA 3AONB 3MJVA 3MTIA 4I4TB 3WLLA 2ZJ4A 4OBWA 3DUFA 1MJNA 2CNOA 5LZ2A 3AB7A 2AI2A 3Q8KA 3WA6A 3HDYA 4EECA 4P80A 1D2MA 4IOLA 1ZFNA 1MVOA 1EGHA 3PUYA 3OA2A 5LZ5A 5JAPA 3FTFA 1TE2A 1T5TA 5BMVF 1M7GA 4J6EA 1W36D 4X91A 5IC4A 1T2NA 1EBBA 3QTTA 3G2MA 3SHQA 1N2GA 2CNKA 3KXIA 2PVSA 5LJIA 1LY1A 2EFHB 2HZBA 3BGDA 4FYMA 3OMXA 5GVRA 1M1XB 5KQGA 3U44A 1EAYA 2P1DA 3QOFA 3FTEA 4YDQA 3WGKA 3MHPA 1UT5A 3OT1B 4FFLA 4EIWA 3V8PA 2DDZA 4DDMA 1HSZA 1OX5A 5C80A 1FMCA 3TZQA 5AR1A 1T4MA 2RGXA 3PF8A 4MYRA 3TVDA 1Y2IA 2O14A 4AJPA 3UHAA 1XR3A 3ZCRA 3U1VA 1ESZA 3UJ7A 4JDPA 4ZZIA 4PX3A 4NEQA 3GYBA 3OIFA 2AS0A 3UATA 2X6RA 3QVJA 1ZU4A 4CV2A 4EGAA 5D2CA 1KBZA 1Z5WA 2VBFA 4CKXA 4Z1MD 3GEMA 5IMSA 4I1OA 3T3IA 4Q7EA 5CYGA 4F3TA 1DBSA 2CLDX 1QDLB 1T1IA 3CVYA 1QDEA 4FCWA 3KAPA 2GEBA 3N59A 3R3WA 4AY4A 4LF8B 3L8HA 5JRZA 5CB0A 3MUNA 2YV3A 3UWPA 4E4RA 5BR8B 4M46A 2AN9A 4FD3A 5KVSA 3BCSA 2Y0BA 4B46A 5THXA 3K70D 5IVHA 3HFZB 3S1AA 2C95A 4C4AA 1SC4A 4RQFA 2AR0A 5FI5A 5K2OA 3L0YA 4JBYA 1YNSA 5EHIA 1E1QA 3HKDB 1T26A 2N1BA 3L9WA 1KXJA 1MQ8B 5GJVC 3K8OE 3SC2B 3NWOA 3HQ4O 2R4QA 1PFYA 5I7RA 2HQSA 4RPKA 1LF5A 1H9AA 3MTJA 3P0FA 1H0KA 3QNMA 2QRJA 2C2KA 2OMKA 3ANYB 4HI0E 4KNWA 1AF7A 2W9XA 3BGIA 2OBBA 1RBQA 2C42A 2FUEA 2YVQA 3BE8A 4IJKA 5H4HA 5CG1A 5K7SA 3TZ6A 2ZZMA 5ESDA 3Q8WA 4KPFC 4A6DA 3I0ZA 4TYNA 4CEJB 1H22A 1DZIA 3CF4A 4G23A 4ZZ0A 3BE4A 1E9AA 3LUJA 1PQWA 1CE8B 3STVA 5A2QA 4JFAA 3DL4A 4FMCB 5IVPA 4KAJA 3T3OA 3ZTYA 4B34A 3ZHBA 1L5SA 1APBA 1JW9B 4PS1A 4Q48A 1HE3A 1JFTA 5F1PA 3ZV3A 2XUIA 3NTXA 3W7AA 1VIDA 2O8FB 2OFPA 5JVDF 4N12A 2P9GA 3N2EA 3HPRA 2FWMX 3QSYA 3U16A 1E3WA 1EIZA 2CLOB 3A1SA 3F5SA 4M7RA 5EZYF 4YAFA 2CFSA 3RL6A 1IZ7A 1FYXA 2N46A 2DPMA 5BUZA 4F4FA 3G9XA 1MB4A 2G88A 2HWXA 4QU9A 1ZONA 1NM5A 1KTVA 4Y30A 5GV7A 2BAGA 4UP8A 3H9UA 4BDTA 3BM5A 3SBEA 4DLUA 4K28A 5AKZA 3C70A 4IWXA 3K2BA 4B4KA 4ZARA 1FOEB 4EJSA 1JJCA 3AERB 1VE3A 6REQB 4KIFA 1NI4A 4QHTA 2IW1A 3AFNA 1R6TA 4UCFA 3F98A 5HK8A 3GJSA 3RU9A 2VWHA 4DS3A 1ZIPA 5DIFA 5EKTA 1TQHA 3EAQA 3PC3A 3UJCA 3GJYA 1M2OA 4JROA 4UBJA 1L5VA 2BCJQ 3I0NA 1E5VA 4IHAA 4GOJA 2QP9X 3W2TA 3LDHA 1M9NA 3SDSA 1JQLB 1F0YA 1SC3A 2VYFA 4L8LA 2WHQA 1LBIA 2C2BA 2BSQA 3TL2A 4GR5A 5BOVA 2REXB 1XWIA 3FBWA 3KSZO 3RVBA 4DADA 5M34A 3OFVA 1NR1A 1SZDA 1W25A 1E3JA 1KQOA 2BH9A 2FW7A 2J9FA 1DX4A 2W2KB 2WSLA 5KNCD 1P2BA 1RJDA 4XYEA 4MKIA 3C8HA 3Q2OA 4GI3A 5EYPB 3T7EA 1U1EA 3ZQ4A 5CFZA 1OPRA 1UQRA 4ENRA 3MT7A 3FAKA 3JATA 3UMGA 1ZM4A 4MWEA 1I1OA 1TF5A 1G20B 2AFVA 4J6FA 4RD1A 1Q14A 1V16B 3ODPA 1CUEA 2PT6A 2YV4A 4FP9A 4WUVA 3W1WA 5K6AC 1XDGA 1MEEA 4JI6B 3ELUA 5DRTA 2P3QA 1HX7A 2W48A 3FA2A 4KDRA 3UXHA 3HCCA 4H1WA 1J8FA 1QGZA 3VX4A 3L5KA 3HLTA 4G0OA 4A2PA 1YQQA 1X9IA 1IPHA 1K5GA 5BV8A 2QU7A 4NENB 1KOFA 3RC8A 4NFYA 5KAMA 4H7PA 3ZLTA 1J7JA 5JSQA 1L4HA 3OQIA 1R37A 4K03A 4RORA 3FUTA 4PXYA 1CUDA 2V96A 2DKOA 5BYJA 1RLIA 3GO4A 4PPYA 3R3ZA 4GXNA 4KI0A 4RC9A 5EEHA 1A8SA 3GN2A 2HU2A 4MS3B 2GK4A 2CHFA 2I54A 3PU6A 5IP5A 4AZWA 4BLUA 4M8NE 1TM5E 3BIJA 3CZRA 3VYSB 3B20A 2SKCA 3DOFA 4C29A 3RANA 5FUYA 3EXG1 3EBLA 5AHOA 1Y7TA 5HG0A 5CFRA 1V11B 3ABZA 1YCHA 5JZMA 4BJ1A 4JOSA 1GL6A 4MCJA 2I6QA 4TZKA 5JCJD 1Y1QA 2EBUA 4FYKA 4G2TA 1UKZA 4ZT4A 2GTIA 4B6SA 1I32A 2ALJA 2GM9A 4MQ5A 5KWVA 4LFBB 1QRTA 4RELA 5FUBA 4JLUA 1XN1A 4U39A 4BU1A 3O2SB 4K9MA 3VH2A 2PBRA 3R5FA 3NORA 4XSVA 4HS9A 1T2EA 1KMNA 2BW0A 4JU9A 4S1WA 1ZRNA 2DJIA 3E9RA 3ZDAA 1WEHA 1A72A 3PL5A 5HGJA 4YJ3A 4EMUA 4F5DA 3OLXA 1UKEA 2BEUB 3CM0A 4BFUA 4TVSA 4Z0HO 2D0PB 1MTZA 1R0ZA 4KNYA 1B73A 4AULA 1HM5A 2Z56A 4OUDB 3AL2A 1I33A 2J09A 5EI5A 1H2EA 1QX4A 2H06A 3KQVA 1KZGB 2AA3A 3BKXA 3DWIA 1KZ6A 1JPVA 2OA0A 2JLUA 4QM7A 4X84A 4CE6A 2WIGA 2X4LA 2A35A 2QW0X 4N5LA 5BMVB 1ND5A 1XNJA 2V45A 4E5NA 4X54A 4KYVA 4EO7A 3H0EA 4RBNA 1T34A 3GLFA 1WOMA 3LUCA 3V7FA 1WXFA 3IQDB 4D4HA 4YV1A 1WZ2A 4IIFA 5ALVA 3ZN2A 4LYDA 3V4PB 1NR5A 3B7GA 1ADCA 3GXBA 3O91A 4LKOA 3ZX5A 4EKIA 4MQLA 4E5VA 1F0NA 1Z5NA 5FL3A 2Z95A 5EZYB 3X3HA 2XUHA 2B36A 2XNSA 2PUFA 2WE7A 1VB3A 3JVUA 1JHVA 3K2QA 3PR1A 2HRBA 4HG2A 1M34E 3FAZA 2O2HA 2ZG6A 1U2DA 1YTLA 4TYYA 1X54A 4JYPA 2GS9A 4EW2A 3WRXA 3ER8A 1ZIYA 3KT3A 3E22A 4KJXA 4UBNA 3ZGXA 3FF4A 1YJQA 4ECEA 3MT0A 2HEGA 3GUUA 1NSTA 1NVFA 2QMUA 2YVLA 4KQGA 5F1KA 3WE7A 2FCAA 4LJYA 5HJ2A 4LY0A 4B4WA 3V8LA 3L8GA 3ZHCA 4F0JA 4CLRA 4TVKA 5ICEA 1V5EA 3WWYA 2JFBA 2PA0A 1KTIA 1F1JA 1K92A 3WYFA 1FMLA 1N1MA 5D6NA 2Z4RA 3AI3A 5ALJA 1DV2A 3WK9A 3ITEA 4HZUB 2BM1A 2B8JA 2IXBA 2HWWA 3AYZB 2I2DA 4K26A 4RKWA 1S4QA 5E95A 3JQRA 4B4DA 1PJTA 4AKTA 2A2YA 3T94A 2H17A 1LF0A 3WO1A 4HRXA 1TMOA 4WN9A 3EFSA 4FBLA 5IEJA 1HTWA 3TMKA 1SPXA 2DQ3A 4GRAA 1QGUB 2JJ2A 1SUWA 4KKXB 2BMJA 1AZSC 3NJRA 1I24A 4ZP1A 1EWYA 1JYFA 3ZX4A 4ARIA 3FWHA 1FP2A 1B41A 1V9LA 3G49A 3D7RA 4HAWA 3BUSA 4RD0A 4BXOB 4JVNA 2A7XA 4DJFC 1M6VA 4FZ5A 2YJNA 3U7RA 5A1JA 1JFSA 2ORIA 3C97A 3K9LA 4MVYA 1AK9A 1YRYE 3M82A 3HVHA 4UU0A 3MC1A 4G84A 1C8VB 1VB5A 5KCMA 3T52A 4JYAB 3SXPA 1DOAA 1E5QA 2Y1OA 4D4LA 5TVGA 1IL2A 2SNIE 3G2PA 2BL4A 3AEZA 3H2JA 3WHIA 2ID9A 5A4JA 2P78A 2FUG1 2DAPA 4LSMA 3ZY4A 1GSAA 3E0QA 2DLNA 2JBHA 1NSYA 1OW3B 1P5ZB 2E4YA 4D3YA 5IHPA 4BHTA 4EX7A 1W93A 1SU7A 2AHRA 1BU8A 3E5MA 3V1TC 2HWUA 1JRLA 1GNTA 3PHBE 1N25A 4YMSA 1L8OA 1GA6A 3TFQA 3QKUA 2J5QA 2DY0A 3BXHA 3G8CA 2YOFA 3P9NA 5FCDA 1F0KA 1K8QA 1OXMA 1CP2A 4PQGA 4YNBA 5FUQA 5DGDA 1FNMA 1X1EA 3GUHA 2C88A 1CG6A 5JOQA 2VP4A 5KX5A 3C16C 3KLOA 4QG3A 1UWKA 2NAFA 4OBEA 1K3FA 3IVRA 1A2KC 2V9CA 3EMKA 3GFQA 4CODB 5KNDH 5ADHA 2D8AA 1ONBA 2XWPA 5J5VA 2J3QA 1P44A 3RK4A 1E9RA 2IS6A 1AVTA 4JL8A 4RIIA 3OQNA 2GN2A 1T2FA 2ZGWA 1S9DA 1UFOA 1L7NA 2XUFA 2QHSA 2BUAA 2WUWE 3IVMA 3DYVA 3P2EA 1FDUA 1S6YA 2MHCA 1CY2A 1VDZA 3P8ZA 5DYIA 5JASA 3OHPA 5AVRA 1PKEA 4KRXA 1NBME 4KJZA 3Q1KA 3DLPX 5CPBA 3VTKA 3DQZA 4IP0A 3BE5A 4RFSA 3IE2A 4KO2S 2XTMA 1OH8A 5DT9A 4ZO6A 2JBAA 3GGGA 1X7GA 3FCOA 1ZUNB 4J0JA 1KWGA 3EFBA 3HB5X 4D5GA 5CPFA 5KYYA 3T7JA 1OA0A 2O5RA 4CFZA 2OCKA 1E3TA 5F2EA 2R6AA 4EY7A 4PE5B 4W99A 2EHDA 3TSQA 5A5FA 4C4PA 3EFOB 1T1SA 3KB1A 4HDRB 2BRUC 4YI5A 5A62A 4EOGA 2HOQA 4IWNA 2AYXA 3DUFB 5ITZB 3WLOA 1QXSA 5DNWA 1KEUA 5BPHA 4IF4A 4R2MA 1HQKA 2ZVJA 2Q3DA 3KETA 1AKWA 3CLTC 1QM5A 4IDOA 2YFQA 3VI3B 3E9IA 4XU1A 2WZDA 3OF3A 1T10A 4EUEA 1QRSA 2ZYHA 1ORTA 2DB3A 1KFEB 1P2SA 1J99A 3K9FC 4YQZA 1IBLB 4WKCA 1YKSA 1OY1A 1P31A 4M9SA 1RQ8A 2H57A 5EKXA 2CLHB 1IVYA 5C53B 1RJ9B 4MRNA 5IVKA 4KCGA 3U44B 1MQ9A 2P3SA 3ZZ1A 2V7PA 2VWPA 3C1AA 1RABA 3RQSA 4BZXA 1OFVA 3SPXA 4COKA 1LUAA 3EQ8A 3ZY5A 4N0PA 4N3CA 4EI8A 3Q9SA 5HCIA 3ZWYA 4YYZA 1AHNA 2A1TR 3VNSA 3R5SA 3PQ8A 5CM8B 3U13A 1T2AA 5L3ZA 4X64B 2O8CB 3O47A 1ZESA 5L3QA 4YLEA 3SSOA 1T6NA 4PZAA 3BHJA 4BCBA 5JNWA 1I4TD 1QIHA 3OLCX 2XZLA 4G9BA 1T1JA 4ZVLA 1IOLA 1K8RA 3OCZA 1B16A 3OOYA 1TRHA 2GBGA 3O0DA 5FFMA 1VYTA 3G5TA 3G9ZA 2QTVA 1ONNA 2ZVPX 4J9UE 2G5PA 4YECA 2C5SA 1E7RA 1ZK0A 5I9LA 5AWFC 1IK4A 1Q95A 4XUGB 2DTIA 5EE5B 3RGGA 1U0NA 3ZWVA 1OAOC 2H2AA 5ESWA 2XMCA 2D5CA 3CF4G 3EQ6A 5IWCA 2O8NA 2SBTA 2WFZA 4GP7A 3RS8A 1I9GA 4K1LA 2AZMA 3E7XA 3GT7A 4IDFA 1AX9A 5BSGA 3D6VA 4IGKA 1BVUA 1UINA 5AJYA 5F2OA 4J2HA 4BLQA 3S40A 1UDWA 2WHXA 3ZD6A 3TJRA 3R0ZA 2YVAA 1UDXA 3W8EA 3F7OA 5U4QA 3EPKA 1N1EA 2E4XA 2YWJA 2E7ZA 2WJHA 3C3XA 3DULA 3WLPA 4R01A 4CTNA 1D2HA 1PAVA 1G63A 2GWHA 1DBWA 1ZGCA 4P3PA 1BIBA 3UOGA 3P1JA 4JNCA 1RYNA 2J9RA 2J6HA 2BE7A 5L3SA 4N40A 4PGGA 2XZDA 4RGQA 5DKFA 2B2CA 2ODNA 2IOFK 1C4WA 1SKUA 2DUNA 2VSOA 3H2BA 4JI5B 1Q1QA 1Z7GA 1T0HB 4M0MA 1MPTA 3RT9A 1WB4A 4WXRA 1NUPA 1CRPA 2KPOA 1T9DA 3BH6A 5FV4A 2WYIA 4OJKA 2YRXA 2CF5A 2VTKA 3LZDA 2N75A 3BSFA 3ZWNA 2XMGA 1S0UA 1E3WB 1W5AA 2IHZA 2XQGA 1SBYA 2BTQB 4EI9A 3E3OA 2G9RA 1O0BA 4QVKA 1BU5A 4KBFA 1CJCA 3I5AA 3PD1A 4HGOA 2FZ5A 2F4NA 1XP5A 2YWGA 1E63A 3RJMA 1ST2A 1ZI9A 4EUSA 1J8DA 4LPKA 2I8AA 5DCLA 4EELA 1C9DB 2CXRA 2DFKB 3E9DA 4H1UA 3K1ZA 3P2OA 4H7FA 1JEOA 3WNBA 1T8UA 3E70C 4HOYA 2ZI9A 4TROA 4E12A 1WTCA 4F7WA 4EJSB 2OPBA 1JQJC 2WWXA 4G5XA 2CXNA 1RI3A 1SCBA 4PZEA 2ZT6A 5EMLA 4MLPA 1A2BA 2O5CA 2OO3A 1QGYA 3IDSA 1KAHA 3IXMA 5C1OA 1UPFA 1ZBDA 1WQ3A 2R6JA 3KZOA 4V2UA 5HS4A 4Y2XA 2F1JA 3NI2A 1U5BA 1M2OB 3BAFA 3OJEA 4JKIA 4GPEA 1CKEA 1W52X 5BRNA 5HF8A 1FW6A 2W2XA 3H9QA 4UQOA 4HH4A 4D82A 4XOIA 3SAJA 5CJPA 3PB3A 5EP3A 2OFWA 3SF0A 3LW8A 4ER3A 1DBQA 1LLUA 2H00A 3UOAB 4EY4A 1G4AE 2R2AA 1GZVA 2J9FB 2PQ2A 4CMKA 5ALRA 1I8TA 4R7TA 1MOSA 3WB0A 3WHLA 2VPTA 3KSRA 4E5KA 3BQNB 4WAUA 4QVGA 3TOEA 3AHHA 1VLQA 1SD1A 1JFFA 5FOXA 2EYUA 2YZKA 3JATB 4PAQA 2C78A 5EUQB 1JQEA 3B9PA 5FX2A 3AHEA 2C54A 1KZ1A 4PRYA 4E09A 4KQFA 1IJFA 3IMKA 3KYDA 3ZCSA 4M0KA 3CUKA 1QVRA 3KOOA 3VV3A 2WIAA 3RB8A 1WLYA 4MR8B 4R84A 2QMEA 2J46A 4IXNA 2ES4A 2FFBA 4G1EB 4QJ4A 3TAUA 3O9MA 5PGMA 2ZTVA 3N9IA 3PNPA 1C7RA 4Y1RB 1IBKB 2OXCA 4LNUB 1TVEA 3RRJA 1N5JA 5E3JA 3BWYA 3S1LA 2DKFA 3QVXA 3ZNOA 4AG5A 4N5DA 1SELA 2HGSA 2PX4A 2W58A 3NDIA 4O59O 4QOEA 3SWWA 3P9KA 1XEWX 4GECA 3RPEA 4AWBA 1H3FA 1PDOA 3RRYA 4K9NA 3L8DA 2Y1EA 1H69A 1UOQA 3H5VA 5DXAA 1J6UA 5L7WA 1NVAA 5CFPA 1H2FA 3JQPA 2R6FA 2PFKA 4Z0PA 1KEVA 2A5JA 3RUXA 4EH1A 2WYWA 2LCIA 4UDYX 1GDTA 5T41A 5F7JA 2WMDA 3G8AA 4LAFA 1MB3A 3RVOA 5CJ2A 4TKZA 1ADBA 2Q4DA 1O9BA 1NNLA 5SZIA 1UBEA 3WGLA 3GGJA 1SBQA 2EKQA 4DNOA 4P73C 4NZMA 5HW0A 1COZA 1XRRA 2XJ4A 3AKYA 3GFTA 2B0JA 2ZAYA 3S2YA 4J49A 1Z35A 3DFIA 3SXUB 2AVNA 4D97A 4R0MA 5FH9A 3OBIA 4DLLA 2UZ0A 3JRNA 4PG7A 2VTVA 3FH0A 3FOCA 4R3UC 1QAOA 1E22A 3I5MA 4B3BA 1EE2A 2ZBFA 1G6HA 4GGPA 4NE9A 3H17A 8GPBA 4U7WA 3LKVA 1N2SA 3NKVA 4DRZA 2HBQA 3UB4A 3TE7A 2ONYA 3VX3A 3PXUA 5L3VA 3ZGYA 4S1OA 2JARA 3K6KA 3O8QA 3HDTA 5FNZA 4EPWA 4RTRA 1O6ZA 4HTFA 5E38A 4IUDS 1F6BA 1FDIA 1SUBA 4LZPA 1IRIA 1NFJA 1FDVA 1P1FA 3BWMA 4RZHA 3UK2A 4BTEA 4D3ZA 4E33A 1II0A 3QU7A 3RIEA 1D03A 3DZGA 1OCEA 3IJEB 3C3CA 4MVJD 1JN0A 2EKPA 3HPQA 3KHKA 1HKUA 1NFRA 4BECA 1V8PA 4IQFA 5CBPB 3RSQA 2XKJE 3MELA 2FUNB 1TTHA 3WMGA 5DYNA 4H2WA 1JFVA 1RW4A 4RY0A 3FB1A 4AXXA 3K8YA 2J08A 3C7CB 1QYIA 1T2VA 2VNJA 3A0UA 4WCDA 2QRZA 4B80A 4TUYF 5FA6A 1XZEA 1O94D 4CL2A 5CT5A 4X85A 4JGGA 2ZRHA 2P4SA 5G2OA 3E9YA 3AVUA 1JYSA 2HI0A 3R5HA 3O3NB 3U5ZB 3RVMA 4BMNA 4J16A 3VR6D 5L95A 2Q8PA 3EA0A 3JQ9C 4GOXA 4C0AC 1AB6A 2G5CA 5DMHA 1MT3A 3VTZA 3WL7A 1QP0A 4LF7B 1SXIA 4JJEA 1C3JA 2YCBA 2VH5R 1B7YA 2ZAIA 3SN6A 2A0KA 4DY6A 4W5QA 1QBGA 2X23A 1Z7WA 5ERYA 2HDNB 3RS9A 3F5DA 3FXAA 3WICA 3JALA 5TB5A 3RHFA 3RUIA 3MWDA 4GUDA 4WN9B 4BBPA 1CVLA 2YXDA 4MWCA 4DN6A 1IBSA 2RD2A 1Y9EA 3KJQA 4ZT7A 2X8JA 2EBHX 3PDIA 5GADl 1X55A 1Q0TA 2VHZA 2H7VA 2NTEA 1QF7A 3A1WA 1XALA 2AMJA 2R8OA 3H84A 2NOAA 3I9V6 4HQLA 4TYPA 5JQWA 3ICQB 2C7PA 2GGSA 2ZZGA 1HDRA 3ASUA 1WMFA 3H9JA 3DLAA 1CZOA 5J3JA 3UFBA 1LSJA 2PV7A 2RAPA 5JAUA 4LDRA 2EFJA 3JYPA 4UDOA 3MBIA 4Q93A 1SFRA 5K8TA 1C9EA 2CGHA 4YGYA 2JGMA 2Z9DA 3A36A 4OY3A 2CLFB 2AR9A 3L6OO 3LY7A 2CT8A 1UBFA 4RVOA 2ZR3A 5A7HA 3VJKA 5I7WA 5J2TA 3I2FA 4X6YA 5HVNA 3K5PA 3L9XA 2XB9A 5KOJA 3IOBA 3ANTA 4INJA 3A9UA 4MUBA 3NANA 2V6IA 1MW8X 2Q0HA 2CMDA 3NV9A 1X3LA 3WFJA 3CIOA 1QB8A 4K9SA 1FFDA 3KD3A 3RKUA 2OORC 5DNCA 1XT6A 2FQYA 3ZE7A 4GS5A 5CH5A 3H5TA 4YYEA 2YHSA 5ICCA 16PKA 2XUGA 2GKSA 4QXOA 4IOJA 2HHAA 5L6MB 4NE7A 1IXZA 1PX0A 3IQFA 5EHQA 1G5FA 4YJ2F 3RVPA 2ZW9A 3FGOA 4QOHA 1DEKA 5KTSA 3TSUA 3RAEC 3D3EA 1MO3A 2BN4A 4HRVA 4IDGA 4JKYA 3G5AA 3HZHA 1YAHA 2F48A 5G02A 3HM9A 1ZD5A 1SBZA 2D2EA 2JAQA 1HG0A 2NAPA 3BXFA 3MJEA 3QX9A 4BO0A 4BVHA 4CEIA 1QKKA 2NP6A 1NKTA 5BWBA 1QQTA 3AIMA 3BK1A 4XAQA 4FBKA 3C45A 3Q9NA 3IIKA 4NXMB 2WDPA 5FO0A 2BE9A 4NPHA 2DKGA 3OZRA 5BYAA 2I66A 4TMZA 5ICGA 7AT1A 3CNNA 3DT9A 4M7WA 4RFSB 3L0DA 5HFNA 1YZYA 4YI3A 1EVLA 4NMXB 2ZB4A 2TYSB 1WX1A 3CVJA 4LBYA 4D9MA 1RC1A 2GSWA 2JBAB 3SHVA 2QN9A 4CEHA 3VNVA 4ROSA 5KYYB 4DIMA 5B4TA 1PE0A 2WWHA 3IB6A 4Z1MA 1TJNA 1CDEA 3QFFA 5LQMA 3KB2A 3BF7A 1JQDA 2VPYA 2E0IA 3OTHA 1Q7CA 2ECKA 2IZ0A 3O38A 1QU3A 1PVVA 3L5OA 4A0RA 1KO4A 2VPWA 1K68A 4B9AA 2BMWA 3T06B 3U4MA 1M74A 3AX6A 1G51A 2ECOA 5J63A 2OCXA 1FRQA 4ZFNA 2JIPA 2FW6A 2X3UA 4ZC8A 2FAXA 3KJGA 4MGZR 4Z4HA 1L4LA 1XZMA 3K9HA 5K8JB 4N48A 1UMKA 3VSAA 1YTUA 4J0DA 4DR7B 5EXDA 2WT9A 1Z0IA 5SY4A 3T7AA 1JHXA 5L6LB 4Y9TA 3G5UA 2BDEA 1ARZA 2GO1A 4WADA 4WLVA 4DEXA 1VQZA 4FSHA 4UW9A 1U5CA 3IPYA 1TIPA 1AQIA 3V8NA 2JA1A 2E48A 2RHQA 2GZDA 4ZN6A 5KC9A 4B79A 1MUUA 1TF2A 2VNAA 4UOEA 4TMYA 5GZ1A 1DAKA 4LHXA 1BBUA 5JNLA 2COEA 3DXYA 1T43A 4FR5A 1IXRC 4JMPA 3QQPA 4A1FA 4TUYB 1GPDG 4BE9A 4BX8A 3LGSA 2VHVA 5CLFA 1OAKA 2FRDA 4CIVA 4V0MA 3FOFC 3DZDA 1GQYA 3EDOA 1PQ4A 3I28A 2LVBA 3D4NA 2LRHA 1IIRA 5DGCA 1DQSA 1M2FA 3IR6A 3BGOS 1D4OA 5L3QB 1GR0A 1T1RA 2QTNA 1Y5RA 4O2AF 3WWZA 4BO7A 2YQZA 4KG7A 5EE3A 3TPZA 3QZUA 1ZUIA 3L46A 4O4JA 1NULA 11ASA 3NBUA 4K88A 3ILYA 2GBIA 3FGZA 1AKRA 4X20A 5DGHA 5EMKA 4QUKA 5TT0A 4DJ5X 4GNRA 1Q12A 4X94A 1QCDA 2JCBA 1K86A 2P7IA 1EX9A 5JCZA 4M55A 1GTZA 2DUWA 4DSOA 4UQLA 1IUNA 1JDBB 2R1UA 3R5TA 1BWPA 4EJ2A 1QC5A 1TMGE 3IYLW 1T4CA 3KKPA 1C9NA 2FNAA 3OWXA 4HFJA 4YP6A 3A8TA 5L4SA 1PJ4A 4N0QA 1K4KA 1RQGA 3RAGA 1AE1A 3A1DA 1E89A 3IC5A 3PFNA 3K92A 2CKDA 1OV6A 3LK7A 3FRIA 4R4JA 2JFYA 5E2IA 3WK6A 5HJ5A 4HB4A 2VUIB 5F4ZA 4YV0A 1ZP6A 1YFKA 2QGFA 1EZZA 1ZH0A 2TSYB 3TNLA 3K16A 5A4IS 1TEZA 4Z4CA 1W46A 5MDHA 1OH7A 3PPVA 5FOQA 4AO7A 5HIIA 2PWYA 2OK8A 4D79A 3LECA 5AI4A 5EC8A 1TNDA 2C5FA 4A03A 3L1IA 1QGDA 3LVBA 5FXMA 2O0KA 3EWAA 4ZXPA 4BV9A 1RXVA 1T4DA 4KQEA 4KREA 3Q8MA 4IVNA 2DRIA 4IDAA 4G9EA 5DHSA 5CCXA 3EZXA 4MA5A 1G3MA 4M1ZA 1MEJA 4IXTA 4QUEA 4Y67A 1REQA 5CB4F 3GPLA 1U2TA 1DQYA 3M4PA 1SQ5A 4DCSA 5L3SB 4CDGA 4DMUB 4K86A 4C2UA 2MSDB 1V48A 5HWSA 3M6UA 1VSTA 4J43A 5KNCA 3HV2A 4RIHA 3P8YA 1MIOA 1CEQA 3EF1A 2QJRA 3GA0A 3ZIHA 2PG3A 3VC1A 2A9VA 1K98A 1GPUA 4HFRA 3CZ4A 1VBNA 2MSCB 1Z0JA 4M8IA 1CZKA 4XGQA 3CE9A 3RWBA 1WPXA 4ZQEA 3N2KB 3KL2A 5B1EA 1SWVA 1NGSA 1N2OA 2Y1WA 1QUFA 5EIOA 5FFNA 5BORA 2DOKA 2QRMA 1AN9A 2WF7A 3A3PA 3OQPA 2BMAA 3LW7A 1U7WA 5D3MA 2JGNA 1SUPA 2GYUA 3S6JA 2RH8A 1EUZA 3BF8A 2GN1A 1GZ3A 1NQXA 4HA8A 1IONA 1N2CE 1ZNQO 4H18A 4J3JA 3WQQA 2YV2A 2ZIZA 1RJFA 3AQ4A 3TLKA 1J1UA 1E2BA 4JUIA 1U11A 2CLKB 3DE5X 2PJRA 1RPAA 4HDMB 5A7GA 2BOVA 1P19A 4ZIBA 2PYZA 1F2DA 3LY9A 1LD3A 1PRYA 4RGBA 4R40A 4XGRA 4NZRM 3C1OA 5D01A 1XQ6A 2A14A 3OLWA 1DC7A 3GLUA 3OVMA 4I5EA 2CE7A 4AMGA 4CZ2A 3VBBA 5AJVB 3BHNA 1Q1ZA 2YIMA 3G2HA 1QPZA 4R8KA 3ZV7A 3R7SA 3W8FA 5H80A 1I3CA 1NVBA 4IFIA 4KXWA 3QVSA 4BFLA 3V4SA 2OG2A 4JFRA 3VOBA 1E7SA 4YFVA 5JCJA 1NPDA 3TL6A 3L7LA 3P7MA 3GGCA 4OGGA 1ADYA 2IA5A 4IX9A 5JS6A 3FVTA 3KLPX 3Q7RA 4DANA 3X1ZA 3QUSA 5KJ6A 5FOVA 4U7DA 5L40A 5D51S 3HU1A 4KGXA 4FJ0A 3THSA 3UAVA 4XTWA 1JT2A 1JH8A 4CKCB 2MR6A 3KYCB 3AUJB 4G8CA 2BZSA 4LHEA 3QLUA 5KYTA 3KYDB 3NFYA 4HY3A 2BD0A 2FPMA 3C4VA 2GLUA 4YCLA 2CV1A 4NBNA 5IKPA 4MUMA 4HN9A 4ENPA 1MG0A 1E3QA 2FWJA 2ZJBA 5E1BA 2N3ZA 4WNIA 1RQPA 3V4OA 3DAHA 1FFHA 2Q3HA 1V5GA 3HEAA 4L5YA 4EJ6A 5AIBA 2C0CA 3R5XA 4P8RA 1QONA 4D6PA 3S0JA 1NNUA 1XZ8A 3ECCA 4O2AB 1RRFA 2O7RA 2XB2A 1Y1SA 1YZUA 4A27A 4NCBA 1M1ZA 3CCFA 2D13A 4ZO7A 3JQDA 1CUVA 4FCVA 1PGQA 3D3QA 3OPYA 4PN7A 5EJ2A 1N2BA 4XU0A 4WY8A 3FOZA 3B9QA 3WGHA 4AJ1A 3WMRA 1D4FA 3VSBA 4WBSA 1KC1A 2NSYA 2J5RA 1UC5B 1PDVA 2MMGA 1FS5A 3EIQA 3KDAA 3TRKA 2RGGA 5EXXA 3V9AA 5HZHA 5K3DA 3MILA 4K0KB 3CUSA 5H8WA 2X7XA 4UVGA 4WLEA 3JASA 3ZBQA 1TCUA 3DPUA 5KWIA 3WVNA 4GX5A 3ME5A 2BCEA 4B84A 4LJRA 4Z4QA 2JZOA 2DTEA 3LUHA 2ACVA 2QXYA 2X76A 3QU4A 4I2VA 1OSNA 2Z5VA 2DJZA 3R3XA 1WU7A 4IIGA 2ETVA 4OM7A 2WIDA 2XOEA 2BZ0A 2QE6A 2BHRA 4EUKA 5EVJA 4KBYA 1PLKA 4O5OA 3K7EA 3UAOA 3ZQJA 1N5RA 3A6PC 3W9UA 4QTUB 4RYLA 3E8MA 1GPMA 1B3BA 2JHCA 4HL6A 5CK4A 1SY7A 1W34A 3A7DA 4FZVA 1QRUA 3HABA 1UFRA 1G0OA 1WHSA 2P9YA 3PPIA 3S2GA 5CB4B 5HFJA 5KJFA 3N6XA 2OV1A 3KX2A 2HK7A 1J23A 5E8JA 4NCIA 1VJGA 1QH8B 3ND5A 3TW4A 3H99A 1PZFA 2PAFA 4HTFB 3TB6A 4EENA 5C7IO 3MMZA 1NW4A 2QP3A 3OIVA 4J4TA 5EXPA 4KUGA 4NZNA 4JT2A 1IQUA 1ZQ1A 3MBOA 1H1TA 3NNNA 5KNNA 1HTBA 5A9RA 1Y33E 4ZT3A 4U7GA 4BJ5A 2CMFA 4BNYA 3OZIA 3BJIC 1H0HA 3BL8A 1BX3A 1TYEB 3SVZA 1NSFA 2W6CX 1Y34E 2OCGA 4ZU6X 2FMIA 2HDHA 3R7AA 3HA7A 3WKAA 4B6PA 3QMMA 3AU8A 2HSZA 1LXCA 2OKCA 2ZVQX 3C6QA 4GC9A 3Q3CA 2I80A 1BHSA 4DLYA 3UAZA 2UYYA 1NE7A 5TSDA 5K3OA 4DPMA 3L4JA 1AV6A 1PFGA 4PYQA 1YRLA 4FYWA 1O89A 2QUBA 4JUDX 3R76A 3H42B 3HSKA 4H4CA 5BSUA 2QENA 1G3IA 2QORA 4KGVA 1OWOA 4PR0A 5SY9A 3T38A 2CMHA 3GUCA 3ABRB 1Y4AE 4UM9D 1HZZA 1T4BA 5T7BA 2I2FA 4UU8A 1ZH8A 3U80A 1EDBA 1H2BA 1B7YB 2EX1A 2IOQA 4GW3A 5SZKB 3E61A 5LXTF 1DNPA 3E9ZA 4BU0A 3FZYA 2UU9B 1NXVA 3KPJA 1QV6A 1RP7A 2NXCA 4N6GA 4Q6WA 3MTGA 4Z86A 2NZVG 1V5FA 2OM2A 5BT8A 3EEYA 3KZVA 2C96A 2FFHA 1CSEE 1CUSA 3MWDB 3AQIA 1YRWA 3IT0A 4YRJA 3QE3A 3QLTA 4YXWD 3LM8A 1ESMA 1IC6A 1XEWY 3L0ZA 3EFRA 3UHOA 1VLLA 5CW1A 3A25A 1TO6A 1K0UA 3EGDA 5C8YF 2X8JB 4DR3B 2X2PA 5BV0A 4J1TA 3TOXA 2J31A 1U8ZA 3U7QA 4DIDA 2HRDA 1JL3A 1JI3A 4B3TB 5C2JB 1V25A 4CG2A 2JH8A 2WBLC 4QNNA 2P9BA 2F8MA 2R6R1 4CS4A 2UZ3A 1D2GA 3O4JA 3PXEA 4GQBA 4IJUA 5KJEA 3MB8A 1QVZA 4XEHA 4XA8A 4RESA 4A1OA 1Y89A 4G0UA 3AOEC 3C15C 4Y6GB 3R0IA 3CO0S 2WWIA 1MMFB 4P7GA 5ELXA 3W3AA 3A5ZA 3TB4A 2O57A 1XEXB 2P4EA 3KT0A 5J2TB 3G2NA 4XSGA 5K3BA 1VCOA 5KOJB 1PS8A 3T4UA 2H2HA 1C8LA 4BPBA 4P4TA 5LZ8A 4K8OA 3OTQA 1V8OA 2JFNA 5HUHA 1N34B 1T9KA 4MS4B 2LKDA 3GEDA 3FRJA 2I8LA 2XAAA 3JQGB 2OUIA 2P40A 4PV7A 5JLJA 1PK8A 1EP2B 1G9XA 2IKQA 3ZI4A 4AF6A 3KSAC 2CV0A 3F7NA 3UK6A 3HJFA 1UKAA 5IM5A 2AOVA 3E9HA 1KI6B 3VPXA 1D2EA 1ZM2A 3ET5A 3G8DA 2IZ1A 2NQ8A 1YIDA 4GX2A 3ZH2A 1LFAA 3C14C 4E5MA 1UR5A 1USYC 2IUTA 3EE6A 3GNLA 3IP6A 1P74A 1W36B 1X7WA 3ZDRA 1K4YA 4BRWA 3D8TA 3NWPA 2A5LA 3UWMA 1EK1A 2HNKA 2NS6A 1CPYA 5CFOA 3OZSA 4R9VA 4BZWA 3N1UA 2I2AA 2G7MC 1RAAA 2FTKE 4AAYA 2YIDA 3WKEA 4PCUA 1CJTC 4XLZA 2XQIA 1BEEA 3DF7A 2AUMA 1C1XA 3ETCA 2VT7A 3OJ0A 4KK4A 1M1NA 1M7BA 2J7PD 8ABPA 4ZVPA 4JP2A 3ZTTA 2F8TA 3PCRB 3HZZA 3V8VA 4RXMA 1RVDA 2B3TA 4DCPA 1O58A 1ZLXA 2GKGA 4UHFA 5B2ZA 3GWGA 1FUYB 1SVSA 3R6TA 5AOVA 1JKIA 2HV8A 2XR1A 2G9UA 4S1NA 3H05A 4MMZB 2IIQA 2L18A 5JDIC 3H3JA 3G13A 1OR8A 1NXXA 3P94A 3WJ1A 1CF4A 5FPKA 4PVDA 3JZIA 4B76A 3NIBA 2WWYA 3LHKA 1JU4A 3H4VA 4FCCA 4HGNA 5FPSA 2B98A 2QRPA 3AUFA 3T34A 5H4GA 3IV7A 2AN1A 4QGSA 5LYJF 4OX9B 3ISTA 2Q6LA 2E5FA 1QP4A 1P8JA 5TMDA 2OAEA 3SC3A 3G6KA 3U7GA 3DAGA 1KZYC 3K70B 4M54A 1COWD 3KQTA 2ODTX 1NH9A 1M8KA 1EPUA 3AZOA 3BXGA 1G4UR 1CJKC 4MUIA 3C2QA 2P8SA 1NBMD 1KJJA 4LJKA 1DJNA 2JK0A 3V4ZA 4GIBA 4KIJA 5A2GA 4CM9D 4IJQA 4AZ0A 4TGLA 5LBTA 1XTTA 5EMJA 3JCZA 1T1EA 1SRYA 1W88A 2C2WA 2EKBA 2PTGA 3BAZA 3SZUA 4QBGB 3U9LA 1E4EA 1HFKA 1Z5PA 3D3WA 2W6QA 4S0XA 4DC9A 1AA6A 4TYWA 1Z4OA 4YRAA 5JY1A 4HQKA 4DYDA 4PHHA 1NI3A 3GHHA 1OH5A 4KLNA 5C8XA 1IQ0A 4LRYA 1I80A 2XQKA 4H7EA 1QRRA 3S5UA 5JJKA 1I10A 4F4UA 1U0SY 2IF2A 3E0XA 4QJ3A 4I3GA 1C0AA 1W4RA 2B9VA 1UT8A 1WDWB 1AGYA 4EDHA 4IDPA 3L18A 4WVLA 3C5EA 4O02B 4L74A 2HADA 3E7PA 3E81A 1Z6YA 3LD9A 4JJKA 4WOCA 3TTYA 3WTCA 1CETA 1W59A 4X20B 4BGUA 4NV1A 3UMCA 3PC8A 2CJXA 1E96A 2CUZA 1FFSA 3P45A 1UM8A 4RACA 4D92A 2W70A 5FQNA 4PFKA 1XUOA 3KWMA 4F96A 1EM8A 1I1QB 2Z2IA 1N2JA 3I9V1 3NUQA 4P4GA 3SQNA 2C7GA 4BCCA 2FK7A 3WAGA 2FYKA 5C8YB 5CT8A 1SCQA 4OQ4A 4P93A 1CP3A 2P30A 3JYNA 3S99A 4E4YA 1DG1G 4PG3A 2P9CA 2GXAA 2ZZNA 2XHZA 2YWEA 3OLQA 2YW2A 4RVNA 2IYRA 1EUCA 1I3MA 3HNOA 3P32A 4WZAB 4DMRA 3CVOA 3VZCA 2NYVA 1NIPA 5JMOA 2F17A 4PO9A 3HCEA 2FGJA 2QAGC 2PQ6A 3TLBA 4ZEXA 1DEXA 3G2QA 1HYBA 4HNHA 3SD7A 3A6GA 1ADJA 3MJFA 1WCIA 2PFSA 4AM8A 3F6EX 5CH8A 2XA2A 4R41A 3LQ4A 4MK4A 1R0KA 4F2GA 1M75A 1JDJA 2PUTA 3A1FA 3K0CC 4RX1A 5HK9A 4LFAB 3SLRA 5MFZA 4LQDA 2YOGA 3ZLJA 1REQB 2FF7A 4X62B 1CR6A 2FMKA 4Q4HB 2AJLI 1Z6PA 3H1PA 2YVUA 2EQAA 4EHIA 2GDZA 1Q20A 4K6GA 4REMA 1EBUA 3RU2A 1JB9A 2XZPA 1MIOB 2VN8A 4EY8A 1SZPA 2HHJA 3C85A 4MYSA 3W4KA 2ZCUA 3U1TA 3QTCA 4YR9A 4Q4JB 3DWGA 1QHFA 1EHYA 1Z3CA 2BMFA 4LJ8A 4DA4A 1E9BA 1HDEA 1WL8A 3GELA 3GVPA 4S1PA 4A3SA 2WWRA 1YS2X 2PUWA 1WKCA 1M3SA 1YMVA 3K5IA 4FYHA 2GXQA 1KI2A 4GRIA 3SKXA 3HJUA 3U3JA 2QHXA 1JH9A 3PQDA 4C7JA 5D3MB 3UYKA 3RODA 1WXIA 3BTSA 4LHVA 2BVNA 4XVHA 4D9IA 1OGIA 1T0PA 3L8MA 5T3UA 5JAZA 2QBYA 1VI6A 1OIVA 3O1HB 3EXIB 3BRWA 5AM5A 2V3VA 2AOWA 4OB6A 1C80A 1DEAA 3TO5A 4ALIA 3RSOA 4EKYA 2FU5C 4ZGGA 5JJ5A 3VZQA 1OJLA 4CMEA 4JJFA 4TWRA 2CUTA 5KTRA 5FJIA 1EDEA 1SG6A 3TXXA 5MF6A 3D4LA 1EFHA 3GROA 4NAUA 4Y1GA 3U6BA 3GJ6A 2XLBA 4CV0A 3VO1A 1YAJA 2YMMA 5FUVA 5DHTA 2O3RA 2I34A 2IE0A 2W90A 2QT0A 1KQGA 4A73A 3ZUPA 3DB1A 1JLHA 1I3LA 3KUKA 1ZCAA 3PNSA 1GDDA 2C8MA 3LOPA 3QP9A 1NPTO 2QMZA 1JLMA 2Q7XA 1MIHA 3A4TA 3GQBA 3PL1A 3UWKA 3CLTD 3PWTA 2H3HA 3WDKA 1LQ2A 2Q1SA 1RADA 5CK5A 4H1VA 3AB3A 1E1TA 1TA9A 2CJPA 2L19A 3DEJA 1J2UA 2JC3A 4IRUB 4ZV9A 3D9QX 4JODA 4LBWA 1H2WA 4W9NC 1XAGA 5DNYB 1XZIA 2RARA 4BVKA 3USES 3DF9A 2DKNA 4XKJA