4K87A

Crystal structure of human prolyl-trna synthetase (substrate bound form)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
497
structure length
490
Chain Sequence
b'LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proline--tRNA ligase
molecule tags Ligase
source organism Homo sapiens
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
total genus 161
structure length 490
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k87A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k87A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k87A02
1B7YB 3NEMA 2QHVA 3ERRA 2ZZFA 2DZCA 4LNSA 2RHQB 4TQFA 3QO8A 3UH0A 2P0LA 1X2HA 4XEOA 2E64A 1B7YA 5K1PA 1QF6A 1KMMA 3TEHA 4RMFA 1YFSA 1V95A 4DQ2A 3HXUA 3V7SA 5KNNA 4H2XA 1EIYA 4HA8A 4XTZA 2ZNJA 4YCVA 4YRSA 12ASA 2ZINA 3HRIA 3A32A 5E3IA 3KFUA 1Z7NA 3V8KA 4YCUA 3VQYA 4H2YA 2PMEA 1X55A 3VBBA 1H4SA 2CIMA 3QO7A 1EQRA 2EJFA 1KOGA 1NJ5A 1PYSB 4XU2A 1L0WA 4XU1A 2XTIA 4EO4A 2ODRC 1SERA 2CJAA 3FJPA 2AKWB 1YGBA 2G4CA 3A31A 3WQZA 3IG2A 1EVLA 2E41A 3HXZA 2ZT7A 1WLEA 1SETA 4TTVA 4OP0A 2LW7A 4YPFA 4TVAA 1EVKA 3DSQA 1WYDA 3HRKA 2C8MA 4UPAA 1X56A 2ZZEA 2DDZA 2DXTA 2IY5A 3RKXA 1N9WA 4HWSA 4WI1A 1E1OA 1X2GA 3HXYA 1NJ6A 4YRKA 4YDQA 4E51A 1ADYA 4XTUA 4CS4A 4ZTZB 4YCWA 3VQVA 2E3CA 4P74A 2ALYB 1JJCA 3REUA 4RQFA 4UP7A 3A7UA 2DTIA 4PHCA 3VQXA 2ZNIA 1NJ8A 2RHSA 2DZ9A 1EIYB 3UFGA 5HGQA 5C52B 3RIRA 4XU0A 3G1ZA 3HFVA 4NCXA 4Q6GA 1E22A 1USYA 1W66A 4P75C 4TVAB 2ZT5A 4HWPA 1HC7A 4TQDA 4ZTUB 4XTVA 4OLFA 1E1TA 3E9HA 2DVEA 3LSSA 5K1XA 2EL9A 4G84A 1NYQA 2ZTGA 2AMCA 2EJGA 2Q7GA 3NENA 3VQWA 3HFZB 1BBUA 2Q7EA 4H2WA 1WQ7A 4UP8A 2ZIOA 3L2ZA 2ZT8A 4J15A 4L87A 3V8JA 2DU5A 1X01A 1X54A 3HTZA 3QTCA 3BFMA 4O2DA 4UP9A 3M4PA 1WNLA 1SESA 1G51A 3RKWA 2ZXFA 4DPGA 4YRLA 1ADJA 1FYFA 5ELOA 2I4MA 1ASZA 2EAYA 3I7FA 1C0AA 4KQEA 2ODRD 3V7RA 4YRTA 3EFRA 3UGTA 4H2SA 3RL6A 2I4LA 2ZCEA 3ICAA 2I4OA 3HXXA 3HY1A 5ELNA 4YP0A 2HNIA 1J5WA 3LC0A 4H2VA 1H4QA 1H4TA 3PZCA 4YYEA 2AKWA 2PMFA 4H2XB 3A7AA 1YFTA 4HVCA 3P8YA 1LYLA 3L1AA 2Q5IA 4Q15A 3BJUA 2RHSB 1ASYA 4KR3A 5F5WA 1WU7A 3A74A 3P8VA 3RKYA 3L4GB 4YRQA 2ZR3A 3V8LA 2FYKA 4YRJA 3IALA 3OD1A 2ZZGA 4P72C 1YFRA 3RGLA 5C51B 3TUPA 2XGTA 1G5HA 2DKGA 4RDXA 3V7CA 2DXUA 1H4VB 1WQWA 4TWAA 4TVYA 3EFSA 11ASA 4H2UA 4P3NA 1PYSA 4CS2A 3RUXA 2IY5B 2E65A 2EJ9A 4EX5A 1NYRA 3HFZA 4AH6A 1USYC 1HXDA 1NJ2A 3NELA 4X5OA 1IL2A 1B70A 3R07A 3IKLA 3HXWA 4P71C 4XEMA 2ARSA 3LSQA 4CH3A 4P3PA 1B76A 3QO5A 1EFWA 3RACA 3W3SA 2ZR2A 4H2TA 3A5ZA 1NNHA 2ZT6A 3CMQA 1HTTA 4CH6A 3HXVA 1BIBA 3REXA 1JJCB 2ALYA 2P5IA 4PG3A 4P73C 4YRPA 4YREA 1QE0A 1NJ1A 1B8AA 1GGMA 4P3OA 4YRCA 1SRYA 1YB3A 2ARTA 3MF1A 4YRGA 4WF2A 1BIAA 4XTXA 1Z7MA 2ARUA 2ZIMA 3RF1A 4XTWA 3TEHB 2Q5HA 1BBWA 2E10A 2ZGWA 4ZIBA 1G5IA 4P72A 3A5YA 3L4GA 3QNEA 2J3MA 4K86A 1VQZA 2C7IA 3NETA 4YRMA 4CH4A 1RIQA 4XU3A 2CGHA 2I4NA 4XTYA 4YROA 4K88A 4HWOA 4HWRA 4KR2A 2E1HA 5C53B 2DU7A 4WJ4A 2RHQA 4TVWA 3E9IA 2CJ9A 2DTHA 3UGQA 4K87A 4G85A 2QHSA 3HY0A 3P8TA 4P71A 4YRNA 1ATIA 4P74C 4H02A 4BWAA 1B70B 2Q7HA 3MF2A 4HWTA 2AMCB 2DTOA 3MEYA 4BW9A 4YRFA 4P73A 2EWNA 2DEQA 3IKMB 3PCOB 2DJZA 3A7RA 2DQ0A 1KMNA 4YRIA 2CJBA 3TEGA 2QHUA 4CS3A 2DQ3A 1EOVA 2E5AA 4RQEA 1WPYA 3PCOA 2J3LA 1E24A 4P75A 2QHTA 4YRRA 4CH5A 4WJ3M 3M4QA
chains in the Genus database with same CATH superfamily
5FFNA 3KAKA 1OLOA 1QO0A 4JVNA 4RD4A 5I5GA 1IBCA 4X71A 1ZFNA 4M8LA 4W5OA 2DLCX 2IPMA 2KQUA 1YIDA 5F3WB 5JADA 1D0IA 4S35A 2IU6A 1M2EA 4I0WB 1QTQA 1L8LA 1QC5B 3SNKA 2NYVA 3DMTA 4ID9A 3H16A 5DEIA 4WKBA 5HKAA 1UBFA 4LVIA 1GXSA 3R0QA 4KG7A 4AI6A 1N2BA 1PO7A 3LZDA 1QJCA 3MTIA 3VPGA 3FNRA 4ZO4A 2JFVA 1VSQA 4WN3A 2AUNA 3EPKA 3MIZA 2BKLA 2WF8A 3O03A 3RUCA 3V8VA 5B5SA 1XTRA 3CVYA 1RPJA 3EFOA 2D74A 1TE2A 2YJ4A 1L8QA 2GKGA 4WADA 5BW4A 3U6BA 5B2EA 1DIHA 4G5RA 1FRZA 4PXSA 3BL8A 5BSHA 1L5SA 2YWJA 4N8SA 5DULA 1YMQA 4A0RA 4FXPA 1O94C 2BFDA 4BEWA 1XGKA 4EY7A 5HG0A 2ZNJA 2IOFA 3U4AA 2NUAA 2ZRNA 4BCDA 1NXWA 2C3YA 5K8JB 1LA2A 3ZY6A 2CBZA 4QUKA 1U8ZA 1W2WB 3L07A 1WM1A 2DFVA 1Z7NA 1HZZA 3GL9A 2PR7A 3V8KA 2X4LA 4MS3A 4F9GA 4F6RB 1A8IA 4H2YA 1BU8A 1T3LA 1X8XA 5EZ6B 2DZDA 3TH5A 4CLXA 3UK6A 3D8RA 3OD5A 7REQB 4RCVA 2V7WA 1HFWA 2PA3A 3GU3A 5DHRA 4ZJUA 3B9QA 2I5PO 2IOQA 2VK8A 1XJ0A 3CR3C 2Z43A 4BRSA 1QTNA 4HYEA 1Z68A 3D43A 4Q5IA 4H6WA 4YS6A 2FJ0A 5FLKA 2FN8A 2HQRA 2GVNA 1E0SA 4DAEA 1Y6QA 3WQZA 1S96A 5CG1A 1IOZA 4ARAA 3AYXB 4WZBA 2Y1LA 1WX1A 1XN1A 1R10A 3OCZA 5FPKA 2BMWA 4IQ4A 1G3RA 1DEOA 1JQAA 4EMTA 5BWOA 1ZD1A 3OIYA 4L0QA 4LHYA 3IVAA 1MT3A 1IYZA 1ZIYA 3H9BA 3IP1A 1PG5A 1JN0A 3LKBA 4DT1A 4QA9A 2PLNA 4ZEWA 1F14A 4PC7A 2UYOA 4QUEA 4U9HS 2NNWB 4MGIR 5KREA 4YAWA 5CFLA 1X7XA 3TFQA 4IDEA 3W6NA 5CLHA 2OM2A 3KBBA 3RC1A 4AM8A 4ZT3A 3AY6A 1P80A 2DDZA 2WUVA 4FD3A 4JWTA 3AF6A 2FSSA 2XE8A 1Y4ZA 1E4VA 3V9AA 2W2NA 5E95A 2GAOA 4AU1A 5JCZA 2DCUA 6LDHA 2IELA 4OHMA 5M2QA 3EVNA 2V0NA 4KQJA 4P0PB 3VH1A 4F4FA 2J41A 5JFOA 4PSDA 3HJRA 3OUTA 2JGDB 1FUIA 2PWPA 2VUSA 3F5MA 3JTEA 4ZAGA 1GKYA 2CNBA 3EMVA 2X3UA 2QW1A 2VN8A 1WKCA 4FOSA 5DBOA 5FO0A 3ZGLA 2GNPA 2QTLA 4YRKA 2GLXA 5DT2A 2VQ6A 1GTJ1 2AVNA 2WAMA 1J90A 4DJFC 1CRPA 4GSLA 2I3ZA 2FFHA 3FB1A 3K0AA 4NE7A 4P33A 3W7VA 1XYVA 4BWYA 1JFFB 1QHYA 2LTAA 4HH0A 3EDOA 2G0AA 4QVGA 4B85A 4E4RA 2WJ6A 3T4XA 5IJ9A 1OBHA 1O6BA 4XDGA 3RS4A 3H9EO 2FF7A 4M4SA 1IWBB 1X80A 1RQ7A 4U7HA 4D4HA 1OZHA 2VT3A 4GGOA 1KI3A 5DVZA 5H70A 5T6MA 3CNQS 3S6JA 2OCAA 4AJLA 4UP7A 2UKDA 3H1AA 3HZHA 4PPNA 3A1CA 5F7OA 4JLOA 2HF2A 2HLDA 1XEAA 4KX3A 3IQIX 2ZNIA 2XR1A 3GJ3A 1JHAA 1H65A 5JS7A 4B3TB 1AUXA 3V1TC 4V24A 3G1WA 3RUEA 4RVSA 3OFND 3W5IA 3FFTA 1WHSB 2G9UA 4N3AA 4FK8A 3WGMA 1TM5E 2RGUA 2D5LA 3LS2A 1O95C 2QQGA 1NVFA 1VJ1A 2R8BA 2REOA 3R1IA 3KX2A 1HETA 2A57A 4LQDA 2OM6A 1C8VB 2XDYA 1IQ0A 3QVLA 2ROQA 2CLDX 3HNPA 3EQ6A 3IMCA 2V1UA 2HJWA 4R8SA 2I6UA 4C4SA 4EJMA 3M1LA 4LNUA 3ENWA 1DDIA 4BWGA 2BFNA 1ICEA 1S4QA 1FYDA 1VG0B 3FYTA 2D3TA 3QE2A 4O4LA 5CT5A 3QVMA 4L5AA 5D3MA 7REQA 3ZZ0A 1JIIA 1U31A 1YA4A 2A2ZA 1H5NA 4LEIA 4F4CA 2B21A 3OT1A 1BQ3A 2E4YA 3HCBA 2FN3A 3DXFA 2R8YA 3A9RA 3WGUA 3GN2A 3GBVA 5H81A 2XWSA 3T5MA 1P4HA 2G7MC 3IOEA 4GVLA 1XCMA 3JAKB 3P9NA 3QF7A 3ICPA 3CEPB 3MWJA 1PT7A 4ETIA 2COUA 3FCOA 4KACA 2DVEA 1J0EA 3ZWAA 3KEQA 4RBNA 5CITA 1O5TA 5KCZA 1KK0A 1NKTA 3UJDA 4ONEA 3Q88A 2YVUA 2PVCA 5EY5B 2QN7A 3BIXA 5JNUA 2ZYSA 3KZVA 2OUKA 2LCFA 1FTWA 3LY5A 4MULA 4IDPA 1BBUA 1P2SA 3HVJA 1R8JA 3PFIA 3GF4A 1BX3A 2GRUA 2HRRA 3D4PA 4HDNA 4RVNA 1ZONA 3EQ2A 2PL1A 3L1UA 4FDLA 1N6IA 4TTRA 3S2FA 5JDIC 1DEAA 2F62A 5FR2A 3W04A 4DEVA 2O1SA 1S8FA 3VVLA 3WL7A 1JHMA 2DOKA 2VF7A 1WY7A 2ZYUX 3FCXA 2EFYA 1QTRA 3O21A 1BRMA 3M4XA 3AHDA 3DW3X 4IZOA 3M5CA 4KFSA 3ICEA 1P0QA 4Q1FA 1V26A 1CDEA 3QU5A 2ZU6A 3A9WA 1TC2A 3EWAA 4RA9B 4M1YA 4WOJA 5DBEX 5TVKA 3WGLA 4RTJA 1EFPB 4UHEA 1NLYA 1IMJA 3OWXA 4RF5A 2ZTVA 3FF1A 2YJTD 3KKOA 2PGLA 2GPWA 5P8WA 1NMZA 4JNCA 1I13A 2YJ3A 1BX0A 2H2IA 2DPHA 1R18A 2QIPA 2YXBA 3DB1A 2JW5A 3F3KA 5FPTA 5GPBA 4C08A 4Q02A 3A8TA 2AYZA 1IWOA 1RMYA 5BSRA 1DPGA 5LIRA 3OEYA 1EX9A 3C3KA 3W2EA 5KTKA 4YRLA 1NIPA 1QYCA 5AH0A 1P5JA 5C7OO 2EFDB 2J0EA 2B5OA 5ELOA 4GICA 1RLOA 1QK5A 2QVZX 3T3NA 1KZ7B 4L95C 1C0AA 3S5UA 3LC7O 2WRZA 3H8WA 5HKOA 4HDKB 1SG6A 1X80B 2BFMA 2NUPA 5JWOA 1ZRHA 2CCGA 1BD4A 2XMDA 4PX9A 4BLTA 2D54A 2J7PA 3HKCB 4BZPA 1E62A 4QHTA 3U26A 4XGQA 2JPDA 1OAKA 1IBLB 4HQOA 3CKKA 3GDGA 1RQPA 2EJWA 1FXUA 3V8MA 2BKAA 3PJRA 4MLPA 3CNLA 3DEYX 3FGPA 3OU6A 4I55B 2O8BB 5EG5A 1QIHA 1Y63A 3D1VA 2JFFA 1DCTA 4LTDA 4PLPA 4G5HA 1SOVA 1J25A 2RJOA 5A05A 1HDZA 5TDHA 5EJ2A 1U0RA 2GCOA 4AZSA 5E4JA 3CUWA 4Y6OA 4GGMX 5D5HA 1RYZA 2GLTA 4QREA 2DWPA 3DXYA 2QVXX 1XVLA 4WCFB 4IZIA 1WDLA 1GZVA 3USES 1QX4A 3BEDA 4HAZA 2ET6A 1UC8A 4LYYA 1D4AA 1T15A 2GAFA 1FLAA 3GDHA 4U7TB 2YOHA 3KWJA 1K7XB 2G5TA 3D4BA 3LPNA 1ENYA 2J9ZB 3IVXA 4O6VA 4XIIA 1PAVA 3Q3EA 1PZGA 3OMLA 5A3VA 2VEDA 3I4LA 1LRKA 4WA7A 3ZBTA 3ZTYA 4F7WA 4X6YA 1ASYA 2YHSA 3NHBA 3HP1A 3MJTA 2SECE 2O1XA 4OF4A 1Z26A 3PPWA 4QULA 1GPLA 4JGBA 5ALWA 3W78A 1Z47A 4UVHA 3T1HB 3HRHA 4PCLA 2C5BA 5FQOA 2OAGA 3IIIA 5TGTA 1N2XA 3VU9B 4NECA 4GBJA 2P6MA 1E4OA 3KU4A 1M10A 3P2YA 1XL1A 2QYOA 1EKXA 2BDTA 5IVHA 1YS7A 2Q5CA 4YUXA 2MYPA 3P2EA 3KPVA 4KB5A 5K0LA 3CVVA 1WB9A 2OWDA 5C51B 1S2GA 3EODA 5FTWA 4NAHA 4AMGA 3HCAA 2YQ4A 3INNA 2NP6A 4ALNA 1F2VA 3GVPA 2A0WA 2DUWA 1FS4A 2Q5LA 2E85A 4CRWB 4PTYA 3RF6A 5HOEA 4ARUA 1UWVA 5CB0A 3KHTA 3GZJA 4AQ7A 1YUMA 3EDCA 2Y0PA 4LHSA 4XDHA 2CBXA 3GX1A 2REXB 3L7JA 2RH5A 1A3CA 3JZIA 3MWKA 3OZBA 4PFJA 2IVFA 2WPNA 5E38A 4BIMA 5A4JA 3T5TA 5K4HA 4B6QA 2ZYAA 3D4IA 4FU0A 4H17A 4PPFA 4X00A 3QBEA 1XZGA 1Z62A 2E9SA 4J4BA 5EL0A 4I1RA 2JFYA 2I9PA 3BH0A 2IF0A 4XEHA 2BGNA 1MC4A 4WCDA 2W2KA 1Y7TA 1OLSA 2EJ9A 3CEHA 4EX5A 4OHWA 2FPIB 4IH9A 4O3MA 3G0OA 5JQGB 4N5MA 2QTMA 3NAGA 4AH6A 1J00A 1V7ZA 4LVNA 3SLRA 1QGED 4GPTA 3B9PA 2W9XA 2OPBA 2GWRA 3DBRA 4A2PA 4C20A 4E1VA 3O91A 4YJ3A 3ASVA 4QOHA 5I6DA 3UWKA 5I48A 3WDSA 2X8JB 5L3ZA 5BQXA 3DOIA 1E6KA 1VXOA 2X77A 4BLOA 2FPMA 3E9DA 2FW6A 4QUJA 4XEMA 5D84A 3AI7A 1D8TA 3LSQA 2CB0A 3HBAA 3IBCA 4N5LA 2XI4A 2HWXA 5EPUA 3ZWKA 2VUTA 4GMDA 4X60A 3UPDA 3WIBA 3KYCB 2XF2A 3QOFA 4LV8B 5JYEA 4NENA 2Q99A 5FBLB 3ELYA 1BO6A 4JLBA 3TPCA 3DAFA 4F4HA 1Z0UA 3DOHA 3O8QA 1N7IA 2ZBPA 1XNRB 3TDMA 1RZRD 5KNCH 5AIBA 3DMYA 4TWRA 3HCEA 1BA3A 2EF1A 1M34E 5AVXA 2R5NA 3Q7RA 5CUQA 3JVDA 1DQYA 3TJRA 3UJ8A 1NXVA 1XO1A 4JBWA 4YEDA 3DDUA 3K8QA 1NVBA 4DDUA 1J7KA 4M76B 3EHEA 3NALA 4KAFA 4NYJQ 1RXSA 1X8KA 3CISA 3WKEA 1TAQA 1I2DA 4NLLA 3BA1A 3ZOKA 5FOQA 1CUDA 1D2AA 1Z5WA 2BI7A 1KIFA 1OBOA 2Y3IA 3TEHB 2Z08A 3C8MA 2QRZA 4KV7A 2R751 4XD7A 3ZJ4A 4ERXA 1XA3A 3E8MA 4EHAA 3AB3A 4FB5A 4QSHA 4AB1A 2ZGWA 4ITVA 2CXPA 3GRYA 1USGA 1ECBA 2IYAA 3Q7PA 1M6WA 1Y9AA 4GI5A 4JELA 1Q1EA 4JUFA 1Z5GA 3LA6A 4V38A 2OV8A 3RRFA 4DHEA 1JHYA 3AUJB 1DXOA 4FI3C 4PZ0A 1S8EA 2C9BA 5BRJA 1VFNA 3PB3A 4BMPB 4BU0A 4OHOA 2J3MA 3DCIA 1UXOA 3L7BA 5D00A 1AG9A 4BNDB 2JGRA 4TKLA 2AKEA 4RQUA 1LSOA 5T8KA 2FK8A 5DDIP 4Z9YA 4LE0A 5KU1A 3A06A 2CVOA 3UV7A 4AYWA 1T0IA 2E3JA 2VXBA 3K5HA 5TPZD 1O6FA 2DF8A 5EXEA 2RGWA 4YRMA 4MWEA 4ZKEA 5BNFA 1HNZB 3H2ZA 4W1SA 4P1ZA 1KXJA 1BZYA 2B25A 3H2YA 1W7AA 2QMYA 2JH9A 1GT6A 1SZDA 4TMZA 3K15A 4MUBA 3HU5A 3WX0A 1LW7A 1CTQA 3COVA 5HMMA 5CBPA 3E7WA 4UCWA 3RC8A 3EEIA 3CVXA 3P0FA 4LE1A 1LTKA 3G5AA 4QTUB 2C3MA 4A8JC 5C53B 3PR2B 2CV1A 1PAUA 4C0QC 3KXPA 1X38A 1K92A 2P6OA 5BP7A 2GEKA 4QDTA 1N0VC 1A5SB 3WQSB 1CUJA 3DTVB 3CF6R 4IDCA 4L02A 3WK9A 4KXVA 3HY0A 3OQBA 1V8ZA 2OO7A 4YJ3F 1V8PA 3QVSA 5BN3B 2MSWA 3D81A 2IHJA 1Q83A 2O4UX 1P45A 1TKBA 3LK7A 3G8DA 3WNVA 4AD8A 4LCJA 2Q7HA 1VYVA 2Q2VA 2ZRDA 3JAWA 5AKZA 1QOPB 3HLYA 1VLLA 2GVZC 2BL4A 1HKHA 2VBCA 2XQFA 3AERB 5I8PA 1GGNA 1MOQA 2VAPA 3LW8A 4EJ2A 1MVLA 2Q45A 3J80A 1B3RA 2RHOA 4Q4JA 5DI9A 1I3KA 3FIJA 2F3PA 3L05A 2CRQA 2ZVDA 1E9EA 4TLLB 1E2UA 1RHQA 4KXQA 2X7XA 5L7YA 4E4YA 2R68A 4MVJM 2DJZA 2XMPA 2DQ0A 2NVWA 3H2IA 4BQEA 4YJGB 1CY2A 1NPYA 3P8ZA 3CGWA 1SJ9A 5JMPA 5B7PA 2GILA 3E7XA 4QJBA 4RADA 2PNJA 1OGIA 3QUBA 4EJ6A 3AKDA 4FMCF 1JNXX 2YFYA 5JTUA 3Q3IA 3KOOA 4GBED 3HEBA 4TLBA 2BHSA 2EW1A 1D03A 1BWRA 2MYUA 2ZIEA 4G36A 3SBOA 3UXMA 1Y6GA 1EDZA 5ITZA 2IVZA 4MYTA 1EAMA 4WK4B 1CJUC 1F1BA 3BOSA 3I45A 3EAQA 4N65A 4QWMA 5ADUS 1Z29A 4R2JA 4DMKA 1P0MA 1SVKA 1LVHA 2V8BA 4CH5A 5DLDA 3FTEA 3VNVA 3N58A 3R5TA 5A0FA 4EF5A 4YMTA 1JB9A 1GPDG 4C01A 4H6VA 2RD2A 4HP8A 1UIRA 4BGEA 4PPQA 5CB8A 3OQJA 2ZVQX 5CH5A 3TX6A 2O57A 3AJ9A 4CQLB 4UNRA 5KHLB 2IS6A 4ANFA 4P81A 3TI7A 4GSYA 1SOWA 1DNPA 2RI0A 1L0BA 3DOCA 3LWBA 5T57A 3IQGX 4MKZA 3T12A 3E2MA 2C2YA 4BNKA 2QSJA 4F06A 1JKXA 1S2MA 5IT5A 4YAFA 5BVHB 1L4EA 1U5AA 3BK7A 3IDOA 4FZRA 3H5TA 4FGZA 3TK1A 5EE5B 1TM2A 1MORA 1RFGE 2H06A 1NOJA 1UJ6A 2I34A 4RMIA 4NH4A 4D46A 5IN4A 1GSIA 1QGUA 3P2KA 4WJLA 3QY0A 1FVXA 2HSWA 2GSWA 4AY2A 4AJOA 1NW4A 1PEYA 2C77A 4IXNA 5DH9A 4GM1A 4CL3A 5K3SA 1JJFA 3GPCA 4MVJH 5KNDA 3H05A 3TD2A 1QGOA 1HDGO 2VRBA 1VHDA 2O1WA 3LBHA 4NCKA 1I32A 3BE8A 1E3EA 5HS6A 2K6GA 2XMRA 5B1HA 1FJ2A 2JAQA 1EUCA 2XECA 4HFMA 1WIWA 3LPMA 4H2XA 3GAFA 1WVMA 3CONA 1HYHA 1NSYA 3KZKA 4MQFB 4XTZA 4R8VA 3OLVA 3VAAA 3I23A 5LQCA 3T4UA 4CM9A 5DKFA 4JFAA 4MVWA 1L7DA 3RUDA 3URMA 1HLDA 1UBGA 1QTIA 3DGFC 4PXAA 1DO0A 1P3JA 2GCIA 1ZMBA 3W4JA 1O3YA 4EJSA 1XALA 3H1PA 3VZCA 2AZTA 2QQ5A 3MGBA 2AT1A 4TV9A 3REOA 2ON6A 4B7XA 2WC1A 4BO8A 3GR6A 4OX9Y 3PR1A 4XYLA 1WKBA 4EGAA 1N7HA 1M1YA 1I7DA 2WIAA 4MGYR 1JSLA 2J7PD 3N6XA 4BKRA 2HO5A 2PDAA 3PL1A 2UAGA 4P92A 2VQDA 4XU1A 1Y7HA 1GADO 4AY3A 2H1VA 3AG5A 3I0ZA 3S81A 3UAYA 1EVIA 4HDAA 1Q19A 4QWWA 3AUXA 2YV5A 2UZAA 3KT0A 2FR1A 3T5BA 2HSZA 2ZRCA 1VM0A 1FXSA 2BM0A 2Z0MA 4Q7EA 5K2OA 4RZIA 3RVJA 5KSYA 5LKAA 2C8JA 4JVSB 4LJ8A 3UK0A 3IDFA 3K9FC 2JB9A 1IUOA 2E37A 2OYSA 4NBKA 1EVLA 4EY6A 3CTPA 3KJNA 2I1QA 3OZ7A 5CT8A 2XA1A 1KE2A 3FOEC 4J7UA 4MMYB 2OXTA 4R9SA 2KPOA 2B4KA 1MJ5A 3DMGA 3BB4A 2LW7A 3H7IA 3K72B 1T8RA 2YN2A 5ALHA 4D81A 5LDHA 1THZA 3PHBE 3R3JA 3TE6A 3FJYA 1LDYA 4RH3A 3VYTB 3KTAB 2ZAMA 3PD0A 3H9CA 3K0CC 3PQ2A 3Q8XB 1LDEA 4HEHA 3WY9A 4NFHA 5TT1A 1LLUA 4GKBA 3D3NA 4M55A 3EUEA 2O0KA 2CXOA 4KCGA 1CS0A 1VA4A 5EN4A 3BRWD 3N5KA 1DEXA 3RC9A 4COKA 2OBBA 3JRNA 1I9CA 2JKZA 1N8SA 3EE6A 1X3LA 3DDWA 2MYTA 2OQIA 2NV2B 1GNSA 4WNCA 1TMYA 3B7GA 4YH1A 2PUHA 2IPNA 3K2EA 3A2NA 4MCAA 2EX4A 3K2BA 5ILOA 2FEXA 1X70A 3AV3A 1LY1A 1Y1RA 4KODA 5HIJA 4EKEA 1E1CB 1X3SA 2C42A 1ADYA 2ZE6A 1CB0A 2FWMX 3L04A 2JIOA 4IL5A 3C6BA 4WXEA 2XTMA 4BNJA 3GJYA 1KFCB 3NBAA 5EIOA 2Q28A 4YCWA 2DWQA 4XUGB 1DX9A 1C30A 1M67A 2IOYA 4NHEA 1KDRA 1T36A 4PC1A 2PWYA 2JGEA 2AG8A 4DMMA 1R0BA 2AXQA 4UNIA 1VLHA 3BIFA 4RSRA 4B9AA 1J0XO 2FSPA 3TIGA 3F67A 5FBKA 3V4ZA 3G2PA 5CTAA 1XD2B 4XIGS 1SD2A 4FI3F 5GJCA 2PZGA 2VPPA 3KUXA 4KW7A 4R1LA 4F6LA 1KJIA 1QQ5A 1XA0A 4GP6A 5T4BA 4HT4A 1YFJA 3CA8A 4S2EA 4MVXA 3ACBA 4O0MA 2RHSA 4BFUA 1X7ZB 4ER7A 1N75A 3EGVA 4HPJB 4FONA 1XEXB 3ICWA 4BNMA 3ICVA 3NOXA 1QYXA 2P62A 4KUGA 5HRAA 4XVUA 1ODLA 1JHOA 1N0WA 1SHLA 1WUJS 2ZBEA 1PQWA 2DPXA 2BSQA 1G60A 1O4WA 4OI0A 1RKQA 3NMUF 3L1KA 3C4VA 4KXWA 2EV9A 4JI5B 1M72A 5GZ6A 4ZI7B 2GPJA 4ICIA 2XF8A 4XWWA 2J5QA 2ZJ3A 3O8OA 4FLMA 5CRIA 5HUHA 4P75C 1AHHA 1M1YB 2RHMA 4Q9AA 2J45A 4IG9A 4EP1A 2Z58A 1E2GA 1XA4A 5KX5F 3KQYA 8ADHA 3KVNA 4HS4A 3ZGYA 1HKUA 4CT4B 3FKQA 1G55A 1Q95A 2Q2QA 4R1MA 3NP9A 4L07A 3S2SA 1L7OA 1B2LA 1NFRA 4A0QA 1XAJA 5L6MB 1CZUA 2SICE 2QBYA 4OLFA 3E9HA 1T91A 2ZRLA 3GP3A 3L01A 2D7DA 1M73E 4AW9A 5HZGA 3CVWA 3G5LA 4MUXA 2NO9A 1TCCA 3DVLA 2NN3C 5DOVA 4A2QA 4B3BA 5ES4B 4MHOA 3E7DA 3N75A 4AS2A 1JR3E 1PE0A 3MMSA 3MK31 3D2CA 2C8LA 2GWHA 4PSVA 3KKEA 3NGXA 2RGNA 2W8BB 5DHFA 1PW7A 1PQPA 4CMGA 2Q46A 1Y8QA 3TW4A 2O7NA 1JL3A 2Q7EA 4NP6A 3EB9A 3TJMA 4DYHA 4AKGA 4PLVA 4PQFA 3GJ7A 3UB2A 1G98A 3KDPA 3LKZA 5E6SB 4DRXB 1JAYA 3U1BA 4CEIB 4GRIA 3V55A 1TYZA 3D31A 3QE3A 1QFZA 4G65A 5T67A 5THKA 3W5SA 2R7LA 2V4UA 3QH4A 4ND3A 5K8TA 3BYZA 2QTVA 4FYYA 5SZIA 2ASEA 2GK6A 3RS2A 4ACAA 5HM6A 5BNWA 1X01A 1LW6E 1L5WA 5AR1A 2JZNA 2QHXA 5EZYB 3WGZA 2IQ5A 3K6RA 4MUGA 1RXEA 1ZU5A 4E11A 2QPLA 2ZIZA 1J33A 3EZYA 2BFEB 1ATZA 4ZALA 1G8PA 4B83A 3VA7A 2WHQA 1LI7A 3KT6A 2A8EA 1RSZA 3E82A 2XB2A 1YQTA 3DDZX 3IQZA 1BH2A 4H08A 4MTCA 1FX0B 3BBPA 4MWTA 4P4UA 3GQBA 3SF8A 2EX0A 4BO6A 1NBMD 1RQRA 4RA6A 3BAZA 4RIEA 4ZV4A 5H9VA 1TRHA 2P6PA 5IT0A 3QVVA 1V1RA 1PWXA 2AUMA 3HADA 2JC3A 1SCQA 3NP7A 1VB5A 3EWIA 4K5QA 1N1MA 2QAGC 3TLZA 3URKA 3ZE0B 2UXCB 3GVCA 1JQBA 3PNPA 4MWDA 4C2BA 3ABSB 4NFLA 4B3RB 4KDFA 3R8XA 3AUYA 1P1JA 1QS0B 1O0SA 3W6ZA 4C1NA 1E0KA 3D6UA 3LC0A 1SOAA 1XK7A 2Q27A 3DMPA 4CEJB 1RKVA 4NXMB 2QI9C 5LMUB 1LQTA 2FZGA 1NHWA 2IPLA 1KVUA 3E53A 3PZCA 1VDMA 1DX4A 1JJVA 1KXZA 1Q77A 2JJ2A 3N6RA 4ZREA 2O07A 4M6WA 1H9BA 3R7WB 2IY7A 3L8YA 1AA9A 2UU9B 1QIEA 1IM2A 1YFTA 1GIAA 1TQDA 4GLJA 1KDVA 5CX1A 5CW1A 3OE7D 4S2UA 1CIVA 5CVJA 5EQJB 1IN1A 1XXHA 4QLAA 3WL4A 2XRFA 1N2EA 3QOWA 4UEOA 3B6EA 4EW2A 3G2NA 4BX3A 1UEXC 1ZMXA 4X1OA 2UUBB 3KQTA 2P9BA 4B0PA 3PFCA 4GE3A 1EK0A 4MGEA 2Q6KA 3I6BA 1NFHA 1J24A 1H6CA 2QMUA 1RRCA 2CXNA 3AX6A 1Q74A 2HK7A 5D85A 3DVSX 3WLIA 2EJUA 2O54A 2FZLA 2GPTA 2D06A 2X1LA 2J3JA 4OH7A 1J6UA 3JQBC 1RQGA 2RH8A 4PW0A 4YMIA 1F6WA 1OT5A 4P72C 2BEUB 2WFAA 3VMMA 1I1NA 4D8UA 2KHZA 4Z86A 1LJLA 1UOQA 2RKOA 4U2GA 5D5QA 2H07A 4FIZA 5KJEA 4EQ6A 1Z73A 1W85B 4RGYA 4Q3KA 5BSVA 5CURA 3S3TA 1FXWF 2JCGA 1ULBA 3PFWO 3PHJA 4EUEA 4DNXA 2ZQYA 2QMQA 5LFAA 4GRAA 1K75A 1MAWA 2BR4A 4L28A 2F4VB 2VWPA 1K68A 2K7ZA 3W2TA 5JD3A 5CDFA 3V1MA 2GGSA 3RG2A 4H15A 3M5WA 4ZP1A 5JNVA 2QTVB 2WLTA 5KKCA 4N0QA 4QUDA 1Z12A 2DLDA 3AR4A 1WSAA 3E4CA 3H86A 3QX8A 1YZQA 2FFJA 4JT8A 1HDYA 3UXEA 2F43B 4D8YA 4R5MA 1CUAA 2NPOA 5HTOA 3P9IA 4CG2A 3D4OA 4HCJA 4AWAA 1MKYA 1Z2CA 2GDJA 4BZWA 1E1RD 4ESVA 3FYCA 1YNSA 1ZLXA 2IA5A 1NYRA 2WD8A 4QTTB 1FFDA 2DE0X 4XD2A 3V8QA 1GO2A 1DJQA 1USYC 5EQDA 3JPWA 4FNOA 4AKIA 4S12A 1DDGA 3QZUA 3T7CA 4V0NA 1CUZA 5A9SA 1RPTA 1TB4A 1T26A 3GJRA 1PVDA 4DTIA 1VSTA 3IVGA 4U1RA 4XIJA 1WBJB 3C6QA 2OVBA 2SNIE 2XUGA 2QAJA 3UFXB 3WXBA 1T2FA 3FUWA 3PUXA 1OVMA 5K03A 1L4FA 1U4SA 2G0NA 3N86A 3R7AA 1CUEA 4NTZA 2PBLA 3Q4GA 4GC5A 5TS3A 6ADHA 2EATA 4BNTA 2ZR2A 4RA9A 1JHPA 1PJ2A 1QUEA 1PZNA 1EVJA 4GKAA 1HTTA 3T1YB 5FI0B 2XCLA 4TXJA 1BXKA 5IVPA 4F2HA 5JXWA 1C4OA 3E3MA 4ZAWA 5IAAA 1SPXA 2O8CA 5DTQA 1MC8A 3KG2A 3QKWA 4MPDA 3QMWA 4YRPA 3MMNA 4BV3A 3MXTA 4BV9A 1Y7IA 4QO8A 1J8YF 1USVA 2DUJA 5B6IA 1VKZA 3MOIA 4IZHA 5E4FA 5TARA 3MTQA 1L4HA 1H42A 2NTJA 4U8GA 1GUFA 2FETA 4C5BA 3NBFA 1U11A 2MSCB 3HJNA 3MBOA 2QPAA 2Z30A 1E1QA 3EULA 5AW0A 2R4QA 1ENZA 4ITRC 2SCUA 1OHHA 4CL0A 1Q7EA 1TFRA 3RJ9A 2XNJA 3I01A 3THOA 1S9HA 4HSGA 4AQDA 3KZOA 1ZVJA 2AC2A 4LCBA 4X1KB 3UF0A 4EHKA 1R0XA 5JG7A 3ECAA 5E3JA 4CFZA 1IXSB 1N9KA 3WGKA 2XITA 3ZLVA 2ZUSA 2YICA 4H7HA 1Z3IX 4V03A 1YBFA 1YXMA 5K0TA 4TL7A 5DLPA 3KQHA 1LPNA 1T3TA 3FPKA 4IJ6A 3UJ3X 4A6XA 3CLTD 4OXYA 3EC1A 1WW2A 3AEUB 2PGIA 3T7IA 3U16A 4LWOA 4KPUB 4DCJA 4EPWA 4GBGA 1YRQA 3WGIA 2WUEA 1NM5A 3TSAA 3UG7A 821PA 5HIMA 1XHFA 1E6EA 1YQEA 4UFPA 1OMOA 1SHKA 2NVUA 1Z13A 3AJAA 2OTCA 2P90A 3OFJA 4L76A 4YDHB 2R9VA 1OUMA 4X61A 3L8FA 4OI1A 4XU3A 3DKPA 2HHLA 3QWIA 4HNHA 2AKYA 3NNDA 2JD2A 2NXCA 2YYSA 3CMCO 4H1VA 5G4LA 1PYOA 2G09A 1X2BA 2CGHA 1WPGA 2IZ1A 3AF5A 4NEGA 2EWVA 4QG7A 4AN1A 1UR5A 1FPQA 1DWPA 2KYRA 1NMEA 2F1RA 2W93A 3D5EA 3TYXA 4R05A 2X2FA 1WCIA 1AZSC 2E4XA 4IV0A 3WZLA 4RZ2A 3TMAA 4A5OA 5M3BA 3JYQA 4MV1A 1C9MA 2DU7A 1Z5VA 3GPBA 3X1WA 1JPUA 2RHQA 1X42A 4JJZA 2R60A 1FQWA 3F74A 4XIYA 3QXJA 4POOA 4M7PA 5JBIA 1T9BA 1Y5LA 3M81A 4MW1A 3QWFA 3CUSA 4Q3CA 4YUWA 2FG7C 4NZPA 3U3RA 1CWUA 2YMPA 1IBRA 4FS3A 5H80A 1A9XA 1ESMA 1QVRA 3TUJC 2F3QA 3EPLA 3QE0A 1DAKA 3MWLA 4LQCA 1ZAYA 1E0AA 3ZW8A 2ZSAA 4RJIA 4EHLA 3L7AA 1JNYA 4W7IA 4Y6PA 1KBOA 3KZMA 2AMCB 2DTOA 2VT2A 4ACBA 4F4IA 3PQ8A 4WN9B 3RVOA 2ESRA 2VXCA 2HTEA 4A6EA 3FBWA 4A10A 3O4JA 4JYCA 4OKNA 5I8ZA 4LE2A 4Y67A 3JASA 1XMVA 3MG9A 3U1VA 3ZIEA 1DAPA 4AO7A 4DM7A 5K8CA 3E22B 4PY2A 3T9CA 2M9MA 2GBCA 1AKYA 4NMMA 4MRNA 4Z51A 5EMKA 2O8CB 1OLSB 4FN5A 1OU0A 4M0CA 1NW8A 3ZTWA 2C84A 3DTTA 2EIHA 1I9GA 4PLGA 1PNQA 1QB7A 1YZLA 2EX1A 3E8SA 1WPYA 4HXGA 2NZJA 3PC8C 4KPGA 3WV5A 5SYMA 3WQHA 2NUTA 3EIXA 2NV0A 4JBXA 4OQYA 2Q3FA 2XUDA 4EITA 2OCLA 3I1FA 3GVIA 4K8OA 1YZHA 1E24A 4QOEA 1DTWA 2GHQA 1MVNA 2GZ2A 2CMDA 1RBQA 4MH0R 1GN8A 4H0FA 2IU0A 2IX3A 4MIEA 1SKAA 2OHOA 4H0NA 3AVQA 3KR1A 1KQOA 621PA 5K9ZA 3PD7A 1MJGM 1PQYA 1KAMA 1TJYA 1C3JA 2A67A 4URWR 2V6GA 2WVAA 3A3OA 5J2TB 4N9QA 5AVUA 3HABA 5ALPA 1O03A 3BH6A 2CDBA 1NF2A 4ID3A 2XUZA 4MQ5A 4MQLA 2BR5A 2H8GA 2HGSA 4OP1A 5BR4A 5KNCD 3G79A 1E2NA 1PJSA 3F2IA 3CW2A 4NPAA 3RSQA 3HV0A 4GPD1 4HAWA 5JJKA 1Y4DE 3CZCA 2VPYA 2WYOA 1SUWA 4PZZA 5I7RA 3QO8A 1X7WB 1X1RA 4HGOA 3ZCTA 3UH0A 4OHKA 4WK0B 4HN9A 5EVCA 5E9AA 4ENQA 4HL6A 1UFRA 5ALSA 1TNDA 2B2XA 2ZSUA 1X2HA 1JDBC 2YZ2A 3RDPA 4B1FA 3I1YA 4QGHA 3R0VA 2XWBF 4BLPA 2OBXA 4YA6A 3H3JA 1DXHA 3H75A 4QGFA 2DQ4A 1U2GA 2FMIA 3CT4A 3K1YA 4EDHA 2P1RA 3JQDA 3RPEA 5KAMA 2QX4A 2RHLA 4NJMB 4QDOA 4RSMA 3TEHA 3WKBA 5AK4A 1ZIPA 4V3BA 1DV2A 2Y93A 3UGKA 4YUAA 1N3LA 2DQSA 2GOYA 1V95A 3V1UA 4BNHA 5JBQA 3COYA 3INRA 4IFEA 4C4ZA 1CFJA 1Q0LA 4F9EA 1DJMA 4AX4A 5EIBD 2RBEA 5LKRA 3COPA 3OM1A 4YI3A 1OBCA 2QTFA 4C0HA 3MCWA 5EHXA 3OZDA 2QM3A 2ZAIA 1WJGA 3DZKA 4GXNA 5IXJA 1E3JA 1ECJA 1RJWA 2A59A 2QEQA 3WHKA 1OKKD 3PPVA 2BV3A 1J23A 2A0UA 1BN7A 1ZVKA 4LZNA 3SJCA 4BX8A 2R6DA 3B89A 1IXYA 4LW8A 3RW9A 1J8VA 4M0FA 1FFHA 1EQRA 1I2AA 3AKYA 5K3AA 1JB1A 1W1WA 1E6CA 4NZTM 1NONA 1J09A 1UJBA 1G9XA 4KMOA 1DUVG 4J0EA 1KPIA 5FL3A 4AIRA 4C76A 1FPMA 2AX3A 2FR8C 3GJXC 5JWHA 3LUAA 2ODRC 2PIDA 5FJIA 4EY8A 5JAMA 1IN5A 3FJPA 1DG1G 1M2WA 1E7WA 3A31A 2ATXA 4EPRA 2G4VA 1Z17A 4LJ9A 3ZHVA 4J4TA 1RZUA 3FYHA 2G71A 4EGFA 3VH3A 4REQA 2CHVA 5EOVA 3RC3A 1CUIA 2I2CA 2FRDC 1I2BA 3RVNA 3GQVA 3HXZA 4DDHA 1C3VA 3SXJA 1RE1A 2XYPA 3H17A 3LCJA 4Q1AA 4B6PA 5B55A 4BO0A 2UZIR 5TF4A 2N75A 4EMSA 1NMXA 4G0UA 3KQQA 1M1YE 1A5BB 5CB6A 5BN3A 3VO1A 1EVKA 3DSQA 1VC2A 3HRKA 3LWDA 3FTQA 5KDLA 4FC6A 2IH4A 3PHGA 4G4JA 3VDXA 2Y9MB 1Z4LA 3TNDA 4UDXX 1RI5A 4NBNA 4PAWA 3T7AA 1R50A 1RTTA 4RGBA 3LX6A 4XFKA 2VDWA 2A0FA 4J2TA 5IVIA 1A82A 1XG5A 4I2VA 1UKYA 2XEXA 1ENOA 3VHXA 3N1UA 3VR5D 3UPTA 3O92A 2GA8A 5K5EA 3MQZA 1VL8A 1VSVA 1YASA 4RYLA 1DCFA 3TCKA 4BMXA 2AH5A 1BQ4A 3FOFC 1F60A 3PNSA 5BUZA 3RYFB 3UJPA 3ONVA 3SQLA 3BD7A 4MDYA 5HSGA 2ZAGA 1UPAA 2FUNB 4AZTA 4EVRA 3GUCA 1WPRA 2F00A 2VYCA 1GAXA 4KQHA 4X8OA 1JS1X 1ZWLA 1IQRA 2VNAA 3JYOA 4HWKA 2QYSA 1XZFA 4IGAA 2W00A 3THWA 2Q1YA 2J9FB 3V2GA 1JILA 1ANKA 2NT4A 2ZYRA 3PUJA 3MTJA 4PM4A 3CRRA 5CA1A 3MD9A 2BSAA 1IUNA 1COZA 2J3KA 3J7AC 1MO2A 1H0KA 4L22A 4TWBA 2I7CA 3UGJA 3RYHB 5GJBA 3GGJA 2QA5A 3UMYA 5FHRA 4JMLA 3AF3A 3LXUX 5AO9A 2I2XB 4AJKA 4MPRA 4EBFA 1B1CA 4YMUA 4H7PA 4OA8A 5AM1A 3WO1A 16PKA 4MXDA 3T0GA 1J2RA 4RVOA 1E5TA 3FZNA 5B1IA 3VNBA 1E2MA 5JT1A 1TU0A 4ILEA 1II8A 3FZEA 2R6JA 4CM3A 1D7AA 1L4LA 3ZD6A 2FFAA 3UKOA 3Q2OA 2XAUA 4H1WA 2WSMA 2QMEA 3PC8A 4YJ2A 3QE9Y 4YJKA 1VGRA 3NBXX 2V6BA 1EX6A 2IHBA 2XDWA 2C2KA 4U00A 3RWMB 3ZEIA 4B6JA 1FP7A 2ZPAA 5HJ2A 3SKYA 4JL5A 1M34A 1H05A 5JALA 4D0GA 3W6UA 1C3OB 2EDAA 1H3EA 4M88A 5ALYA 1ZQ1A 5CDTA 2P75A 1WZUA 3QM1A 4HN2A 3R8CA 4BQIA 5LNK6 2ZM5A 2EWWA 4WXHA 2A1UB 3HG7A 3OFSA 4FOTA 3SU8A 1T9DA 1OA1A 3IUJA 1T9CA 4DUGA 3T61A 3DDCA 4QU5A 4PZYA 3HFGA 1QIGA 1O97D 1GRNA 4OQDA 4KAAA 1HNNA 3FFWA 4I6GA 1IN8A 3FFXA 3G9UA 5C3UA 1NATA 3AF2A 3QG5A 4XDZA 5I8WA 4MW6A 2ZTGA 4ZPJA 5HW0A 3HFJA 1G8GA 4QL3A 1ZCJA 3HWRA 4EGSA 3GT7A 3CYFA 1U0OC 2B35A 1BDBA 2Q7XA 3FDJA 4FN4A 3TEMA 4TKMA 3LY9A 3OG9A 3ZLUA 4ZZ0A 3O8CA 1PX2A 2IEGA 3JY6A 5JC1A 1WE2A 4LFAB 3RKUA 2AEFA 3TKYA 3EARA 2JCSA 1OCEA 4DNQA 3L2ZA 2MSEB 5KVQA 3AHEA 2OHFA 2YS7A 1SVUA 1DWQA 4LC0A 4RY0A 4J9UE 2DWUA 2DU5A 3AEKA 3C98A 4D9EA 1TEZA 4K2AA 3OHPA 5F73A 2BUCA 3S2IA 4ZHQF 5A4MS 4O4IF 4PZUA 5IVKA 2HREA 1A77A 5F5XA 4IWXA 3BFMA 1RAGA 3N7AA 4TVSA 5I7HA 1W1IA 2WNHA 4MLZA 3ANMA 1FJGB 3WLJA 2EU8A 5EMNA 3FVQA 2NVBA 3I28A 3DLCA 1LGYA 2JBHA 3L0SA 3BULA 4IHQA 4TTQA 4AMZA 4DM3A 4CKWA 3HTXA 5A5VA 4DA6A 3T95A 2GN1A 3ILYA 5SZHB 4O0LA 4EFLA 2V58A 3B7PA 3N2NA 5EESA 1ASZA 1XCBA 4BZXA 2VNSA 4MWOA 3NRJA 3ZDXB 3V8RA 4BGVA 4DVJA 1G4AE 1PFUA 4D0NA 5ICGA 1XF9A 3ZX5A 4PRLA 5KAPA 1P5FA 3DUFB 4AJ1A 1UWCA 3D7RA 2H31A 4QX6A 3HGMA 4Z1MD 2QR3A 1UMDB 4H2SA 5B4UA 5BN4B 4WD3A 2RHTA 3HCNA 4IDGA 4PC3A 5AXBA 4D9MA 1KMHA 4L6CA 4RJKA 4PWYA 5C0OE 1V4BA 2B36A 2H4ZA 2ZSFA 4GRDA 4RW0A 2OO5A 3UM9A 5ITSA 4JBLA 1JYEA 3R5HA 1C0IA 4FZVA 2XNCA 4E21A 3RFTA 3OY7A 3B1ZA 1I5OA 3K9BA 2GBLC 4A7PA 3U56A 3N0RA 3OQOA 4X3OA 4U7PB 6CHYA 2XMZA 2ZYTX 2OG1A 3A05A 4PIPA 3ZIDA 5JDCC 2GJSA 4KIJA 4Y1FA 5FT9A 2P8SA 2VDJA 3A7AA 2ZANA 4RTRA 1L3IA 2P9YA 3P8YA 2AK2A 3ICQB 4C21A 2VJBA 4K6KA 1M7BA 1WSDA 4IHJF 4LYDA 4QBTA 2VWQA 2EDCA 5DM60 1SXJA 2RHSB 2YZ7A 3DAPA 3PCTA 1SEVA 4LKRA 5JZSA 1N2CA 2JGNA 1U5BB 3AEQB 1E4EB 4GYJA 3I92A 2QUZA 1NBME 4WESA 4MS1A 3SX0A 1RJ9A 1VKJA 3DULA 1JFFA 3Q5DA 4ZV7A 3BXGA 1NW7A 4RFLA 1KORA 2JH8A 2LGJA 2AL7A 3PR3A 4K28A 3RK1A 2WKRA 3M5PA 2FYKA 1CRWG 4LXGA 5B7QA 1RAAA 3EWNA 4ZI2A 4ZI7A 3N28A 5DN6A 3RGLA 2VR1A 1UC9A 1ZM3A 5I4CA 2NG1A 3BTVA 3IH5A 4O8ZA 2QTWB 1E2IA 1JDBB 2VI5A 3CZ9A 1THGA 4PSAA 1GRCA 1YS6A 1Q21A 3LP6A 4R8RA 3AIKA 3G5UA 4NATA 3T9FA 4U7GA 1AUPA 1JF8A 3SS7X 1ZJYA 3NHZA 4GH5A 3WIEA 2P41A 5I5EA 3K70B 3IGFA 2I8AA 3X1YA 1E1LA 1MUUA 4K3UA 1Y33E 1XLVA 4C0BA 3LFUA 5F64A 2PCJA 1ZGAA 3UMGA 1R6BX 4BUCA 1V5IA 3W3AH 5MGNA 1Z08A 5CB4B 1N25A 1SAYA 4FE3A 2ILVA 3FIUA 1XTUA 1SC9A 3E8XA 4Y30A 5GIOE 1KYZA 5ADWA 5EUBA 1T5LA 3G49A 4D98A 1TW2A 1XDSA 1TIBA 1A9ZA 4M7WA 5IKXA 4DA9A 2HK8A 3A10A 3NWEA 1AT1A 4UPDA 1MG0A 3EY4A 3IVCA 4AJNA 5JYCA 1A8SA 2X8AA 2P9HA 3ORYA 1B70A 4G56A 2WLSA 3I5MA 1B6RA 3VNSA 5ELXA 2WU1A 4GW3A 4O2BB 1ZCBA 2VZEA 3IKLA 4RV9A 1SZCA 3OIUA 5HF9A 3RHZA 4Z0TA 2QTNA 3HCOA 5CFQA 2H17A 4Z4FA 1ISSA 1RWMA 2A58A 3B20A 3O84A 4KL8S 2YQ5A 1CD5A 1IPEA 1DEKA 2YVAA 4U2EA 3OAAA 3CMQA 2JHGA 2EG9A 1M2OA 3I5AA 5EZYA 3ZBUA 5B37A 2H8KA 5KJ6A 2PRJA 4NC9A 4TVKA 4G63A 2CCKA 3LX8A 1O54A 1P2GA 1U8EA 4F9TA 4Q37A 4ZDJA 1W2HA 2B99A 4KXYA 4ZFNA 1E9VA 4C89A 5D86A 1OFIA 5BQ5A 5CFZA 5FLYA 9LDTA 4PZ9A 2D5CA 3TQTA 3W7BA 3AP1A 4OXNA 4UBNA 5UKDA 1P7CA 1ZIXA 4PYJA 4YCNA 4KRFA 1JRLA 4GL4A 1FX0A 1LPOA 2G5CA 4P7GA 3CUVA 4RKRA 3EGEA 3TCXB 1XMJA 2HF8A 5AK0A 4ZVRA 1RWXA 4ZOAA 1C3XA 2GPAA 5AM5A 2QJOA 2H4JA 3ED1A 3FGNA 1L6IA 2QUKA 3OLYA 1AHNA 4M53A 4RK4A 4XB6B 4XOIA 5IK2A 3UQZA 1UOPA 1JFRA 2A7QA 4EB3A 1R3DA 2V5AA 3D59A 5CEFA 1QP7A 2Q5HA 2X58A 3KZXA 3MAJA 3A9TA 1L4MA 1J9EA 3KFLA 4R1TA 1N2CB 3S2ZA 1K3UB 1MQ8B 4O2BF 5SYNA 1JDZA 4QZVA 1A2OA 4UFNA 1Q1NA 3SDBA 3R3ZA 1TJNA 1TFUA 2MMGA 2WG2A 4ON9A 4HXEB 1MX5A 4KYTA 3S1AA 4F4UA 3IRVA 2YCLA 5B53A 4W9RA 4G0PA 2AMLA 5CCXA 2GYUA 4FB4A 2NV6A 2XYRA 4MGKR 3R7SA 1CE8A 1XDDA 1CNMA 2DP4E 1FK8A 3AU9A 5IJ0A 1E1NA 1A88A 2H1HA 1INLA 3K0CA 4MIYA 3CLRC 3HYSA 3OPQA 4KK3A 3WIVA 3U7JA 5K01A 4L8VA 1Z82A 3L06A 4R2KA 2LDBA 4Q9KA 4I55A 1NE7A 1VMIA 5AK3A 4D97A 4DC9A 3HBNA 1PVVA 1R66A 2D5AA 1FFXB 3NW9A 3P9YA 4J4HA 2D6FA 5KI6A 3MRVA 4B6FA 5L45A 1OJ7A 1CY1A 4OP2A 5ILQA 3HGQA 2B83A 3GDWA 2FOLA 2ANCA 1QZZA 5JO0A 2FMXA 2QX7A 5ENDA 4HDMA 3I01M 3UHAA 4DR3B 2Y6UA 3IAEA 3JYPA 4Y1RA 1LF5A 4WBXC 2C4VA 3FWZA 2BGWA 1J2UA 3BHIA 3D54D 1IOLA 2VSOA 5CT9A 3WWZA 1KI4A 1KARA 1YIOA 2C7VA 4JC0A 3V6LA 3ZWWA 2G4LA 2IS2A 1B70B 4U2FA 1CYEA 2P2LA 4B4DA 3MEYA 2PGNA 3KXKA 4FR0A 1RE0A 1TF5A 1X0XA 3EIHA 1M1UA 4O2BA 2ZE5A 4U9UA 3M5DA 3O4RA 3WGNA 2DXIA 4Q4HB 3I9KA 5DHPA 3ADKA 3A04A 2V4ZA 5TQ0A 4ZVQA 3FETA 2FR8A 3F4KA 1I3OA 5DB4A 3FF4A 4EG5A 3SXUB 2EWNA 2DEQA 4P4SB 3IKMB 1H8HD 1XNGA 1H5UA 3FYSA 4B17A 5JAHA 4LJAA 1Q22A 2A9QA 4E12A 1T4BA 3L43A 4OQNA 2CLOB 2JJ1D 4QUIA 2BFBB 3OQIA 1A69A 3R8FA 1WULS 3B2EA 4RQEA 1C4WA 1IPHA 1PG2A 2BCGY 2I3BA 4B79A 2XGJA 2CD7A 3C3MA 3N8KA 1PTJA 2NPIA 2C2OA 3T1VA 4G0XA 4HGNA 4QU9A 4U7WA 2E4AA 3RFXA 3BA6A 3HBMA 4X3CA 3LT0A 4P75A 2Y8EA 2Q50A 3HSYA 3ONDA 1HGXA 4KN9S 4BB5A 4FCWA 3WTCA 4F85A 1IJBA 1FYVA 3PTAA 1UM9B 2G8NA 4Y2GA 3W5VA 1AMUA 3I32A 3M6IA 1BFDA 1E5VA 1G2QA 2Y1EA 3KVVA 5DTEA 3BKXA 5I9BA 3UUEA 2XIJA 4J9VA 3SEZA 5IHPA 1SHTX 2YWFA 4ZQHA 4GZ6A 1UDRA 2IHYA 2WDZA 3JQ6A 4CHGA 5IJ0B 2I6FA 5LMZA 5DU2A 2IYYA 3H8JA 4NHOA 3V2IA 3FPFA 1VLJA 3LQ2A 2AC7A 4AMVA 3HVKA 3NBYC 1OWMA 3I0MA 2AOTB 3E9CA 2QYHA 5AJWA 1H0XA 1DTEA 5K4AA 4BNNA 1P1RA 1YAHA 3OHMA 3TIIA 2VF4X 5C80A 3F8TA 1MQSA 5ALMA 4OPMA 4KIGA 4XLZA 6YASA 5THQA 3W90A 2OD2A 1LI4A 4TV8F 2DJIA 2E4UA 3K0EA 2PE5A 3TOEA 1MFPA 2IPOA 1YTUA 3HN6A 3REFA 4INJA 1JEQB 3RQIA 2BHRA 2FDRA 4EL5A 1VR4A 2Q9UA 4OQQA 2O06A 1W59A 3IR7A 1CR2A 1D6SA 3DWEX 4CFSA 2FQQA 4I08A 2BISA 4R2MA 1TT7A 1XTIA 2VJMA 3A6ZA 4YRSA 3BFKA 3ILXA 5E2BA 1XJCA 4IS3A 4Z8YA 1E6LA 1Y82A 2ZINA 1YJBA 1BH6A 3AEUA 3SEAA 3VUEA 4UOQA 4WDRA 2YZMA 3AXSA 3BL5A 1OZFA 3WL8A 1E2PA 1XRQA 2ZIWB 1J9GA 1X74A 4US0R 5J9FA 4EGCB 1CETA 2DERA 1NC1A 1LBQA 4ZC1A 4DCUA 2Q9AA 2YX1A 3PJDA 1KOGA 1S7CA 2ZGVA 3GWGA 3JARB 4RTSA 2XE6A 1G7TA 3Q6IA 1CJVC 1MPXA 2QL7A 3OICA 3L5KA 3CO5A 4WDQA 4YUVA 3ME5A 4II3A 1QWOA 2PL9A 2I7DA 3PX7A 5JCJA 1ZJ4A 5SV2A 2VG8A 2J0UA 4OCZA 2PIAA 3HUUA 3WWEA 3UKDA 3EY9A 4LHVA 1AK2A 2QAGA 4EIWA 4DNPA 2G08A 2Q6IA 4MJXA 5F3RA 4HNGA 1OAAA 2EHJA 2GEDA 1N6KA 2RC6A 5SY6A 1U8CB 4PGMA 5JFTA 1M0SA 1MPTA 1UOEA 3DD5A 4JI6B 5JS8A 1EHCA 2UVPA 2CKDA 5DM4A 5EUCA 2QP3A 1EEXB 1NH9A 2A5JA 3WNZA 3WGVA 4YPFA 2GZSA 3GLGA 2ISQA 1A9XB 3ES9A 4CIDA 5HE8A 4RVCA 4D0RA 1PRYA 3C7KA 3P9SA 4YLEA 3K30A 1RMTA 4LSMA 4NMLA 4AICA 4EVSA 5A5FA 4CETA 2H48A 3ETJA 4NDZA 3ZZMA 1D2GA 2ZYDA 4FJ2A 2DXTA 2IKQA 4Y2SA 3GEGA 4K9PA 2RHRA 2F9MA 1FFEA 1CERA 2YIMA 5LYJA 5JJIA 2PTHA 2YXLA 1SKQA 3OP4A 2JA2A 4U2BA 3RUAA 2GUWA 3W8DA 4PFKA 1IY8A 5KYXB 2O5EA 3HR7A 1CLUA 2BPOA 4O33A 2E4ZA 2YRWA 1UT8A 4B6EA 5HVNA 1OREA 3KQKA 2DFDA 2H11A 3EIQA 1OZAA 2PEZA 1H6DA 4FKBA 4W99A 5B12A 3WAKA 2ECFA 2H0RA 2HDWA 2V03A 2WJIA 3MQFA 4JS0A 4AKTA 3UJ7A 3I9V6 2B8EA 2PSJA 3K1AB 5ECWA 1CY0A 5F51A 5AM0A 5AUNB 2AHRA 2YRXA 2XCSB 2FG5A 2CLHB 1EA7A 4RIHA 2QD5A 3QKBA 3QOXA 4GQIA 1TUGA 1EJ6A 2R79A 4DQ0A 2C7RA 3JAWB 2WF9A 1Y0BA 3K1ZA 4LOLA 2XHEA 2PBFA 4ND2A 1EESA 1CQJB 1ES9A 4ESOA 1XKLA 1J39A 1TAHA 5DHAA 2QRUA 4HTAA 1UL1X 3PJGA 3U7IA 5AW2A 2P0EA 3REUA 1EK1A 5K3OA 2C3UA 1KEPA 3FFAA 5JFGA 2VYFA 3C5VA 5E8RA 3A6PC 1QHIA 2VDKB 5EP4A 4C4AA 5J2TA 3VYUB 1O6CA 2A92A 2WSLA 4XQEA 4N47A 2VPTA 3OKAA 2Y2VA 3V6MA 2VJMB 5JY6A 3QPVA 4QOJA 1HZJA 3F8WA 4D25A 3VPSA 4R9VA 4IIUA 3AL0C 2CYBA 3G1ZA 3GRAA 4X90A 1SZJG 4KXNA 4RDIA 2QG6A 4HRVA 4OXIA 2HA6A 2AEMA 5KMGA 1ZHFA 1NDHA 3RSGA 4TMWA 3WKDA 1X15A 3K70C 4LG1A 4TQAA 1CSEE 2WIFA 4TVAB 2B2CA 3IJPA 3JARA 5EE0A 2ZT5A 2R1VA 1ZIDA 2VRNA 3PT5A 5TJHA 3WGYA 7YASA 4EYOA 5MFPA 2G63A 1YOVA 3MRTA 2YIJA 1COWD 3CZMA 5G1NA 2IHKA 3PXEA 1G66A 4LGCA 2Y1CA 4D74A 3M70A 1SQ0A 3A14A 4EJFA 4P4NA 1LD3A 1P7VA 3P04A 2HQSA 3O1JC 4TYMA 1UKZA 4ZCTA 5AW3A 2J5KA 4UUNA 5LLTA 4EO0A 1UOOA 4OGFA 1OTHA 3BVPA 5GM1A 4UUAA 5F21A 4Z0HO 5BNZA 5DYIA 8ABPA 4KUHA 5AVWA 3OIVA 4MGZR 1D07A 1VG1A 4N12A 2C2XA 2PEYA 1SG0A 4L5IA 3V3TA 4C2TA 2MHCA 1CR0A 1D1SA 4B80A 3FHTA 4AXXA 4C1BA 1ZOOA 2EG5A 5HK8A 2V59A 2ID7A 1BEEA 3OT5A 4Y9DA 1XPUA 2QZZA 2PT6A 2XYHA 2LKCA 3EN0A 1JFLA 1OPXA 1W9MA 2XTNA 3LYLA 4NOJA 4GLLA 3U49A 4LDNA 4RK7A 1MHPA 4FFWA 4BN4A 3RKRA 1JDTA 4DQKA 2D4HA 3ZHTA 5A6SA 3FA2A 4GPZA 2HN9A 3KUDA 1GCGA 2CXRA 4RHUA 3T3OA 2GBFA 3DZBA 1T8UA 1QQAA 1RQLA 3PQEA 3AHHA 1J06A 4N3GA 3OJ0A 1NFQA 3PBKA 1JE1A 3CKMA 2FEOA 4L9SA 4URXR 1E3LA 1I3CA 5D1NA 2JJMA 4DIEA 3HTZA 1PS9A 4ND5A 5IT9A 2R0QC 1JVSA 3MJRA 3CX3A 1FJXA 1P19A 2XPCA 3W2FA 4ZMSA 2GH1A 3RKWA 5CYFA 1GLNA 1KDOA 4TYWA 4O29A 4RFSB 1GQRA 3VHQA 2A5GA 3IQFA 1RD4A 1L4KA 4UBLA 3DT8A 3STWA 4L4SA 4RF3A 3Q6NA 3WFIA 1CVRA 3GLRA 5JCOC 1JYFA 3C3CA 1YCHA 2F48A 3EAFA 4O2AF 1JHQA 3EVFA 721PA 1MBZA 4WK2B 1OV4A 2PA0A 4RV5A 4PHGA 1F9EA 4M9CA 1EG7A 1FUKA 1E5DA 2ODWA 5JPIA 1YQWA 2A0KA 4Y9SA 5JVDA 1A1SA 2PUCA 4UM5A 1C3LA 5JAUA 5GONF 3EF1A 2IP4A 3N05A 3GA7A 4CIAA 1QH1A 2E55A 1YVDA 3HJUA 1ISFA 1R9JA 4JHXA 3GG2A 3QHQA 2RCNA 3KV3O 1XYGA 4PG5A 4WW0A 1AQUA 3A1EA 2OPHA 3U6YA 3FWNA 1E79D 3ZVRA 3TR6A 1CBUA 1QF7A 1KI7A 4DR1B 2VT7A 3PC7A 4V0RA 1EK2A 1OD6A 4YT5A 2YZNA 3LI2A 4JXKA 3K6SA 4KRYA 1H4TA 5FBWB 1UQUA 5ULLA 4J90A 3MT9A 1KU6A 2FPUA 2PD3A 3CGGA 3KSUA 3TW6A 5KMGB 1FSZA 2B34A 2VYVA 3HPRA 4JQSA 5LA6F 4JP5A 3ZIUA 2QXYA 5EWMB 3ASUA 3B85A 4TS9A 2R44A 1NI4B 1ZBQA 4JMPA 2M6SA 3MC1A 4OK6A 2VZLA 1U7ZA 3MB8A 4IVPA 2GZRA 4JLNA 1X87A 4RPIA 5FL7A 1GGVA 6GPBA 1WETA 3KYBA 4PQGA 1YOVB 1ZNXA 1DBQA 3CKLA 3IPCA 2QSUA 4KR3A 4MVJP 2R6HA 1O95D 1NVTA 4RC9A 1KAHA 1Y89A 4DBZA 5GM2A 3LU1A 1OLXB 2KJQA 2RAUA 4M1SA 4TQ9A 1DCJA 4BUJA 1O77A 2FPGA 3QXHA 4DSNA 5E7IA 3CNOA 1G21A 3ZIHA 3BD8A 1KRHA 4W1QA 4S1TA 5E1MA 3U3MA 2Y1BA 1UBEA 5LPNA 2C5FA 4ARZA 1IVSA 4PYNA 3AI1A 3H5WA 5H68A 1Q2XA 2A9VA 3QY9A 4K46A 3I9V1 3PLNA 5JLAA 4N3CA 2DHQA 2GHTA 1YI0A 2H63A 3ACCA 4GR9A 1QFJA 4CUZA 1TJ4A 4TWAA 3PCRB 4XSGA 2OLEA 2A1UA 3LVFO 3BJEA 1A7AA 4L4XA 1FUUA 3ADCA 1ZGJA 4H3VA 2RK6A 4RL4A 4ZIRB 1E2FA 3UHPA 1NAIA 1F4LA 2ZJ0A 4D43A 2D4AA 1LS1A 4P3XA 4YGXB 4UE3S 1PV1A 4DJEC 1EJ2A 2VNHA 3VTFA 1G20A 4ZQCB 1KAGA 1LI5A 5JMWA 1RS0A 1NULA 3ONEA 3VO9A 3O8OB 4H7IA 5EKXA 2TRSB 3K05A 1LPBB 1STOA 4EECA 5LQRA 4EEXA 5F9HA 2XT6A 1FEZA 1ZITA 3O0TA 4FMBB 3QX7A 2DVMA 1E3WA 3DZCA 1V7QA 2QOEA 2V97A 3HKBA 2XBLA 1VHJA 2JD0A 5CVTA 3TSUA 1N92A 1EGVB 1YIAA 3KB1A 2QBYB 1CJBA 4KBFA 4MROA 3WDMA 3OF5A 2PMBA 3AEKB 4C0AC 1LX7A 5IM4A 1ECCA 2WJZB 5KB3A 2LE0A 2WE7A 1UUFA 1NSTA 3FTNA 1G5QA 3G2LA 3UHOA 1WQ4A 1MENA 1T9GS 3BD9A 4QYTA 1FX1A 5AM4A 5EKDA 3SSAA 2JG3A 1BXRA 1RCTE 1SQ6A 1U8UA 3I12A 1XNJA 4R4JA 2AFHB 1DQNA 1PYDA 2PUDA 1RI3A 1MW8X 4DJAA 3LPCA 1ZN8A 4XWTA 2FMFA 2A9JA 1JXQA 1RWOA 3MWEB 4H7KA 4P08A 1ULZA 2BFPA 4X94A 3VKWA 1UAGA 4ZT5A 3AMVA 3N74A 4EZEA 3J7TA 4HRYA 4OUDB 5LYJB 4A82A 4PVDA 2FSVC 1JDUA 2AJ8A 5EWMA 3I2KA 5JBNA 1BIAA 2BI8A 1T4CA 3IT1A 4LJ5A 2XMBA 3EZ7A 1GCAA 3RM3A 1QO9A 5IKMA 5E0OA 3PZBA 1PX0A 3KB2A 1NVAA 2A2YA 2ZJ5A 3GYGA 1KYVA 1YL7A 3P4UA 4W9NC 3AR3A 2D2IA 1Q11A 1KO8A 2P7IA 4ISCA 1KZ1A 4A0HA 4H16A 4UTNA 1UJCA 1VIDA 2QRNA 1NN1A 2FW7A 4OY3A 4BMOB 4Z54A 1AO3A 1HTWA 1R64A 3LOPA 2QRQA 3T5AA 4DQXA 1GQQA 2LWIA 3DE6X 4JR2A 1SEPA 4F5YA 2ZKLA 4F46A 1EDOA 1MAVA 2RGBA 4F5WA 2QJTA 3WA7A 2OCGA 5DNCA 2QJFA 1T9KA 3K0KA 5JCOA 1GUAA 1PJQA 2ZZKA 2QL9A 3GQBB 1JU9A 2ZQZA 4U8HA 3ZNNA 2WEKA 2ADFA 4AO6A 1GPBA 2FDCA 4BKMA 3FUUA 5KQMA 4XKJA 5CLLA 4BB9A 3RT1A 4R3NA 4E5PA 1LB1B 3COJA 3A6HA 1N4DA 4W5QA 3DOOA 1QG6A 2PO5A 4OV6B 3CCBA 4XQ9A 3B12A 5D1HA 4OL9A 3SS8A 3ZHUA 5BSEA 2Q1WA 4YROA 5TX7A 4GXQA 2XY4A 2XZTA 2ZSHA 4QYXA 1LJ8A 3BXPA 4HWOA 1WEHA 3HNOA 2O3QA 1UBCA 1CQZA 1H2HA 3AZOA 3EA5A 2QQ0A 2YBDA 3I9FA 4FYIA 4PYIA 5H3CA 3S2EA 3U4DA 3AVVA 3KQWA 1NR7A 3G2IA 3EIFA 3RWBA 4UOZA 1I14A 2CJ9A 1IHDA 3E7FA 3R3WA 3D0QA 4A6PA 2DTHA 4WBNB 2B78A 4Q4AB 1SBQA 3BSFA 2YV3A 3DC2A 1VLZA 1FNNA 2GB4A 4MUHA 4MPPA 1F6DA 1IHOA 5FEUA 3E0XA 2NZYA 3FWPA 2OBYA 1NBHA 1U9IC 5FQNA 4Y2PA 2DBRA 3H4IA 3MF2A 1E3WB 8AT1A 1DBWA 2FX3A 1D1PA 1HF3A 1MCZA 2VT6A 3STYA 3WLFA 1FDIA 5IZ4A 1SCAA 2BFDB 2JGAA 4LVKA 4MUMA 4PHHA 4B8ZA 5J4YA 1Q84A 1XHLA 4EENA 1VGQA 2PKQO 4IVRA 1NBMA 5LP6B 4FZ5A 1EPUA 2EAUA 2QRGA 4M8IA 1IHYA 1D09A 1V9SA 2VPXA 1Y7LA 2ZP1A 4OK3A 1E8NA 4LK2A 2JIPA 4M83A 4B7UA 2O7QA 2I54A 2GTCA 3IO5A 4CS3A 5GJWC 2DQ3A 2FEKA 3AB8A 3ZN2A 3DPIA 4ZDKA 3TSQA 2IXBA 2L18A 3KE9A 3LGXA 5LB4A 2E5AA 5KYYA 3PFKA 5DXFA 3HO6A 3G2JA 3FOBA 1COWA 3OZCA 2L8YA 1XJ5A 1QOZA 1FFSA 2YINC 2AMFA 4GM0A 4CM6A 4G5FA 1ISJA 1J9ZA 4Q0MA 3F3SA 4OA5A 4UNNA 3RSLA 2GK3A 1P5ZB 3AQ4A 1IEXA 3R6GA 3V7YA 1Z0JA 1K7EB 3U4HA 5CTJA 4HRAA 3L0BA 3HCWA 1SU7A 3LFHA 2A1IA 4YXFA 4BJ1A 3UMJA 5KX5A 1XQ9A 2H08A 2IOFK 2PT9A 4FKZA 3W3AD 5KYUB 4ZVOA 2V0GA 1S2NA 2JHPA 2VUIB 4PTLA 2WJGA 4PV7A 5AJUA 4BFVA 5FKJA 3ADDA 5KWEA 1SBCA 4XVQA 3BK1A 4ZOCA 4PZLA 2ZZFA 3DZGA 4PQEA 2KMLA 2DZCA 4N49A 1G2IA 1VB3A 2A35A 5CJPA 3OLXA 1H2RS 3S7ZA 1R0CA 3TTWA 7ADHA 5IKPA 1XV5A 2O14A 1ISGA 4NU5A 2O8DA 2ZETA 4BNYA 3Q0EA 2H92A 3UA4A 2LCQA 3HU1A 2WFZA 1M66A 2C2GA 5ESWA 1DXQA 2D1RA 2IEDA 5TQ2A 1L5KA 4S05A 5GJVC 4IJKA 3WVNA 3P97A 3W05A 2NACA 2P11A 1XD8A 3HR4A 1KETA 4LGVA 2AJLI 4QQRA 3SCZA 1KZHA 2HRDA 2HADA 3WHPA 4FMCB 4DMFA 2IZ6A 1YFSA 2B1IA 3WGOA 4DR6B 3ELUA 2P78A 3VZQA 2M6RA 3V7SA 3QFCA 4ZARA 1GD1O 2PUTA 2OYRA 2VDQB 1ZNZA 4YCVA 1NN0A 4FQ7A 3SM3A 1ZDMA 5A9RA 4HAVA 3GYBA 4JQOA 4R3UC 4DWOA 3GNTA 2C96A 5BV8A 2DGDA 5HRUA 1MIHA 3TI9A 1YQUA 1GPYA 3K8ZA 2C83A 4Z4CA 1VCHA 4XWOA 2J6IA 1R5NA 4WKGA 4DSUA 1NYLA 4YMLA 3PQ7A 3ECSA 1RAHA 3ANSA 2GN2A 2VHVA 1E7YA 4KXXA 3K94A 2YIVX 3QTTA 3FOWA 4QBGB 5CT6A 3WNQA 1Q0ZA 2WJ3A 3ND5A 5ALVA 2VHYA 3AESB 5HJEA 1KSGA 1XHEA 4JJIA 3EG9B 4Q21A 5LWHA 4GL2A 3GDOA 2QZ4A 3CN9A 3B1KA 3Q6MA 4NG5A 4RGVA 2WZDA 4UEWA 1JHVA 4X8HA 3Q9NA 1MRNA 2CJAA 3P0RA 2J87A 3DM5A 4KNVA 4W9NA 5E4YA 1W5SA 4FOLA 3ZQ6A 2Y68A 2C7OA 5BYJA 1KJQA 3NPMA 4XAQA 2Z9BA 4HTFA 2J6BA 3BHJA 2NO6A 3GW8A 4JVLA 3R24A 1A0OA 1JALA 3FUCA 4IIEA 4E03A 4HD0A 1X1TA 5FUXA 3WISA 2FB9A 3AP3A 2EIXA 3JRXA 1SETA 2OBFA 5KWJA 5DNEA 2CGEA 4DSAA 1KJJA 3VR3A 2XODA 3X44A 1E59A 1P1IA 2VTEA 4KQ6A 4RZQA 4ZT6A 4KQKA 3WB0A 2JNWA 3QP9A 3LPAA 4Z8XA 3ZIAA 4DPLA 1D4ZA 2IY5A 3MJVA 4EUHA 4IZ6A 3OPYB 1XOIA 1F8XA 2WUDA 1R16A 5L40A 3O8NA 3T35A 1AO0A 1MAUA 2C4TA 2PO7A 2V54A 1G7CA 3PWKA 1U2DC 5DTJA 3RU9A 3OPNA 1E1QD 1UBUS 2L17A 3DOEA 3IEXA 2BY4A 3VPDA 3CUEF 1E94E 3W1WA 1RQNA 2PKEA 3BMOB 5K1ZA 3TLCA 1YTLA 3KWMA 3IHWA 3JV7A 5TV2A 2H1FA 1KRXA 1ORIA 2AE1A 3FPJA 3O8RA 2XKJE 4BNUA 4RSHA 3UN1A 4GPBA 1PLJA 1RRMA 1RBZA 2VNIA 1OX4A 3GRUA 1BWQA 1WW3A 4MK4A 1DAIA 4NCBA 2VTBB 2ZIVB 5JAPA 1M2VA 1GSOA 3SC3A 5EIFA 4AQYB 4G0WA 1NR1A 1HMYA 1UDXA 4FFMA 3M83A 1E2EA 1FNDA 4QC2A 3U2QA 2PK3A 1H2YA 1G3UA 1QHHB 3CEJA 2GZDA 2X7HA 3TINA 2FR0A 2AZ4A 2O8DB 2NTNA 3NV9A 1ZSNA 3OKPA 4HJXA 5CAEA 5KNBD 4QODA 2VJQA 1WQ3A 2YTZA 3DLHA 3IPXA 4XTRA 2HUNA 3SD7A 4CT5A 5PGMA 3PRHA 3UK2A 3PQDA 1IB0A 4DV6B 4FXOA 2C5HA 2ZUCA 1WZCA 1H2XA 4FEEA 4F9FA 5EJ4A 1I01A 2B4QA 1OW3B 3OPYI 2HK9A 3QUSA 3I3OA 3QVGB 5BUSA 4ML3A 3G0BA 3FMVA 2IHNA 4BP9A 4XU0A 4F6CA 3W1VA 3K4QA 2DPGA 4H1HA 1PSWA 2WAAA 1YVRA 3K0BA 1KYYA 4NCXA 3GUHA 5DNYB 3VHRA 2ZXEA 3ZDYB 4XGKA 2JRLA 1NPTO 2DEUA 2ZYHA 1CIPA 1P4JA 3D2LA 1VL1A 1PW5A 2K2QB 1WOMA 4XRGA 1JHZA 3D8TA 1MD9A 1RJDA 4YTEA 1KEZA 1N5MA 3B52X 2O52A 4OMUA 1V8DA 3ANLA 1BW9B 5A02A 3A2MA 3QPUA 4MS4B 4MSUA 1VTKA 3ER9A 2H7VA 3KYDB 1AXRA 4HGYA 4QDUA 3OCUA 1EFTA 1ABBA 1RJGA 1NT4A 3HUFA 3IAAA 5TNXA 1P8JA 4JR0A 4YJFB 3DLBA 5BUQA 2ICAA 4YCSA 4RTQA 2IYTA 3WLKX 3TRDA 4KREA 3DL2A 2QLTA 3EC7A 3QVWA 2A33A 5JD5A 4IYRA 1MHTA 2BGKA 3PHHA 2Y77A 1IMOA 3NENA 3RVPA 2Y76A 2DHRA 1UPXA 4LXHA 4U4AA 4EI8A 2J0QA 1F3LA 1BJTA 2AJDA 4N40A 3SC4A 1CQPA 3OCVA 4RO0A 3U40A 3JQBA 2YY7A 1GL9B 1PJBA 1RP7A 1Y3HA 2BFFA 2ODNA 3L0OA 4JI4B 2OV2A 5DHTA 1XQ1A 3KQSA 3R41A 3KJIA 1XKTA 1GDDA 2QQEA 2Y1DA 5ESXA 3V4OA 4BO5A 1DLIA 2RHWA 3FGZA 5J4HA 2XXBA 1CCWA 5IRCD 1XZHA 4Y98A 4C4RA 2ODTX 3NATA 3WAJA 4MHSA 3T52A 4HN4B 3I04A 2R1ZA 1FTGA 3GCZA 1HE2A 3WMGA 3DD1A 4L72A 4CLOB 2HCFA 2OCKA 4E94A 1VP9A 4KE8A 4DZZA 1GPMA 1TQ6A 1Q6YA 1ETUA 2BGTA 1YB7A 1YD7A 1XIVA 4WECA 1FTSA 4YXWD 1T6YA 4Q3BA 5BV2P 1NT2A 1AKEA 3NEYA 5TEWA 4YP1A 4C7KA 2KX7A 3WLQA 5IWAB 1GL3A 5DI3A 2ZXFA 4LC9A 4R2IA 4PCAA 1U7WA 4WKOA 4F5ZA 3LYAA 4L9WA 1EI9A 1PR6A 4JVOA 1N7JA 2ST1A 1AZWA 1OWPA 1RYFA 2AQKA 4FFPA 1U94A 1UP6A 2I4MA 1Y7PA 3JQEA 4CTJA 3DV0A 4KQEA 1CUUA 2YFQA 1TM7E 2PCLA 1OZGA 3PC2A 3ZI7A 2GPBA 5CAEB 2A0YA 4PG8A 3CU5A 3L82B 4HYTA 1HQCA 5ALDA 1JA9A 5MF6A 5FV7A 3DF7A 2IV7A 1TMKA 4LRYA 4LJRA 2Q0HA 4C0KA 5HZKA 1PZMA 1ZA1A 4ZVLA 3NOOA 3DDSA 3NZEA 3MPUA 4NBWA 1ONBA 2APJA 4IQ8A 2WPDA 4EW6A 5BMVA 1CUBA 4L85A 3KJHA 4X7RA 5SY9A 3B1FA 4K6MA 4HX5A 5CK4A 3OI7A 1Q7TA 4GOXA 3LFTA 4L4ZA 3ZDBA 1BGXT 3ROEA 1RQ2A 2Y1KA 3DBRB 3A36A 3DTYA 1OLUA 2BE7A 2BZSA 1CDOA 2Z6QA 3ZDQA 3E9RA 4KKVA 2VDOB 2GPYA 1HMPA 3A1UA 4I9UA 3MUNA 4F21A 1CUFA 3PIDA 2JK0A 3H6KA 5EP2A 3UJCA 5FWYA 5SYAA 3RUPA 1L7MA 1PFVA 2QTAA 3PRYA 5BWCA 1F9AA 1RHUA 3L8EA 2G36A 2JIRA 4GS5A 2A4KA 2QDXA 1P9OA 2H51A 3KKLA 4WCVA 3RVBA 3L0PA 1BW9A 1AS2A 3AJRA 3A26A 5F5WA 4MS4A 2P6NA 2FEPA 1MV5A 1MZVA 2UZ1A 2DT8A 4CE6A 1B16A 1GTVA 4JP2A 1KJZA 2PHZA 1JTEA 5B2ZA 3CJRA 3R40A 1CZOA 2EKBA 2A3NA 3FI9A 1E92A 1TM1E 3ZBQA 2I7VA 3GLIA 3BB1A 4MIOA 4MRMA 5L4SA 4IMRA 1GKKA 4LPKA 3MOSA 1A9RA 1HE4A 1T0UA 4EG6A 1HM5A 3BGWA 2H9AA 2V6FA 3TO5A 1H22A 2A86A 1NSFA 1TECE 3A7EA 1WF6A 1UBJS 5HZMA 3AUUA 4GMXA 4DADA 1DVRA 1Y1LA 1QF9A 2OHHA 1XJWA 2OXIA 1JLKA 1MEEA 2HHAA 3NDBB 4JL6A 1H4VB 3THXB 3LXMA 2ZBRA 3NT2A 5JSZB 5LP6C 4LVJA 2R1TB 1E4YA 3B9RA 3LYUA 4BNWA 2B4RO 3CBGA 2KB0A 1NX6A 4DBLE 1DU4A 2QVLA 2VAWA 2WU3A 4FBMA 4LISA 4MWGA 3TSZA 3ZQKA 4L8WB 11ASA 1P1CA 2FMKA 3BPSA 3GJ6A 3NR2A 4Q12A 2WILA 5IDVA 5IVDA 4E31A 1OWOA 3ZDDA 1PR1A 3ESXA 1IXRC 2P2NA 4Z2AA 1RZRA 1UWKA 2XQKA 5ERXA 4CXMA 4CMIB 5EPEA 1R4NB 2W90A 3I37X 3GBPA 2CWDA 2CHEA 4ZEMA 3DSRA 1WB5A 2RGRA 1RCUA 2YV2A 5F35A 3I73A 4LECA 1IXKA 5EXSA 1G3QA 2QN1A 1KWKA 3DWGA 4I1PA 1D5CA 2Y66A 2IK8A 1CZKA 3VVCA 2XE7A 2HIHA 2AKAB 2GF0A 3NOQA 3Q0IA 5LDGA 1A7JA 1G291 1QZXA 3BSWA 4FNAA 3TLBA 3VU8A 1TT5A 4JI7B 1XFAA 3U7GA 2HMTA 2RBKA 2YVLA 1H8HA 4EA9A 1ZO8A 3KJFA 1H66A 2XVXA 4WUVA 1DC8A 2OYCA 1B76A 1F8FA 1FP6A 1MLDA 2CE7A 3OU7A 4LVLA 4G1MB 5HFJA 1A9TA 3RT7A 4GT1A 3WNBA 3AVUA 1J2YA 1KS9A 5BMVB 2PX8A 4P82A 1W4ZA 5DIFA 2P5IA 3P9PA 3F7MA 4JLSA 2AE2A 3DTVA 3GMSA 3QXSA 1DINA 3I4CA 3DB2A 3VGJA 5K6AA 5L7TA 5HFAA 4KHZA 4NG4A 1MA0A 4ND4A 1ZR4A 2M6LA 3B1XA 1GGMA 2A9FA 4HF7A 2CV2A 2B7LA 3MJ4A 5BSMA 2Q3LA 2X0IA 3L46A 1W4AA 4PXYA 4X6LA 4Q9DA 3G2QA 4M1KA 4PC2A 4KQFA 2X23A 4CMHA 4INOA 5T4EA 1L7EA 4R1QA 1E7SA 1Z7MA 1IPFA 1BKSB 2LRHA 2IHZA 3KPUA 2WU8A 3KOWA 4P58A 4ZDWA 5REQA 3H4MA 3RVSA 1NRWA 2NO1A 3ZY2A 2H2DA 1KIAA 1YDGA 2ENUA 3LWNA 4ZHQB 4Q1CA 2VZ9A 2I33A 5ALXA 5GV8A 1MTZA 1V11A 5E2IA 2UZ1B 4BMCA 3FTPA 1EWQA 1MB0A 1H1DA 4V3CA 3BMCB 2AQ8A 1NRXA 2WWFA 4ZMRA 1FNMA 1LN4A 4C07A 1A9OA 3N2GB 4NY1A 3U7HB 3G1UA 4NZNA 1XBTA 2EK0A 3LSTA 3IABB 4B6OA 4LF9B 1JAHA 2YN0A 5CHEA