4K87A

Crystal structure of human prolyl-trna synthetase (substrate bound form)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
497
structure length
490
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Proline--tRNA ligase
total genus 161
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k87A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k87A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k87A02
1X01A 3M4PA 4BWAA 1YGBA 2ZT8A 4P74A 4RDXA 4KQEA 1FYFA 3V8KA 1SERA 4WJ3M 3HY1A 3VQXA 3TEHA 4XEOA 5HGQA 1NJ5A 2DKGA 4P72C 2CGHA 5K1PA 2CJBA 3HXVA 2E5AA 4P75C 2DZ9A 2Q5IA 3HFZA 1NJ8A 3HRIA 3UGQA 1X56A 2P5IA 3V7RA 2PMFA 2ARSA 4PG3A 2XTIA 3A7AA 5C53B 1WQWA 3BFMA 2DQ3A 2ZXFA 3TUPA 5K1XA 2E65A 2CIMA 3VQWA 4TQDA 4YPFA 4Q15A 4XTZA 4RQEA 4CH4A 3E9HA 1WQ7A 3RL6A 1NJ1A 1N9WA 3LSSA 1EVKA 2EJ9A 1E1TA 5F5WA 4P73C 2XGTA 4YCUA 2AKWB 4YRQA 1BIAA 4YRFA 4YROA 2J3LA 4YP0A 3IALA 5E3IA 4HWPA 2DVEA 4OP0A 4KR3A 4XU2A 4P3PA 1H4VB 1YB3A 2QHUA 3G1ZA 4YRNA 3RGLA 3RF1A 1B7YB 2ZZFA 2E41A 4YYEA 3A31A 4YRJA 4AH6A 2ZNIA 3HXUA 3NENA 3RUXA 2CJAA 2ZINA 2ALYB 4K86A 5ELOA 3UH0A 3V7CA 3UFGA 2QHVA 3ICAA 4YDQA 4TVWA 2DTOA 1PYSB 4YRGA 4ZIBA 4RQFA 1E22A 2CJ9A 4YRPA 1HC7A 5ELNA 1ADYA 2AMCA 3HXZA 4P71C 2PMEA 1L0WA 3HFZB 1G5IA 1NNHA 4XTYA 2ZGWA 2EJGA 3VQVA 2ZNJA 1QF6A 1ASYA 3L1AA 4CS3A 4TQFA 4EO4A 3FJPA 2DXTA 2ARUA 2EAYA 2QHSA 4H2WA 2Q7GA 2E64A 4RMFA 3P8YA 2ZR3A 1ADJA 1Z7NA 4P3NA 3L4GA 2ZZGA 1YFTA 3R07A 1WPYA 4YRRA 4WF2A 2P0LA 2Q5HA 3HXWA 2E1HA 3RKWA 4XU3A 3HTZA 3IG2A 4XTXA 1NYQA 2ALYA 4WI1A 4XTVA 2DTIA 3HXYA 4HWTA 4YRLA 3NELA 1SRYA 4UP7A 4UPAA 4HVCA 4HWOA 1NJ6A 2I4LA 3LSQA 4H2UA 1USYC 1KMNA 2LW7A 4UP9A 3REXA 2IY5A 3RKYA 3QO5A 1USYA 3RIRA 2EWNA 1HTTA 2ZIOA 2DU5A 1WLEA 2I4OA 1B7YA 1Z7MA 1JJCB 1G51A 1KMMA 4H2SA 2ZT5A 4TVAA 3DSQA 2RHQB 2ODRD 4DQ2A 1SESA 4TVYA 4YRMA 3UGTA 1EIYA 2ZIMA 3QNEA 4O2DA 4G84A 2DEQA 3BJUA 2ARTA 1PYSA 3RACA 4Q6GA 1EOVA 2AMCB 3P8TA 2I4NA 2DDZA 3HY0A 1B70B 3W3SA 1X2HA 2DTHA 1IL2A 3PZCA 1X2GA 3MF1A 1B8AA 2EL9A 4YRTA 1SETA 1WYDA 1NJ2A 1BIBA 1LYLA 4HA8A 1RIQA 2ZZEA 4P71A 1HXDA 3PCOB 4TTVA 4L87A 4J15A 3V8LA 2EJFA 2ZTGA 3LC0A 2FYKA 2DQ0A 1H4QA 1V95A 3L4GB 3QTCA 4P72A 4OLFA 1JJCA 2QHTA 4HWSA 2HNIA 2G4CA 1E24A 3MEYA 2RHQA 3NEMA 1X54A 4XTWA 1EIYB 4XEMA 3REUA 12ASA 1WU7A 3QO7A 4EX5A 2E3CA 3E9IA 4BW9A 2ZR2A 1EFWA 3A5YA 5KNNA 3EFSA 3HXXA 3I7FA 2IY5B 2DXUA 2ZCEA 3A7UA 1VQZA 1YFRA 1EQRA 2DZCA 1ATIA 4P73A 1EVLA 3HRKA 4CS4A 2RHSA 1KOGA 4XU1A 1H4TA 4TVAB 4H2XA 2C7IA 1GGMA 2ZT7A 4YRKA 3PCOA 3A5ZA 4NCXA 3QO8A 3V7SA 4CH3A 4ZTUB 4H2TA 4CH5A 3V8JA 4YRIA 4XTUA 4X5OA 1J5WA 2I4MA 4LNSA 1QE0A 1B70A 4PHCA 3TEHB 4YRCA 4CS2A 2ZT6A 1WNLA 3EFRA 4K88A 2DU7A 4K87A 3CMQA 1C0AA 1ASZA 2E10A 4P75A 4E51A 4H2VA 2Q7HA 1H4SA 5C52B 1BBWA 1BBUA 3A74A 11ASA 3HFVA 2RHSB 3NETA 4XU0A 1G5HA 3OD1A 4P3OA 3TEGA 3KFUA 1W66A 4UP8A 2ODRC 4G85A 3A32A 4KR2A 5C51B 4DPGA 1E1OA 4WJ4A 1X55A 3IKMB 3A7RA 3P8VA 1B76A 3ERRA 4CH6A 3VBBA 4YCWA 4YREA 3M4QA 3L2ZA 4YCVA 2C8MA 4HWRA 2AKWA 4YRSA 2DJZA 2J3MA 4ZTZB 1YFSA 3IKLA 4H2XB 4TWAA 1NYRA 4H02A 3MF2A 4P74C 3RKXA 2Q7EA 3VQYA 4H2YA 3WQZA
chains in the Genus database with same CATH superfamily
2PUDA 3KC2A 5AJYA 2G17A 3ZGLA 3C24A 5KS2A 3V33A 2WHQA 4HNTA 2MYUA 2NUTB 2Y6VA 4WOKA 1GFWA 3QIAA 1AQJA 5DM60 5JPCA 4B5KA 3L4EA 2O7SA 3OIYA 2ZE8A 3VHLB 1O6FA 1JI3A 3HNPA 1P45A 2YHBA 4DZTA 4AWBA 1I0ZA 2GAJA 2OFXA 2TMGA 4N5IX 1GCGA 1VE7A 3I4LA 2RGWA 1SPXA 1UFKA 4WFQA 3TUIC 3G0IA 3H6HA 4MW9A 3ZIUA 3D4NA 4BDSA 1GPKA 4BB9A 2XITA 4CR6A 3OY7A 4NZ9A 1D0IA 1SK9A 1G20E 3QI2A 4Z2YA 1ZZEA 3HI6A 1GRCA 4JT9A 2DT8A 1KI4A 1V7CA 4QD3A 3UW1A 1AUOA 3B5EA 1R5JA 2PZFA 2RGCA 3H75A 1C0PA 4P72C 2ZIGA 3NDPA 4IIJA 4MI1A 4UC0A 1D03A 1YS1X 5K1ZA 3D6NB 3SJCA 4ITUA 5KYXA 1TB4A 3HN6A 4HXYA 4PGFA 3MWEA 3LDGA 3JCZA 1SY7A 4GZ6A 1CETA 1N0IA 3FHOA 3D4PA 3QUTA 2QM8A 2K87A 1N2XA 2Q5IA 2ATEA 5FL3A 3TQIA 5CVTA 3MTBA 4OEHA 3NHRA 3UGQA 3NDBB 1I7SB 2HHHB 1VHTA 1JQKA 2DLDA 3UHPA 3IIJA 4AN1A 2Z6QA 1NVUQ 1OBFO 1WULS 6NULA 2C9CA 5DGHA 5A0VA 2O6HA 3LBHA 5GVRA 3BTUA 4L0QA 3L92A 2C57A 4OQZA 4Q24A 1ZICA 1ZQ9A 3IP5A 1AS2A 5H1YA 2DKFA 4G4SP 1NJFA 1ZCBA 3MG9A 3PP8A 4PNPA 1SVMA 2CFOA 3AP3A 4DJDC 1SBCA 4G81A 4MUKA 1E98A 1NMZA 4C4AA 5JQWA 4ZRMA 3PXUA 4YP1A 1W52X 1Y2IA 1S3FA 2WD8A 1DAMA 1JQBA 4FSXA 5ALEA 1EFTA 1K3UB 4LDQA 4JC5A 3N8IA 3OE4A 1GGNA 2A1TS 2OZLB 3A2KA 2EL7A 2AOUA 3HVJA 4R81A 5HF6A 3G79A 3L0YA 3A6DA 2V7TA 3HSYA 1Y9AA 2J3IA 5AJZA 2XI4A 2YV4A 4FXOA 1DDOA 3GARA 3ILYA 3WFIA 4JNCA 2WFZA 2ADOA 5ABPA 5L6MB 2R86A 3THXB 2PYDA 5FNVA 1U9YA 3BH6A 2ZSBA 1AZTA 4F8JA 1PV4A 3LYAA 3QSGA 3A1DA 1SULA 2WF9A 4NU8X 4W63A 4D79A 5IRCD 3RSHA 4IF6A 4NG5A 1M6VA 3FYHA 4BUCA 2CNOA 4K9LA 3HY3A 2GD2A 3FSRA 1Z4QA 4LVNA 3T9AA 5F5WA 2JFOA 4RD1A 1M75A 3VR4H 2QMUA 5EWJB 2XHZA 3A9CA 1JIUA 3RSFA 3OUZA 4AO7A 5JWOA 1O5TA 2POQX 2YBEA 4ZO7A 4UTPA 1JQJC 1WB4A 3DMFA 4RSGA 4XEUA 3TGPA 4BVKA 2ZIFA 1TOAA 2GJ9A 3D6VA 2Q9AA 1PEKE 1VRVA 4P82A 3K71B 4JI4B 5A71A 2C2GA 5C7IO 3HNRA 5BUZA 4NPAA 4Q93A 2GM4A 3WQBA 1B1CA 4NV0A 1XAHA 1JR4A 1Z2CA 2C88A 2A6PA 4REOA 3UJ8A 4C05A 4CKBA 4JS0A 5LVAA 1UAAA 4X6LA 4RQAA 3HVRA 3O82A 1TKAA 3UMRA 1LPAB 1URPA 2FPUA 3CZ5A 4M1YA 3OQJA 5BPHA 1GPWB 1MENA 1JDBB 1QCYA 1K68A 3RF1A 5CB4B 4PZZA 1U6IA 1QIHA 3FGNA 1RS0A 2WT8A 4A8JC 1T4GA 3H8JA 3NNSA 2ISQA 3D3QA 4I2NA 5ENDA 4AKGA 1SC9A 1JHRA 4CFYA 4ALIA 3U2QA 1NRIA 1UPBA 2D2EA 1ZNXA 2O2XA 3K73O 3TTTA 1ZKDA 3OF2A 4BGEA 1Q1NA 2HBYA 2I8LA 3U09A 1C8BA 4HNVA 4PM4A 1CUUA 4TUYA 2FOIA 4E14A 2VDLB 4MP8A 5GZ1A 3CEJA 4F72A 4BFTA 3OJOA 5A06A 4BVJA 4TV9F 4DJ5X 3GFTA 5EXPA 4DT1A 3T7TA 1CK4A 1U5BB 1S2NA 3JYLA 5DTMA 3I42A 3I5UA 4FGSA 4BNZA 1WV1A 4ZT7A 3VPAA 4A9AA 3IPAA 1GFSA 4XPIA 2ZVQX 2VPZA 2GT1A 5H16A 4DA9A 5BMVF 2G72A 4IJQA 5L51A 3J81k 1Y4ZA 3LHDA 3L8FA 5FBWB 3B2NA 5LOVF 1GGHA 1V4BA 4FFBB 1C2TA 2QV0A 3HFZB 1GYRA 3QK7A 5E9QA 4OYYA 5FQNA 5LZ5A 4PYRA 3WWYA 4KB5A 3F90A 5HGJA 5KWEA 3RT9A 3DLHA 4J0QA 2HADA 1KSJA 2OV2A 4H6VA 3OJWA 1U7WA 5D2CA 3VQVA 2C83A 3BWEA 3D2BA 1D6SA 3HYTA 4GXNA 4Q5IA 3T41A 5EIOA 3T7DA 4HN9A 1PZGA 1AXGA 4LBZA 1SIUA 1IC6A 1UOPA 2GZRA 3C1OA 5JARA 4MB2A 2GYUA 3FFWA 4CHTA 3ZHTA 4G1BA 1NVMB 4BU1A 1T9HA 2G7MC 4R9SA 2ONJA 3K1YA 4PCLA 1G21B 3AXSA 1I30A 1RJ9B 4TPKA 1KK2A 1KZYC 1OXTA 3A27A 5ER9A 4ACBA 3PLAE 2L82A 4M7WA 1PIWA 1A0OA 4HD0A 4B46A 3CXRA 2RIRA 4NNJA 4HAOA 4DGSA 5DCWA 1Z2DA 1QH1A 4PRKA 3SQDA 2FR8A 2FE4A 3PZBA 4RPLA 4UMEA 5U4QA 5I4BA 4Q4HA 3VHXA 3K5HA 3MSCA 4EGQA 3BBPA 1Z2OX 4E33A 3JZAA 3T5DA 7MHTA 4IMJB 3JPWA 3JD3A 1P2DA 4CTJA 4S24A 3D7SA 3OTGA 3ZWPA 2NVWA 4I1RA 3HKCA 4LJ5A 1BDHA 3HFJA 3AFGA 4D5EA 3QJYA 4GUDA 4YAJA 1WM1A 3C98A 3OZRA 5CH3A 4HWTA 4RVNA 3NELA 3FVQA 4K7JA 3STWA 3UYLA 3NBFA 4UXIA 2WNIA 3O1IC 4Z8XA 1PWEA 3GRVA 4W6QA 1GZ7A 4B31A 4ZGBA 2AKYA 5HE8A 4Q21A 1UBTS 4QWMA 3R9XB 5C8VA 4M83A 4UP9A 1C7ZA 3VR2D 2C8LA 2IY5A 2CWWA 5A4KA 4FZ3A 2CNBA 2J4FA 1J2UA 4HDSB 4ZO9A 3GN1A 1GD1O 3KYCA 3NCTA 4P4SA 4Q7MB 2JLXA 3ZU2A 1T91A 3VU1A 1WDLA 3Q3JB 3HLYA 4EUNA 3HV2A 1LI7A 1J0XO 2AFHB 5D1NA 1F7UA 1X1AA 3IEKA 3U13A 4C88A 4L73A 3SZLA 3JQGB 1FQJA 1BXZA 2CD9A 2WMYA 5E7IA 5GINE 2ZJ3A 3LBNA 1ECFA 2X9GA 2BE9A 4X95A 1ICEA 3BM5A 3REQB 5ITSA 1J39A 3NAGA 1L5NA 1JGTA 3ZNPA 3EXHC 2RHQB 3WGNA 5H9WA 1E9RA 2B21A 2BKUA 3H3XA 4G67A 4L51A 5CA0A 3H2SA 1QBGA 5EUMA 4RD2A 3BK1A 4IMPA 1LPPA 4JP1A 2LXRA 3ILSA 4JX8A 1UADA 3CR7A 2ZS8A 3ZU4A 3PQ8A 4LKOA 3VXKA 5AJXA 2DEQA 1H9AA 4ASUA 5JBNA 1P4JA 2AUMA 3VKVA 4ND8A 3RACA 2FHSA 2OLEA 3P0FA 1PGNA 2WWYA 3IV9A 3VPCA 3KQNA 4OXQA 1KNXA 3GZNB 3QVUA 3EGXB 2X5OA 1QFYA 4I50F 2KQUA 1DQRA 3OMLA 3DE1X 1TO1E 2AEJA 1NM5C 2H17A 1PJZA 1DBVO 3PX7A 4B33A 5CLHA 5JD5A 4O59O 4OB6A 4AMVA 2BE7A 2F9MA 3B7PA 4WK6A 2XMQA 1CHDA 2C5FA 2BTQA 1L5LA 3V2HA 4FC6A 1WCV1 1LLUA 2R4QA 4Q37A 1GR0A 2HU5A 2VZLA 3RFCA 4YCBA 3Q9LA 3K72B 1I9GA 2H1FA 4YRBA 5LQKA 5DO9A 3SYKA 3WIOA 2OCPA 3G2PA 5BW5A 1QVZA 3B5JA 1DMRA 4BRSA 5KTYA 1BIBA 4D8TA 2EG5A 1E2HA 1F17A 1USKA 4GL2A 4HA8A 1O4WA 1PJTA 1QG6A 5CT5A 4AG5A 5D3ZA 5HIAA 3LYLA 1L4KA 1RKUA 2LCIA 1R0KA 1SXJE 2O0KA 4FYIA 721PA 2XQGA 3GGCA 3AW9A 3ND8A 4IIEA 2FN9A 1IPFA 1B6SA 2PKRA 3ESBA 3ODPA 5EIBD 4G8CA 1I1NA 1FRFS 1R6XA 1SHTX 4ZVKA 2V58A 4UCWA 1YA4A 4O4HA 2R7AA 4RMIA 2EX1A 2IWRA 3PJFA 4KXNA 5FPKA 2FPPB 1RXUA 2OXTA 1QNLA 1A04A 3KJNA 3LNTA 4OLFA 4NPCA 3OSZA 2GVNA 1IBMB 4HWSA 3FMVA 1VMAA 2G4CA 2WZDA 3ESQA 5F7OA 1AS3A 3IQZA 1D6NA 4U7PB 2HO5A 2AOWA 4PFKA 1AM4D 3BRWD 3FTDA 4DRYA 2OR3A 3D4BA 2BMFA 3KIPA 4C4TA 1FDVA 5I01A 5EP2A 1KHHA 1MVLA 1RXCA 1O2DA 4ABTA 2EFHB 3GR6A 4Q05A 4UUBA 4AP6A 1RI3A 3KQHA 2FZGA 1W5AA 2E3CA 3E9IA 4DA0A 1ILEA 3RLFA 1YQDA 5FFMA 1J9ZA 2HV9A 4BQOA 3TGLA 2I65A 2R79A 4EGSA 3G88A 1CJSA 3NIFB 4OJYA 4RS3A 2OEPA 3A5YA 2UYOA 3AEUA 3INYA 4KIJA 4U5QA 5ALYA 4ZCQA 1ODLA 4BCCA 1CUWA 2X58A 4G5XA 3D1LA 2WM8A 2ZIWB 2NOAA 2FPGB 5EWMB 2Q1YA 3A0RB 3CEHA 2AGVA 3SYMA 2O0MA 3CF4G 4M38A 4R8VA 4UVGA 5CFLA 3NX4A 3FKJA 3L6CA 4B4WA 4CCAA 3N8GA 4E3ZA 3G0OA 4BAUA 3CURA 3VJRA 2HJGA 1IDN1 1JR3E 3KKZA 3NTLA 1LVUA 3C0KA 4JI8B 2OWDA 3H1BA 3OQMA 1YBFA 5DRTA 3V1YA 4BO4A 2R8ZA 1R4AA 5BNWA 3CX4A 3BK7A 4URVR 1U2SA 3AP2A 4U2KA 4H2XA 1F8FA 4V39A 1G6HA 4MS3A 1G6KA 1RHJA 1CULC 3V8VA 2DFLA 5CA0B 2CZGA 3JVEA 1J99A 4QDXA 5G3YA 1EUYA 1J8FA 4Q3NA 3T7CA 3CWZA 1SNYA 2NZVG 2XLBA 1U7PA 2FZKA 1H42A 3HM2A 2VF5X 3NDRA 3G8BA 3RWBA 1DADA 1BNCA 3V8JA 3I6MA 3DM5A 1CY4A 2PWYA 3BXEA 4FT2A 3FUVA 3WSWA 2CXHA 3EGXA 3HB1A 3HR8A 3MJHA 2JGDA 4DWOA 1E1CA 2K2QB 5H7XA 2IHZA 2OAP1 4FSDA 2OD9A 3BA6A 3RIMA 2G82A 1GZVA 1UWLA 3A1CA 2QVLA 4LNSA 1VJCA 2O2SA 2I5PO 3BIWA 3TPCA 2XB8A 3RVSA 1Z2EA 3OT1B 4FPXA 3L9XA 3BD9A 1YCDA 5BSVA 3CM0A 5IPFA 3LZ6A 2M98A 4AS3A 5HJ5A 4IXMA 1JYEA 2WJ4A 3R40A 4CMAA 1CQIA 1SBIA 4IV0A 2HXGA 4NAVA 2OZPA 4ZZIA 3C3BA 4JB3A 4DA4A 4EUSA 2L8YA 1WX1A 3A1UA 4HQFA 4PQRA 5CW2A 3X0DA 2WA1A 1MA3A 4MW4A 4WVFA 1Y7IA 5FUVA 1Y9EA 1XXHB 3M5CA 2EP8A 5ARCA 5IFLA 1WEHA 1YVEI 2Z7CA 4LYHA 4XJVA 1AGPA 2YJ6A 3VDXA 4DG9A 1KJ9A 2O50A 1PZFA 2GARA 2RH4A 4CF7A 3GXBA 4KITB 2WHRA 2NW6A 2QL9A 3D7LA 1KH2A 1ZN7A 2HDWA 2Q0QA 2B4YA 3GY0A 4Q9NA 4C5BA 3BWMA 1G55A 2GZ1A 2VC2B 2YMQA 1KSGA 2JGJA 5AWFC 5PGMA 1LS1A 2GN4A 1U99A 1YWGO 4ZEWA 4JL5A 1T26A 3CSDA 2E7ZA 3KK0A 4G63A 2NIPA 3ZKAA 1TM5E 2IYEA 5T6BA 1X14A 2YFHA 4M0FA 3S1AB 3LAWA 1T5TA 1W66A 3SM9A 5IJ9A 1NH9A 2OHGA 2FFJA 1JQAA 3MERA 1VJ0A 2GRUA 4Z54A 4DLAA 2V9PA 1PS9A 1U0SY 1JR3A 2IU6A 1YB2A 2PL1A 2Q9UA 3WKAA 3H87A 3FSGD 3DEJA 5BW6B 4DNXA 5CFMA 2DQZA 1CPYA 3DGEC 1KGSA 2IYSA 3EZLA 1WCWA 1PBNA 1HE3A 1QC5A 1A9PA 1XX6A 2VA9A 3CZRA 3HE3A 4HN4B 3CZMA 4K8OA 5D1HA 3ROPA 4HRXA 3W04A 3JRXA 1WUJS 1CYEA 1O94A 1X1EA 5HCNA 3AO0B 4C14A 1Y4UA 1EEHA 1ZP6A 1YKFA 1KSHA 5EWMA 4PCAA 4HCJA 5B1SA 2I22A 1GUFA 3VR4D 4BMCA 5JAOA 3T1TA 3BUSA 4UNIA 1HYQA 5IK2A 1WTCA 2VYND 3PQ2A 4IHAA 5C46F 4BFXA 3NPAA 4HWRA 4CF3A 1CY8A 2YCLA 1GNPA 3ROGA 1EVQA 4GWGA 1UPFA 1YR1A 2BH9A 1E0DA 2H2AA 4P32A 2QIPA 2HJRA 3TDKA 3M70A 5CDGA 1V3TA 3GLSA 5KNCD 2RI0A 3AVVA 2IHBA 1ETUA 5EMJA 3INRA 4KBYA 3LK7A 4GI1A 4HZIA 2X2PA 1PR9A 3RRBA 1SXIA 3F6PA 3C74A 3MF4A 4QLOA 4P83A 3SC6A 1QONA 3KQKA 4YMSA 4GX5A 5TT0A 3C97A 3TAUA 1UK9A 3VDQA 2DVMA 3O31A 1Y8RA 2FVYA 3ORRA 1PG0A 2IQ5A 3FCEA 3FRIA 3KELA 3MT0A 1SU6A 4G1UC 4REQA 3V4RA 3N2ZB 1L7PA 2ZJ8A 3MT9A 1U2DA 1V43A 2XE6A 3F7MA 1UQUA 2ZYSA 4AMZA 1XMVA 3HADA 1KJ8A 2YNMD 4IZ6A 1A97A 2VDWB 4XD7A 3B8HA 3SICE 1GQSA 1JKFA 3TRJA 3ZS9A 3ZXXA 1UKYA 1RQGA 5HZMA 2GEBA 2WG0A 5FWAA 1P7PA 4QUIA 5D00A 4FBWA 4ML3A 3PUYA 5G1OA 5G0WA 1TT7A 1ENOA 1QCZA 4WZAB 3DTNA 2NV6A 1EJ2A 2IZZA 2Q6OA 4TL9A 4ZVTA 4ZI7F 3DUFA 2HPZA 1V71A 3VNAA 2B2NA 4MX8A 5DULA 2AF3C 2IE0A 4E3WA 4Y9DA 4YWHA 1N5JA 3D2AA 3FLBA 5BOSA 2O06A 4BX0A 1BVYF 2DFPA 2HUNA 2JFWA 4JITA 3W4KA 2Z6AA 3FKSD 5AK6A 4X7RA 3ZD6A 4TN5A 4ZYLA 2MHCA 2VF8A 1PZEA 3COSA 4MIYA 5EI5A 2OORC 2GEJA 3N6RA 8LDHA 4XM1A 1NMEA 5A3VA 4DKXA 5LKRA 1M2NA 1DOZA 1HEUA 1C9NA 1ZC3A 3PIDA 3E23A 3VR2A 1TYEB 3FXAA 1H6BA 3GFSA 4Q3OA 4LYEA 5F7JA 4D6PA 4E5DA 4TUYB 2VNJA 3MQ4A 3KOYA 4RXMA 4KAXA 5IYZA 1JIXA 4E31A 4NI5A 3DBRA 1POWA 3EXFA 1TMGE 1W29A 4DPMA 2ZRIA 1CEXA 1GT6A 2TSYB 5AKYA 4PAGA 5KYVA 5GVSA 1CIPA 2OPBA 2BJVA 1U5BA 1J56A 4FLFA 3IABA 3CONA 3N28A 3R0QA 3N6XA 3O75A 4Q4AB 5JYCA 5TJ9A 3GGOA 1Y5IA 1Q7CA 2PZMA 1W2WB 4BBZA 1ESEA 4FQ5A 5DYIA 2PD4A 4RH3A 2BCEA 4LF9B 5F1PA 2JIZA 1V6SA 1MHPA 2JLCA 3HYNA 1VE6A 3NHUA 4X94A 2FR8C 5DMXA 4YONB 4ARZA 5B1YA 3FUUA 5ALJA 2WMNB 2F1RA 2CDCA 4WK4B 2YNMA 1OR8A 2OQIA 3G0DA 5KSPA 1XLTA 2B2XA 3TSWA 3QVVA 4JQOA 4JLMA 4E30A 2VCYA 1I13A 1PDOA 2WC1A 4RESA 4XIGS 4YCUA 5I7RA 4YRQA 1P1JA 3JAWA 3MQZA 4KN9S 1BIAA 2IV7A 4A8PA 3ZCTA 4DCPA 5HWSA 1GFZA 1ZRMA 2P5TB 3K30A 1E3JA 3HU5A 4FFSA 2EQAA 3KXIA 5AXDA 3REOA 4WWHA 2JZNA 3G0GA 4Z99A 3V3KA 1T2FA 1VG8A 4ASUD 3WRYA 4DS3A 3RYIB 3B6ZA 4Q3DA 4CLRB 4F8YA 2AOTB 2BP7A 3RSOA 2EGHA 4I9GA 1ZOLA 4WVLA 5LWQA 1SVSA 2Y2UA 1XB2A 2PGXA 1QHHB 3AKEA 5JROA 4WZ6A 4CE6A 2HA3A 3EXIA 5ALWA 3TLAA 5THKA 2E4XA 5DLQC 2FSVC 4F9GA 4DARA 3BWYA 1MJHA 3F73A 3GLGA 5E1MA 3TKLA 3U56A 1X94A 3WG9A 4Q9DA 1XNHA 1YZYA 1TUBA 2V0NA 2YV1A 3WX0A 1K2WA 2K7ZA 4I55F 3QELB 4QREA 1E2LA 1C7EA 5EIEA 4PAMA 2G9UA 2QRQA 3IR7A 4E03A 2H1OA 2R48A 3HA5A 3V4SA 3KXKA 3ESDA 4K1LA 3ZN2A 2DHCA 2H1SA 2JAUA 4WA8A 1ODTC 2R1ZA 2Y71A 1QZ3A 4BAGA 1W85A 1E22A 1WMSA 2HWWA 5U1PA 3EF1A 3DE4X 3UMMA 3C5CA 4HQRA 4DR2B 1N6PA 1TRKA 3IP6A 1A1SA 1KYQA 2COUA 1NBOA 1YMVA 2C2OA 2H5JA 2PMEA 5FO1A 4OMUA 1XZIA 2VRWA 3LHIA 1E6KA 1VSBA 1Y82A 1Z7WA 3M6FA 1CY7A 2NS6A 3GFBA 4YT5A 1NW3A 4DM7A 3RYCA 2MSLA 1UBRS 4OQPA 2ZBFA 4TOIA 3RDPA 2GKOA 2PRZA 2C58A 1QRDA 3HU2A 4DSZA 1T24A 1P4HA 1X1DA 3KKQA 4R1NA 3U3KA 4ETIA 3KQLA 1KKUA 1WPRA 2WKQA 2XCUA 3X44A 2ZUVA 3FJPA 1O94C 5IH7A 3P0RA 1JWLA 5DOZA 4PZPA 3VFDA 3M4ZA 2J67A 4XX0A 5B7PA 3OOHA 4OFWA 3T1IA 1JKXA 3RH0A 2BCJQ 4IG9A 4ZDWA 2BISA 1P62B 3AR3A 4TMVA 2ZBRA 1PT6A 2Z1MA 1J5XA 2XR1A 4FTWA 1N6OA 2CY0A 4LY9A 2VUIB 2ZU0C 2ZR3A 3R6WA 2DFTA 3S7ZA 1TM1E 3QENA 1YXMA 4IHKA 4F4HA 4MA0A 3PR2B 4C08A 1P91A 4YRRA 5TE9A 4A2PA 3S1SA 1GLVA 4NBUA 3HO1A 5L8VA 2BKLA 2GZHA 5K4HA 5T41A 1YR3A 4MUJA 2IUYA 2GBPA 4D56A 4KO8A 3HB0A 2GCOB 1SBZA 3OLQA 4P08A 5ALMA 1RXVA 2QPAA 5KJ6A 3V9PA 3BDIA 1FFYA 3BGSA 3CNNA 3DOUA 1M2GA 4C4OA 4QUKA 4ND3A 3NHZA 4IIBA 3GH3A 3GJ0A 2YUTA 1SRYA 3MCAA 4TTIA 4R9UC 1BFDA 5L40A 2ES4A 4EGAA 1R0SA 3U6BA 3LD9A 4BRZA 4QOEA 3MBIA 4AX8A 4OXKA 4CQLB 3A4MA 2JGAA 1OBOA 3O21A 2R7NA 1M34E 2PWZA 3NHYA 4PG4A 3D5QA 3AMVA 3B9QA 3RS5A 2FF5A 1PYDA 2YJ5A 4K05A 3RKYA 1AQUA 2P3LA 1LWOA 3N1UA 4M9QA 4KYTA 4F12A 5DOVA 2JAWA 4UE6A 3C3JA 5FPTA 4U7TB 4IKPA 4N49A 5ADHA 4CODB 3LHSA 1I4WA 1XD2B 1YV9A 2HQOA 2ZKLA 2ZRBA 4FYYA 4GMFA 3ZIEA 4Q9LA 4DLKA 1KQFA 4C3OB 3WHIA 5CEFA 4K9MA 1T3TA 3WWPA 3C3PA 2GF2A 4LNAA 1HF3A 4UU0A 4XA8A 1DC3A 1R50A 1M6WA 1JJAA 2UZIR 5B53A 5BQXA 2BGTA 4IFTA 4TVYA 2RHJA 2VRBA 5FTWA 1MT0A 2AZ4A 4GQIA 4TMFA 3EQZA 3U9TA 3CTPA 5K4GA 3KZXA 3JXEA 2GDJA 4WBSA 2BFPA 1KF0A 1KZGB 1LSSA 3S4YA 1O6GA 3ICQB 2OD2A 1LEHA 2AN5A 5FA5A 1HA3A 2OSBA 3L7KA 5CB4F 4EJMA 5JH7F 5IS2A 5D86A 1Y7HA 1TQ6A 3TQSA 3QUBA 1AKUA 3LIPA 10MHA 5FPPA 4QJ3A 2C3YA 3KB8A 3STTA 1MDFA 1EOVA 1NLZA 2HAEA 4L4SA 3QPWA 4G1MB 4MROA 5AXAA 4DMHA 2JNWA 3ABOB 1T0JB 4L57A 5MGBA 1HYHA 5KTKA 3W3SA 3HKCB 1D2RA 1DRVA 4LZLA 1LQ2A 4CU2A 4DPKA 2XEDA 3FPCA 5IEJA 4LF6B 2FFBA 1OFUA 4B4UA 1JB1A 5AD1A 5B6JA 1Y4DE 5KKAA 4FFLA 1ODKA 5AVTA 1WZNA 1O77A 1N0HA 2XQIA 3MMPA 4JJEA 5IASA 1MC4A 5J43A 4R8MA 4A82A 2WJ3A 4N6NA 4ND2A 3VYVA 2WVJA 2P35A 4NCJA 5IJ0A 2I91A 2FMFA 1NPDA 3CF6R 2QHXA 2ORWA 1VBFA 2X9LA 4QUHA 4Y3UA 1P1BA 3SGLA 5HVNA 1FJXA 3VV2A 3SYLA 3TXYA 1NF8A 3R5SA 3R8FA 4JNKA 3ZDFA 1JNXX 1CZOA 3DWGA 2QRKA 1FNBA 3M49A 3WB0A 4D0LB 1V95A 2QAGA 5IHXA 5JAIA 2A8YA 1RWWA 1ZO8A 2MIIA 3G8AA 2ONKA 3JQGA 4TSFA 4BVHA 1II8B 3VYWA 2QRHA 1E58A 3HCNA 5DYYA 3HSKA 4D4KA 3QE9Y 3DV2A 2YVQA 1WY7A 2RHWA 3I9JA 2X5KO 4MK4A 2HRDA 2NQ8A 1COWA 2RHQA 1TNDA 1ZVKA 4LW8A 3HKDA 4URYR 3VH3A 5JD4A 3TMYA 4BO2A 4Y7DA 1NQVA 4BWFB 1RRCA 2OCDA 4OMCA 2FY8A 1TMOA 5JUWA 4HQ6A 3UUGA 2NSLA 1UUFA 1P0IA 3KQQA 3K4HA 4JL8A 2RG7A 2HCTA 3H65A 2H5IA 3PNBA 2NMVA 2WEKA 3BERA 3JZDA 2PLWA 4A15A 4JK3A 3HWX1 3FPGA 4WSOA 2HSZA 2R00C 3AF0A 1LJUA 3NM5A 1MVOA 2AMLA 4ZODA 3QSYA 1AKEA 1ZFNA 3BL6A 4CKWA 2XCQA 4V1CB 3CUEF 4D0SA 1T2VA 2VQSA 3D2CA 4MR7B 4X8LA 5AKGA 4RHXA 4B7XA 4MDEA 2HKIA 1E3DA 4A16A 5IBCA 1NQXA 2DCUA 1CE8B 5IDYA 2YIJA 4XD2A 1SZPA 1V11A 5F3RA 3MT8A 2BMDA 1PR3A 1CJKC 4LNUB 2RHSA 4B74A 1CS0A 1WU8A 1GNVA 1D6MA 2A9VA 2NM0A 2O48X 2VK2A 4BE7B 2BI4A 1FFAA 2XVZA 4B85A 1DCJA 5KTMA 5LPNA 3H2ZA 3W5HA 1M72A 3S1AA 1QO7A 2VYNA 4UPDA 1NW4A 3V42A 1X7WA 4Z4HA 1Z9BA 5DISB 2R62A 3DEZA 1T5LA 2PS0A 3QEOA 2V7XA 5EIWA 3RYFB 5EN4A 4G2TA 4JQSA 4KZPA 3OQNA 1RZRA 2PA0A 3EDMA 2CJFA 4OKSA 3T5GA 2BHNA 5DT2A 3FDFA 5FBVB 4D1YA 4XGNA 4KRFA 1N8NA 1VPTA 4O4HB 1JAZA 4ITRC 2AXPA 1LPNA 2I2BA 1C3XA 4FMPA 4QVIA 2FPPA 5JNSA 4YRIA 1JPUA 3TEFA 3ITDA 1US8A 4ZRDA 1RWNA 2B4AA 3AH8A 4XUDA 4CM7A 4ESHA 4Z2AA 3W4JA 4IDQA 3TTUA 4R54A 3HP7A 3PQ7A 1Z4KA 1HK7A 4DCGA 2R1VB 1KIFA 3PRKE 5JT1A 3C3KA 3T1YB 2CHGA 2RKBA 2M6SA 3PDIA 3C2QA 3HZHA 1NMYA 3C7AA 4R3UC 2HHLA 1GAJA 4BYMA 3KXDA 3CGWA 4CG1A 1ZYUA 4QTUB 3COJA 2OHHA 3OPVA 3DMRA 3OFND 3A05A 4Q01A 4XTRA 4B6OA 2N1MA 4ZJYA 5B7GA 5E9AA 4PNZA 3WV4A 1KQOA 2CLMB 4RNCA 3LQQA 1ACLA 3HR4A 1I7DA 1EWKA 1C0IA 2O7RA 4C2AA 4PQFA 4BNHA 4DEVA 2E10A 3PPXA 3PXBA 4LQCA 2XT0A 3F5FA 4UE2A 4Y1GA 3WZ2A 5MFZA 4U63A 2Y1WA 1A76A 4BNXA 4ESEA 2PSFA 3SR4A 1EM8B 2R84A 2HK9A 2PRYA 3QVTA 4P8RA 1VI6A 3A2MA 3LGXA 5DHUA 5EP1A 3UCXA 3WLSA 1BYUA 2CL5A 11ASA 1QGYA 4CUZA 1XCLA 1MZVA 1W5BA 1J8YF 3OT4A 1GLGA 2CFCA 2PLFA 4DLPA 1W48A 1T0PA 2OCKA 4JR0A 4BBJA 4EW1A 5C5CA 4YJFA 5BO5A 4UAGA 1MFPA 1QYIA 2B25A 2IDMA 1A98A 4KOAA 3WZLA 1ZMBA 2EQ5A 2IU3A 3D7NA 3IXMA 2Y0PA 3RUIA 3ZTWA 4EEZA 1LLQA 1RPNA 4C3UA 1INLA 4L0CA 4V0OA 4KR9A 3VU9B 4F92B 3QFSA 4UZFA 3UWOA 1E3WB 3QEJA 4LECA 3KSBC 1PYGA 5J1TB 2QMQA 2Z1NA 2NT3A 3SBOA 2XVXA 2HDHA 4XUEA 1YSCA 4ZGGA 2EZTA 2VDOB 4FFNA 5B2FA 4OQDA 1OGJA 4CM6A 1E7WA 4HGNA 1ABEA 4F9EA 2WTNA 4LHXA 1M6YA 2JGDB 3VKFA 1E1CB 1B6GA 3EVGA 3IKMB 1I01A 5J4KA 1C3OA 2AEMA 2X13A 3JAKA 4HXFB 3HY4A 3FY4A 1RPJA 4M9UA 4RDIA 5E95A 4CH6A 1HQYE 2F64A 4C89A 4C76A 2RE8A 4HDAA 3U4DA 2NP7A 3NCHA 3R24A 1SKBA 5D7NA 3VR3A 1BS2A 3OM8A 4MIOA 1HNZB 1JYSA 1N6IA 1Y5NA 2BMVA 4OM7A 3LUFA 1CS0B 1N77A 2GB4A 1S96A 3E4DA 2J3MA 4RK4A 4QELA 1G19A 4EPWA 4IHJB 3EZNA 2HPHA 2PSSA 4BMOB 5ERYA 1QX3A 4RV4A 4WLFA 4WV3A 1NVXQ 5LYJF 3RKXA 1OYOA 4WNAB 1KR5A 1SC3A 2G1PA 2HCJB 1EZZA 2QWXA 3K09A 3K4QA 1OXMA 3ANYB 1OPRA 1UDAA 4L75A 2Q7EA 1PT8A 3I8SA 3W2IA 2WQZA 3W5VA 4M2LA 3B1JA 3WQZA 1GTL1 2G9NA 5J58A 3AFHA 1JZQA 3B3QA 1YGBA 4BQEA 521PA 2ZXUA 1O57A 2FWAA 1HNNA 2HCFA 3ONWA 3PNQA 1ETHA 3VPDA 4WNIA 2EBHX 4RKFA 4LOHA 2V3VA 5J2UA 4YEDA 4P74A 1UK7A 2QUBA 2ZBDA 4UVHA 3W5BA 2YZNA 3EMKA 1F3LA 2UYHA 1YT5A 2IELA 2YZ2A 1I36A 1GTJ1 4LJ7A 2CHFA 1N2HA 4B75A 4QU8A 1R8QA 1NPYA 3R0JA 1UT6A 3DZCA 3UA3A 1EBUA 1ICIA 3R3JA 1FOEB 2V6MA 4H77A 1YDWA 2CMFA 2IODA 2Q4DA 4V0MA 1YONA 2K4MA 2GNPA 3N8HA 4PLYA 3KFVA 1O89A 1HQKA 1M8FA 5T3YA 3ZY6A 4F3YA 5HKBA 2CXNA 3QTTA 4P75C 1BKYA 3WL5A 2OBBA 3TZQA 3DBHA 2J3HA 1E6LA 4ENVA 4MKIA 2PRSA 4RIEA 3LL7A 4TS4A 1VCIA 2QDXA 2PY6A 4RXTA 3W79A 2WQ7A 3AVTA 1TADA 1JSXA 1QYCA 4EGFA 1OLOA 3K9QO 3REFA 5CHEA 4U9HS 3SBXA 1AURA 1IH8A 3ZGVA 4BKRA 4K9NA 4XRGA 1IHOA 1RM5A 3I04M 1K8QA 4YUYA 5KYGA 2WD7A 2WZBA 2P2CA 4NCBA 3KJEA 1A9YA 3O03A 3WYFA 1ENZA 2BRUA 3IRUA 1K08A 2AWNA 3R3YA 5IUKC 5AK4A 821PA 2DBVO 5ICEA 4G0WA 1U7ZA 3G3EA 1FFXA 3G7UA 1JPNA 4ZI3A 4MVJE 3ON5A 2CWDA 2RONA 2DQSA 3A6LA 2DFKB 3GVHA 4GLJA 3L7OA 2IKQA 2PZAA 2E65A 3LOUA 4MCHA 4MS1B 2V55B 3K9CA 4MOWA 1LBQA 1RXYA 1OWMA 3VV3A 1YTLA 3C85A 3A1WA 2EZ9A 1H9BA 1S8FA 2IXGA 4ZO8A 2Q1UA 4Q15A 3B2QA 4YQZA 1CQXA 4RTJA 4GKKB 1P4SA 3B52X 5H02A 3PFKA 4KQ6A 1XTRA 3GJTA 1XZ8A 2YXLA 4TTRA 4A4DA 4REQB 1S2OA 3ZCUA 4FE7A 4R51A 1PR5A 2Q2VA 1NLYA 2FLKA 4LRWA 3AVWA 5JISA 1B23P 2QR5A 4RZUA 2HCRA 1T5SA 3CNQS 3VYUB 2PE5A 1FS4A 4QQKA 5FTMA 5FI3A 4UQLA 2IYAA 3T9EA 4GNRA 2A0WA 1XLVA 1C0KA 1X74A 2ZWOA 4AY3A 2DPMA 1QFZA 4G9GA 4BLUA 1M33A 1RLOA 5C35A 4H0NA 5L3VA 1EA5A 2QE6A 1XTQA 1FNCA 2W6JD 3ONVA 2OGWA 2AZTA 3BAFA 1ULZA 3N70A 3QYPA 3IPRA 4YJHB 3WYDA 4ZJUA 3BOSA 1ADCA 3BIOA 4E5VA 4Y6SA 4ZREA 2C5GA 2WWVD 1PNTA 3M6LA 5FPYA 4HWPA 1Y37A 1D4OA 1FDRA 1P9NA 2DHQA 3N39C 1WPXA 4LYJA 1OIVA 4RC9A 2ONYA 1Y8QA 3ZHRA 5KX5A 3RTDA 2DG2A 5AM1A 3ED1A 3UC5A 1DWOA 1TLLA 4FHDA 4PLVA 1UZUA 3ZH9B 3ZXSA 4PLGA 2AVNA 3IOCA 4RSMA 3FLMA 2CNDA 3NBYC 4R1SA 1E5XA 1RVDA 4IZOA 4IOJA 3RGLA 3KCQA 3IHTA 1P7YA 1ZD5A 4G0UA 1RR6A 3PNMA 4IOMA 2ZJ1A 1E2PA 1GTG1 4K26A 4PYKA 3LRTA 2GHTA 4E11A 2PXCA 2WTXA 3LKBA 3A6ZA 2O8FA 2CJAA 1RCTE 4X71A 3DWEX 3PQ6A 1FEZA 1X1QA 3RREA 4G0VA 2GUWA 2VQ3A 6PFKA 4RPGA 3ZE8A 3TJRA 2V65A 3FE2A 4ZQIA 1SCJA 4KQ2A 2VDMB 3E22A 3OJ0A 4RHFA 2D3TA 4TM7A 2RHMA 4INOA 3VO1A 1GAEO 5DBIA 1Z5NA 3HHEA 1MEOA 1W5SA 2YR0A 3KLBA 4YV1A 3ECAA 4B3TB 1UK6A 4PGAA 3WL3A 2AC2A 3A1EA 2UVQA 1AK9A 3UCEA 3EFHA 2O3RA 4R3WA 3AIIA 4UEKA 4Y9SA 5LLSA 4JI3B 1L5FA 1CJBA 4FFWA 3E7PA 5AHOA 4XOUA 3T8YA 2WKWA 1F0KA 3ETLA 3I23A 2ZNJA 5FL7D 2AIRA 1LX6A 2W5UA 1FP6A 3IJ5A 3S2ZA 3TGWA 1MC1A 3H5OA 2DERA 4OQYA 1QUFA 5LQSA 4JT8A 4A6EA 5L53A 1XQYA 4EJ6A 1WL8A 4NU6A 5EVJA 4ZAYA 2QHSA 3WFJA 5K3DA 4O02B 4BZQA 5BWNA 4H4EA 2CE7A 3KPWA 2VN8A 1VLLA 3ONEA 3TSCA 4HZGA 1OUMA 2NGRA 2X5XA 2ZR9A 3WP1B 2Y0DA 1HORA 4JFAA 3P8YA 1CT9A 4HATA 2ZRLA 1P60A 3R6LA 1T9GR 1QPGA 3QF4B 4L6CA 1HTBA 4UFNA 2ZZGA 1DKOA 1R8SA 2Y1GA 3MMNA 3ZH2A 4EA8A 3EXIB 2DH5A 2VSFA 2WJGA 2G5PA 1Q6ZA 4WOPA 2A33A 2BONA 4DLRA 5CLJA 1T6XA 3HJBA 2D0DA 3NWBA 3MLBA 5JYDA 4ARCA 2WJ6A 3ELWA 1ZHHA 2E1HA 1T1IA 1JHQA 1SCUA 1Y1KE 1YI1A 2YY6A 4MIEA 3HTZA 2CBXA 3ZWBA 3AR4A 4BNNA 2IXDA 1W2GA 1CUZA 4FI3F 5DP1A 5EZ6B 4DC0A 3EOAI 2R9VA 1FFWA 1S2DA 4GVXA 3ROFA 5JAUA 3CRQA 3ZGYA 1NVWQ 1YK1A 4QGFA 5G0VA 1KARA 2Q5FA 3OHPA 5BSRA 1KDZA 1W1WA 4BO8A 3ENNA 2F2TA 3KVYA 3LX5A 5IT5A 4HWOA 5MDHA 1TFRA 4K3UA 5HA5A 3K9NA 2JK1A 1CIVA 4NFSA 4N18A 1AVTA 3N0TA 4RK1A 4UTZA 3UJHA 3KEOA 1Y1RA 2V0CA 5DBGA 4Z0NA 2J1LA 4QUBA 4OHXA 3LLVA 2ZRMA 4X44A 1KE2A 2FEXA 3GDGA 3VR5A 1E2NA 2BF7A 4AK9A 3CKKA 1WETA 2DPHA 3SIWA 4FFDA 3ECCA 3F5MA 4F2DA 2FWPA 1QU2A 4YTEA 5K9ZA 2ZWAA 2YVKA 3H5VA 4GS5A 4N7BA 1Z12A 4OP3A 1NY5A 1UEIA 3VR6A 4NXMB 5JCXA 3EF3A 4GLLA 3JYQA 1D8TA 2BAGA 3IHLA 3LL4A 4LNHA 1LFAA 1RWVA 1VTKA 3OECA 5FR1A 2QI9F 1HUQA 3BXOA 3ZV6A 4GYJA 3I2YX 2P4EA 2GFIA 3IQDB 3QKRB 4GX0A 1ODFA 2NLOA 1FJ2A 1GITA 2D7JA 4FOTA 4F5YA 1ID8A 5DGCA 3F98A 1SD2A 3SF8B 1XQ9A 1QAMA 1SXQA 2BGJA 2GK7A 3N9IA 2BHRA 5FCDA 5TT1A 2J7PD 2GJKA 2GPSA 2EEZA 2E37A 3QMWA 1EFVB 1FRQA 4GE3A 4XJXA 3WLRA 3FVVA 5I8ZA 4X20B 3EOZA 1M9NA 4MPTA 3MOSA 5BSTA 2PNJA 1TVMA 3BHNA 1WPQA 3U4GA 3ZHQA 3U6YA 1XXHE 1FA9A 1KXJA 1XL1A 2FRXA 3EWNA 4WXYB 4ZOAA 4IF4A 4ZZ3A 4LF4B 1Y6QA 2GZMA 5SICE 4PZ9A 5KTSA 1VKZA 2FH5B 3P20A 4AS1A 2C5BA 1RADA 2A35A 3IJEB 1X38A 3VU3A 2VP0A 1HZJA 3B48A 2LVBA 2WIDA 4BNIA 1H0SA 1JL3A 2P91A 4EQ6A 1SQ5A 1MIOB 1IMOA 5A02A 1VQ1A 1G0NA 3OFSA 4MQLA 2X42A 1KOFA 3TCKA 4FX5A 3TZLA 4LZZA 2EL9A 2PWAA 4ZCPA 3IBSA 5KYUA 3AC0A 3P71T 5DH9A 1D8AA 3G2JA 1YE8A 1YDEA 3FD8A 2H6EA 4L9SA 4GPZA 3ZHZA 1C7JA 3NHBA 3ZWVA 4TLLB 3GLIB 1V35A 1A96A 5EZ5A 1P19A 4M9XA 2Y8EA 4C0QC 4Z4FA 2QNIA 2AG8A 4ENRA 1YVRA 2V98A 1NWHA 1YJXA 3H0EA 1BIFA 4I50A 5CCBA 3HDVA 1X80A 1RYFA 2XUOA 4ZOCA 3AF3A 1I2MA 3FOAA 5HUJA 3KZ1E 3T94A 5GP1A 1WKBA 4WUVA 1KXZA 1MX1A 1ISGA 4P72A 1Z6ZA 2HOQA 2XODA 3OEWA 3HGMA 3AR2A 4TV9B 2VLIA 3HMKA 1CJVC 1FNSA 4IIDA 1H2EA 1SU4A 1WDKA 4HTFA 4P2GA 4RZSA 4FYXA 4UUQA 4D4HA 2HHJA 1SHJA 1T8WA 1FF9A 1U0HC 1ZM4A 3C5EA 3H9EO 5ERGB 3UCFA 1U7UA 5LOVB 5CA0F 1KAHA 2CBZA 4LJLA 2I1LA 5CBPA 1U4OA 1PO7A 3HP1A 3UTDA 2AN3A 3C7TA 2Y2VA 1OGIA 4CDNA 3MS2A 4K9QA 3ME5A 3B2EA 4YRDA 3WAGA 2J6HA 4ZVRA 3QO7A 3AG6A 4WK2B 5KHOC 1YQUA 2GF9A 4DABA 3I12A 1Q0SA 4C7JA 3WVNA 3P2MA 4WN3A 3BHMA 5DGDA 4ID9A 4KLRA 4DFDA 5F1KA 1WE2A 5BRAA 4I14A 5A62A 1FVFA 3Q41A 1AQLA 2FGKA 3ZW7A 2XUJA 1XZMA 1K0UA 3EW9A 4BB0A 1CUDA 2GBGA 4JBXA 5EJ6A 1OLUA 4EAAA 3NVMB 1CY1A 3LY8A 2QN2A 3N6VA 4UM5A 2NO9A 4FS8A 3HDYA 2LE0A 4OO3A 5DSZA 3RF7A 2QV7A 3NP7A 4P4NA 4D96A 1R15A 1Q0TA 2BEUA 1ATIA 1VIDA 1DZIA 2D0PB 3A1VA 4J7AA 4JODA 2YHAA 5CXSA 2X77A 2I2WA 3ACCA 3OLWA 4YIKA 5BURA 4FFPA 5KWIA 4FC7A 3WMEA 3HRHA 1TAHA 2MYNA 5J5AA 4YC7A 5KCMA 3E8MA 4YRAA 2DR3A 2P5UA 4D0GA 2WAOA 4G0OA 4G0MA 5JALA 5IK2D 3BMNB 1Z0DA 3L1KA 2FU5C 4YCAA 3RRNA 4B9EA 5IJ0B 4RAOA 4EW6A 1AUPA 3DL0A 3SHQA 2JLWA 3QV1A 5HKLA 1X9HA 3QU9A 1QO9A 5LBIA 5TVGA 5E3HA 4QLBA 1GZDA 4YXWA 1EVZA 3VBEA 9GPBA 3ENVA 4HB0A 1UBOS 3B3AA 5EZYF 2QQFA 1ADGA 3DAHA 3RV3A 4RDCA 3WBBA 4DCVA 5L4NA 5F3WB 2DE0X 2YXEA 4TN1A 4X97A 4AYWA 4ZICA 2EDAA 4NWIA 4WLUA 3QU7A 4BKMA 1NBMA 3MTDA 5JNRA 3MQ2A 3C6QA 3C5HA 2C61A 4BLSA 3AEQA 3M8KA 4U3JB 2PUCA 2RJ3A 4O2BA 4Z3DA 4MQFB 2YWGA 1MEJA 2FEOA 4AL4A 1QE0A 4EJ2A 3R3ZA 1UODA 3RRJA 3IELA 3W34A 2FX5A 5LXTA 2H4WA 2WWIA 2R6HA 1SHUX 2XTZA 1ZVVA 5C2JB 1EDDA 5CT9A 4ZCLA 2FFHA 2FRVA 1K27A 2Q6TA 2WU3A 5B2ZA 5EE1A 1MVNA 1N75A 1VKHA 1QLHA 2NZJA 1NVVR 1YFZA 1ZGCA 4K87A 2YQ5A 3MJ4A 4X7MA 2QRVA 4NMWA 3WB2A 2JJ2D 4E70A 3FBTA 4ZOLF 4OHZA 1X19A 2FG6C 1W4ZA 3KDPA 3VM6A 2HF7A 4HV4A 3DPIA 4ZYVA 3Q7TA 4MR7A 5ARDA 1RIFA 2Y9PB 3L7AA 2V3CC 3K1ZA 1JQDA 1KP3A 1FSZA 1Q0UA 1R5BA 4P0TA 1ST2A 1SOUA 3C3AA 4LTDA 3H8WA 3PCRB 4BYGA 1KS9A 2PUGA 3HXPA 1XTUA 5C52B 1UEXC 2P2GA 4X84A 1YH3A 5FBRB 1PZMA 1MJ5A 1GZ4A 3IAM1 1C4WA 1P9RA 4X1IA 5A03A 2R97A 1VECA 4TXHA 2FEKA 4TV9A 2ABWA 3CWCA 3W8NA 4H7FA 3S29A 4Z0PA 1YRLA 1Y5MA 1ZK1A 2P68A 2HRBA 1LH0A 3ERCA 5KVQA 4F6RB 4JP3A 4WGFA 5A2GA 2QRMA 3JQ8B 4MWDA 3TEGA 2AA3A 3UJ6A 1SURA 1W19A 2BKAA 1OXXK 1VHJA 4HLNA 3TD2A 3DONA 1P3JA 2WQ6A 1WB5A 3MAGA 2GWRA 2QN1A 4H0CA 1EZ4A 5DVZA 4D97A 3NYRA 2WRZA 3K20A 4XR4A 1NQOA 1X6VA 4R8SA 5JXJA 1RI4A 5ICMA 1XJWA 2H08A 3NM4A 4ZAVA 3DV0B 4MAAA 5I48A 1CF9A 3PNLA 4OHWA 3PT5A 2OV4A 4KXMA 3WA6A 1VG1A 1YAJA 4LC0A 1JXQA 2Q9BA 3P27A 4FXPA 4NYMQ 3TQFA 5HKOA 4CIDA 4KC0A 3KKPA 3RVJA 4UTVA 1A8SA 3LCJA 4CN8A 2B7LA 1JFSA 1DDIA 1XI2A 1C8LA 4C4XA 2R5WA 1SVNA 5T5QA 3HBNA 2FZCA 2V7QD 3OWOA 1C7QA 4EG0A 1EJBA 3E4CA 1E32A 1G5RA 1AIPA 1XDUA 1R3DA 1T36A 4TXNA 2FV8A 1E8DA 4CF6A 1E5TA 5L3QB 3UK1A 3FYUA 1F7VA 1R0CA 3IR6A 3V46A 1JFFB 2YXNA 4BV3A 3R5JA 4DDTA 1VI5A 3BX1A 3SE7A 5F7XA 1U2QA 4HFNA 4PIVA 3CV3A 1CNMA 2QXTA 3LI2A 1Z39A 2PUFA 3DDWA 3EH2A 2E9SA 1NNI1 2OCBA 3B51X 5FI1B 1R12A 5CX1B 2MWMA 3DT8A 3SX2A 1NR1A 1OVGA 1GHTA 1K8RA 2RHHA 4E2WA 5EJFA 5I51A 1EGVB 4H2YA 1ZINA 3SQNA 2INGX 4BFZA 1FYEA 4BU0A 2ZB4A 1L7AA 1MLDA 2QIOA 3B6JA 3BBLA 3KQVA 4GMDA 4IZIA 3U3RA 3HCRA 5ALQA 4EFKA 4MI3A 1VBNA 2IJGX 3ZE7A 1PLJA 2OFWA 2AZMA 3LW8A 3F71A 4EF6A 1QXSA 4KO2S 2NTJA 2FPWA 5MHTA 5I9LA 3GBPA 4FQ7A 1DRWA 3DDHA 5IXJA 1NC3A 1UFVA 1AF4A 4E4YA 3HGQA 4G09A 2PH7A 5AW5A 1OZHA 5IBRA 1P2FA 3MINA 2XJ9A 4JP8A 5DGXA 3S99A 4DC1A 1N2ZA 2DHRA 3H42B 2WPDA 4KWHA 1F8XA 1NT2A 1XVAA 2GTPA 5IM5A 3UY4A 3GPIA 3KHSA 5IC5A 3ZJ4A 3HXVA 4FS3A 4UTRA 1N4AA 3MTJA 3X1XA 3OEED 4KPGA 3R7BA 2E87A 1G59A 4LRXA 1QDUA 5EQTA 3GJ6A 3OJLA 5JG7A 4TTAA 3AEKA 1XKQA 1GAWA 5KX5B 1AKTA 1A5SB 3JALB 4Y2TA 1NKTA 3CKMA 2Q9CA 3FDJA 3L8YA 3K53A 4RSHA 4TLDA 3N76A 1ZG3A 1ZXXA 3V4PB 9ABPA 5JZMA 2J0QA 3VKUA 3PR3A 3EEFA 5JNWA 1E9BA 5B4VA 4IIJF 5THXA 4KNYA 3B1FA 3II6X 1FXWA 4JBYA 3ZDRA 3HO8A 1Q0LA 3WK8A 4NBNA 4KE6A 5I7OA 1IBKB 2ZXFA 3Q5DA 4IV8A 4E4TA 3BL8A 1J90A 3MJRA 1V16A 3F4LA 2PS3A 4WOJA 5JD3A 3WK7A 4LQ4A 5SY4A 4HNQA 2NO0A 4B8ZA 5BW4A 5EL0A 3SQWA 1JWBB 1YCHA 2RI6A 2Z9CA 3GEMA 3PEFA 3ZJVA 1QAOA 5KQGA 3L43A 4DREA 3B6EA 3FPSA 3R41A 3VU8A 2I0FA 4QG7A 3ZK8A 5JXHA 3KHTA 1HBJA 5JVDB 4B80A 5JQGA 4UMDA 5GOTA 3CO5A 1RYDA 4BWVA 2MR5A 4ARVA 1SUCA 3WLAA 3LO5A 4BFYA 1QR2A 2GF0A 4GPTA 1ZRHA 4BV9A 1K06A 1ZI6A 3EE6A 1Z5OA 3F4BA 1JHYA 5BN3B 3GP8A 1VBMA 3LBFA 4HO1X 4UDNA 3CNLA 2QLBA 1UZMA 2AXNA 4U4AA 3I28A 1HNXB 3F7TA 2CLEB 2P6NA 4GWLA 4I4NA 1Y9XA 1O4VA 5DTQA 1SH7A 3W8FA 3VSEA 2BEWA 4O5OA 3GRYA 1H0HA 3PD1A 1KH3A 1N2EA 1W6RA 2Y4NA 3LT0A 5DW3A 2OPHA 2QTVB 2BZGA 3L49A 3ICVA 1II0A 1OJ7A 1JHDA 4GOND 2NZ8A 3GIWA 2W6CX 1BRMA 2ZJ7A 3JVIA 4LWQA 4XFJA 2IV3A 1USWA 3A3YA 3USZA 4U7FA 1RXSA 3VNSA 3HKEB 2V54A 1X7YA 4MYRA 3O0TA 3EDOA 3GK3A 2XE4A 1ZM2A 2VF2A 3DD5A 5CB8A 4NFHA 1TCBA 1CJTC 5E3IA 4I5EA 4JR1A 2RMKA 4XU2A 3A3KA 1F2VA 1OC4A 3HBLA 3P5BA 4L27A 2JIQA 2I54A 3IO3A 3UHOA 7AT1A 2Z2XA 2GEKA 3MFQA 4G5QA 4BJ6A 4D4MA 2YHIB 4A6XA 3DHVA 3N7AA 3TCNA 3V7FA 1XAIA 1A71A 4ZTBA 4NVRA 4IMIB 4EPVA 4QGAA 3LOPA 4CUJA 1CSEE 4XIIA 2FDXA 1UDBA 2FOXA 2NAFA 1D3AA 1QQ6A 3FBGA 1WBJB 2P78A 4GX1A 5EJGA 1BTOA 3SXPA 3T1NA 4C6TA 5JEEA 4LZPA 4WH0A 3EA0A 3S8EA 3H04A 2QHVA 4YY3B 2Q5CA 4N01A 1A4XA 1XRJA 4OBEA 4J0EA 4GOLD 5JAMA 1E64A 2JHGA 3F7NA 4GDFA 1PYSB 1DIHA 2Z0MA 5AICA 1KFBB 3D3WA 3VRHA 1CUGA 3QYFA 4JBIA 1BWPA 3OZGA 4DOMA 5IABA 3DG9A 1JR3D 4QHYA 3DJFA 5KAMA 4GI5A 1VDZA 3LPCA 5SYAA 3LUHA 3CO0S 4FKMA 9LDTA 2FSUA 1I4DD 1CR0A 1E6CA 2BR3A 2C3PA 3R5TA 2XCTB 1NNHA 3G49A 4G5HA 5DP2A 4D9MA 3MUNA 4X92A 1ISMA 3OU2A 1XROA 3L8CA 2C5EA 3P0JA 3EB9A 3GF4A 4G8DA 5ITVA 3L1AA 4PYOA 4URFA 3E03A 4PRYA 3RBAA 1T25A 1ISJA 2BJWA 5GM1A 3B9RA 3E18A 1ZNYA 1IY1A 3TZCA 1BJKA 1J21A 3H3JA 3ZX5A 1P7CA 1DQNA 3VMMA 1J7JA 3EG9B 4UUMA 1X70A 2YJGA 2XAUA 3GLTA 4KE8A 4XLZA 1YOBA 1NSYA 3LOQA 1L7RA 4BXOB 5F9MA 2XF8A 3R09A 3EGOA 3CISA 3ETEA 2BI8A 1H9CA 1N2OA 3X1YA 1RWPA 4IDHA 3WSTA 4OJNA 4X90A 4QPNA 3VJMA 5J5CA 4WEOA 3TI9A 5JQGB 5JVDA 3TECE 1UK8A 4GPIB 3K31A 5EFZA 3ICPA 1BH6A 3C1AA 3D5EA 4PSVA 3IP8A 3NU1A 3EGEA 2Q5HA 3C43A 4IDNA 5ALNA 3T7JA 4EYEA 4HRVA 4XU3A 3IG2A 3E48A 4X7BA 2V7VA 1QK4A 4LISA 2PU7A 5BNFA 1U8XX 5K51A 3WGHA 5BN3A 2FPXA 1U2ZA 3D9QX 3DF9A 4NU5A 4B2YA 2QKYA 5CRIA 2Q3FA 5CDHA 5LQDA 4XTVA 4UM9D 3O8QB 3HXYA 3PA6A 3ND9A 4MS4A 3OICA 3N05A 1EUCB 3Q7RA 3I45A 4WLEA 3RLIA 2SCUB 5FHRA 3JQPA 4Z8YA 3LSQA 2CYCA 5IMBA 4WACA 5TB5A 3NORA 5E7QA 3Q0TA 4K46A 5JCJA 4EARA 1L5YA 5BPFA 3PNVA 3HPQA 5FADA 1JFLA 4JHLA 3Q0EA 2UZAA 2X8LA 3QI7A 3FFXA 4FYJA 4BVFA 3C6BA 4MGEA 5KU7A 5A7GA 5IFKA 3KS9A 5CXXA 1XD8A 4NJEA 4K6FA 3IDQA 3O4VA 1KJQA 3TTSA 1K9SA 2FHPA 2H29A 2IF0A 2JJ1D 4RH0A 1WLEA 2BFEB 1FYDA 3HABA 4JEIA 1MRNA 3CZ9A 1G51A 4RY8A 2UKDA 1VP3A 2ZT5A 5GZ6A 1S8AA 2X2FA 2YJNA 2BN4A 1GUBA 1Z4JA 3IT3A 3MLAA 2Q2WA 4MKHA 4EKDA 4JD5A 1DSSG 4C29A 3LVJC 4KQXA 4YRMA 3FW1A 4CM8A 1DHTA 2XNCA 1CQJA 3CLTC 3NI2A 4P38A 5D5QA 3TZ6A 2W9XA 3K0SA 3L93A 3W5CA 1H23A 3NB0A 1P31A 4FR2A 4GSLA 3IVCA 5FR2A 2FMTA 3LHFA 1FNNA 1P29A 3LVQE 1P0MA 2ARTA 4FP9A 4YJ3F 3FWKA 5F12A 1PYSA 3GRAA 5F5XA 4H16A 4V0SA 4BEVA 4ZALA 5J4YA 4DMUB 1YZHA 5C8XA 1T6BY 1UM9B 2C3MA 2DEUA 4C2BA 4MJXA 4PLTA 4BZXA 2IX3A 4RJJA 1UZNA 4Y30A 4CEHB 3E8SA 3NC1C 4IY1A 3E1SA 2F62A 1ECJA 3N2GA 2FF7A 3HY0A 1N1EA 4RD3A 5MFPA 3RC7A 4REMA 4JP5A 3OO0A 4ZU6X 4A3SA 4BZPA 2P27A 3J7AC 4ANFA 5IJAA 2OBLA 2PGAA 1TTTA 4B6GA 4BKUA 3R74A 4F97A 4RFVA 2V6IA 2HU7A 3H18A 4P1ZA 1A2OA 3NANA 4XM2A 1VHLA 5AW2A 1VIAA 3AUXA 3PHLA 4M6WA 5JFGA 1T1EA 1AG9A 5FP0A 1RXWA 2OXCA 1GILA 1GLNA 4Q3BA 1Z6GA 2Z8ZA 4QUDA 3ZIAD 4PHGA 4IUCS 3CT4A 2PD3A 3ZW9A 3ZGZA 1FDUA 4GP7A 3U3MA 5TC4A 3LC0A 1TKRA 1I1HA 2HA0A 3A28A 1EGAA 4K6CA 3V8EA 3RADC 4O2AB 5ICFA 2Q4TA 1CVLA 1X87A 3K6SA 3HTXA 3CVUA 1BXRA 1W30A 2QM0A 4WT7A 4E5YA 1HDRA 3QBEA 2GFHA 3QLUC 2PX2A 2XE8A 2PKQP 2Y1EA 3CH6A 3LZCA 1Z88A 4HQNA 5DV9A 3WIBA 1WG8A 1XVTA 4GU5A 1EFPA 1KI8A 1P72A 2BFDA 1F2UB 4H7JA 4I9FA 1WF3A 4ES6A 1N1GA 2I1WA 3X1DA 2RHDA 3IGFA 5K0CA 1BDMA 5A3JA 3BDVA 5HIIA 3I09A 4FZJA 5IUNC 4E94A 1CUAA 2GASA 3OCJA 3U4IA 4KP7A 3TTYA 3WBMA 5HBGA 4L4RA 1BHSA 1Y3BE 4MHSA 2PBZA 3USCS 4EI7A 4HVTA 5TMDA 2P6OA 2XUHA 5EMHA 3N2KB 4B17A 2HEGA 1DIOB 2HQ1A 4OB7A 4KPEC 5AVOA 4QEZA 4D42A 4HLUA 2G83A 3I7FA 4E09A 2JBAB 3L0CA 1OH8A 3C8ZA 1NURA 4JGGA 3TJMA 4EITA 1Q2UA 2QEQA 4UHDA 4WN9A 5CT4A 4CPDA 1YVDA 4MDHA 3A6FA 4B6QA 3IBGA 4HPXB 2B37A 2X6TA 3NVAA 1I51A 3UV6A 3VR3D 4J3FA 1FYXA 3IHWA 2XCOA 4IIXA 4LPSA 2B7CA 4RNDB 4XIYA 4EB0A 1QRRA 2A5YB 5JASA 4CS4A 2AEFA 5FA8A 1NQUA 2ZSAA 4KUEA 3OQ6A 4RTQA 4C2UA 1E1RA 4RK7A 2LWIA 4JDUA 1QZUA 1H4TA 4TVAB 4FR0A 3IDZA 1E0AA 4FYMA 2C03A 3L8EA 4C4YA 4PZAA 1V2GA 2ZIUB 3PF8A 3C15C 1PZHA 2YIMA 4B09A 4C0AC 4YAKA 1MUUA 2PCJA 5EJ9A 1RLUA 1O6ZA 1PJ2A 3N5CA 1Z5PA 3HXMA 2W37A 1AGYA 4CT0A 3GEEA 2OBMA 1K7YA 3FZYA 1FTQA 3RC9A 4RMHA 1BKDR 1Z16A 3Q11A 4KEAA 2EP5A 4NOLA 2H4XA 1YQEA 3MGAA 3MMSA 2NUTA 2C2WA 3O8BA 1MX3A 2CJWA 3UKJA 3DF7A 4CQMA 3PVSA 4RF5A 1THMA 5FORA 4NYMR 2VNSA 5HMLA 1XYYA 5C7OO 3RKSA 3IBCA 4MHOA 4JJKA 1MX5A 1HNWB 1QP7A 5FPSA 3I2HA 2HJ9A 3JVVA 3KSRA 3RS4A 2BFCB 5HP4A 3ZIDA 3H11B 1TJ3A 1M66A 2X8JB 4UTOA 4FOSA 3PICA 4BB6A 4WOCA 1QTIA 4BN0A 1PSWA 2JAHA 3JR7A 4QA9A 4BNFA 3D7KA 4MULA 1Q1ZA 3LUGA 3PNOA 5IC6A 4DUYB 4NZRM 2W90A 1OLSB 2AWOA 2EFDB 3EZ7A 1OCEA 1S8OA 3PIIA 2JFUA 4IH1A 2G80A 1R6UA 3WGZA 3W77A 5EJ2A 4BIMA 3KUUA 1U3WA 1JSZA 3NW9A 1YU9A 2R6FA 3DLTA 2WIFA 4RPKA 1C1XA 1FFHA 3O9VA 4KAJA 2W6IA 1MRSA 3N87A 2HPVA 2C9OA 1BBUA 2XZDA 3DO8A 2QVGA 4ZVVA 3FFTA 5HF8A 1DBIA 4QARA 3K96A 2WZCA 4J07A 4Q34A 3VO8A 1JDNA 5A5VA 1U0EA 1I3MA 3I5AA 5TMEA 4BLRA 1CDZA 5IHPA 1U28A 4UEJA 4TS9A 5KINB 1VLJA 2QZJA 2KM1A 4N0QA 2P3OA 2IF2A 1CUEA 1WMFA 4IJWA 4ICIA 5FV7A 5BV2P 2V1UA 1ZUNA 1A9RA 2I3DA 3JD1A 1NKVA 1E0KA 1EE2A 2AW3A 1PGJA 2OZLA 2FN7A 4PZLA 4D8UA 2HLNA 4CETA 5I7FA 2ANCA 4NFLA 4B7ZA 1MO3A 1KE1A 1XU7A 3JYPA 2Q5OA 1WF6A 1CP2A 3VGPA 3T4PA 4E5NA 3HA2A 4EA9A 2P9HA 3OKCA 5FYDA 2BGLA 3CNOA 1H8ED 1NN3A 4UUNA 2WHPB 1SU7A 3PC8C 4X63A 5H3LA 3R7AA 3AF1A 4D41A 2A5LA 5DI3A 3GJ8A 4FKZA 4M98A 4YCJA 4J2OA 3L82B 1ACMA 1X55A 5AVUA 2O8EA 1C3VA 1M6VB 1M1UA 2OK8A 3DDOA 3EDQA 5TEWA 2Q50A 4RKYA 1G7SA 5J4HA 1P9OA 1RWOA 2DWCA 3WYAA 1L7NA 3JALA 4MRPA 3DVAA 3DXFA 1NXXA 2ZJ6A 3PFBA 3TKYA 1IDOA 3TIGA 1J0BA 5EJ5A 3HXLA 1VLMA 3UAWA 2DXIA 2D3WA 4B3CA 2BBSA 4YRSA 2EJVA 5AR1A 2YX1A 3TTXA 2H4ZA 3Q7QA 2DBQA 5TVKA 4EPTA 1FFCA 4EAQA 3G2OA 2D13A 2WJVA 5IT0A 4BC0A 1RYHA 5IAAA 4XYLA 3SS9X 3LUKA 4M1QA 4UXHA 3WRXA 1ONSA 4H02A 3PGA1 1M2VA 1PVOA 3QVLA 3CBGA 3G9QA 5B4TA 2AOXA 2O2JA 1CJMA 1NONA 4X3OA 4BJ1A 3PQEA 1LQUA 4RBNA 5H68A 2W6MA 3DCJA 4DC9A 3FNQA 5JXIA 3OUTA 4ZRNA 3X1MA 3M6AA 1ZMTA 3HVUA 3ZVKA 2L69A 4F60A 3LCVB 4HR7A 4YKEA 1RDFA 5KB3A 2PSJA 1K63A 4C6SA 3AJ9A 3O1LA 1W5TA 1SWWA 1W4RA 1MO6A 2JZCA 3O90A 2A14A 1TEZA 1YBAA 1FYFA 2Q28A 5LNK1 3L6OO 1QO0D 1T0UA 1R6DA 4F6RA 1VLQA 4ZMSA 3UC9A 2A5GA 5BR8B 4OX9B 4U0JA 1PL7A 2B9VA 5BSFA 1UBGA 1AC5A 2ZIEA 3C3CA 4BLQA 1H6DA 2P5SA 3FVTA 3KXPA 1QB8A 2Z83A 2R751 3DJYA 4HAUA 1UBCA 1XTBA 2G7ZA 4WXHA 4AJJA 3ZBUA 4N41A 1VKOA 2ZYWX 4M8IA 2HMYB 2IOQA 3L4JA 1HYGA 2AL7A 4X9XA 3OX2A 2IYFA 2C5SA 3UMJA 5FX2A 3BFKA 5KHLB 2BGGA 2ACWA 4QXMA 1MTZA 5BV1A 1PV2A 4DV7B 1E66A 2VP2A 2ZIZA 3HJCA 4FBQA 3R5HA 1IJKA 1G5PA 1FYVA 5EHGA 3WL8A 5KMGB 2DFVA 3JS5A 5JSKA 2ARSA 4PG3A 1ND5A 2XOKD 4E6EA 1DV1A 5JZ9A 3DCNA 1PSDA 4YMLA 2W2LD 4QU0A 3VZRA 3IX7A 2NYUA 4Z0TA 5TY0A 5CMLA 2F1OA 2ZROA 3V1TC 4JROA 3R7NA 1XJ5A 3B1YA 3W5AA 1M2KA 2X41A 3B89A 4LJ4A 4UU1A 5CFZA 1IYZA 3LMKA 5K4AA 3IIEA 2QPOA 5G2OA 4FIZA 4GECA 4F46A 3L6BA 5BN5B 5JYEA 1GNTA 1RJ9A 1XN1A 2I3BA 3NONA 1A50B 2AR7A 4II2A 5DF1A 4YQYA 1EVEA 1A82A 1H6CA 3TTVA 1TXGA 2YJ3A 4HSGA 2H2IA 3UM9A 3FTEA 1TZKA 5HCIA 4MQEA 4DIDA 1EK5A 3VQWA 3D3WB 4PSKA 1W88B 4FMCF 1ST3A 2R6AA 4EGCB 2EFCB 5EGNA 1Z0IA 3A7EA 2XF2A 3U7QA 5CEEA 3W1WA 1L8QA 3JQAD 3ZW8A 4CLEA 4X1YB 1O96A 4BMZA 3LSSA 1SQFA 3UMGA 4D9HA 1DGQA 4W5WA 1O97C 2B5VA 2XZPA 2F1JA 2OG1A 4O2AF 2WAYA 5E6SA 2NXJA 1CC1S 1M8PA 3UICA 2B4TO 3SMQA 1JDUA 2CXXA 2ZIXA 3S27A 2PUVA 5LC1A 4UOEA 1EFAA 4BVBA 5JSFA 4MWGA 3PJRA 2EATA 4KYVA 4XYMA 5CLQA 2CV1A 4KPUA 4RE6A 4TL7A 1G5QA 1VLHA 1U7XA 4OQQA 2AMVA 1S7CA 2CLFB 2XUZA 1DO0A 1XZLA 1E4EB 3OJXA 3IALA 1SCAA 5DNUA 2IXFA 4OP0A 2MSEB 1HDXA 1UIRA 5FULA 4QTXA 3ANTA 4L4ZA 4AUKA 2H59A 3SFZA 1OH5A 1YZQA 3PIRA 1QIGA 4XGKA 5T4HA 1M1YA 4V2UA 3AINA 4L8WB 3R7WA 3IAFA 5KBYA 4DBLE 4OL9A 2IS4A 4A2QA 3RO7A 3I9NA 2ZUSA 3LX6A 2W2LA 2VJLA 1DLJA 1N7IA 1FDIA 2XOEA 1HE8B 2WT4A 2XD9A 5CH5A 2ZNIA 1L4BA 4RLHA 4FGWA 1X0VA 3FWPA 4NY1A 4LDNA 4TWBA 2LUOA 4O4IF 2A8EA 1JXAA 3NHSA 4R8LA 4LMAA 3H5NA 2CLIB 4B6EA 2H18A 2VJNA 3J7TA 5A3RA 4YIHA 1NMXA 1T35A 2QD2A 1EGHA 4YH1A 5ELOA 3CG4A 2M6LA 3WKEA 3PXXA 2FSPA 2ZUUA 3NBMA 2ZUTA 2FUNB 4IS3A 2C99A 4ND8B 4ZC8A 5K20A 2C84A 1VJDA 3FSJX 1RABA 4EHLA 2CJ9A 3GZNA 2UU9B 1C7RA 3WLQA 3MJSA 3DE3X 4EO7A 2G67A 4XVUA 1CRPA 2AMCA 1W9MA 4RO0A 3A6EA 4EYQA 4X8OA 5KPDA 3QF7A 1N0UA 3A04A 4P71C 2G9VA 4PHHA 3SC3A 3IUPA 3N2EA 1CUSA 2B36A 2VJOA 2ODBA 3WAJA 2YWXA 4KOEC 3EPRA 6ABPA 2BTQB 1OWNA 3EULA 3OCUA 4AKSA 2Q7XA 1X8KA 3ZWQA 2VAWA 3MZ0A 1LRKA 3K2BA 3FI0A 1M6NA 3GEIA 1HRDA 1N7HA 3BN3A 4Y2SA 5F33A 5AK5A 1JDPA 1NBME 2ZYRA 3RFTA 3HCDA 2FW9A 2G76A 3FJOA 3V6LA 2OBNA 3TZBA 1TFUA 1X7YB 3CGGA 3D6UA 4RGQA 3MWDB 5KJ1A 1LJ8A 1C14A 1PEYA 1P61B 1FDSA 1KEPA 4K03A 4Y0NA 2CC2A 5ESDA 1Z7NA 2P6PA 2IRWA 2UUBB 2HZ7A 3PC4A 1E5DA 1D5WA 4GOJA 1Z6XA 2HC9A 4KNVA 2P75A 4FE3A 3WNQA 5JFOA 3G0BA 3G1WA 4NU0A 1WPYA 1ZD4A 2IXEA 2YHIA 2G0TA 2AI1A 3RI3A 2QSJA 3L02A 1EP3B 1O6CA 2P0LA 2AMYA 3DNMA 2I99A 4GRAA 4WLOA 1XWFA 3CN7A 3RTBA 4B87A 3ID6C 4WIAA 2ISSD 1KS2A 2VTVA 1C9YA 2O7QA 2FW1A 1JV2B 2X1MA 2H11A 1GKYA 4O8ZA 1XV5A 2W83A 3D59A 5DHRA 4ADSG 1K7CA 3PQCA 1ZH8A 5AVXA 2AYZA 3LU1A 4NZMA 1RBYA 1QLJA 1P6QA 3E05A 2R2GA 2X19A 5ALZA 4UMFA 1LW6E 2IIBA 1GGVA 4JLUA 2DPGA 1RTKA 1Y98A 3QVGA 3TBKA 3LQRA 4R5HA 3AEUB 1XYVA 1NI4B 1UDCA 2PH1A 2QRZA 3CW9A 5DLPA 2DYKA 4YT2A 1KDRA 4BP1A 5KQPA 3WZMA 4W5OA 2CHVA 2ZE6A 4IZHA 2GBLA 3RWMB 3WRYC 4QPPA 3UVEA 3Q7EA 4V24A 1AZSC 4KN5A 3D54D 2HRQA 3P2OA 4LXHA 4B76A 3RIRA 3TBFA 3Q87B 4RTMA 3E2MA 3OCCA 4XRRA 5ARBA 3IUNA 1CUVA 5DBFA 4I3HA 3EVNA 3SYRA 4HS9A 1OH6A 2G36A 4IILA 4MV1A 3EUEA 3MJFA 4OK3A 3GLQA 3C87A 4Q4LA 4LJ9A 4M8KA 3KL2A 3IIMA 1EX1A 2G6BA 1F2UA 3NHPA 3GZ4A 3SVTA 5K2MA 3UA4A 2HWUA 1KKLA 1XCBA 4QHSA 1EE9A 2GMWA 2EV9A 4PQGA 3AR7A 3V8QA 3WQSB 1TLFA 1A69A 1R88A 2WBLC 4INAA 3KO8A 1Z6YA 3TQQA 2VTDA 3WLJA 4MO9A 5TS2A 1IVNA 2P1ZA 2PZEA 4WKOA 3D1JA 5AP9A 2NU7A 4DV4B 3ICEA 1NBMD 4ZQCB 1Q1QA 4HFMA 5K3SA 1XALA 5T4FA 4JJFA 3E7DA 3R5FA 1UBHS 3ESYA 4LGVA 3EZ2A 1A4UA 4DMFA 2EQBA 1XP5A 3GFQA 4AUMA 4KK3A 4PPYA 2JBAA 3U40A 3Q72A 1AH2A 1NUQA 2A3RA 5EQDA 2NU9B 3GVIA 2XA1A 3KVVA 4BASA 1V7QA 1HPLA 4GSYA 4IJMA 3SY8A 4OP1A 1H5NA 2XDQA 1N78A 1ECGA 2ZDGA 3JD0A 4RVCA 4EK9A 3LTNC 1G9SA 5DDIP 3DOOA 3O8QA 2NTVA 3RC3A 1B16A 5BV0A 2IZ7A 2PX6A 4KMRA 5HPYB 2VHQA 4Z4CA 1ZWLA 3ZWXA 2N42A 1MOSA 1E1NA 1KPGA 1QH9A 3B1XA 3GPDG 4Q48A 1QFMA 1IRIA 3WNCA 3ZIHA 1T0IA 1ZL0A 2POCA 3KFXA 3SM3A 1ONNA 3SP1A 5IZCC 4P9NA 2C8VA 2H4JA 2PH5A 2PMKA 1YTUA 3EVCA 1XN4A 4IYJA 1FJHA 4WKCA 4ARBA 4TZTA 4AS2A 1V1MB 1G5TA 4O0MA 1X1TA 3BB4A 3V8PA 2O4CA 3NHAA 3HB4X 2ZSFA 2AJLI 3MUEA 4EUFA 2FB9A 5BMVB 5E6UA 3TTDA 3ZCPA 5GOZA 1UMDB 4DMRA 1S02A 1MQAA 4L5IA 1V7ZA 2NO7A 2PT6A 3ACBA 4PAQA 4KVFA 2Z4RA 3K15A 4F38A 4EPYA 2BKYX 3H4VA 2AFIA 4YR7A 2XTNA 1PQUA 1PWYE 1ZH6A 1FK8A 1FW8A 1E2UA 1P1IA 3EAFA 3MS7A 3OEHA 3RRYA 3TPZA 4DLTA 2QJOA 1CQJB 1F6WA 1LSJA 1YR7A 3U9SA 2QYOA 3OPYA 4S1TA 2HX1A 4EVSA 1Z47A 2XSZA 2VZ8A 2HF9A 2DCMA 1O9GA 5IU6A 12ASA 4TLBA 3GGDA 1CG6A 2WG2A 1OLSA 4HBGA 4TWJA 3RAPR 4DEXA 3C8MA 3NTOA 1HDYA 2AR0A 2BWJA 3W7VA 5M04A 5KNNA 4Q12A 1EP1B 1Z6PA 2XMRA 4AJPA 4ETNA 2WSMA 3PD7A 3SKYA 2V7QA 5D01A 5ALLA 121PA 3OPMA 4PHTA 2I2FA 4R9VA 5AW4A 1SOVA 2UUPA 3GO4A 1FMJA 3W6OA 4EVQA 3ET5A 3TNLA 3RVLA 4GLFA 3DS8A 3ZBQA 5JECA 2C2MA 2HPAA 2AQ8A 3V1KA 1BOFA 1NN0A 1ILWA 4JLWA 2HN9A 2QGNA 2BZ1A 4TZ0A 2Q3JA 2GXSA 3IPLA 4TLAA 5AESA 3UAZA 2DF8A 4EF5A 1KK1A 3THSA 4N7MA 2QMEA 1X92A 5DNWA 2VTBB 1I7LA 1Y8ZA 3ZK9A 4DEYA 3NT5A 3H9UA 1MV8A 2YN0A 3EODA 4K9KA 3I1JA 4HLUC 5AHWA 3GMTA 2I2XB 3LGSA 2H4HA 2B78A 2M9MA 4QDTA 4HT3B 5KNBH 4DN6A 4J90A 4WHMA 1FSGA 1TIKA 3PUWA 3QKSA 3K70B 2OFPA 3F6YA 3D6AA 3WI7A 3DZDA 1BE0A 3LGAA 1J24A 1GO2A 3EQ8A 4ZTUB 2PZ8A 3NR2A 4KXVA 2IGBA 4OXRA 4CDMA 2HK6A 1TZMA 1CFZA 1P3Y1 1Y7PA 4LV6A 4R0MA 5C8YB 5ED4A 1HE5A 1OT5A 1BQ4A 1G66A 2HZBA 2FE1A 3AL3A 4JJZA 2IUUA 2C98A 3V4ZA 3CA8A 4U7DA 4TM8A 2HV8A 2IXAA 4LHEA 1S8EA 1J06A 1J2TA 1T8SA 4A8JB 3WHKA 3QXCA 4CKEB 3OZIA 2VDWA 3EVDA 2BFDB 5ECYA 1FU4A 3EIWA 3KQOA 1EUZA 5FUYA 4OOEA 5G1PA 3FYCA 4ZVMA 1XQ6A 1JHXA 2ORED 4HAZA 1R5NA 2WSSD 5KIAA 2VDVE 2J87A 4DDMA 5KKNB 4ZI5A 1DQYA 1EWRA 5FWYB 3WRVA 4EY8A 1MJGM 4KFRA 1KMHA 4RM2A 5FBQB 4P93A 4F45A 1VL8A 2QX4A 4R1LA 1RMQA 4FZRA 3QBTA 1D1QA 2ZITA 3OX4A 1FU7A 3PYLA 4IXNA 5TGDA 2AD5A 1UBNA 5CIWA 3RHZA 4EFDA 1IWPB 2DWQA 4MW7A 4FB4A 1JAYA 1E9EA 1PSZA 1IRXA 4PO1A 2O2YA 2O20A 1E9DA 1S89A 2NU8A 5IX8A 1G21E 5MGNA 3OIVA 2G04A 5JS1A 5E1BA 1JLLB 1YI8A 3AJEA 2EWWA 3N58A 4OQXA 5FUMA 4AZ3A 1FFEA 4YCCA 3FTPA 2IBTA 4LV8B 4DV0B 5AW9A 3FPLA 4HTAA 3K94A 1VL5A 4JL6A 1MNQA 4BKQA 2BTOA 4J9VA 2YN4A 4A0FA 2R96A 1XA4A 1FX0B 3MMXA 3M83A 4YP5A 3TIIA 3TUJC 4CLXA 4MVJG 4G41A