4K86A

Crystal structure of human prolyl-trna synthetase (apo form)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
497
structure length
488
Chain Sequence
b'LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proline--tRNA ligase
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 151
structure length 488
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k86A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k86A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k86A02
1RIQA 2P0LA 2QHTA 2XTIA 5ELOA 2DTHA 4RDXA 1B76A 1IL2A 1H4VB 4P71A 3HXZA 1B7YB 4OP0A 3P8YA 4H2XA 2ODRC 1L0WA 1ATIA 2DU7A 2ZR3A 1W66A 1GGMA 4KR3A 4P71C 1JJCA 2C7IA 2E10A 2P5IA 1KOGA 2QHVA 2ZXFA 2ZCEA 4WF2A 1G5HA 4YRCA 3HY1A 2DZ9A 4YRNA 2Q7EA 4XU0A 1E22A 4H2VA 4XTUA 5K1XA 4H2XB 3QNEA 4YCVA 3DSQA 3RKWA 2AKWA 2DJZA 3QO8A 2CJAA 1JJCB 1X56A 4XU1A 2EJFA 1NJ8A 3A5ZA 4YCWA 4LNSA 2J3MA 1Z7NA 4CS2A 1BBWA 1BBUA 4P74A 2RHQA 4UP7A 1E1OA 1X55A 3HXYA 1BIAA 1NJ2A 3EFRA 2ZZGA 4UPAA 4XTWA 3A7AA 1SERA 3MF2A 3V7RA 4P3NA 4XEOA 1SRYA 4EO4A 4HWPA 1PYSA 2DDZA 2DU5A 3REUA 2AKWB 3HXUA 2EAYA 1ADJA 3HRIA 2ZNIA 4H2WA 1ADYA 1QF6A 3L1AA 2DQ0A 5C53B 3A5YA 2RHQB 2FYKA 4TVYA 3L4GA 4HWTA 2CGHA 3W3SA 3A7RA 4CS4A 1USYA 2ZT8A 3TEHA 4H2UA 4KQEA 4J15A 3RL6A 1E24A 1PYSB 2RHSB 3RF1A 4TVWA 1ASYA 2QHUA 2CJBA 2ARUA 4ZTUB 1V95A 1G51A 1HC7A 4YREA 4G85A 3L4GB 2Q5IA 2G4CA 4DPGA 5C52B 1FYFA 3P8TA 3QTCA 1WPYA 1B70A 3VBBA 3BFMA 1YFTA 2DXTA 4AH6A 4P75A 4DQ2A 1J5WA 4YRPA 2J3LA 4YRQA 1NYRA 3RKXA 2E65A 4HA8A 1EVKA 3HTZA 3ERRA 4O2DA 4P3PA 4TTVA 5ELNA 4YYEA 2E1HA 12ASA 1B70B 5HGQA 5C51B 1WU7A 3UGQA 3RUXA 3RACA 4RQFA 3BJUA 1SETA 1EVLA 2ZIMA 1WQ7A 2ZZEA 4XU2A 3EFSA 4XTYA 4CH3A 4WJ4A 4Q6GA 3FJPA 4UP8A 3E9HA 2PMEA 4YRKA 11ASA 1YFSA 3QO5A 3LC0A 3HXWA 3V7CA 3HY0A 1NJ5A 4ZIBA 2ZTGA 4P74C 3TUPA 4YROA 2EL9A 1Z7MA 3G1ZA 4HWRA 3A32A 4YCUA 1G5IA 4CH6A 3UFGA 3NENA 2DTIA 3V8JA 1SESA 1X2HA 3CMQA 4K86A 2DZCA 2ZINA 4HWSA 4NCXA 1X2GA 2Q7HA 2E64A 1QE0A 3NETA 1HXDA 2ZR2A 2ZZFA 1N9WA 3MF1A 3NELA 3UGTA 3IALA 2DKGA 4P72A 1X01A 1USYC 5F5WA 4UP9A 3R07A 4YRFA 3V7SA 2ZT5A 2AMCA 2ZIOA 3HRKA 4H2SA 4BW9A 4TQFA 2I4OA 1B8AA 4RMFA 2ZGWA 3TEHB 4XTXA 3LSSA 4P73A 2DTOA 4H2YA 1EIYA 4WI1A 3VQVA 1HTTA 3IKLA 2LW7A 4TVAA 4TWAA 1WNLA 4KR2A 3E9IA 4EX5A 1EQRA 4L87A 4XU3A 4YRJA 2AMCB 4P75C 4YRIA 3PCOA 1EFWA 2ZT6A 3I7FA 3V8LA 4X5OA 4YPFA 1ASZA 1EIYB 2DQ3A 2EJGA 2DEQA 2EWNA 3ICAA 4Q15A 3QO7A 1BIBA 4XTVA 4TVAB 3M4PA 4YRLA 3VQYA 2IY5A 4PG3A 1WLEA 3VQWA 3IKMB 4YRGA 3KFUA 3UH0A 1WYDA 1H4SA 4H02A 3WQZA 2PMFA 3REXA 3RKYA 1NNHA 2E5AA 2I4LA 1LYLA 3PCOB 4HVCA 1VQZA 3HXVA 3RGLA 4CS3A 3M4QA 3NEMA 2Q5HA 4TQDA 3TEGA 1C0AA 2IY5B 1H4TA 2I4MA 2I4NA 2Q7GA 2CJ9A 1YGBA 4CH4A 1KMNA 2ARSA 2DVEA 3A31A 2E3CA 5E3IA 4H2TA 5KNNA 4HWOA 4BWAA 3A74A 4K88A 2C8MA 1NJ6A 3IG2A 1X54A 4XEMA 1YFRA 2DXUA 1EOVA 2HNIA 3L2ZA 1NJ1A 3MEYA 4WJ3M 3HXXA 4XTZA 4K87A 2CIMA 3V8KA 3VQXA 2RHSA 3HFVA 4YDQA 3LSQA 4RQEA 4YRTA 2ZNJA 3PZCA 4YP0A 4ZTZB 5K1PA 4P3OA 1YB3A 3HFZA 2ALYA 4G84A 4CH5A 4YRRA 1H4QA 4YRSA 3RIRA 4PHCA 3OD1A 2XGTA 1WQWA 4P72C 2E41A 2ODRD 2QHSA 1B7YA 3A7UA 1KMMA 4E51A 1E1TA 1NYQA 2ARTA 4YRMA 4OLFA 3HFZB 2EJ9A 3P8VA 2ALYB 4P73C 2ZT7A
chains in the Genus database with same CATH superfamily
3ZVLA 1F06A 1OXKB 5KSYA 3UAGA 3U0BA 3ABIA 3OG9A 2F1IA 4MP3A 3Q8MA 3L9XA 1I1NA 1M6YA 3OLWA 3SY8A 3PQ4A 2PA0A 2RARA 1I2CA 1XLWA 3K1AB 1YMUA 1QNFA 4YXFA 3WBMA 3M8KA 2DUNA 2R8XA 2AX4A 3LGXA 4G1FA 4KQ6A 3QUQA 2GN4A 3NHMA 4R5HA 4J4TA 3KJNA 2PUTA 2WF5A 3TG8A 2RGWA 5I8WA 3FBTA 4O63O 3F49S 4NABA 5K3FB 5JXWA 4PZCA 3RSFA 4EA8A 2ZR3A 1PJBA 1Z25A 4C4XA 4LJSA 1FP6A 3TXAA 3TVDA 3GLFE 1AF4A 2PFSA 3BFXA 4NFHA 2CHUA 2VWGA 1IJBA 1CY6A 1M83A 5B64A 4B35A 4M0KA 4WT7A 4F3TA 1G20A 3FOCA 3FUUA 5H4GA 1A4RA 2PXHA 4NE7A 3ESQA 4JJAA 2BMDA 4Q3OA 1H2RS 2QMOA 3F96A 3C6ZA 4JEMA 2VNSA 4EYEA 2YCLA 3O4IA 3WI7A 4CKBA 4DJJA 1MX9A 3RFCA 1PHPA 3ZV6A 1OBHA 4MQLA 2E21A 2QSJA 1N1GA 4UHCA 1G21A 1NT2A 3RTCA 3TIFA 1LNQA 3AUFA 4JI3B 1DCJA 5K1XA 1GAEO 1LC0A 1NF8A 1S3SA 2C1XA 3BILA 2OXTA 2DTDA 1G5RA 3VXKA 3RRZA 4ZZ0A 2NMVA 1YNOA 4YI5A 3W7VA 4QXAA 4KQJA 4BO4A 2ZB7A 2WMDA 4DB2A 4Y2RA 5BRNA 3AEXA 3LK7A 4WWHA 3P52A 1R3UA 2AJTA 4BRWA 4ZJZA 1UJNA 1ZK2A 2J9RA 3Q40A 1X56A 2RJ3A 4XB1A 1GLGA 4W9NC 2BEVB 2YY6A 2FR8A 2JAWA 4HNAA 1GFZA 1YMQA 3ADOA 1Q92A 1U2SA 1M34E 2A58A 1JXAA 3L43A 3PWTA 4KL8S 2X5OA 4E4YA 2XJ4A 4KFUA 3KS9A 5L40A 2WHRA 3ONWA 2F7SA 2AUMA 2XRMA 1GUBA 1BNCA 1M2FA 2VH5R 2IUFA 3FLBA 3HZOA 3SG0A 1XNGA 1JS1X 2AZMA 2OQ2A 2AMFA 2H51A 2HTFA 2TS1A 3QIVA 4TYPA 4B2IA 3EFRA 3MJSA 4B5KA 2XE4A 3GLKA 2Q7XA 4N9QA 3FTEA 4MLZA 4AJ2A 3A70A 1VJRA 4M0LA 1F7UA 2VUIB 1ZKDA 1CUSA 5FBHA 1GTL1 3H16A 4KBFA 4S1TA 4WJLA 2O4UX 5BORA 2JI6A 1UF9A 3EMKA 4WUVA 5FV7A 1IIRA 2H00A 3AJAA 4YK7A 4C0XA 4DA6A 4EKYA 4KWHA 2OKCA 3L1KA 5CP8A 4KR9A 2Q4EA 4D3ZA 3LI2A 2XTAA 3HO8A 2H63A 2O2GA 3F6SA 1FYVA 2VHVA 1CRWG 2CLHB 3QFTA 1S8NA 4RA9A 2PBLA 1O08A 2J0QA 1TCUA 4HYYA 3H9BA 2ZNIA 4H2WA 2HDNB 4QEKA 3AJRA 5JRJA 3B9RA 3OQIB 2QRPA 1P44A 1FRZA 2PLFA 3RUPA 3YASA 4BQOA 4GL2A 1FQWA 3JTEA 2Q7DA 4TVYA 3B51X 1M6HA 2WKQA 4JC8A 5SICE 4UTPA 3GA0A 4FU0A 3OIUA 5FR2A 1TM2A 3LUAA 3E84A 1KY2A 4PZ0A 5FTNA 1EHYA 4TS3A 2ST1A 5ETJA 4LVMA 5GP1A 3WSWA 1ZL0A 4Q3CA 3GNLA 2DYKA 4RHUA 3RGWS 3D4OA 2IKQA 3B7GA 3ILVA 3NJRA 4I9FA 4R9VA 1RTKA 4DEVA 2XOXA 4J15A 1KJZA 2DPHA 2VAPA 1YE5A 1A27A 5AP9A 3GT3A 4JC5A 3RVLA 2C5FA 3HO1A 5AJZA 2EL7A 5LBTA 3TM5A 2OBYA 1NFFA 3KKPA 1MAHA 1XCPA 4H9GA 2G72A 1W59A 2CJBA 2FG6C 2G76A 3ZS9A 2HR1A 1Z0IA 2WIDA 3QMVA 4OU4A 5F52A 3SE0A 1XWFA 2QEQA 1LVHA 1GV0A 1I5OA 3E3LA 2AQKA 4DMLA 5JAZA 1SKYE 3ESXA 3IPCA 2QTRA 4AN4A 4CN8A 1EFVB 4PZPA 1RQPA 3ZZTA 1GILA 1HNWB 2WG1A 3KAJA 4YRZA 4YREA 4HVAA 3PP8A 1WVIA 2SICE 1I80A 1BXGA 2ZE7A 2QTNA 3IEVA 4IH4A 4FHDA 4RVGA 4QHTA 4WFKA 4CIBA 2FDXA 4FFOA 5LNK6 3A4LA 1QOPB 4Q3BA 4RGVA 4C3VA 4QQ8A 1Z38A 2FXVA 5FYQA 4BLUA 3PNYA 1UPTA 2DT5A 3FETA 4PO9A 2AQIA 2X7XA 2Q3FA 2WFAA 4JC0A 4R8RA 4RW0A 1XPOA 3VBBA 1WMFA 1FU7A 2BV3A 1TIKA 2R6R1 2SCUA 1XSEA 3AIIA 3E82A 1E3SA 3OMLA 1XVLA 2XXBA 4MV5A 2IZ5A 3HXLA 1H9AA 4L95C 4KPUB 1GRQA 4OK5A 1ZJ4A 1FDSA 1NI5A 3TTTA 4ZGGA 4YRPA 2XCSB 2FPWA 2ZYDA 4G0OA 4JYZA 1FCJA 2F3TA 3P2OA 1X7YA 5AW7A 5TT0A 3FVQA 3RR2A 4L5JA 1GNQA 3P9XA 4KTVE 2Q4BA 1RHRA 2HNBA 3MB5A 2WV7A 3CEJA 3SAJA 5KJ6A 5BSGA 2JBHA 1XKXA 6ABPA 2KB0A 4FQ8A 4AK9A 5BVHA 2Q3MA 2C9OA 3BVPA 3R77A 2RSLA 1CIVA 2XIJA 3TX6A 2QZSA 4EY6A 3WBKA 4FYIA 1U80A 3Q10A 3PDWA 4NBWA 1JR3A 3NJ4A 4WXMA 3TLBA 3WWOA 2DWUA 4B47A 4D80A 2IE0A 1AS2A 5K8LA 1RZRD 2GA9A 4DT1A 3QE9Y 2QAGA 5JHGB 3MGKA 2XE7A 3GI1A 3M33A 3DCIA 1IQPA 4LNUA 1P3DA 1RPNA 2VXCA 3LPMA 4QYMA 4E70A 1F51E 4ZAWA 3UGQA 1KTIA 2GDZA 2YXLA 3RUXA 1G6KA 3JWPA 3CNNA 4XUEA 5CT4A 3TQIA 2P9FA 4CJXA 1B6SA 4PAQA 1QYRA 2GA8A 3T1OA 3TIIA 3KO8A 1PJ4A 1E2JA 1TLLA 4J07A 2O2IA 3M81A 3LPLA 1BDIA 4Y2YA 5EKTA 3DLBA 1F8YA 4E13A 4E88A 2DY0A 3AFMA 4UC0A 5IZ4A 3C2QA 4XU2A 1WHSA 4F2WA 2JCVA 5JJLA 5HF5A 1UJ5A 2YJ3A 1IG0A 2YTZA 1E69A 2EK0A 2YL2A 3N2KA 3DSCA 1EINA 4JI6B 4XXHA 2YX1A 3ZE7A 5CIWA 4EUSA 2OSVA 1JL3A 5ERGB 1NE2A 1TB4A 5KS2A 4P98A 1HNNA 1VXRA 4EG4A 4GS5A 4HYQA 1G8PA 4J94A 4M0CA 3S81A 4HQOA 5E1BA 3MJFA 1B1CA 1G16A 3NYQA 4N5NA 3QO5A 3MBKA 4GLLA 2O48X 3VTIA 4TYWA 2TECE 1JHPA 3AF1A 2JLWA 3UCEA 3PQ8A 5EQDA 1ENZA 2OMEA 1DJMA 5IJXA 3GELA 1YB5A 5DXFA 2G17A 1RRFA 1QRAA 3K96A 2XHZA 3O90A 5JCJD 1EQAA 5FFMA 3OIFA 1EGAA 2FA9A 5CYGA 3U40A 5KI6A 4YCUA 3IP9A 2VQDA 1NBMA 3MUEA 4MUIA 1MT3A 1VYHA 2R6JA 3AKEA 4HDQB 3RC9A 2J0SA 4P93A 1DLJA 2DPGA 4PIVA 1UEXC 1PJRA 1BXKA 2J7KA 4K86A 5K6RA 1NPTO 2BMVA 1DPGA 4GPIB 1A7JA 1P31A 3EXG1 5AOAA 1TDJA 4EB0A 4LF8B 3A4YA 4OKIA 4RDCA 5TE9A 5L45A 2Q8QA 1XXHE 1KAOA 1DBSA 1T24A 1VLHA 1OQAA 3JWHA 3LLMA 3LPCA 1U3FA 5AXBA 1DBPA 1GTZA 3RV3A 3TVYA 3ZBQA 2PMCA 3E9MA 1ZI8A 1RVDA 1U3DA 1TQ2A 3SOPA 2QM7A 4J90A 2UAGA 3OTIA 2EGGA 4XIYA 5K20A 3JD4A 2PGLA 2ZZFA 1BIFA 2LVBA 4GX2A 1NQWA 3I62A 3OEWA 4ND2A 1C4OA 3TBFA 1Y6ZA 5IEBA 1SM4A 4KWTA 1NONA 3DVRX 4KQWA 1N2ZA 5K3AA 1OOEA 3R0XA 2CXUA 4C3ZA 1A69A 1DARA 4AMZA 1C2TA 1ZO8A 4XQ0A 2DGDA 3DV9A 1UT6A 3ORFA 1X01A 1USWA 2JAPA 2XKAA 3LUHA 4ENQA 3EFEA 5BQOA 4UXJA 3K16A 1PEDA 4XGNA 1KVQA 1NUTA 2XV1A 3EZGA 3MTJA 1T36B 4BIIA 3OE7D 2PUFA 5EA2A 2VP0A 1USGA 5LFAA 1FVHA 1W4AA 1WUHS 1DEHA 3WO0A 2Y1EA 2X2EA 5TVKA 5BPFA 3WGQA 4B3DA 2PUGA 4KXXA 4TMWA 3TDMA 2R2GA 4FR2A 4AY3A 3AF3A 5TMEA 3BTVA 4YH1A 3OIDA 3GZ4A 1KTVA 3D5EA 3VV2A 3IJ5A 4ZHQB 2ZGWA 3ITEA 3QF4A 2O05A 4AWXA 5FPKA 1VM0A 1DV1A 1OC2A 1NXPA 3PJGA 3O38A 1ZJZA 4IIVA 1D7OA 3QHQA 4RPIA 1FOEB 1K8YB 3QWHA 4UUMA 3H42B 3VR0A 1PT7A 3H7IA 4HDRB 1E3WB 2CC2A 4FN4A 5K3FA 4AMBA 3AM1A 3HR7A 4KOEC 2VZ9A 4J03A 1PLKA 1OREA 2OCIA 2XEXA 3DM5A 4XWTA 1I0ZA 5FOXA 3QLEA 3ZC3A 4A5SA 4LDZA 4CKEB 4KXNA 4H6PA 4DLZA 3HK2A 1N6HA 4HD8A 4AKEA 4LSZA 1G20E 3WB9A 1JEDA 2VQFB 3G1UA 1AQUA 1JDPA 1AY0A 2BCEA 3C3XA 2R7AA 3P19A 2SKDA 3ZNPA 2FW6A 1Z35A 1GGJA 3U1BA 4KLNA 1C1XB 4LNAA 3OH8A 3PCOA 1GCGA 1NDQA 1LH0A 4MUHA 1B74A 3M6MD 4LVLA 4BU0A 1NF2A 1HLGA 2AA3A 5CDSA 3L04A 4G65A 4F93B 2QPAA 2UV8A 3Q0IA 1TK2A 4HNGA 1YQ9A 2EJGA 3H18A 1CT9A 1XK6A 4LRWA 4B3JA 5DI3B 1XHLA 1GTG1 1LTHR 4W5JA 5LKAA 3U4QB 2Q50A 4OIFA 4LJRA 4YT8A 1XNHA 3RRXA 4JZYA 1RI5A 1FW6A 4ZMBA 3D6FA 5FOUA 3M5DA 1ISJA 3MMSA 1J39A 1ULHA 1LA2A 2BP7A 3DTNA 4UU0A 1OIWA 2UUPA 2I3DA 2XYRA 4I1YA 4JIGA 2Q9CA 3VSCA 1C81A 3P8ZA 1D4OA 2BEUA 3ZI7A 5BPHA 621PA 3WWCA 3FTDA 1WXWA 3K72B 1E1CA 1X15A 1JRLA 2IHBA 4QTUB 1LYLA 1YZKA 3CZ4A 3LJKA 4ROSA 4X93A 3S5UA 1YFJA 1M33A 1BH2A 2FDRA 2P30A 3NUZA 3QKSB 4UVHA 4RFLA 2IWRA 4G5XA 3WB0A 3JQGB 4KRYA 5HK9A 3GLRA 1YTUA 1VMIA 1D2GA 2HA2A 3H0KA 1RFLA 4G1VA 1K3UB 3DHNA 4IGIA 4N47A 4DQ0A 5I7EA 1WXFA 1X1CA 3FZGA 5FEUA 4JEIA 1N3LA 4PO8A 5J23A 2R60A 3OWXA 2NU9A 4AMVA 2QL7A 2PS9A 1CNEA 3DF9A 3PX3A 2I4NA 2F3QA 1RLTA 2HIAA 2OVBA 2QTMA 3CSDA 4OJTA 4OH7A 3L0CA 3ZLUA 1VKZA 4JI8B 1TEHA 3L79A 1I6KA 2MINB 3ISVA 2WTUA 2PGXA 2ARSA 3ORHA 5IAKA 4RTKA 2YIJA 3DM9B 3P0HA 3D1LA 5E3IA 3WWDA 1M10A 4MR7A 1VL2A 3OPXA 1AG9A 5F7JA 1N4AA 4RBNA 3S0JA 3WNCA 5A5EA 1LPSA 1RLIA 3QBDA 4MXDA 1F14A 4OJNA 1EA5A 1AHNA 3T7RA 3X2FA 1VOTA 4D9CA 1QTIA 5FLKA 1CKEA 1EDZA 4JR2A 4MR8A 1E1NA 1L5HB 3D4LA 3V2HA 1W85B 4C3OB 1RAEA 2VUTA 5GONF 1YQUA 1T0IA 4FYHA 1EFTA 3B85A 4Q0MA 4Z7QB 2R84A 2NTYC 3KX2A 1WR8A 3PPVA 4J9UE 1U2TA 2FGJA 1CUXA 5F35A 2HHCA 3T7AA 3TGLA 4AKIA 1BHO1 3KUCA 3G59A 3A27A 1X86B 4XGIA 1QVWA 3N5CA 4WERA 2Z8XA 5IHPA 5JVDB 2G28A 4PN7A 4XJSA 4PGGA 2G4VA 2Y1LA 2A59A 4B2PA 4EO7A 4ZREA 4Z4IA 1Q0UA 1WW2A 2D0DA 1M6VA 4KB5A 3BWBA 5EWJB 1JQAA 3FOAA 2E4XA 1X1QA 3SIRA 4RJKA 1FFEA 1MEJA 4IHKA 4FSXA 4QBGB 1EWVA 1H2YA 4LX8A 3F4LA 4YRRA 1RCUA 1XVIA 5G41A 1JMVA 4NFSA 3N0XA 4NPCA 4FK8A 2REQB 1DC5A 3OE1A 3L18A 5J2UF 4L8GA 1ZBQA 4FOTA 5EZYF 3S1AA 3K6RA 4Q1EA 5ICSA 1HEIA 3ZIIA 2OZPA 5BRAA 3T99A 3AJEA 2I2CA 3ZE6A 3BICA 3WIUA 3CR3C 2QHSA 2X2FA 1D2NA 3WNBA 4IHQA 4F11A 5FB3A 2QNBA 5DGTA 2HSJA 1DLIA 3D4PA 3D7NA 2UUCB 3QKTA 3RV4A 5JH7B 4ZQGA 1UUFA 4LWQA 1MPTA 2ZWVA 5HS4A 2IOYA 2C83A 3S7ZA 1UKAA 3DC2A 1N92A 3PC6A 1KI6B 1FDTA 5KWIA 2P5SA 2X13A 5DLDA 2I9PA 4C4AA 2AKYA 5CCEA 4TTJA 2Z2ZA 3OCXA 4KIUA 5F3WB 1A8PA 2NZ2A 1L7PA 2WJPA 4V2IA 1M0TA 1DB3A 4L9SA 3T0GA 1XCMA 1XRLA 2XHEA 4JXKA 5IDWA 1RIQA 1LY1A 2W4IA 3PLNA 1LZLA 3O6VA 3R8FA 4GOKA 1FFGA 2RH8A 3AI3A 2DTHA 3DOOA 4MMYB 3VPXA 4HNHA 2QM0A 4H4CA 1HE8B 2IU6A 2RB5A 3ZY5A 3U26A 1LK5A 1Y1LA 3TMAA 3VR2A 3BB3A 3NHPA 1L4UA 2O0KA 4WZAB 3TSOA 2JLUA 1K6XA 2XBUA 1SD5A 3IP6A 2RJOA 1WB4A 1RIFA 1Z26A 2WDPA 2XXJA 5GM2A 2WTAA 3HBAA 3EXEB 4KN6A 3KBBA 3UJ7A 1FSFA 3H11B 4UZFA 4GMKA 4O4HB 2V6GA 4Q9NA 1OI4A 1STOA 2G07A 1Z5OA 4WDRA 3THYA 1UK7A 1AUXA 1IN8A 2HLPA 1EUCA 3SPXA 4BLVA 2CNBA 4NXMB 2HO5A 3PJFA 4DNFA 1CZKA 1P73A 1YJXA 3L2OB 3GJ4A 1M1YB 3PRHA 4L5BA 5F3RA 3SLGA 3STYA 4ZFNA 4CIYA 3G23A 3A3OA 2ZRLA 3PHBE 5LA6F 3VSBA 4Q7LA 2YMQA 3T9DA 4KPEC 2PL9A 1PSDA 4BWFB 1LS1A 1SH7A 4WLVA 4BNHA 4ESHA 3O8QA 4X1KB 5DHRA 2IEYA 2PN1A 2HA7A 5DZSA 3GEBA 4BBJA 1ZPDA 3HRHA 2ZITA 3KJHA 1O6CA 2JAOA 2IHKA 1CJMA 3MJEA 4H3KB 4D7AA 2OMKA 5F77A 3W6PA 2AJDA 3WB1A 3ZU4A 5JASA 4Q02A 4XD7D 3GJ0A 5ECDA 1GN9A 2IHZA 3HLKA 4LJAA 4YAGA 4BMSA 1PUIA 1WD7A 5DF1A 3DOEA 1NV8A 4AS1A 2X5JO 5IUJC 4IHJA 1H8HD 1XCGB 4MOWA 5IBRA 3SIWA 4DSNA 3BCSA 1CDDA 3EODA 2DB3A 1WQ3A 1SUBA 4F9TA 4DV3B 3FAZA 1MOQA 3WG9A 2VRCA 1EDBA 1KO7A 3BGOS 2XYVA 3EGIA 4IV5A 2ZROA 1YZVA 1FSZA 1YQDA 5KMGA 4OOEA 4EHNA 1M7HA 5JOQA 4WVLA 1FU4A 3RBXA 1EX7A 5JC8A 3MZ0A 1GXSA 2AVDA 3E61A 2COKA 3IUNA 4NECA 4PG4A 4UVGA 3VR4A 1UPAA 2GVDC 2Q6LA 4MW4A 1THZA 4Y9TA 1ULSA 4KLRA 2NGRA 2GZSA 2HF8A 1Z06A 4K9LA 2L17A 4E09A 2HY7A 1QV9A 2REXB 4NPAA 3NIBA 3FLAA 1JAHA 4XGRA 2QNIA 1DRVA 1GNSA 1UMDB 4HSGA 4NFYA 4D99A 4Y0AA 2DMRA 1RKXA 3L8GA 3UJNA 5C7IO 4QVIA 2DCMA 4C78A 4DDKA 1A72A 3O9ZA 4LY3A 5TEWA 3QVXA 3K70D 2PLRA 2ZSAA 4BY9E 3RWBA 1C7ZA 4G0UA 2GFHA 1Y3IA 4V0NA 5LQAA 3ABQB 5JTTA 2P90A 3NM4A 5EOVA 3WL6A 4RWEA 2P0YA 1ADJA 1C7QA 5JNTA 1FQJA 3QRWA 3FCAA 4HTFA 2D7DA 3ZJTA 2YXBA 1EPUA 3DFUA 4KOAA 4WN9A 3I1IA 1L8AA 3ILYA 3NCHA 3VTZA 1OZ0A 4WKCA 1KJQA 1M74A 3QU9A 3R3YA 3K32A 3HADA 1HE1C 1LPNA 3MMXA 1L4MA 4TWJA 3RANA 1TADA 2CGHA 2J33A 1C9KA 1UJ2A 4IWYA 2WILA 5AR1A 3U2QA 4GICA 3F3SA 3I1JA 3A10A 4ZHQA 3DAFA 3MWGA 2B1JA 4NU6A 1HDOA 2Z9BA 3ILHA 1OU4A 2PU7A 2OT3B 1PVVA 3ST7A 1KIFA 4F2DA 2O52A 1QNLA 5D3MA 1D8TA 4HDRA 2BEWA 1E3WA 2HSGA 2VQ3A 1HY3A 1CUAA 2OFPA 4DNQA 5L95A 3MSXA 3R4CA 4WOCA 1YULA 2BM0A 1F60A 1WOMA 1F2TB 2O0JA 5LBUA 4LFBB 1PTJA 1QHYA 2CXPA 4KW7A 3OEHD 2BF4A 2FQYA 3EIQA 3IXQA 3CSSA 2IIVA 4IEFB 4J2TA 5LBIA 3ZCSA 4QOEA 2H0RA 3D7LA 2VHQA 3RK4A 2Y6VA 4Q47A 1ZD8A 4X1IA 2CNLA 3M2PA 4YDRA 3EVGA 4FWTA 4GRAA 4RIGA 3CLUD 5FUQA 1G0OA 4IJUA 4ICIA 3SHWA 1QBKC 1H3NA 3NOXA 5LMZA 4JXZA 2ZSKA 1U1DA 3LLCA 2VCHA 4CM9A 4LS3A 5JJIA 2R1UA 1T5HX 2HHJA 2ZI4A 2ZYIA 1Y4ZA 4WCDA 4TKMA 3TWOA 1V3VA 3WKDA 4E03A 4YR9A 1T4CB 1BN7A 2DKOA 2WNIA 2AG1A 2CLSA 2XGGA 2ZJBA 3AVVA 1NH9A 1VQ1A 2V7QD 4EB6A 1Y3DE 2Y71A 3L4EA 1YI0A 2PRZA 4LIPD 5DULA 1OFTA 2B1GA 2H16A 2YHBA 4G1CA 5BT8A 3OY7A 3RKXA 1UWCA 4FZ3A 3KJZA 4G36A 4ZXFA 4K7JA 1DZIA 1X7WB 3HGMA 4H0FA 4JROA 1XYYA 3SZRA 3GPCA 1KJNA 3IELA 4QRHA 3Q1LA 1L5KA 4LOKA 2FJ0A 4FE7A 3E0QA 3E9ZA 3EPHA 1YOVA 1HDXA 4D9FA 1MU0A 4RK1A 3ZXXA 4RTSA 4XVHA 3SMVA 5ALFA 1ZSNA 2UUBB 4IRXA 5ELNA 3B48A 1UDVA 4Y1GA 4HY3A 3BM5A 4LK3A 4X6LA 4R84A 2VZLA 3T0FA 1L5GB 3NHAA 5ICGA 1G2QA 1QCCA 3D3KA 4EZEA 3R0ZA 3V8QA 5JAIA 5IM4A 1WU7A 3E22B 1N78A 2R1VB 1NR5A 3LP6A 3MYRA 3ZWOA 5L7WA 1RS0A 2UZ1A 4QNMA 3I12A 3B60A 4H3HB 5A04A 1NZFA 4BZWA 1DAMA 1JAYA 2JAUA 3KHSA 1VECA 1UM9A 1WZ2A 4NBSA 4JJGA 3ZY4A 3ROMA 1XIVA 5H81A 3ASVA 2X0NA 3NALA 3Q9LA 3F73A 1UK9A 3PEWA 1VRVA 2MINA 1GQRA 2FU5C 3C6KA 2QJTA 4L7QA 4N9WA 1P80A 3KYDB 1NW3A 1N8KA 2X6QA 1OR8A 2ZB3A 3OC0A 1M8FA 2OHXA 1C1HA 4GL4A 4XCVA 3FGNA 4MGZR 2PKEA 2YDXA 4MMZB 4DKXA 4RZ2A 2J09A 1ZIXA 4DLNA 4AP9A 4CEIA 4HN2A 2KE5A 1B6TA 1HFJA 2RGEA 1W85A 2JLCA 4NZYA 1JWBB 1ZOOA 3WRYC 5L6MB 1S3FA 3K9QO 1WPRA 4OSPA 3P9NA 1GUAA 1MB9A 3W0LB 4ZHQF 3KPUA 1GPWB 3GAZA 4G4SO 1DQRA 2V1UA 2VSNA 1H2EA 5GM1A 1MBZA 2F62A 4FWIB 4HMOA 3H9JA 4D8YA 4JD5A 2PKYX 2QPLA 4UFNA 3DVAA 4M0FA 4QXQA 5K45A 4EYOA 3ZIAA 5EUBA 5BW6B 4ZIBA 4KE6A 3K1YA 3TFOA 1QR2A 3NAZA 2Q62A 4TYQA 2UXDB 5TGDA 2YZ7A 2E89A 5IYZF 1OHHD 2G06A 2XUAA 1D2MA 3JAWA 1LLUA 4HP8A 4KWCA 2E87A 1OX4A 1VDMA 2YOFA 3GFVA 3QIAA 2FUG1 1W4ZA 2BFFB 1P29A 4K6KA 5BSKA 1K7EB 1G8HA 1YHYA 2LD4A 2D5AA 3STHA 3DBIA 5EXDA 5JS8A 2H1CA 2HMVA 2PUVA 1UL1X 4RLQA 1N2OA 1JP7A 1TTPB 3CMQA 3L1JA 4CCSA 3K4PA 3AM3A 4D9IA 3G9TA 3IDQA 3ILXA 4OX9B 2UVPB 4QBFA 4FJ2A 5AW8A 3LYHA 2E64A 2NO1A 4X45A 5B1YA 1R6AA 3A4IA 4IQ4A 1DAGA 4ZVRA 1QE0A 5TPZA 4XASA 5K8VA 5DBFA 1O96B 3IOEA 4NNPA 3LUBA 1A5SB 3QXHA 3WDLA 2A8EA 3DLAA 4OQXA 3LRTA 4UHHA 2A5GA 5CM8B 4BX2A 3LA6A 1E3TA 4RVDA 4UXHA 3VUEA 3EA4A 3F9CA 3GZNB 3FJOA 2AF3C 2FN8A 1EFPB 2GCEA 3HCPA 2VF5X 1PN3A 3E9YA 2CWWA 3UGTA 3JTMA 2WKPA 4FC6A 4GOLD 3Q8XB 2V4ZA 4HQKA 3AKDA 2VJKA 2QMHA 3GBSA 1U1CA 3DP9A 2KS6A 2OENG 2J5XA 4HLNA 3AUJB 1J8MF 5CM9C 4RPJA 2B2XA 4R8SA 4ER6A 1HDRA 4ZKEA 1TVEA 3A05A 3IAAA 3UUFA 1MC4A 4CG1A 1VP9A 4KC0A 1C8VB 4QQKA 4ONEA 3ZHOA 3H1PA 3IEXA 4JX8A 2O54A 4KMOA 1R12A 2O57A 3ULKA 2BJVA 2R8BA 4AJ9A 3WBBA 1J07A 3NO4A 2B8NA 1SCJA 1J4AA 1YDEA 2PUWA 5CDUA 1R00A 2M98A 1GG2A 2PGOA 1QC5A 1E1QA 2HPVA 1IOLA 3NBAA 3OCZA 5CIQA 4BGUA 4BO2A 3RUEA 3VQVA 1EJ0A 3RC3A 1GNRA 2LW7A 4HX9A 5DSTA 1YB6A 3E27A 3U4GA 2H2DA 3HDHA 1ZL2A 3LHFA 5CPFA 5TS2A 3CWZA 1ODSA 4ZCPA 2OCPA 2FNAA 2FX2A 2ETXA 3ZIEA 4Y2PA 1SVWA 2EW1A 2ZRFA 2VJBA 1SXQA 1L7BA 2PJRA 4L28A 2GM9A 2GZDA 1CX9B 2BFPA 1I4TD 4E30A 6Q21A 4CT5A 4FCWA 4M98A 5CLJA 3CPEA 2Q6OA 1IRIA 3EIOA 4NMLA 3VNBA 4UM5A 2PZEA 4DIOA 1H2BA 4I3HA 7ADHA 4H7EA 1IM2A 2JI4A 3I04A 4Y1RB 2XAAA 3W5SA 5L8VA 1EFDN 3B82A 1J2JA 3TB6A 1HLPA 4B7UA 5K4GA 3G5MA 4X5OA 3JSAA 4ZMSA 3FGPA 2POCA 5IZCC 4G5HA 4DRXB 3ESYA 1XZEA 5B58T 5AKHA 2KBFA 3QKIA 4YRBA 2PWZA 5F1PA 1EK0A 2O7VA 4TM8A 2PZ8A 3QA3E 2I8AA 3GJSA 2C7OA 1G59A 1Y1QA 2I3GA 2CXRA 3TW8B 5J4KA 3W5DA 1XEAA 3PFGA 3OZEA 5D5PA 3I01A 2Y93A 3UWPA 2HRRA 3AKYA 4G1BA 3HA2A 4Q9LA 4ZU6X 2GN1A 2PQMA 3RIXA 4RHFA 2EIXA 3CF2A 2YJNA 4S1VA 4X9XA 5AM4A 2O3UA 1RE0A 3BGVA 2XUJA 1M2NA 1L8QA 3ODPA 4J0IA 3W3AA 1T1GA 1KFBB 1MB2A 2OM2A 2BE9A 2XVZA 4MRMB 1SNYA 5HDBB 1YKSA 1W5AA 3L49A 3RYHA 4GI1A 3EARA 2IYAA 5ILOA 4MSUA 4NK5A 1WSDA 2HV9A 3P9YA 1IATA 3FUCA 3PZRA 2DFKB 4UBKA 2ZUTA 4Q7EA 1QPZA 1JU9A 4GC9A 2Y4NA 2ZYVX 1N75A 1K6EA 2P67A 3D3NA 4U2DA 5FWAA 1G3UA 4LY0A 2V7XA 2BTQB 4QUEA 1LLDA 3WLLA 4DQKA 1WDMA 1AXEA 1AXGA 4HDNB 1RQNA 4W7SA 1RXIA 2DPMA 3S8MA 1XKQA 3IHKA 3W06A 5LB4A 3DT8A 1EEXB 2CZCA 2CXOA 1U2QA 2Q0HA 2VPPA 1Q1EA 1YDHA 1MA0A 4MUBA 5ABPA 3K94A 3R5KA 4IOMA 3OJCA 2NZJA 1E9CA 4MRAA 5CBPB 2BUAA 2CJYA 2WAAA 5T3YA 3TQHA 3ZGZA 1M5TA 3FHTA 3UHPA 1E7WA 3KL4A 1YFRA 1D3AA 4EO0A 3HU5A 4Q4DA 2CFSA 2IUTA 3SC4A 3DUFB 2P8SA 2VK4A 4Q3EA 5FP0A 1WSWA 1C8BA 3OLYA 4BNMA 4BVFA 4R40A 2Y77A 4U9HS 3RU3A 4G4GA 4NZNA 2NUBA 3L7BA 3CBGA 1DHRA 4AFNA 3VFDA 3DMHA 4BNNA 2TMGA 3NVKI 3GV0A 3IEKA 2EFJA 2YUIA 4IDNA 1O89A 3RUHA 2BL4A 1PSZA 2E18A 1Y3AA 3JALB 4GC5A 5DEIA 3DE4X 4CMEA 4H1UA 1MJHA 5SY9A 3LUFA 4W1RA 1Y9JA 2WG2A 5TR9A 1IXYA 1BWRA 1F2TA 2FPLA 4IGKA 4TKUA 5T4EA 3L01A 4HPXB 2W70A 3UIEA 4OHBA 4RXTA 5JATA 3A6EA 5IKPA 3O31A 3QVSA 3P26A 4TLAA 1JHYA 2JPDA 1BA2A 2GK3A 3TZLA 3OPYB 2GNAA 3KD2A 3I3SR 3PDJA 4G26A 1II0A 1N8SA 4OQFA 4P53A 4YDSA 1EX9A 4QBHA 3UA4A 2JIPA 3RH0A 2PKCA 4EY7A 4WJKB 3CRMA 2YWDA 4J0JA 1VHDA 3GLUA 4NV0A 1ZD4A 3VHLB 1ZUD1 3P96A 1Q0QA 4R2XA 2P65A 4C03A 1Z0KA 5CVDA 2P9EA 4MEJA 4CLRA 4K1LA 2ODRD 4DDVA 1MIHA 1Y33E 4OMUA 4QNNA 4EVSA 2CJWB 1JBEA 3GLIE 1DBVO 3UKDA 3J81A 3CUEF 3PFFA 1KMMA 1XDSA 2DZDA 3CZ5A 4L22A 1XDDA 5HA5A 4DRYA 5KVAA 1H2FA 1J2YA 1HE2A 1N5OX 1Z8DA 3BGIA 5BVGB 3DLTA 5KQLA 3CFYA 3H7AA 5DYTA 5JPDA 4KQCA 1XU4A 3CLSC 1VLLA 3HBLA 4JLPA 3TR5A 4EGCB 1QFZA 3IH5A 5HKKD 4RY2A 1G66A 1X1SA 3X1JA 3IAS6 3FKJA 1KQOA 3CW2A 4ILEA 3SHTA 5HVNA 3BX1A 3D4BA 3WGVA 1K2VN 4M21A 2XCQA 5JBIA 3GLGB 2OL4A 4Y2HA 3AQIA 3COPA 4C01A 2QG9A 4E5DA 5L4LA 5IJ9A 1Q5PA 2PMBA 3O95A 3NWJA 3QKWA 4NCBA 4CCWA 1UDAA 2C9BA 2HK7A 4M86A 5DCWA 3VR1A 3JRXA 2PL5A 3EBPA 3H5RA 3P2KA 4ARZA 2EJBA 1THTA 4I5FA 3RODA 5AVQA 2V6MA 3IPYA 1ZXLA 3AF5A 4R51A 1ZZEA 1XWIA 1MOSA 3L02A 4M60A 4EJFA 3DKVA 3RO7A 2JIRA 1PGPA 4N3NA 1EUYA 1ZCZA 3IBFA 2VHTA 3K5IA 1U8CB 2X5XA 3RDPA 3ZWWA 4ENUA 3N39C 1I2BA 2I54A 1YDMA 1LSUA 3KL2A 3ER9A 5FR1A 1BEZA 2OZVA 3KR9A 4X95A 3HR4A 4GBGA 4DBZA 1HSZA 3HDVA 4QQFA 3B3QA 2C59A 2K7ZA 2IP4A 3NNDA 3FMIA 4MVJF 5F2KA 1VA4A 2X5KO 2ACKA 3C8DA 5BN5A 4BUJA 3WRXC 3EE6A 2WF7A 5J1TB 3UW3A 1ZUNB 1PVDA 2OO5A 5KTNA 3RYFA 3NTQA 3HJFA 2WUVA 2WU1A 2FLVA 3V2UA 2AN4A 4C0QC 4ZOAA 1JHXA 2EEZA 4ON9A 1V9LA 1M6WA 5IC4A 3N76A 1ZICA 4Q9DA 3SEAA 1MJGA 3AEKB 2AC4A 2VAXA 1U9IC 3R3XA 1Z4IA 4CI9A 2A7XA 3IP8A 4H2XB 1A9SA 4HGQA 3JZDA 3TNDA 3VDMA 1NVUQ 3THXB 2IRWA 2WJGA 2WHQA 3VKVA 1Q44A 4EY5A 1EWQA 3ZWAA 1M67A 2E85A 2C7QA 4M7OA 2BZSA 2W2LA 3H5IA 5G40A 3DE2X 1IUOA 1JSCA 2Z2XA 1P3JA 2YVUA 4FFLA 4IIGA 3WOVA 4C5AA 3N2YA 4CR7A 4FM9A 5KO2A 1PJ2A 4YQEA 5BWCA 3VVCA 5CAEA 1VIYA 3SEQA 4TUYB 4AY5A 4OGGA 3TFWA 4DGQA 1QCZA 4R2MA 1QB8A 1DXHA 2YFKA 1Y9DA 3QFHA 1Y6JA 4UBJA 3OUTA 3J80A 4KQFA 1NIPA 2WAMA 4V0ME 5H68A 1A0OA 4UCQA 2X9VA 2YC4C 3GT7A 3L8CA 1FXWA 2HJHA 2HRDA 3ZNQA 2FRDA 1SGWA 4ISBA 3EXIB 4PCVA 4GT1A 1T6ZA 4P3NA 1L9XA 3CPJB 1QLHA 1UADA 2BFEB 1SRYA 1PWHA 3NOQA 5AKIA 1XPJA 4TKVA 2DQSA 1N3BA 2PWBA 4XUGB 3LK6A 3EVNA 1EFPA 5K3CA 1KDOA 1DVRA 2AKWB 1ECGA 1XD2B 4M6WA 4XKJA 4LRUA 1DFGA 3BSFA 3P0EA 2EAYA 1QV6A 1VZ2A 2ZREA 5COAA 4AC9A 2Q5QA 3RC8A 3G1TA 2AWNA 2XXAB 2ZTVA 4FIDA 4PBSA 3OZVA 3UMVA 5B3KA 3KYCB 3HRIA 3TQCA 1RLOA 3IJPA 4C2UA 1C50A 1UBTS 4P3YA 3GFOA 4FQ5A 3AILA 1XN1A 2A9PA 2ODQA 3M1IA 3WV4A 2L0XA 4HVZA 5JFGA 4DR4B 2XQKA 1MC1A 1NBIA 2FPIB 3K5PA 3Q4GA 1ENYA 4PLHA 2C54A 3DOHA 2XUKA 2RCYA 2VHEA 3A28A 2MMCA 3KBOA 4BECA 1IOVA 2ZU6A 4GRIA 4I14A 3ZG6A 5AVUA 3RIHA 4TROA 1K66A 1XQ6A 1ABEA 4N39A 3GEGA 4BNUA 3NPAA 2Z6UA 2GHRA 3MUNA 3RF1A 3P9ZA 4U0JA 4G41A 1D9XA 3R0VA 1R0YA 2ID9A 2IV2X 3A9SA 1JJIA 3QEBZ 4QX6A 5BYJA 4JKOA 3F5MA 5F76A 1HDZA 1QS0B 3AETA 3C5CA 1Y81A 2L19A 2B69A 5KYXB 3KU4A 5INTA 4C87A 2ORWA 1NRIA 5FNVF 4JJ7A 3DTVB 3B1ZA 5E9JA 1GHTA 4OTZA 1DUVG 3ZE8A 1PAUA 5THKA 3RVMA 1MG0A 3BSSA 4MUFA 5AMXA 3X1WA 5BSEA 4LF6B 3PS9A 3EQ9A 5C37A 2VK1A 1FUUA 1SBHA 4P08A 2JC3A 3T7DA 4GE0A 2GCOB 5A7HA 4ZGWA 4C76A 2WP0A 3P8TA 3ONNA 3OPMA 5KYVA 4N3AA 5E9AA 5A7FA 2GO1A 1QRDA 3HH8A 3QENA 3QFCA 3VYSB 3L4KA 1HORA 1ORVA 3DNMA 3BFMA 2ON6A 2A0KA 4HB4A 3ZW7A 3ANYB 5JWOA 2LXNA 3AHEA 3NBFA 1OI2A 3NNSA 3STTA 4CKXA 2PQ0A 3HXPA 4R6XA 3KQYA 2DBVO 3QFSA 1H6AA 3SC3A 2AMJA 4DARA 5K0BA 1CS4C 2WHEA 1I2DA 3TNLA 4HA8A 1OVGA 2PYIA 3E48A 2A67A 1SC4A 4Q1DA 3VOSA 2BFCA 3OHSX 3WYAA 5HPYB 4AWBA 3D3QA 4K9NA 4U0KA 2XB8A 4DPMA 3LY7A 1UMBA 4LVNA 4UUBA 1AKVA 1U8UA 4TWIA 3VDRA 3CN9A 2QRZA 2GRAA 4GE3A 1YFZA 4EHKA 2X23A 4GAEA 2F3UA 1PS0A 2DU8A 3GD7A 4AYTA 2VDRB 4GZLA 4D1YA 5HIIA 4HZUA 1GPKA 2Q5LA 4KWIA 2WZDA 2WWGA 4NOLA 1BKDR 3BFKA 4L8FA 4MRMA 4PIPA 2B4RO 5DHPA 3RS3A 3UK2A 2PL3A 3KQSA 1N5MA 2BSXA 4WMLA 1TQ4A 3JSXA 3QEOA 5JLAA 2V9ZA 2WR8A 1YMVA 2BM1A 2SBTA 3KOMA 1PR4A 4LEIA 1ONBA 1JMYA 3WRWA 1CF4A 2C57A 2GPNA 5KSOA 3A6GA 1JXOA 3QWAA 3RACA 1RACA 2QZ4A 3EC1A 4BOYA 2D2EA 5FOWA 3IP5A 3PDHA 3CNBA 5I7OA 1OFUX 3MB8A 1EVLA 4J3NA 5HKAA 2J46A 1CJUC 1MVLA 4ND8A 4G0MA 4J7CA 4KN9S 4K6FA 2VJDA 1KARA 3R7NA 1K06A 1K4YA 4ZIRA 1HZZC 2JJ1A 3A2NA 1ODIA 4LXIA 1EGVB 1W0JD 3TQSA 2IZ6A 2Z3VA 4TSKA 1QGAA 1AVTA 1UP6A 2CHGA 3JQPA 3VZSA 1YL6A 4CR6A 1WKCA 2K7FA 4DSUA 2GZRA 3SM9A 4Q6GA 3SR4A 4EBBA 3JYLA 1LLCA 4P82A 1E3QA 5CYOA 4Y2SA 4FXPA 2Z3WA 3ZVMA 3L1HA 2FPKA 4YPOA 3DTVD 3G7NA 4I5DA 1OXMA 3H4IA 3EAGA 1LDYA 4QRDA 3KFLA 4B31A 4BGEA 1LRKA 2RB4A 2F1OA 1HMPA 3HHPA 2V9PA 3TO5A 2I76A 2IVFA 4CKZA 3TX2A 2NQTA 4JCCA 5C4IA 4F04A 1U8YA 2DR3A 3RUDA 2FPGA 1WIWA 1XAIA 5BN4A 2QN2A 1U1FA 3I6YA 4HX2A 4OA5A 1FVXA 3TSCA 3K0FB 1NP6A 3CRVA 3DVSX 3TTWA 5DXAA 4CQMB 3BRWA 3WSVA 2W6JA 3T9FA 4B48A 5C5DA 3VUFA 4E1AA 5REQB 5LD2B 4COKA 3UFGA 3EG9A 5DI9A 1SVLA 3EUFA 1T4BA 5AK5A 3WIOA 1PJLA 1IB0A 2Y1WA 1GL7A 3ZX5A 5IFKA 2ZSFA 1FU8A 2R00A 1A76A 2GBFA 1KZ9A 2RGCA 1CQJB 1RBMA 3FOZA 3PLAE 4F12A 1FVFA 1I13A 5CK5A 1KP2A 4WZBA 4G2TA 3H84A 2W4MA 1FFDA 3AIOA 1FXSA 4M3NA 2DPYA 4W7IA 3WB2A 3WJAA 1SXIA 2XVMA 2WBLC 1H6DA 5LDDC 1NG9A 2V8OA 2EATA 3EBOA 2QAIA 4LZOA 1NOIA 2QZ9A 2R6HA 2P3SA 1V39A 3QLVC 3PU6A 1CUFA 3AV3A 3MF1A 1TRKA 3ND6A 1ESDA 3NFRA 4A3SA 4BVLA 3HYTA 3RUIA 5BVGA 3HM9A 1K9SA 1AOXA 2E37A 3ASZA 3TW0A 4M1MA 3JXEA 5HRAA 1G7RA 3GEPA 3KKKA 4PANA 1H3EA 4KSBA 1B0AA 2CMHA 3DMTC 1N5DA 4N0DA 1QH8A 1T0BA 4WD3A 2G08A 4YONB 4CF6A 4DQDA 3V1LA 3QSGA 1T0UA 1BS1A 1MO3A 3W7AA 5E3JA 3HB1A 1FYDA 1P4RA 2A0XA 2WA1A 4PSDA 1E9AA 1CUZA 4H2SA 4JYMA 4RSRA 4DLBA 4PG8A 2PE5A 4B87A 4B8YA 2WWFA 3WK6A 2Q27A 5EIBC 1MABA 2Q29A 1BFDA 4EW3A 1Q14A 3AIMA 1EBUA 3GVXA 5K1ZA 1FNDA 1PQWA 1YDFA 3BL8A 2H1WA 2GTIA 1XF9A 2JCGA 1XAJA 4PW0A 3N6VA 3N2EA 2GVZC 3DCJA 4FZ5A 3EIEA 4A92A 5ELXA 4MPTA 4L78A 4XW2A 3IIJA 4KXMA 5EMNA 3VHXB 1IXRC 4JIMA 1PSWA 3ZCUA 4D44A 4R31A 5AHOA 1BCSB 3R4VA 1VTKA 4I5GA 5A4MS 2GGSA 3WYFA 3TZQA 4OBWA 5TQJA 2PBRA 4E5VA 1EQRA 2UXCB 3KOOA 5JT1A 1Z4KA 3IP7A 4M1KA 2BSAA 2C9DA 4MQEA 1OTXA 2GEDA 1F1JA 3VVBA 4EJMA 3MQZA 3EFBA 1QTNA 3Q12A 1M0EA 1NL3A 1OMOA 1EGMB 3VKFA 1FSGA 2ZUEA 3MWEB 5CVCA 3LNTA 4NV3A 4QXMA 1CUBA 2GBCA 2IZZA 4P75C 3Q5DA 4Q93A 2A5LA 5DTIA 3SLKA 3SR3A 4F3KA 1I1QB 4D0NA 1R5OA 1XC7A 3KZNA 1APBA 1ICIA 1Z22A 1EB8A 4UBNA 3H6KA 1VYUA 2J3KA 1XTJA 2PD6A 4X3OA 4LKOA 1UKYA 5FEMA 5LR6A 1AUOA 3DB2A 2X1VA 3I2JA 1NUSA 1CHDA 3NIDB 3JAKB 1BX3A 1ZK3A 2XVXA 2IZ1A 4QFDA 5JRZA 3V2IA 2AXPA 4WFIA 1V2HE 2F1JA 3FSGA 2IY8A 3FSRA 7YASA 4BAUA 1XZMA 2YYAA 3V33A 3FXAA 2LRHA 1HT3A 2V7WA 5A3QA 4WLUA 5DX8A 3OZRA 1Y37A 3OJWA 4ED9A 3UBMA 1Y0BA 4IFEA 2QT0A 1CUHA 4C2AA 3J81k 3KQOA 1Z13A 4U39A 3TSQA 3LUPA 1RJWA 3M49A 1Q12A 4FYJA 2BR3A 4DCUA 2Q0SA 4PYKA 1R0CA 3ORQA 1KO8A 4GKAA 4GM4A 5BYKA 1U31A 2QMQA 3NFYA 4PGMA 4BLQA 1RAIA 4DV1B 1SQSA 1L9KA 3OA0A 1JH8A 1KMHB 3AM4A 1BHSA 5T64A 1V0JA 1VE6A 4R5MA 3ICPA 1E1KA 1OWPA 1YQTA 3V42A 2P9GA 3HXVA 4RDHA 2J3IA 5JLJA 5FNZA 4W9NA 1JEQB 1K89A 2Q49A 4HAUA 4Z99A 3RGLA 2IGBA 3EXIA 3E03A 3UMGA 2GO7A 3TAUA 4RIHA 1XNRB 2YOHA 1V3UA 3NONA 2VTEA 4DZTA 2XUFA 3KHTA 3K7EA 2JGMA 2AHOA 2VJPA 1GL9B 3QOXA 5E4TA 3HTXA 2J31A 1JDBB 2N1BA 2WIGA 3I83A 4UMDA 4AZWA 1CZUA 3EGEA 2HDHA 2P91A 2FOXA 2AIRA 1DX4A 3GLQA 3OZAA 4FNGA 5KUTA 3QPBA 2FLWA 4GSYA 3AR6A 3A31A 3QUTA 2HA3A 4N0PA 3EZ7A 3QY0A 2QTVB 3T7EA 2OHFA 2PANA 3D6JA 4G07A 4M9QA 5AXAA 4XYEA 1CF2O 3DEJA 3W5HA 4EKEA 5BSWA 3REFA 5GINE 2OUKA 3HO6A 3C3DA 2GOYA 3L8MA 3L2ZA 3ICWA 1VLQA 2K2WA 3HUEA 2FQWA 4BVHA 1W0KD 1WS6A 4IJWA 3AB3A 3V4PB 1T5DX 2QYOA 1UH5A 1F0NA 1PJAA 3GDGA 3LSQA 4ZDKA 4JQZA 4JB2A 3HP4A 2VDOB 2BGWA 5IH7A 3TMKA 1Y8AA 1A5TA 2VQ6A 4PQEA 4Q4AA 5ITSA 2W11A 4B1FA 4DV5B 4FEGA 1ONSA 4MR9B 3PZCA 5JO0A 3NOVA 3H5WA 1GRRA 2QW1A 4Q01A 5M29A 2HF7A 4XFDA 3KKMA 3K9HA 1LPAB 1NVWQ 3DAHA 4HXFB 1UKCA 1TI7A 3FNQA 5MGBA 3FWPA 4QTYA 1WMBA 1F9EA 2ZRGA 5JJBA 3LYUA 2J9GA 2PWYA 1R18A 2XYGA 3OLXA 4MYTA 1XMIA 3HFZA 2XOEA 4OUDB 4ENRA 4KXVA 5F78A 3UJ3X 4DL9A 4C1NA 3PVSA 1I01A 5EWMB 2NSHA 3Q7QA 4UBOA 2DJ5A 1SD2A 3R0QA 1GG5A 1KDRA 4MKHA 3GJ6A 5I8ZA 1X80B 4B3FX 2HW8A 3WADA 4ZDIA 2QNRA 4RJIA 5F51A 5KJFA 4J1TC 2E41A 4R1MA 3N8HA 1DWPA 2C9CA 2BJWA 3QMWA 4RNCA 1S8AA 3STXA 5HJ7A 4F46A 3ND9A 1FSSA 3TNFA 1YS4A 3K1TA 4Z1MA 4MRSA 1X7GA 3JQRA 2P2SA 1BE6A 2QB5A 1BG6A 2GAAA 3CTMA 4M8SA 4MCAA 4R0VA 4UEKA 4C07A 3BJMA 4WXEA 2FOIA 1ACLA 4KJXA 4D9BA 4KUGA 4RY8A 5GMOA 4ZEOA 2WJ3A 4NZRM 3EFOB 4O5AA 5EXSA 2NM0A 4JSYA 4KSYA 4NVRA 2OQVA 4BC0A 3OZIA 4QOHA 3QVKA 2GF2A 3GJ7A 4GMHA 5A9RA 5FUMA 2B6HA 3G2PA 4JT8A 5CFMA 3QPUA 4L9AA 5L4SA 1Q0HA 1YIOA 2EW8A 2HEGA 2M6RA 2WC1A 3A37A 5KC8A 3AEQA 4X1YB 4Z7OB 5C7YA 1D1QA 3U16A 1JHAA 2XTIA 1N4DA 4F2HA 3AG5A 4BRSA 2O8BB 5U4QA 3ZWNA 5BQ3A 1OSNA 4PFQA 4I5EA 4ZCSA 3UEOA 1H4VB 1W47A 1W93A 2AVNA 2Z2IA 4XWOA 3HM2A 4IDEA 1L8LA 3ZVNA 4E5KA 4ZJPA 2GJSA 2HBRA 4LV8B 1LS6A 2IXFA 3VISA 3WP1B 5EESA 1CJCA 2O7SA 3FFTA 3GRFA 3QBVA 4JU9A 4P86A 4ZV9A 4L5CA 1W4BA 5DM0A 3WGKA 1Y80A 1XZAA 2Z6QA 1WV0A 1LJUA 3HDJA 4D8WA 2G8NA 1X1DA 2PZFA 4FI3F 3LECA 3BMNB 1VJCA 4TXHA 1Y1SA 3ABZA 3W6OA 4CLDA 5SZKB 1MPXA 3BXGA 3EVZA 3OCVA 2JFPA 3PNSA 4A4DA 2J4DA 1PLJA 2JRCA 3GPIA 3K0CC 4BZPA 5LXTA 1JFSA 3AL0C 4EI2A 2YZNA 4II2A 3RVKA 5IEJA 4F6RA 2WB4A 3L77A 3BQNB 4AULA 1POWA 2N46A 4OK6A 2ZCEA 5HQJA 4PXYA 3JQ7B 1F2DA 4L08A 4RKQA 3Q0TA 1TW3A 4DSOA 4DW8A 4YRNA 4GMFA 2ZSJA 5GONB 4PGFA 2R3SA 5EP4A 4W6ZA 3AOGA 4XTUA 4JL5A 2BKEA 3B9BA 2QLBA 4YMHA 1TMGE 3HPRA 3UO8B 4F06A 2B8TA 3T95A 1GQYA 4FGZA 4IO0A 1KJJA 4C7BA 4ENVA 3W5CA 5K0FA 1NN5A 4BKRA 2NO6A 2OLJA 2H57A 3LCVB 1OKKD 3ANLA 2YASA 5KJCA 2GB4A 1Y7IA 4QEZA 2PPVA 5K3OA 3D2AA 2HSDA 4US1R 3HXKA 3CLTD 3K20A 4KN8A 5C8XA 4F0JA 2JBAB 2VDLB 4UPDA 1TF7A 4HAIA 2CEKA 1RYYA 2E3JA 3C24A 3TOSA 3CX4A 2V98A 5EP3A 2ZUUA 3K8OE 1RAFA 2HGZA 3LBAA 3LTEA 4L4ZA 4XOIA 1JSZA 4MKFA 2V6IA 4FMCF 3MYYA 3HXYA 1FFCA 4R2HA 5C5IA 3I6IA 1MB3A 3I3OA 1BIAA 4V3BA 1K98A 1XB2A 5FWXB 3CVYA 1RWPA 2V74B 2H2WA 5BWMA 2QLMA 1WB9A 3KZ1E 3WLHA 4FD3A 1L6RA 5L6LB 3JZMA 3ZZUA 3V7RA 4A0RA 5M34A 1JDUA 4LSGA 5FULA 5A1TA 2E6KA 3P9QA 4EO4A 2ZJAA 2II6A 4KSCA 4JWKA 4BVBA 1ORIA 2EWVA 3MWDA 3Q3HA 1SC9A 2X2OA 4AF7A 2R87A 1YR8A 2PTHA 2QYTA 3LBYA 4Y9DA 3AVXA 4Y2JA 1U8XX 3PEVA 4OQDA 5LJIA 1T2CA 4UTOA 2UYQA 4BGVA 3CKKA 3BMCB 3CUWA 3KWLA 4KAJA 5GV7A 3SDBA 4D96A 1SBNE 4EYGA 3A0RB 2FZ4A 4M0DA 5TARA 3WNZA 2E4WA 5JQGB 2A5YB 4FLMA 2WYOA 4Y6RA 5J2UA 1FMLA 1Q57A 3CLVA 3T7CA 3ZIAD 2PV7A 5DTQA 5ARBA 3TSPA 3DLPX 1T3GA 3E2IA 5AM2A 1H8EA 1YRAA 4WZZA 3IMCA 4C4OA 1NXTA 2JK1A 1D4FA 2FSIA 2BONA 1AQNA 1FX0A 3NORA 1KJWA 4P0TA 5BXYA 2NV6A 2IY9A 2R62A 3M6IA 2XKJE 4I1RA 4QOJA 4WA7A 2XDAA 4CM7A 2WHPB 2Y68A 4O2BF 1E2NA 1P1IA 4C4SA 3I61A 4Z5XA 3OU7A 4TVWA 1QP7A 3OCJA 1EVQA 1ID1A 5DRTA 4EY3A 4W5RA 2KWIA 2D13A 3S28A 4S24A 5DCLA 1NXQA 1QPGA 3ND8A 3JR3A 2XT0A 3MA0A 2Y9PB 4ZTUB 4JLUA 4GNKA 1Z5ZA 4KO2S 5E6UB 1NN1A 1NQXA 4LF4B 3H5VA 3EIXA 2RG7A 4FFMA 4JJEA 4LQLA 1R16A 1T35A 1G51A 1Y3CE 3H2GA 5BYBA 5HJ5A 5IG2A 2PUDA 3ZD9A 3X1YA 4DM7A 3MWEA 2BFDB 3DE5X 3FCEA 3IAFA 4GYKA 4JK3A 3IE0A 2NZXA 1O5IA 4ZZ2A 3SNKA 1Z6PA 1EVYA 4PRZA 1M5UA 5COBA 2KI5A 3OI7A 4DCOA 3PC7A 3U44B 1WY5A 1WPYA 1TAGA 1U11A 4AWAA 4P7KA 4WNCA 2ZQZA 2FRXA 2DPLA 4AH6A 2ZCUA 1WMAA 1IWOA 2GAOA 4D0RA 1BD3A 4QZVA 3IUEA 4KCGA 3WR5A 4KRFA 1B43A 1PUJA 3JYNA 1NYRA 1XTQA 4Q3KA 4CIWA 4I1IA 1PV1A 4EKNB 3IO5A 3K31A 5IJZA 4JJIA 2WSMA 2NPFA 3GLHA 3QPDA 1Z2DA 2HFKA 3KXDA 1M2OA 2RHLA 3U0VA 4P3PA 1UJ4A 5EUMA 2F3SA 1BS9A 2GBLC 4RO0A 2P1ZA 4UD6A 4B9AA 4ZCLA 1K75A 2Y0CA 2RK4A 1B8OA 4G0ZA 1T43A 2HA0A 1POXA 1G4HA 2Z5FA 3CJQA 3B2EA 2VAVA 2E1HA 3CW8X 2VNIA 3HBNA 4TXJA 5MDHA 4Y8VA 1O87A 2BH2A 3OCUA 1GPNA 3WKCA 3A9WA 3URKA 1IY1A 2XNCA 4C0BA 4J0HA 2OYRA 4ZYYA 1A97A 5K2MA 3PQ7A 4XR4A 4IDHA 3HUDA 3WS7A 3RT7A 4CLHA 4EABA 4N5IX 3F6RA 4CLEA 5A03A 3KLOA 2BGJA 3D6VA 4H1TA 1GP2A 3UMSA 4OLHA 4QYIB 1SVIA 2XCTB 2VQEB 1RJ9A 4MYUA 5B58C 5C7OO 3AJ9A 2OHGA 1V7ZA 3HFRA 4NMWA 1K8QA 3VPDA 4BZZA 1Q16A 2WJZB 1Y63A 1DAEA 4MEAA 4NZ9A 4CM4B 2BUCA 4P32A 4LYFA 1DKQA 4MTCA 2P3LA 2QTVA 4G0XA 4RMHA 2VHZA 5LQRA 1WUTA 3H2JA 4TSFA 1NFRA 2FZKA 4IILA 1DIHA 2YYZA 3ESCA 3LM8A 3OIYA 4YCLA 4DG5A 3CVWA 1XE3A 5CDGA 3I2HA 1VYTA 3BXZA 3KJGA 4BNVA 1WVGA 1ORWA 1I30A 1OXVA 1ZS9A 2B34A 1Q1QA 2EF1A 3LYAA 4NDNE 3U4AA 3FJPA 4L1KA 3IEIA 1F2UA 4YP7A 4GPZA 4B7ZA 1AQYA 5M7EA 4UCFA 1OASA 5ADVA 3VX4A 2NXEA 3SJZA 4I19A 4M0PA 1G2PA 4J3FA 5GV8A 3GFQA 1FDVA 4INPA 3Q7SA 2WM8A 5TSDA 1XO1A 2H1IA 2AMLA 3UPDA 3UJDA 4C14A 1NVXQ 3OF3A 5DX0A 1NQTA 5EHXA 2CB9A 1FUEA 2O8EB 3MQ2A 4OFZA 3ZBPA 4F92B 4BNFA 2P3OA 1TFUA 1T13A 2JGLA 5KTSA 1TPZA 1DWQA 2AJ8A 4EJ0A 3NENA 2Q2QA 1JSXA 4ZYLA 5JZSA 2VTBB 4OKNA 4N5LA 5LZ2A 3UHJA 5LYJA 1Z18A 1Z07A 1IONA 3CLTC 4PQRA 5IF9A 4LF7B 5MHTA 1P39A 1FF9A 4EARA 1H65A 3RRJA 3MUFA 2OLKA 1VPDA 3GY0A 4RMNA 1UEIA 3FUXA 4LI3X 4JNCA 5BMVF 4B6EA 2GYYA 5JZBA 1II8B 3CX7A 5JCJA 4HMQA 4ZQHA 1ODCA 4E2WA 3C15C 3IT0A 1NQUA 2C5SA 4FT4A 3VKWA 3NETA 1Z63A 3LO8A 2QSZA 1V5GA 2ZR2A 2G5CA 3WHLA 2OC9A 1GLVA 2XRYA 5KQPA 4HGNA 3OEED 4O5OA 2C5AA 4JOBA 4UDNA 3ESBA 1ZI6A 4IL5A 4ZVLA 1E7SA 1SCBA 2VC2B 4KDCA 1A9QA 1PYOA 1JLLB 1USYC 3HNPA 3AB7A 5BOVA 4C7KA 5I5GA 2AFHB 1JYEA 3R0JA 1P7PA 4K9DA 2IPOA 4HUTA 3JWGA 5K0ZA 4LVKA 2IHNA 2AMVA 1O6FA 3KT8A 4XDHA 4BEBA 3VC1A 2VZ8A 4ARBA 4C22A 4MB2A 1UKEA 4PFKA 4MWEA 1VPLA 4F71A 3PV0A 3IVRA 1KYWA 5FAKA 2EERA 4X64B 2O8BA 3M83A 4A7PA 1CB7A 4BMCA 4GD3Q 1GNPA 4IKEA 3MCTA 4A1FA 1V11A 1QQ7A 2Q4OA 1B8AA 4M46A 1PFWA 3MS2A 1PGOA 2DUUA 3ITDA 4MYHA 1KI1A 4NEHB 3BULA 4LJ8A 1V1MB 4F9FA 3AUUA 4HFRA 4W5HA 3RU2A 3T1TA 4JENA 1C3OB 1DAFA 5J59A 4JI5B 2I2AA 2GETA 2FTKE 2H7XA 4Q4HB 4YMSA 1N5RA 4DRZA 4EB8A 1HTTA 5I7HA 1NF3A 3RTDA 3BHJA 2QX8A 4NNJA 3KM0A 3NHSA 4B3XA 1NAIA 2B61A 4B2YA 4IIFA 4F3YA 5CD9A 4V02A 5L3VA 9ABPA 1M7GA 3M4XA 2QKYA 2PLWA 4YMVA 5LL6P 3SJCA 1DAPA 1P0PA 4FFBA 4IQFA 2Q2OA 3KVRA 1N2CA 4Q39A 1SUDA 1YB1A 3TDKA 2WD9A 2ZM5A 2B5VA 4GX1A 5EUQB 3BL6A 5IC5A 1XP5A 1ABBA 2UU9B 1ISMA 1UBNA 2BFNA 1P0IA 5F1OA 2FN9A 2IW1A 3G0GA 4CM8B 2ZT6A 5GONA 5FJIA 1FX1A 4RTJA 1X7ZB 2EJWA 3W90A 1P2VA 4FLFA 3CCBA 4A03A 4UPEA 1OAOC 1M8GA 3B1VA 1ZK1A 1ESCA 3D43A 4PTLA 2F64A 3MCAA 3OHMA 4DJEC 1OLOA 2J32A 3TJRA 1M1XB 2ID8A 2QTAA 3LC2O 3NIFB 3ILSA 3OHPA 1T2NA 5C8YF 1DKNA 1KFKB 2E6UX 3ETNA 3FZYA 3AHJA 1W36B 4PG3A 1PR0A 1B6GA 3AVPA 4CBVA 1WHTA 1L0BA 4E4RA 4R7GA 1XPUA 5FOVA 1VB5A 2QRNA 4NY1A 4PLPA 2G0NA 2G83A 2JBAA 1DUSA 1XZNA 4X44A 3U7QA 4B6SA 4Q18A 2BT4A 4XARA 2AC2A 4YJFA 3UXYA 2F2TA 3SIPA 3CZQA 3I8SA 2XBMA 4FINA 2GPTA 1ZOSA 2YS7A 3O8BA 7MHTA 5IFLA 3QKUA 3WDKA 2EP5A 2VNJA 3HQ4O 1KPHA 5EHNA 3U60B 1VQZA 5TQVA 3VR3A 3UV6A 3AR7A 2FV8A 5EZYA 1DIOB 1XX6A 2A9VA 2IYOA 1PFYA 2ZLBA 4CR8A 3CNEA 2RI6A 2Q3VA 1JFFA 4MVYA 4KN5A 5JC1A 1RZUA 3VU0A 3GJQA 1AB6A 1P7YA 1KEEA 2HF2A 4BUZA 4TMYA 4XCQA 3PC4A 2AOTB 2IH5A 3H5NA 1NVVQ 4JXJA 2ZJ2A 1YGBA 2YNMC 4D3DA 2ZJ1A 3TKAA 4EBFA 3N2IA 5AJHA 4IJVA 4WRRA 1ID8A 1N5KA 4XYLA 3U7GA 4A36A 1E99A 5CRIA 2GYWA 1RRKA 4JSRA 4D02A 1N1EA 3DWEX 3SSAA 4KVGA 1SVUA 4K6GA 4BWAA 4DJTA 4BTLA 1MAAA 4L15A 3A9RA 3LLVA 4ZAXA 5CG2A 1CULC 5FYDA 3TZ6A 5K03A 1RXVA 1QYDA 1ND6A 2WOJA 1Q3KA 2PMKA 2OV4A 3FBWA 1B26A 3H4TA 4GW3A 4KHZA 2HK6A 2QVYX 1WF6A 4RVNA 4MWCA 4XWGA 4ASUA 2QRGA 2F90A 2TYSB 2DCUA 2YQ5A 3A3YA 3L6UA 3OEYA 4HDCA 1M3SA 1UXJA 4MVXA 4Z1OA 1AA9A 4IIXA 2JGRA 2O7RA 1CQXA 2XUHA 3NKLA 2J3JA 2Z30A 3ZH9B 2NYVA 2ZS7A 3GN1A 4YMIA 1JLHA 5IBPA 3R9XB 8ABPA 1FFHA 4IRUB 5FBRB 1ZCAA 1U4NA 3OUZA 3Q9SA 4NCKA 5DNAA 4QM7A 2UXBB 2V4MA 2Z2YA 1ISPA 2AG6A 1I6WA 1FNMA 4UTVA 1VL5A 1VKHA 1FDIA 2HM7A 2OORC 5JSUA 2EIHA 4PAWA 2O2YA 4GX5A 5LA6A 3HCRA 3GVCA 1IFXA 2FMHA 1V47A 3AKZA 5ED4A 2P9BA 2WJIA 2YWGA 1U0RA 1UBCA 3BN3A 5JYDA 1Z6YA 2V7PA 4DV2B 1VHQA 1NBOA 1R9NA 4CTJA 2A9RA 5IJWA 1W36D 1B23P 4KK3A 1J0BA 2FEMA 3ETEA 2NW6A 1W8DA 4XYBA 5FFFA 5C0OE 2C9ZA 5HFAA 4PYJA 3DZDA 4HWKA 3SEZA 3OJOA 5KNBH 1GQSA 1LKZA 3BSWA 3O75A 4YHHB 4HNQA 1E4EB 1RWVA 4GR9A 3TL2A 4DE5A 5MN6A 4RTLA 1RJFA 3P94A 3EOBI 1G3MA 4CMAA 5A2QA 3HPQA 1Z62A 3WK5A 1IK4A 5BV1A 2PT6A 3PFWO 1GO2A 1NFQA 4UAGA 2RGXA 1U3GA 3RRYA 1UPXA 2W6CX 5CLIA 4DJAA 5FPQA 5BRJA 5B53A 4DUGD 4FNOA 4J1SA 1DTSA 3G13A 1IH8A 3M1YA 2FE1A 2FMIA 2VF2A 3AVQA 2YZMA 3B52X 2X0DA 1PL6A 3NU1A 1EE1A 1ZH2A 4G23A 1GUFA 2DAPA 4QC2A 3UMMA 1BOOA 5AWFC 1Y89A 1J8FA 3LDHA 3KXIA 4FZRA 4FMDB 1AQ6A 1DT5A 1XAGA 4NU0A 2PNJA 4MIOA 4ITRC 4PCLA 1UBUS 3E4DA 2XB9A 2P62A 4RYLA 1YC2A 5LU8A 5CXXA 3RU9A 1ENPA 3KQVA 5IVPA 2CLKB 1X39A 2IXAA 2OGTA 3BZUA 3M4YA 3PIIA 1PFQA 4ZYWA 5I7RA 4MDYA 3P9KA 4PIMA 5TJ9A 1PYDA 2CK3A 5JHHB 3LW7A 5EJIA 3U37A 1T5LA 1WSBA 4JMPA 2P0AA 4CIAA 2AFIA 2YXDA 4MIKA 4M36A 5IKOA 2D0PB 5IUNC 5KVCA 3KKQA 3C97A 4INOA 1JHRA 2B1RA 4KYTA 5BV2P 4MKRA 2I0FA 2W2VA 4YUZA 2PGIA 3FI0A 1IN4A 3MWYW 1JPVA 4KR0A 1FFXA 2AYXA 3EH1A 4BN4A 2DETA 3USCS 4EAAA 1PNVA 4ZQBA 4D6PA 3C74A 5H1YA 1ZVVA 1NZDA 2B78A 4ETIA 3CJTA 1I3LA 1WTCA 1HLDA 3Q85A 3NM6B 4JWTA 4LHEA 5I01A 2YV3A 2C5EA 2D7JA 3TEMA 1Q22A 3HA3A 4EUHA 3EGDB 4FE3A 1AT1A 3Q3EA 1FYWA 3FLEA 4KQ9A 3S2SA 4YUXA 3EJ6A 3HXMA 3O3OB 3CXUA 4OH1A 5BMOA 2CHQA 5BWBA 3HEBA 2EKBA 3DZ8A 4WESA 4I55F 1OPXA 4WE3A 3WRYA 5BV7A 3IRVA 1LF0A 4YV7A 3NHBA 3TLXA 2VNHA 1N2HA 1E7YA 1GV1A 3RKWA 2VYVA 1CE8B 4QO8A 4QWWA 2ZSDA 1ZHOA 2RKWA 1TD9A 4HZGA 2YCBA 1L7DA 2ERCA 2KYRA 3ND7A 3OD5A 4FBLA 2NOAA 1J22A 3HB0A 3QUAA 1U5BB 3JYOA 1UT5A 2JFUA 3U80A 3ZWKA 2IYSA 2VTBA 5BW8A 3KNZA 4HRAA 5DBOA 3S2GA 3R5SA 2BISA 2X2PA 4W8HA 4XD7A 4KU4A 1DQZA 3MGCA 4IDDA 3O8LA 3ZJYA 2ZB4A 1UBHS 1YJCA 1H8HA 3KEGA 1V4BA 1RWXA 2JZOA 3IEPA 4WQMA 4Y2QA 4YCNA 4ZC1A 4BVGA 1TEZA 3JRWA 4BQSA 2IS6A 1MX1A 1NPDA 1JE0A 2RC5A 4BDSA 3DOIA 2QZPA 5HK8A 2I6TA 3HVRA 3ICEA 5FT9A 3RFFA 4FDUA 4MCJA 5LN1A 3EDYA 1IZ7A 1YKFA 1Z5GA 2PUJA 3H5LA 3ZBTA 3G2IA 1D07A 2WSSD 4B7AA 1X2BA 1T1JA 2AFHA 4ND7A 3T1YB 1FP7A 5KREA 3CRRA 3JY6A 2J0UB 3N70A 1YJ8A 4NYMQ 1JIQA 4V0LA 3A5YA 4D5EA 2B4YA 1GG8A 2QVBA 2R1TA 1MX5A 3CF0A 4KYVA 3L4GA 2MSWA 1TC2A 4AZ0B 4FMBB 3W3SA 1ITZA 1Z82A 1DBQA 3A7RA 3AY0A 3H19A 4MWOA 1PGJA 1K1EA 3ADPA 4PC6A 4BMPB 2HWYA 2G63A 2QD5A 4Z9EA 2ZSIA 2WUWE 3GMDA 3Q9NA 4P0QB 1A9XB 2C7VA 1PTKA 2HJRA 1HE3A 4HEA6 4JLAA 1Z12A 4JOCA 5F7ZA 4DOMA 2B6NA 3RSLA 4E15A 2ZQ5A 3ORYA 4E2XA 2UZ3A 2A7QA 1Z0SA 3QXCA 4NZTM 1BWPA 4J7XA 4MNTA 3IL2A 1I1HA 5BUSA 1KK2A 2WSIA 3VZPA 1C4WA 5AVXA 2J5QA 4L85A 4Q1AA 3I5AA 5JWHA 4AICA 4QT0A 5ALGA 1MW8X 1V95A 5SY6A 5BNFA 3P0JA 2IUYA 4S04A 3JS5A 3AVTA 2HIMA 3AVWA 2CNKA 5CT6A 1FTYA 4K2AA 1S9HA 2Q3JA 4ZEWA 3MMZA 5AVSA 2XOKD 2JGAA 2YVAA 2NXJA 4GZ6A 4DPGA 4PLZA 4X63A 5KSZA 2IYWA 3ND5A 4M53A 5KPJA 4F5ZA 3VR5H 1BROA 2AZTA 1W87A 3OP4A 4M7PA 3T5BA 2HWKA 2P6MA 1HDYA 2TMKA 1JHUA 1GNVA 4XB2A 3S2FA 4Z9FA 1SELA 2UKDA 4DLAA 4DLWA 3IDFA 4N8SA 3ISTA 4F3RA 1J8QA 1KOFA 2DXTA 4HT4A 4LJ7A 2XGSA 5BQXA 3LRXA 3QU5A 2HQRA 3DD1A 4FZVA 3VU9A 2EX4A 3ZLVA 1RT9A 2CCJA 5JSZA 5TB5A 3H2SA 4DYVA 1H0XA 4LCEA 5IYZA 1PJQA 4LDJA 2EU8A 4Q48A 4Y6PA 5H59A 5AVTA 1QLJA 1L1FA 5IZCA 3C7TA 2L2QA 3M4NA 4HNSA 1CUYA 2ROQA 1NNEA 2CDCA 2XVYA 4Y7CA 5IUKC 1U0OC 2H9YA 3ZWMA 1R8YA 5A5FA 3OT1B 3D9QX 1XEZA 3LDFA 1JFRA 2FW8A 4DLPA 2PUCA 2V7QA 4KE9A 4ZCRA 4M1ZA 5GZ6A 3VH1A 4IG4A 3QX3A 4L8YA 4R68A 3RC2A 1UKZA 2QDXA 4WTOA 2BRUA 3B38A 4X7MA 1GYRA 3VR6H 1P6QA 2JGDA 1N8NA 1T0HB 4HMPA 5E7JA 5FBLB 4ER3A 1VI2A 3AHGA 3I45A 4Y1FA 5JJ5A 2J07A 2J67A 5KWSA 4LFAB 2HRZA 1FUKA 3OFJA 4FNMA 3DBLA 3FUWA 1UOOA 2DTEA 3T6KA 3F5FA 2AOTA 4HUQA 3FPLA 3IIMA 2D4HA 3HGQA 3RGGA 3IQDB 1ZD3A 2A8YA 4EELA 1E92A 3PT9A 1NVAA 2IZ7A 3COZA 1SVOA 1B0PA 4MS3B 2YWFA 2ZRBA 1N7HA 3EEOA 2VWHA 3TF5A 2QW8A 2R96A 1AMNA 5B7GA 1ZEJA 4GR4A 5CEFA 3EFSA 1NV9A 4LVIA 4F3CA 4Y3UA 4D46A 4XTYA 4Z9BA 5TJHA 2PY6A 1U65A 3K1JA 4RZQA 3PSAA 4FW8A 2PU5A 4GLFA 5IP5A 4RLFA 5BSRA 1N0WA 4R4JA 1T9BA 4L50A 4S0ZA 4RV4A 1NBHA 2WY2D 3VPGA 3RSZA 1Y5IA 3HJNA 4EGFA 3WHKA 1Z3CA 1DDOA 2LIPA 4XJTA 8AT1A 5ER9A 5IHXA 1JEOA 4GUDA 4URFA 3V8EA 5MFZA 3AR9A 1NKTA 1T25A 1IBCA 2UUOA 2P9TA 3AY7A 3TXXA 4HVLA 5B1EA 3GPBA 1DEXA 2YZKA 4V03A 4CLOA 2OAP1 5EN4A 4P74C 4MUEA 5CNMA 5FTJA 3I8XA 3W6ZA 3TUPA 1W49A 1GDTA 1XHEA 4OGKA 4Z6KA 2J0EA 4IRMA 4BIMA 3MSCA 2O1WA 5DOZA 2RE8A 2CD9A 2B7BA 2YQZA 1U9YA 3UJBA 4PONA 1NYLA 5GY7A 5KSPA 4WCFC 5A3RA 2G8LA 1UEJA 1ZCBA 4Z4EA 4X62B 4EG6A 1NY5A 3ZGVA 4Q1CA 3LOPA 5GADl 3MRSA 2FOLA 3K9FC 1VC2A 4Q03A 2RJNA 3D8UA 2DULA 5FUVA 3D8RA 5HKLA 4OHZA 3NPMA 5ALHA 4NATA 4EUEA 1AQIA 1Z2PX 1IG3A 2R79A 1H6BA 4BB6A 3GL9A 3NG1A 4ALNA 2PSJA 3E3MA 1GZHB 4H6VA 2HREA 2W0SA 1OHHA 1TQ8A 1R4NB 4X90A 1XA4A 3R3HA 4UVEA 1HXDA 2QL5A 3G0DA 4UNSA 1M1NB 5ITZA 2H1LA 4LRQA 1RJEA 4IYJA 3ZWDA 1RW4A 4AJPA 4ENTA 3ETCA 1YVRA 2I5PO 3AEUB 1V96A 4FCVA 3UB2A 2JZCA 1CWUA 5A06A 1WTAA 1KYYA 2JEZA 2Y2UA 3B6IA 3AUTA 5AI6A 2X1LA 3PBKA 1GY8A 1N2JA 3EVBA 3L0ZA 2O3QA 3LF1A 4TVSA 2A35A 5JDCC 3TXYA 2B2NA 3MHPA 5DNWA 4UP9A 3R07A 1O6BA 3HABA 4AS3A 5EJ6A 5CT5A 5C2JB 1UWVA 4JP5A 4MUNA 4N5HX 3AGPA 4AYWA 2ONYA 2C7GA 4AP5A 1BU8A 2QGNA 4A8JC 3EZ9A 2W5UA 4LN1A 2FF5A 2JG3A 2QL9A 4MW5A 1NSFA 4KXUA 3ZK8A 5DK6A 2D5LA 4B33A 1Z6TA 1TPYA 2O7NA 3P9PA 4NENB 1ZKMA 5IJ0A 5AUQA 3BD9A 3ASUA 3Q7PA 1ZNQO 2QPTA 2H4WA 3MMNA 1OWNA 5FQOA 1QKJA 1P81A 2BF7A 2QN7A 4X54A 1PEYA 2OBLA 4F2GA 2AFRA 2Y76A 4X71A 1L3IA 3VTFA 3QGMA 2OPHA 4RJ2A 4HVTA 3P32A 1WNLA 4IDBA 1XQ9A 3DBHA 3OECA 3GH1A 3UG6A 3NP9A 4JVOA 4L87A 3ETLA 3ZH2A 4ZYUA 2FDCA 5LLDA 4C4PA 3N2GB 3VAYA 4DLVA 4YP5A 2WVAA 4LXYA 2OUIA 1NQAO 5JU6A 3QW2A 2GKSA 5IXYA 1D6NA 1TVKA 1M2VA 2Z9CA 4PRKA 3PSHA 4TVOA 4U6NA 5J4LA 1YBHA 4UU8A 1YHNA 3ZY6A 5F12A 4JSTA 1SCDA 1AGPA 4FKBA 3UWOA 1GDHA 5LDHA 3CE6A 4JH0A 4R1TA 3PWZA 4AN0A 2XMCA 4YJHA 3RUFA 3WRXA 3UMYA 3MXOA 3SEFA 3TOVA 2OCKA 1RPJA 3BWCA 4A82A 1Y42X 1ZNXA 4I1SA 1UXGA 3PFHA 2DBZA 3DTYA 3M4PA 1YC5A 3ODGA 2X4LA 3QEMA 4YFVA 4BZQA 3I5MA 3H04A 4PINA 5I5EA 3LGSA 1BWQA 1CE8A 3I28A 1SXJB 3L84A 4RKWA 4BATA 2JF0A 1U9IA 4KDRA 1F9AA 2QU8A 1WXQA 3B3AA 4X20B 2YDYA 2CBGA 4DY6A 4DR6B 4I5IA 721PA 1E89A 1FRFS 1KQNA 3OP1A 1PL8A 3TH5A 3A9VA 5AVYA 1RWKA 3IVXA 1T10A 4IF4A 1ZOLA 2A1TR 3X2SA 4BPRA 4QJ4A 4J29A 1X7XB 5B37A 3UQYS 4BCCA 2H5JA 1FQOA 3MTGA 3ZGYA 1ZM2A 2YWEA 4ZP1A 5CFNA 2EBHX 3KQKA 4NJOA 1S4QA 2P68A 3A8TA 1RQ7A 4C0SA 5J43A 1IY2A 2P7IA 4Z0HO 2P6OA 3IA2A 2VK2A 5KYKA 5FBVB 4TS4A 4FCCA 1E7RA 2A9FA 2AOUB 4PLYA 3NEMA 1E0SA 1RC0A 4KV9A 4KP7A 1J25A 3PITA 4OP2A 1EXNA 4OHXA 3SHQA 2DSTA 3PC2A 3SCZA 4DLLA 2JARA 2AH5A 5CW1A 4C20A 1YBMA 2HEIA 3LFHA 3OOJA 2BGLA 1XZDA 2I2XB 3TZBA 3E9CA 1OFIA 1MEOA 2V7UA 2X8LA 1WE2A 4H1VA 4IJQA 2VTKA 1KP9A 2QV7A 2R8EA 3MGBA 4JJKA 4QBIA 3UHOA 2A1TS 3O82A 4DUZB 3COWA 4P4UA 1KVRA 3ANMA 3VNUA 3GK3A 3N0TA 2VL7A 3ZDRA 4BNJA 3CG4A 3WLKX 2COEA