4K86A

Crystal structure of human prolyl-trna synthetase (apo form)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
497
structure length
488
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Proline--tRNA ligase
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
total genus 151
structure length 488
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k86A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k86A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k86A02
5E3IA 4BW9A 3HXUA 3V8KA 1B8AA 2DZCA 3UGQA 1EVLA 4RMFA 1B70A 2I4OA 2ODRC 3CMQA 2ZT5A 3REXA 4DQ2A 4P74A 4TQDA 3PCOB 4RQFA 3DSQA 1ATIA 1WPYA 1ASZA 3HFZB 2ARTA 2CIMA 1BBWA 4RQEA 3IALA 2EJ9A 2E41A 2DVEA 1WLEA 4K87A 2RHQB 4O2DA 4HWRA 3A5YA 4K88A 2FYKA 4XU0A 3UGTA 4ZTUB 3V7CA 2ZZGA 4BWAA 2CGHA 4TVWA 3MF2A 11ASA 3LC0A 1EFWA 1LYLA 2DJZA 3HFVA 4P72C 3QO8A 4YRJA 2ZR3A 4KR3A 1NYQA 2CJBA 2EAYA 4UP7A 4YRNA 1X54A 4AH6A 1RIQA 3G1ZA 4YCWA 3NENA 1SERA 1WYDA 3E9IA 5HGQA 3A7RA 4OLFA 2ZIOA 1PYSB 4HA8A 1E1TA 1WQWA 2CJ9A 2E10A 4E51A 2C8MA 1X2HA 2ALYB 3QTCA 3RIRA 3I7FA 2ZT6A 3TEGA 3BJUA 1IL2A 2DU5A 4G85A 4YRGA 4UPAA 2J3LA 1USYA 3HY0A 4YRKA 3HFZA 3VQXA 4TQFA 2IY5B 1YB3A 2EWNA 3HXVA 4ZIBA 4KQEA 3V7RA 5K1PA 1ADJA 5F5WA 3BFMA 4YYEA 4CS3A 3HXWA 1H4VB 2DTOA 3ERRA 4PG3A 2EJGA 4HWOA 3P8YA 3TUPA 4TTVA 3LSSA 1SRYA 4CS2A 2P5IA 4OP0A 4H2WA 3RKYA 3R07A 4WJ4A 5KNNA 4P73A 4P3NA 2DTHA 4P71A 1NJ1A 3RF1A 1NYRA 4G84A 4K86A 2C7IA 3HRKA 4P3OA 1ADYA 4NCXA 1SETA 2ZZFA 4XTVA 1NNHA 4TWAA 4X5OA 3HY1A 3UFGA 2Q5HA 3WQZA 4EO4A 4XTXA 1J5WA 1PYSA 3QO7A 4XTUA 4YCUA 1X2GA 2DU7A 1JJCB 4YROA 2ALYA 4P75C 1QF6A 4YRIA 1X56A 1E22A 4XTZA 4YRMA 2ZCEA 4XTYA 2IY5A 3M4QA 1NJ8A 4H2SA 2Q7HA 1V95A 4KR2A 4XU1A 3VQVA 1W66A 2AKWB 2E64A 1YFRA 3L1AA 4UP8A 3OD1A 2J3MA 2ZT7A 2DQ0A 4H2YA 3REUA 1BIAA 4P3PA 3VBBA 2PMEA 3V7SA 4CH3A 2ARSA 2DTIA 2ZINA 3W3SA 3NELA 3A74A 1B7YB 1H4TA 1NJ2A 3V8JA 2ZT8A 4WJ3M 3A31A 2I4MA 3RL6A 5C52B 1BBUA 4P72A 1KMNA 1H4QA 1WQ7A 1GGMA 1G5IA 4CH4A 3M4PA 3LSQA 1EOVA 3P8TA 4HWPA 4HWSA 12ASA 4YRQA 4EX5A 2E65A 4P74C 2RHSB 2QHSA 1ASYA 2I4LA 2E5AA 2ZNJA 1JJCA 3PZCA 5ELOA 3HXZA 2ODRD 2CJAA 1N9WA 2DXTA 3KFUA 5K1XA 2DEQA 4H2XB 2XGTA 4HWTA 2QHUA 1KMMA 3A7AA 3A5ZA 3RKXA 1C0AA 3EFRA 3EFSA 2AKWA 3ICAA 3VQWA 4YRTA 1L0WA 1HC7A 2DZ9A 3L4GA 4H2TA 3TEHB 1BIBA 1YFTA 2Q5IA 4XU2A 5ELNA 2DKGA 2ZTGA 4Q6GA 4YRPA 3MF1A 4YP0A 4YRCA 2DXUA 4YREA 1H4SA 2ZNIA 1B7YA 1KOGA 3IKLA 1WNLA 3V8LA 1HXDA 4HVCA 2AMCB 4L87A 4XEOA 3IG2A 4YRRA 3L2ZA 2EL9A 2Q7GA 4TVYA 2ZZEA 3FJPA 2ZR2A 3RKWA 1X01A 4YCVA 3NETA 3P8VA 4H02A 4WF2A 1VQZA 3HTZA 3L4GB 1WU7A 1Z7NA 3QNEA 2E1HA 3HXYA 2RHSA 2LW7A 1SESA 1NJ6A 1EQRA 4PHCA 1B70B 1USYC 4ZTZB 2PMFA 4TVAA 4DPGA 1G5HA 4J15A 3QO5A 1EIYA 4YRFA 2P0LA 4H2VA 3RUXA 2ZIMA 4H2XA 4P75A 1E1OA 2HNIA 4UP9A 3RACA 1YFSA 4XEMA 2DDZA 2Q7EA 3A32A 3E9HA 3A7UA 1EVKA 4YRLA 2G4CA 4YRSA 4YPFA 1QE0A 4XU3A 4H2UA 3HRIA 4CH5A 5C53B 2QHTA 3TEHA 2ZXFA 4CS4A 3IKMB 4CH6A 3NEMA 2QHVA 2I4NA 1B76A 1FYFA 3VQYA 4YDQA 2ARUA 1G51A 3PCOA 3UH0A 2ZGWA 3RGLA 4P73C 4LNSA 1E24A 4P71C 4TVAB 4WI1A 1X55A 2E3CA 3MEYA 2AMCA 1EIYB 4RDXA 2DQ3A 1YGBA 2RHQA 1HTTA 4Q15A 3HXXA 2EJFA 2XTIA 1Z7MA 1NJ5A 4XTWA 5C51B
chains in the Genus database with same CATH superfamily
3X1KA 4AKHA 1QFSA 5E3IA 1N3LA 2Z5LA 3JV7A 1GEEA 5JAQA 2BN4A 5IVKA 2DPHA 5ALQA 4TGLA 4ENWA 4J4TA 4RSHA 5JXIA 4MGIR 2IUSA 3C97A 2NWQA 2IYLD 1BQ4A 3ESRA 2NPFA 2DUNA 1BS2A 1B8AA 2HJ9A 4O3FA 4P5EA 3P96A 4Y0NA 4EHBA 1U98A 2GM3A 2FB9A 3WIDA 1Y8RA 1IY9A 4MV3A 3WMXA 3UGQA 2J5XA 5LBIA 1RAFA 2C2HA 4BEWA 3ZWAA 4UD6A 3WHLA 3MD0A 1KP2A 1YQEA 1D7AA 3K0CA 4P6VF 4TM8A 2A5YB 4CMHA 3REXA 4G5YA 5HBGA 3D1JA 3JZIA 3TTYA 4Q4JA 1T0HB 2XRMA 5K45A 1NPYA 3EIXA 1ONPA 4KNWA 4S24A 1QU3A 1IM5A 1DQNA 2C96A 2HNAA 4H16A 4NTZA 3CKYA 1PZHA 4KTVE 2O57A 3FBTA 1IBMB 1YJQA 1NY6A 1CF2O 5JUWA 2O8EA 3JR7A 3RVNA 1NVMB 1UADA 4WOPA 4CF6A 4KDCA 3T3OA 3W8RA 4HB4A 4S0XA 4DS3A 2Z1MA 5FD8A 1GZDA 4N3GA 4ZT7A 5GPBA 3K9CA 2Y0BA 3HKDB 2B5OA 3OMWA 2JLAA 3GVCA 3WQRA 3K70B 4QYXA 2GDZA 2Q50A 2ZPAA 1YDFA 2OHOA 5SZKB 1ENOA 4M1KA 1X8XA 1CDOA 1I2MA 1ORHA 1GGKA 4QLBA 5CFNA 4BO4A 4B80A 1AGRA 1GCOA 3A5YA 5DI3B 3LA8A 4DRXA 4XTCS 3WKDA 3KRTA 1A98A 4GYWA 1TKCA 2IS4A 2E4AA 1GKUB 2WKPA 3VTZA 2AWNA 3KS9A 5EIAA 4CM9A 3BD8A 4M9QA 4F8EA 3PZBA 3IP9A 4MMYB 2ZSKA 2HX1A 4JASB 3UUFA 4MPTA 2CB0A 3BN3A 1MAHA 3BQNB 4QU8A 4X64B 1WG8A 5IT0A 1OLXA 2H6EA 3HJCA 1GDTA 1T2NA 5JNRA 5LD2B 1T5DX 4G07A 4MW0A 3ECCA 5DIZA 3DOOA 3CEHA 4FYVA 4IQ0A 2AA3A 3FNEA 2V5VA 3MJHA 3RVBA 3ZE9A 3FPGA 3DMHA 5EIEA 5TQVA 4WH0A 4BNJA 1PIWA 4MS3B 3CVYA 1N92A 2HA0A 3IOBA 3AP2A 3VKVA 5K01A 4GOJA 4HL6A 1JFLA 1T6ZA 1BQEA 2W6IA 1P1IA 4OKIA 4ZIRB 4QBKA 2NAPA 3JTMA 5FAKA 1GQOA 1ZD8A 2A94A 2OM2A 2QVCA 3ND9A 1K4KA 1J0CA 3E4DA 1FFDA 3DZIA 3P0FA 1QCYA 2EEPA 3T06B 3TRHA 4WHMA 2OHHA 2QUBA 1WV1A 5AT1A 1R8QA 3W7AA 1ZKMA 2IVFA 4O02B 5B1DA 2VYQA 2BKYX 2QJTA 1NLMA 5EVJA 2BFWA 4UOEA 1ZM9A 4ABTA 4ZC8A 2QY9A 5H59A 1GZSA 2P75A 3PTLA 4RF5A 5I4KA 1HFJA 2A0FA 3EAQA 1YDMA 3G0GA 2KI5A 5COBA 4ONEA 3RJTA 2HTEA 3GH1A 3C3AA 4MEAA 3EFHA 3I6BA 5CHEA 1N7GA 1XXHE 1IK4A 1BDIA 3IUSA 4FOOA 4FNMA 5CT8A 2XADA 2BGRA 3CJRA 1DZ3A 1I4TD 1BU8A 2JAXA 2VQDA 5SZIA 1WQWA 4MVJP 2AQKA 1VMIA 3I5MA 3VR6A 5FHRA 5IBPA 3SKXA 3SK0A 1TB4A 4LDRA 1YDEA 1E2IA 3TEGA 2ETXA 2EHJA 3Q9LA 1KVUA 2I7TA 4QATA 2HLDD 5ER6A 3EN0A 3H9QA 2MSNA 4A16A 2ONKA 4DR7B 4QPDA 1PHPA 2ZI4A 4IDQA 5TF0A 2A0UA 2ZJBA 2GEUA 5JISA 2V5AA 2Z1DA 3FUXA 3I53A 1DKMA 1P3DA 1D2RA 4OGKA 3UCFA 4PSVA 2JFYA 4GDFA 1AY0A 4LWZA 5CDYA 1J5XA 2I2XB 2ZBEA 3C3MA 3PSAA 1ADCA 1CUYA 4NZMA 2MJLA 3F8TA 1E99A 3HKDA 5K05A 3COYA 3KUXA 3L4SO 4RXMA 2CXPA 3NHUA 4LRYA 2WWYA 2HF2A 5ALZA 4HAOA 1ADJA 2REBA 3DBIA 2XUFA 4D9HA 4R7TA 4D4MA 2HF8A 3LNCA 5CYFA 1AV7A 1KQFA 1WRBA 5DI3A 3FCEA 2DTOA 3H9CA 3IDQA 5AK5A 3U9TA 3BL5A 3MOGA 5CFQA 1G8MA 2OBBA 1DRWA 4FS3A 4TUYF 4UBNA 5ALWA 5EMNA 1N36B 4G3XA 3LSYA 1XRLA 2WWXA 4AMUA 1KBZA 1K3UB 2IYYA 3DYVA 1KMIY 4IQ8A 3S2SA 1Z0IA 4KFRA 3NTXA 5AVYA 3URKA 4F5ZA 4MQLA 3NIFB 4V03A 3I64A 4XJXA 2I8CA 4Z4GA 3FNHA 2GEJA 3LDHA 3PGMA 4MPPA 2Q0QA 1PFUA 5JADA 1N77A 3VNUA 2Y4NA 1PQPA 2IHKA 3OUTA 1OXVA 5WRFA 5JZBA 1E1LA 4YUVA 4PGAA 4RY0A 1AKYA 4OBBA 5LNK1 3LLUA 4MS3A 3QLUA 4BEJA 5CA1B 2G8NA 1W9HA 2GTHA 4N8EA 4Q34A 1D09A 3GUCA 2ZLBA 3DP7A 4JC8A 1MLDA 1T8WA 4C06A 4D9BA 4ZIRA 2O0KA 2GZDA 4ZK6A 4MV5A 4EW1A 2NYUA 3T1NA 1RWWA 2IIQA 2C8KA 3FVQA 3OKCA 4KKVA 2ZK7A 2L2QA 1O9GA 1WPQA 5JG7A 3N5CA 2CV2A 3H17A 3TTFA 5G0TA 3Q7SA 3W34A 4ZEMA 1HLPA 1WLYA 2YFKA 3E22A 4M8KA 2X42A 4Q9JA 3BK1A 3IV6A 4P31A 4XTVA 2QBYB 3MAAC 1J1UA 5FPYA 4AKIA 1U0EA 3U1TA 4IDBA 4HXEB 3WQZA 4IMPA 1RVDA 5AJUA 1Q50A 2QL9A 3JD4A 4N54A 2B7LA 2IXDA 1D2NA 2F9MA 3BRWD 4Q7JB 3LXXA 4XSGA 2RGXA 2IY9A 4AECA 4EA7A 5HUHA 1QG0A 1SVKA 4W5RA 2JFNA 3B3FA 4D9FA 1JLKA 2VT3A 1NXXA 3IHWA 4F11A 1H3FA 3DHVA 1L5YA 3HCPA 2QUAA 2EP7A 1NFRA 2WWGA 1NUUA 4X3PA 5CDGA 4LYGA 5F73A 3D6MA 4O2BF 1SEVA 3PFCA 2EJCA 2QW1A 4RZ3A 3PF9A 1PL7A 1ZJZA 4DG8A 2GZSA 2VJLA 2B2CA 1Z4LA 3PJEA 2MSDB 4QUKA 3PUXA 4UU7A 4F85A 4CKCB 5ALOA 3GJRA 3CRRA 4LV8B 4QXMA 1AIPA 4W63A 2FSHA 1XMSA 2PXCA 4N18A 1O8BA 2JAWA 1HDCA 1UINA 4EFNA 2Q7HA 4ENUA 3IJEB 5EOVA 5C7OO 1WZUA 1QCDA 2ZYGA 4ZVOA 2AKWB 2D7DA 1NFHA 3ZI0A 4GEGA 1UIRA 4GOXA 2GEFA 3NV9A 1KETA 4LDQA 4YAEA 4F91B 2ZZMA 1RHMA 3D7MA 1NF8A 2RAUA 3K6JA 1LDMA 1YZYA 3E3AA 1WO8A 4L85A 4M76B 3GROA 3OBIA 3VPBA 4JL8A 3IE2A 1XEWX 2C5HA 4KODA 4X8MA 1RQ8A 2V0NA 4DLWA 5I4CA 1G8AA 3E03A 3QU9A 4Q1AA 1U2TA 2IT1A 2QMQA 4CH3A 2J7KA 1NI3A 3P2OA 4FZ3A 3DEIA 3C7AA 1UXHA 2WJHA 1N5JA 1PTKA 2F1JA 3B6ZA 4ILEA 4BJ5A 2FG5A 5BRAA 2B78A 4R05A 5BWCA 1SBTA 2ZIWB 4AZVA 3DMDA 2XUHA 2EAUA 2ZJZA 3EWAA 4IIJB 16PKA 2CDAA 3WGUA 2FETA 1C3JA 1J0AA 2CDCA 2O2JA 4HAYA 5CT5A 3RE1A 1HDEA 4C7XA 1SIBE 1GQFA 3DXXA 2GXQA 1R6AA 1ZFNA 4RJ2A 3TLCA 3UQYS 1BHJA 1JG1A 3TJMA 1ACLA 3GPCA 3DFIA 2R85A 1SU4A 2IPOA 3GMTA 2FKAA 9LDTA 3UT0A 1G5IA 1ISJA 4HPJB 3U31A 1WD5A 3T1TA 1VKHA 1LNSA 2OMEA 3AUAA 4NZPA 4HLCA 5FPKA 2HH9A 3TGPA 1TZMA 3BXGA 3KNZA 1CUZA 2FSUA 4HYEA 3NFRA 4GWGA 4N3AA 2LCQA 1ORRA 4G0PA 2WIGA 5KNDD 3IVGA 1A8IA 3KYIB 2QBYA 2CWDA 5FBVB 4GUDA 3U60B 4RZ2A 4PNEA 3U26A 3TGWA 4DG5A 1C7RA 4TYPA 2PDAA 5B3LA 2H4XA 4N5IX 3RTEA 4EQZA 1F48A 3HR7A 2RHSB 1YR2A 1Y37A 4DQLA 2H4ZA 4UDXX 4RVUA 1QG4A 3LVFO 3ZGLA 5HPYB 4DB4A 4MV7A 2CJPA 2V4ZA 3BRQA 5HRUA 1S01A 1Z8NA 4FOTA 1CUXA 5ELOA 2FN9A 3N07A 1HG1A 4GH5A 2ODRD 2YMQA 1J5EB 2P6NA 2O3QA 3CW9A 2DXTA 5A9TA 1YJ8A 3HM9A 4C6RA 5IG2A 1YC5A 3V3KA 3D5QA 1U6KA 3GZNB 4LJ9A 5A04A 5KAPA 4LNUA 1ZVKA 3M1LA 5AR1A 2TMGA 4CKCA 1QZXA 2BEWB 1WM1A 4PGHA 4LVCA 2CNWA 5DOZA 3VC1A 4U7GA 2WFZA 1YIDA 1VG1A 3AUKA 2QHUA 3NAZA 3SY8A 1A50B 5HM8A 2A0YA 4NEQA 4IKOA 3WYDA 5CHYA 4PLWA 2CNNA 4V3CA 1QGOA 1R4MB 2JGDB 5DDIP 2AKWA 5EP3A 4YRBA 4LC0A 3E61A 4IM7A 5LPNA 1LQUA 3M8KA 4DCUA 5BR7A 2VDPB 2QTZA 5LNK6 4GWLA 1GTG1 1Z4NA 1LBEA 1V8OA 4LRXA 2W11A 4D9JA 5JYDA 1I5EA 3JVUA 4Z0TA 3QXXA 2BLLA 1OBOA 4HDKB 5EI5A 1ORWA 4C04A 3GGSA 4D79A 3ZCQA 3WB2A 4BCDA 3CMCO 4RS4A 1DKRA 3DEHA 3IMKA 3SEZA 1SUIA 1JLSA 4MWZA 1A7JA 1NOKA 1NVTA 2QP3A 2ZJ5A 4GQBA 4O4JF 2P4SA 4YUYA 1DQZA 4NRDA 4NYIR 1DTEA 3HP7A 1YR9A 2RGEA 4I9HA 2LCFA 3SGLA 3RSFA 3N76A 2HD4A 2WHXA 4F38A 1AA9A 4IIXA 4IIJA 4EENA 3M4JA 4FILA 3DPIA 2PS0A 1ZMBA 1XKLA 3A4LA 1DC5A 4AG3A 2ORED 3K4HA 4C7OB 1TMYA 4XEOA 2BEUB 2GMWA 1AV6A 1ODSA 1MBZA 4OA8A 3BWEA 3KZMA 2IYFA 4KE7A 2XHZA 4YMHA 2Q7GA 3ZVLA 2GARA 2PGDA 4LYYA 4OHUA 1Z0UA 5SICE 1ZH4A 3OG9A 1J25A 1P1CA 4K9KA 3TR5A 3AEKA 4DF3A 1VGRA 3G1UA 5ESRA 3FOAA 2ZJ0A 3KBBA 1PZNA 1H2XA 1GPKA 1L4MA 2P9EA 1FQKA 5J58A 3DFKA 3KKPA 3TVDA 4ZVKA 3QOWA 2FA9A 1M0WA 2ZAOA 3Q12A 2GEDA 2A92A 4ZJZA 2WJ6A 3THWB 2PRSA 3KXKA 4TRJA 1AN0A 3IPYA 1OCEA 1GADO 5KYNA 3HXYA 2RHSA 1U0OC 2FLKA 2LW7A 5HJ2A 1XRRA 4XB6B 1EQRA 1RE0A 5HZHA 3JAMA 2IBSA 2ASEA 2I3ZA 5LBTA 2CJFA 3Q0EA 5BMVB 2CLKB 3H2ZA 4TTAA 2PMFA 2BCJQ 1TD9A 5FNVF 1U2PA 1V6CA 2A5GA 1U2GA 1VMAA 1EIYA 3G7NA 2E4VA 1QVWA 1OTXA 3H6HA 4QYSA 4BNVA 3IVAA 4YMGA 2MINA 3KO8A 3OHMA 5TARA 2H4FA 3GZNA 2WVGA 4HNQA 4O1HA 1PVOA 1N2JA 2BEWA 4WCVA 4W8OA 5DWDA 1NFFA 2NSYA 1K4YA 1TLLA 1TEVA 2JFWA 3C4VA 2EGHA 2O7SA 3WHIA 3B8EA 3E0QA 2XLCA 2EKPA 1CJSA 1R4MA 2JGDA 4K6GA 4QICA 2X5KO 3PVCA 4XU3A 1YZQA 3KHSA 4LWPA 2MMGA 2ZYDA 4LBZA 1ST3A 1HA3A 1BMDA 2HRRA 3Q8XB 1E5VA 1NJFA 1XAIA 1CETA 2AQ8A 3CF4A 4E32A 9MHTA 3RSSA 1N5IA 3I2HA 3NEMA 4ZEWA 3CZ4A 1P29A 2NU8B 1OLOA 3KOUA 3K0BA 3MJVA 3P0JA 3P9RA 2I4NA 4HDKA 2F17A 4K9SA 4Q3EA 4AN0A 2HA7A 4DLZA 4WLVA 2WIKA 1HRKA 4MCAA 3A9UA 3VQYA 2CLHB 4RELA 2AZ4A 3RCBA 2C7RA 4CT5A 2ZBQA 2A58A 1Q17A 1QPBA 1FA9A 2Y6UA 2AOVA 3H5VA 3NM4A 4IH9A 3MJRA 1DLJA 4BB5A 3C8HA 3ZY4A 4IV8A 2ZS8A 1L8AA 1ZC4A 1F6WA 4JS0A 1LPBB 3NFYA 2ZRAA 1KIFA 4YFYA 1M1YB 3QPWA 2Y71A 1JIJA 4WX2B 1M3SA 3AOGA 4PQRA 3FPSA 4ZRMA 2ZCJA 1J0XO 3QVLA 3R4VA 3Q88A 4TSFD 1N2HA 5DHFA 5EKSA 1YFJA 1LFDB 1X1CA 1Q84A 1E3LA 2BEUA 3IAUA 3KTOA 3WKAA 3WZMA 1GLGA 1E2PA 2ZWVA 2BVNA 2P2ZA 2BH9A 3I3SR 3VSAA 2CYCA 2F7SA 2VK8A 4BTLA 4EJ2A 1PJTA 1REQB 1EVQA 2NW6A 4IX9A 3D7NA 1N1MA 3R7WB 1SELA 1GNLA 3MWGA 3ZY2A 2QV0A 3HADA 5C51B 5C7YA 5FUXA 1YRBA 2P65A 3I32A 1ADFA 3FDFA 4BW9A 4WDRA 4YPOA 1OWMA 2ZSHA 1UFVA 1J23A 1EX7A 2FPSA 3I01A 4MA0A 3KC2A 2AFIB 2HCRA 4H3KB 3LFTA 1H2AS 1EQ2A 2AXNA 5KSOA 4J4BA 5DN9A 3AR8A 3EXEB 1NC1A 1IWPB 1ABBA 1G9XA 1L4LA 4MHTA 4KRFA 1OPRA 4HFMA 4B7AA 3C87A 5EZQA 1ZESA 4FQ5A 1VLLA 4U63A 2XAUA 4LFCB 4N0EA 2NT3A 5BMVA 1Z6QA 5HCUA 4ZCRA 3ZD7A 2GLXA 2HEGA 1KIAA 4X7RA 5JSQA 2DR2A 2YJ6A 4EI7A 3L3BA 1G2PA 4CKEA 3TIIA 3W5UA 5EP4A 4ZOLF 3W5BA 2O4UX 5ICFA 3GAFA 5KSYA 3GT0A 3HFZB 4YCSA 1A9SA 4NICA 1NWHA 3ONNA 5A4IS 1HE8B 2Q1YA 2HLDA 3DKRA 4LDJA 3FNIA 4C3VA 4W6ZA 2VXOA 5D5HA 4MA4A 2E6UX 3O0TA 3WJ7A 1POWA 1E59A 1SKYB 5BXYA 4ZCTA 2FGKA 1Z37A 4WADA 1PP4A 3PHBE 3CRW1 4K87A 3MT0A 3P04A 2H9AA 4RF3A 4PW0A 1U0TA 1G8GA 3EIFA 3GQVA 1RWMA 3WNQA 3GDWA 2H92A 4Q6WA 2ROQA 1E89A 1FS5A 1PUIA 1UMCA 2FUCA 1V6AA 3AR2A 2QYTA 3H0KA 4X91A 3T38A 4F6LA 4F6RB 3ZGXA 5LM3A 3EEOA 1EFKA 4ENTA 2Q5LA 4FIZA 4TWBA 3NIGB 3UAYA 3PQ3A 4BFCA 4DZRA 5AW0A 2HV8A 2NU8A 1FDUA 3BH6A 3LCCA 3WWZA 4BLWA 1O8CA 2ZW9A 2JHCA 2F59A 3W06A 3CS3A 5L3RA 2QW8A 8ATCA 1FQWA 4HB0A 1XCGB 1EFWA 3G8AA 3IUBA 3N2LA 4FBLA 3ZX4A 4E09A 3EOZA 4KGDA 5DCLA 1TA0A 4Q3OA 3HPQA 1EXDA 1H9BA 1JQ5A 1WS6A 4YBRA 1Q0LA 1FSZA 2FP3A 4KH0A 1WMBA 1ZJ6A 3DE4X 3SOPA 3VTFA 3ZHRA 4DSTA 5JZVA 4TTPA 1L7BA 2ADOA 4P80A 2HPZA 4QECA 3CF0A 3GFOA 3U17A 3G2NA 1AO3A 3WTCA 1J22A 5EZYB 4CLRB 4DA9A 1VPEA 2Q3CA 1UKAA 3OJLA 4X3CA 3H19A 3BF8A 3TOSA 4DLBA 2PWZA 2P2GA 4GGMX 4QQNA 4U1RA 1YUBA 4HTAA 4UP7A 5E7JA 1REQA 1XKTA 1FFEA 4FBMA 5LOVB 2O2CA 2VTBB 1ZSYA 2F8LA 3R7WA 3RS2A 4M8LA 1B6TA 6ADHA 2OCAA 3H5RA 3QPAA 1MAWA 1QANA 2FMXA 2G36A 1PFYA 4AY3A 1T2CA 2BHTA 3U09A 5I45A 1DZIA 4D56A 4D99A 1UT8A 1H1DA 1QIDA 3GZ4A 4JZYA 3IYLW 3SHWA 4MYHA 5FLXA 1TZKA 2F6RA 5AVXA 4PCAA 4M1ZA 1S7GA 2FMUA 3EXEA 4Y2XA 5CITA 2JIRA 1FTYA 2YN0A 2A1UB 3Q5DA 3SC3A 3MPOA 4QKQA 1JG2A 2VPQA 4GRAA 1QHSA 4KNVA 4CIYA 4RDHA 4HDNB 3FTEA 3A1CA 3VYWA 2O1SA 5L3VA 2XYVA 1QDLB 1T3GA 4IJ5A 3IBTA 1I6KA 1IOWA 3BRWA 4J6FA 1JFVA 3IPRA 2ZT6A 1R7RA 3OEWA 4OYYA 1JDTA 1KP9A 1L1EA 4H59A 1IZ9A 5JXWA 1U0JA 4MV8A 3C85A 2JC3A 1TLFA 2A9QA 4UPAA 5L6MB 1EP9A 3P9YA 2X4LA 4GBJA 6ABPA 1PVDA 4P5DA 5ENDA 4E5MA 2KS6A 3HFZA 4QREA 1BGXT 1QVZA 1M10A 5DXFA 1MO6A 3GD7A 3G6WA 2ZQZA 3JD0A 2W58A 4QOJA 1C8VB 1ESMA 2J3IA 3W9UA 4I1UA 2VL7A 3A1NA 4QGSA 1DHRA 3UWOA 2IHJA 2ZIVB 3A6KA 1IEXA 1QFZA 2OCBA 4MCJA 4JHXA 2E55A 3OJWA 4L51A 4QUIA 5EL0A 1YGPA 1AQJA 1E1DA 4MWGA 1UCFA 1IUOA 2YJGA 2DLCX 3K94A 5JI3E 1A5SB 4QO7A 1TYAE 4FYIA 4HC4A 2QNRA 5F21A 4BNMA 4D4GA 4F6RA 5IAKA 4GRDA 4AROA 2ZUSA 2IV2X 3P8YA 2FWJA 1WBJB 2QVBA 2X76A 4ZT4A 3TLZA 3PWTA 5LQRA 1XVTA 2Q5JA 1USUA 3DNMA 3SZUA 3ONFA 1HNZB 4NKRA 4XR9A 2QP9X 2MTBA 4NULA 4MTLA 4D25A 4F71A 4EAAA 2P6UA 4MIEA 1U81A 1IPFA 1X87A 2Z5VA 3GNQA 3T3NA 1JN0A 1ZG3A 3A4IA 3D81A 3D4NA 3HVIA 1VHLA 2NSLA 3RK1A 3VHXB 1HFEL 3HZHA 1P1JA 3VVBA 1NSYA 4D6PA 3MXTA 5CT9A 3X1WA 3FCXA 4UMEA 2M71A 1XYYA 2JS7A 1OREA 1NBHA 5EZYA 1RLMA 3DR5A 3ZI4A 4DMRA 1Q3HA 2X13A 2YZGA 4QFCA 4Z49A 1J99A 3ZWOA 3S2IA 2ZQ5A 2XUOA 3U3ZA 3NR2A 4E22A 5K99A 1O97C 4TV8B 3CX4A 3H3FA 5FX2A 3DR3A 4NZNA 4JIMA 3GJ0A 4UQLA 3OZGA 5JMWA 2VTBA 4B3MB 3Q1LA 2Q0SA 3EXG2 3WSTA 4ZYUA 3JPYA 4LY6A 4DCSA 2PXHA 5D1HA 3F9IA 3RM3A 1HZZA 1JW9B 5C8DA 4X5OA 2IPNA 1QFXA 4IHQA 4J2HA 2MR5A 1G4AE 1D4AA 3I6MA 1M83A 4I2NA 1WHSB 4FGJA 1UC4B 2NQ8A 3E8SA 5KNDA 2I9KA 3A3OA 2DCMA 4ETWA 2A1UA 5BVGA 1POXA 5AW6A 2H85A 1RJWA 2W98A 3A58B 4HDNA 2QKYA 3CNHA 5ALHA 4DLLA 2QQ0A 3M9WA 1ZJ4A 1J8QA 1OX4B 2JGKA 2C2BA 3DL7A 3GUUA 4IQGA 5C2JB 1XZIA 2IFTA 3R6LA 1NKSA 4JYBA 1DPGA 2QD5A 4BKOA 4DR4B 1TU3A 3L82B 1XU9A 3CBQA 3STYA 1EP2B 1XLUA 3B70A 4NONA 3VDXA 1SCKA 4D3XA 4DJDC 2IZZA 4IHJB 5J4KA 3OWHA 1EBFA 4OFWA 3ROGA 1FU8A 1G6Q1 1HF3A 1VMEA 3KCQA 2UV8A 4QARA 3ILXA 3EH1A 4MGHA 3TUIC 1L1FA 1VG8A 2FFRA 1YXMA 4BGDA 4D44A 1ZIXA 4UEJA 2P3LA 1PT8A 2QW0X 3FYUA 3ZOZA 2DHDA 3IP7A 1HT3A 2KBFA 1BA3A 1HKHA 5IWAB 1I51A 4G41A 4RACA 1OYVA 3DWEX 3HJNA 3KUKA 4FR2A 3E9YA 5M3BA 1NMZA 1P9OA 3LK6A 1JIIA 3PNQA 3H5IA 4UP8A 1Y8QB 3COPA 1GFWA 5HRCA 3B3GA 3HNPA 1QRAA 3MQZA 1X94A 4ZRNA 4H2YA 1U99A 3QVTA 3W4IA 5A4FS 4QPJC 3VBBA 5YASA 5C5EA 3F1KA 5ALMA 1BRMA 1OLSA 3E0XA 1UQTA 3RF7A 1Y33E 1GTL1 3A2LA 2RH8A 3WRXA 2I6TA 5C4IA 3TLAA 1KYYA 1JFTA 1EX9A 1JWAB 3BA1A 4WFJA 4Z54A 2ZRIA 4ARCA 2WJYA 5C3MA 1TZ2A 3B53X 1GP2A 1KFKB 2O48X 1PL8A 2WSLA 2WAOA 1EA7A 4QNMA 1B7YB 2RC6A 5L8VA 1IDOA 1SMKA 1NPTO 1SUWA 4KIFA 1Z7YA 3B7WA 5EINA 4WJ3M 2IZ6A 1BNCA 1GVHA 1HE5A 5EWLB 1JSLA 3L0IB 4P5PA 5C52B 1A5ZA 3DZ8A 3V8PA 1M7GA 2ODNA 3OIDA 1DIRA 4YAWA 1IXYA 1GGMA 3IR6A 1P2DA 4ND1A 1SWWA 3MQFA 4Q4DA 4TV8A 3U4CA 3E1GA 3LSQA 2QZZA 3GLSA 5BRJA 1FYEA 4KCGA 1EFPB 1SHLA 4J4HA 2OC4A 3H2GA 3W77A 2VTVA 2OCKA 3EDCA 3OCCA 1U9ZA 1VA4A 4JLJA 1UBGA 4OXYA 4FNGA 2R6GA 2YWGA 5EKDA 1K8RA 5NLLA 5K8IA 1Z62A 5JS1A 1SQGA 3QUCA 3SC4A 4NG4A 3UAWA 4OQZA 5F7XA 4RW0A 1WHSA 2BGUA 1JAIA 2B69A 4PYIA 4XJVA 3GELA 4EA8A 2QHSA 3E35A 3LZCA 1XRPA 3VR1A 2I8LA 2ECOA 3FZGA 2WNHA 1ICIA 3HUEA 5EN4A 1R6UA 1U94A 1IEQA 3TQRA 1OX4A 4QJ5A 2OV4A 4FJ2A 3JWIA 5JV5A 5B1SA 2IGTA 5LB2A 2W0SA 1V6SA 5LQUA 1JJVA 2BI8A 2HK9A 3HXPA 4BO8A 1P31A 1XO1A 1XVAA 5COQA 4AI6A 1YJXA 3UXMA 1ZMRA 3L8EA 1JS1X 4IHJA 3ENKA 1Z83A 1EE1A 3LAWA 3UW1A 4EB0A 3ZI7A 3R5KA 2WYIA 2O8DB 3WL5A 4IUCS 4K28A 3A9WA 4B81A 1E9FA 5THXA 4LOIA 4AMBA 4NXMB 3NBKA 3MMSA 5B64A 3CSSA 2VQEB 1GU1A 2XJ9A 4LZOA 1T0UA 2OZVA 5J5CA 3NNNA 2R8XA 2GFHA 3IT3A 2BBSA 2PT6A 3O3NB 4FWBA 4YIHA 2DZ9A 2FLVA 2P41A 2EF0A 4ALMA 1Y8QA 4LF7B 3TEHB 5HBRA 5C8XA 3BWCA 1FDWA 1VL0A 2FWMX 3HZOA 3MWFA 1ANKA 3EVAA 2CYAA 3KXIA 4PHTA 5AKZA 1PLKA 2YQ4A 1JYSA 3MMXA 4AZ0B 3A4MA 3R7AA 1XZHA 4RHUA 3ZCUA 5A0VA 4P4UA 3H42B 2WDPA 3IUEA 3CCCA 4JHLA 4A03A 2DXUA 1V8FA 5LQNA 1GUYA 5HUJA 4PC1A 1PT5A 2PY6A 1H4SA 1TTPB 2B7CA 1NXSA 1RU3A 1P2BA 2YWRA 4LUCA 3TEJA 3AWIA 2WE7A 2HJVA 4FEYA 1B7YA 2OXTA 2PSSA 4U9UA 3LRTA 1QB8A 3FHOA 4HQRA 2FEWB 2EJVA 3E23A 4ND5A 3DFFA 3TKAA 3AVYA 3DMRA 1H1LB 4JGBA 4LJYA 4WPGA 1RYHA 5D3ZA 4TLAA 4DZZA 5HK9A 5ICCA 4J49A 1Z34A 4N5HX 4WL0A 1J0EA 1BGWA 3PL5A 3YASA 3ZDYB 1MX3A 2FPRA 1XAGA 4HH4A 3QEAZ 2G7ZA 2YIJA 3PDWA 2VPPA 3FZEA 4JLAA 3ROTA 1DU4A 4ZVSA 4X0EA 3L6CA 4NS1A 1A69A 1FE8A 4POOA 2O2GA 1Q6YA 4L8LA 1EFPA 4W1QA 1RHUA 3MN1A 1I10A 1MCZA 1Q6ZA 1Z0ZA 1QH8A 1T6NA 3HGMA 3PX2A 1JVNA 4GMFA 3L4JA 4DV3B 4NJEB 2HGZA 2JRLA 4QDTA 4CMIB 2PUJA 1G0NA 4Q9NA 5FULA 1VQZA 2I5PO 5JHGB 4XR4A 3LG2A 4UARA 1J8FA 2X86A 1K27A 3NVKI 2OBLA 3GLRA 3MBIA 2WJWA 5FO0A 2Q1XA 2IWRA 1VBKA 3RTAA 5IKMA 2J08A 5CVTA 2FSFA 2RMKA 4YR9A 1Y3HA 1CIPA 1Z7WA 2QD3A 3BERA 1NATA 4DMFA 1ORIA 2NXNA 4US0R 2O9JA 5AUPB 1FFWA 2DWQA 2QLLA 3AHDA 5KQLA 3G0HA 2JIPA 2Y1EA 3AR5A 1SPXA 2CVZA 5EG5A 2JDIA 3BSSA 3DBVO 1S8AA 1DAMA 3SIPA 4D4KA 2VQFB 1Q3TA 1XHFA 3C3KA 3NHZA 2CXXA 2GHRA 3L4BC 3MAGA 5CK4A 1OY1A 4MVJD 4RS3A 3LBYA 3STWA 2FQ1A 2VH1A 5JFOA 3FGNA 3G23A 1ZNXA 1T13A 2JBAB 2Q1SA 1NUPA 3NHFA 1GVNB 4WKNA 3QNMA 2O8DA 2XT9A 4K1LA 3TRKA 1GL7A 4B2PA 4AJIA 1WQ4A 1Y0BA 3SFZA 3S70A 4Q3NA 1EUZA 4HDRB 5F1KA 2DKOA 2WUGA 2OFWA 1EJ6A 2Y0CA 2UZ4A 2R7KA 3GJ8A 3IXLA 3TZHA 1ZR2A 3PHGA 3ZDEA 3HYTA 4HT3B 1G7RA 2B6HA 3ABOB 3NNDA 3QELB 4RHYA 2P8SA 4ZCPA 3TEHA 3AHCA 4QDZA 3GPDG 4NP6A 3IMGA 2I9PA 3LI2A 4P4GA 4GOND 4IKEA 4A5SA 3IR5A 5I9NA 2PS3A 1WHTB 4GR4A 1DFGA 1JHYA 3AYXB 2IC5A 3PITA 4BMXA 4AZ0A 1XDUA 3BULA 4C0WA 1BROA 3AP3A 2IPMA 4C0XA 5B2EA 1R0ZA 4PIVA 2ZAGA 1MG0A 3WGJA 2H2GA 4B2IA 1E5DA 4IDCA 3WLJA 1P4AA 4E6PA 5JBNA 4ARIA 1VJTA 3W3AH 1K8QA 3RVLA 4IS2A 2O0JA 1W2WB 4UDOA 1BN6A 1R4NB 5DWQA 1Q1AA 1SK9A 4FCVA 5BNIA 3RSOA 2G1JA 4HVLA 1T9HA 1U6IA 2G88A 3ABRB 1YKSA 3GFFA 1SH7A 2QTCA 1SVOA 3H2IA 3B3QA 5EGSA 4V3BA 1U7DA 1SO8A 4FONA 3ESYA 1R16A 3MGBA 3ZWNA 1UBNA 2EKZA 3WVNA 1BS1A 5D5PA 4JI8B 1GKYA 3NHPA 3PB3A 2HWWA 2PZMA 4ZARA 5JZMA 2GO1A 5AW3A 4FD3A 1FZQA 5JS8A 1E9CA 1FRFS 1TA4A 3KK0A 4O08A 3H65A 3OKAA 1HDOA 1PWHA 2QTGA 4B43A 5B7PA 1C7FA 2AC2A 3WKBA 1TF2A 3A36A 2VIIA 4GSLA 4XD7D 4BQEA 1GPWB 2ONCA 4QTTB 1Y1QA 2EBHX 3WSWA 2NUAB 4K9RA 3RB8A 3S2YA 2M6RA 4J7CA 1AKRA 1Y8AA 3TNDA 1MIOA 1G20B 2SKEA 1FSFA 3VZBA 1TL7C 4B7UA 2J4DA 3UUGA 2DZCA 3DXFA 5CTAA 3AJ9A 4J2TA 4YO8A 1SZJG 2GPTA 3DAYA 4ZAYA 3RRZA 3KTDA 4GT1A 5DBGA 4L02A 3ZW7A 4ZO6A 5L9AA 3T5TA 3RHZA 4MKFA 5EXDA 2B83A 2VH2A 3EA4A 3MSCA 1SCBA 4FCCA 3KV3O 1V7CA 3H83A 2I4OA 3MS7A 4UQPA 3CMQA 2BGJA 2P6MA 4P74A 4FFBB 5GZ1A 3HUUA 4YC7A 1OI4A 1RNLA 2LZ0A 4HRAA 1W2GA 4FLMA 8LDHA 1KYXA 2P2YA 2XKKA 3MZ0A 2WW8A 3CZMA 3QUAA 3C0KA 5CVEA 2IHYA 5KVQA 2ARTA 5BSFA 1F1BA 3U44B 1Y5RA 2WB4A 2HW8A 1II9A 2JBAA 3IE0A 3MA0A 2ZTUA 1SZPA 3ZVRA 2E41A 3GFQA 1U2RA 2Z2IA 2DVEA 4GECA 2I55A 3BRSA 4N8SA 2OXIA 3DTVB 3SHTA 1FTWA 3E9MA 3X2FA 1IOZA 2WQZA 2Z2ZA 3L02A 4Q0MA 3T9FA 4HDRA 4DMKA 1BA2A 4ZDKA 4XJSA 4HUJA 3R5JA 3HR8A 4ZYVA 1VHQA 1E1QD 3D6JA 4QIHA 1R0WA 4RVDA 2PJZA 2IDMA 1Y3DE 1J9ZA 4B09A 4B4WA 3P8ZA 3NORA 5FH9A 2ID9A 3NM6B 4EECA 3DYBA 5ED4A 3VU0A 4UBMA 1LLDA 1J33A 1U4OA 2AZDA 2ZJAA 3C1OA 2EOAA 3H6KA 4MK4A 3VZSA 4BB9A 4ZTUB 5CCXA 2QGNA 4EGSA 3P45A 2ZYUX 3OFKA 3L7YA 1L9XA 5BVHB 2XMSA 3ON5A 1V5IA 3F3SA 2B4KA 3GO4A 2GEVA 1NUQA 3QQ5A 4I4IA 2XCSB 1GITA 3TIFA 5KUTA 2YJ3A 3BEOA 1EFTA 4R1SA 2G0NA 2ZSUA 3ZZ1A 2BJVA 1R4NA 1E20A 3TL6A 1O0BA 5FTNA 3X1MA 1NDHA 2CE2X 3QBTA 3CT6A 7MHTA 2YL2A 2YXNA 3TTSA 1NN1A 4BMSA 4MW9A 1WPRA 3V9AA 3OMXA 5IAOA 3H4TA 1NT4A 2QT0A 4HDMB 1TVKB 4IG9A 5E1DA 1QO9A 2HWUA 2P62A 2YH2A 3FYTA 4TVKA 4LKRA 5L4SA 3PEUA 5BSMA 2QTFA 1BWPA 3GV0A 3RS8A 4CM4B 3WBBA 3FPFA 4OYRA 4UFPA 1E5TA 3NHYA 1W0KA 3AC0A 2VDLB 5ALTA 3LBNA 2RHJA 4PZLA 2QTTA 1JPJA 5GAJA 1UKCA 3D1LA 4LVUA 1EHIA 1TC2A 1OXXK 1LLCA 1QRRA 2EKBA 2WWTA 2X15A 4ZA2A 3B85A 1B1AA 2NUAA 3CW2A 3RC1A 1VMKA 4P0QB 1PU2A 3PPXA 4MYRA 1G20A 3M9XA 4M9XA 3VR2A 2ZATA 4HQOA 1RFGE 3LUKA 1H8ED 3LVQE 1PQ4A 2F4VB 2GZAA 2GJKA 4ETIA 3MJDA 4JSYA 1EVEA 2VJDA 2YVLA 3T8YA 2YZ7A 2FR8C 3OTIA 4IDGA 4MI9A 2X0NA 1QG6A 3KVYA 4OM8A 2ALYB 3QTCA 1UPUA 2O2DA 1O6CA 3C43A 4R68A 2Z6AA 2VOJA 4DA4A 4K0KB 1LVGA 1RBQA 5AHKA 5IJZA 4FFBA 3G2KA 3PEWA 4YXWD 1YVDA 2HJGA 4E1BA 1WKVA 2MMCA 2P0AA 3E6AA 3NBQA 3MTIA 4FHEA 4EA6A 4EY3A 1XP5A 5ESWA 4Z4FA 1KNXA 5DCYA 1USYA 3HY0A 1J0BA 3T1OA 2PUTA 8AT1A 1U8ZA 4MW1A 3U44A 5DX1A 2PT5A 5LQAA 3QBJA 5LDHA 5AH0A 3DHWC 1PEAA 4S35A 3K1TA 3MGCA 3K1YA 3HXVA 2BRUA 2QTVB 3WGIA 3E48A 3CMMA 3DTVA 1EI9A 2IEBA 1JR3D 1RWKA 2A4KA 4RLFA 2V7WA 3NDIA 2GZ1A 5AW9A 4AKTA 4YPVA 5T7BA 1SRQA 4MGZR 3OAAA 1MA0A 5K7SA 3SZRA 1QFJA 2R2GA 4QXQA 3PJDA 1BWQA 5B1HA 1V5FA 2K87A 3FAZA 2CNOA 4B34A 3WBMA 1O6BA 1TA9A 3PYXA 2Q07A 3MB8A 2HK6A 3EXHB 4HWOA 1XTQA 1PJ8A 2O0MA 4GMGA 3T9DA 1NG1A 2H5JA 1E3SA 5BVHA 1HLFA 3E27A 4PYNA 1KE2A 1QGYA 3QPDA 3GOHA 4JBYA 4OPMA 2C2WA 1ZCAA 1T9ZA 1V8ZA 3WRYC 2IS1A 4YX9A 3DZGA 1H0RA 2I62A 1J8MF 2ZIEA 5KVAA 4OP0A 2AOXA 4L2IB 3UCEA 4BX8A 1RKVA 3ZWDA 1XZPA 2GWRA 4UNQA 4CMEC 1SQFA 3HY4A 3LUFA 4GBED 4RDIA 1M6VA 2AEEA 1FNDA 2JK1A 3GA7A 4EG0A 1AB6A 1ENYA 4JUIA 1TPZA 2CXTA 4TLBA 3ZVNA 3GT4A 3JYLA 2Z5FA 1J20A 1UMBB 3NHJA 4MQFB 3WSVA 1TVKA 3LC1O 3CLHA 2DTHA 1KP3A 5CVUA 1SVSA 1T5OA 4U2CA 3SLGA 4K86A 1ZN2A 1PFWA 1NX9A 2CVQA 2HCJB 2JW5A 3VR6H 4AWXA 4CM4A 3UAVA 5J47A 3ZEIA 1P75A 3RUHA 5B3JC 1TRKA 4OBWA 2CXHA 1N4DA 3TJRA 3BIFA 1D1TA 3UKJA 4ROSA 5BQXA 4ARBA 5FBRB 4I55B 4KWHA 4FYPA 4K6CA 2HHHB 3EPHA 3GRZA 4IDEA 2GPNA 3D2AA 4NBSA 5FI0B 3BMOB 5JMTA 1LBTA 2KB0A 3OTHA 1FS4A 5K3DA 3ZWWA 1KGSA 3C39A 2W2NA 1G2IA 5K8JB 1P45A 4YCUA 4WUVA 3WIEA 3IB6A 2A1TS 3H8JA 1OXBB 4HNUA 1DIOB 4CF3A 5E3HA 2ALYA 3QXJA 4AY4A 2NUPB 4ZMRA 1WSAA 4RCVA 1X56A 4NECA 5JLJA 1JEJA 4U39A 1EM8A 4B6OA 4MKGA 3QFFA 1V1JA 1GAEO 1FFXB 1X3SA 1BS9A 2IZ1A 2JAQA 3NBYC 1O95C 2I65A 3ESQA 4GW3A 4JBLA 1ISGA 3CZPA 2G4LA 3QGMA 4AYTA 3O21A 1A9PA 1W36C 2B4TO 4BHTA 1DC8A 3DQQA 5T4FA 3PXXA 2R47A 5LZ2A 1RQGA 3ZGNA 3PE6A 3W2FA 1HTBA 1PNVA 2QTVA 3KVOA 1E1NA 3ST7A 4IRUB 5BNTA 1DWQA 3OEHD 3C4QA 5HG0A 1V37A 4D92A 4E33A 1QQ5A 2VA8A 4MDHA 5DTIA 2D6FA 3L1AA 2IYTA 3IIMA 5AM2A 2YIVX 4P38A 2XRFA 2UUBB 2J3MA 3Q6MA 2ZR9A 4R6WA 2V8BA 2JARA 3UJNA 1OBCA 2RGBA 5HF6A 4Q9HA 4KQFA 1ZSNA 2ZCUA 3FD8A 3K96A 4WA8A 1UDCA 3EXHA 2GN9A 3ENZA 1NVEA 5HMLA 5BXQC 2C4HA 4OH7A 4OUDB 3A6DA 5BNZA 1JA0A 3GAAA 4EMBA 1I2ZA 2R48A 5JJBA 1EWQA 4QHTA 2OA0A 2TMKA 4IO1A 1E0KA 3REOA 1KZGB 3WKCA 1NMQA 2MYTA 1SXQA 3RFFA 4K9OA 2DH6A 3NELA 2RIPA 4OQNA 4ZANA 1UXOA 3JD3A 4L2IA 4B44A 1RRGA 4RLQA 3NEYA 5FBLB 5LZ4A 4FMBB 4AY2A 4BZZA 3G8BA 5C8YA 3B48A 2HRDA 4ZCQA 3PGXA 4KAJA 4CU5A 2CZGA 3ER6A 1RW4A 3NYWA 3SHQA 3BXHA 5JD4A 1SQ0A 2YWDA 4Z2YA 1T8YA 5SYAA 2QMZA 1UMBA 1ML3A 4MQFA 1LVHA 1R3UA 1TU0A 3AKEA 3BAFA 3GCXA 2WTXA 2JB9A 3OM1A 4J0EA 1DV1A 3IRVA 4Y9TA 5F5LA 5KDOA 1UC8A 4A2WA 4D3ZA 5JCPA 1NOIA 5HMMA 4F8JA 5B4TA 1R5NA 4DMMA 4KQMA 4R01A 4JKYA 4BATA 4GI5A 5A5GA 4COOA 4FM9A 3NPAA 2VUTA 2AVDA 4NEHB 5EZSA 2V65A 4OGLA 4RBNA 4A1OA 1F38A 4FHDA 2C4TA 3A26A 1E9AA 4Y9DA 3CG0A 3I3OA 3IQGX 3G8CA 4I55A 4MLDA 3ND7A 3BFKA 1FS6A 1X8JA 3T1YB 5KWSA 1FY2A 3BMOA 3A1UA 2ZFUA 4PEVA 1JO0A 3S5JA 3ZV7A 2OCLA 5A9RA 4GM1A 1A4XA 5EHXA 4G9GA 4HS4A 2E5AA 1GL6A 3H0EA 4W1SA 3IQZA 4ZQEA 1WOMA 1MO3A 2NUPA 2ZRCA 1EWVA 1X38A 2WYUA 2YCLA 3QJYA 1P74A 4ITRC 2AJDA 3VC3A 4E7PA 4L3OA 2OQVA 1XMXA 2CLLB 4K40A 3WQQA 3KJZA 1C9MA 2F3RA 3UJHA 1TC1A 1A71A 5HM6A 4DUZB 3L7LA 5K3BA 4ZYLA 2J3HA 4I4TB 4M0KA 3KQTA 1RACA 1Z2EA 1RXIA 1S8OA 5LWQA 1M5UA 2ZJ1A 1YB5A 1JHZA 4BC1A 2VHQA 1TVEA 4MVJA 4ND3A 1SU7A 3HA2A 3L6EA 2RIRA 4MS1B 4YNBA 2FTKE 5G3YA 4X44A 4DHWA 4MARA 4EZIA 4C5BA 2FW8A 5BOSB 2XF2A 4HFRA 2J1LA 3T0FA 3U40A 1N3BA 1E77A 2O05A 4IEEA 4OB6A 5EUBA 4DXHA 3INGA 1NH9A 5K2OA 3QPCA 5LB4A 4WNAA 4YMLA 3N53A 4KN9S 1NP6A 1SUCA 4ZCSA 1LFAA 1P17A 4A91A 2EEZA 3AQIA 5DEIA 2WPDD 3LBHA 2B3DA 2DPLA 3KZNA 1VFNA 1H8HA 5FTWA 5IASA 2HREA 2I2WA 4OUDA 4LJKA 3CZRA 2G67A 4EB3A 4EKGA 1M6EX 4L27A 2YFQA 3T7DA 4CTMA 3DVQX 3O1JC 5DNDA 2F3UA 2PLAA 4PYKA 2ZNIA 3RYIA 1FVHA 1SG9A 2DRIA 3NGXA 1NU8A 3RKSA 5ADVA 1PJBA 1FPQA 1H5NA 2QM8A 2IP2A 3E53A 1BEEA 1IL0A 4I0WB 1XCMA 4XASA 1G8PA 3RS5A 3NH9A 4HVCA 2JGJA 3M49A 3C41J 4KXVA 3QHAA 4J91A 4S0ZA 2O8BB 2D62A 3OTWA 2YW9A 4OHRA 4UVEA 2MT9A 1AXRA 3IXMA 1R8YA 1WVIA 1DEOA 1C9NA 1GYQA 1AU9A 1KSGA 5HIAA 4UUOA 2HHJA 4Y8VA 1LF0A 2ZRFA 1RM4A 1XD9A 2OHXA 3ELDA 2L18A 1F5SA 4IF4A 1USKA 1L5OA 3OFVA 4EW6A 3CO0S 1QRSA 1T2DA 1NNI1 1ZD5A 4PFKA 4R8VA 2G08A 3GN1A 3A11A 1UOOA 1F9AA 1CVIA 2GBGA 4AY5A 1K6EA 3S7ZA 5FUMA 5CYPA 4JLKA 3UT5B 4XKJA 3CNNA 4QBHA 3TRFA 2ZITA 2HLHA 2J30A 2Q62A 4C03A 1QHNA 3GK3A 1VGQA 4XD7A 5KAMA 2W6CX 3TM5A 3KVRA 3Q15C 3NWPA 4XWTA 3HL0A 4UE3S 4BTEA 3I9KA 2NP6A 4RHXA 4H1TA 2IY8A 4AKEA 4PHCA 3R9WA 3Q41A 5MF6A 2FFBA 4LZJA 3IO3A 2Q7DA 1L7AA 4BLUA 1CQWA 4DPGA 3AB7A 3USCS 3WYFA 1T26A 4CR8A 3ELWA 1TIKA 2VDNB 1GG8A 1F7VA 4YRFA 4BDTA 4BQFA 4B3TB 5AW1A 1MAAA 1VSBA 4HSGA 4FXPA 1UJBA 2A9FA 4I4TA 3NGLA 4QC2A 2G0TA 3B2QA 1NQXA 3NUZA 3LNTA 4JUDX 1CDZA 4XEMA 1QS0B 1X92A 4QXOA 2OZEA 4R8KA 2X2OA 2PGIA 4M8SA 4MS1A 5BOSA 3UY4A 1L5QA 3AM4A 2IU4A 3WG9A 1NN0A 4KRXA 1QE0A 4O0LA 2QGFA 4C0JA 3EBPA 3ES9A 1HOTA 2JIMA 2VHVA 4ITVA 1XEAA 1IJEA 2HO4A 2WFAA 3AZQA 3PNVA 4OKSA 2ZXFA 3T3IA 1STOA 1DJMA 1JQ3A 1I30A 2WU3A 2W4QA 2PRKA 3T12A 3V4VB 2G1KA 2EYQA 1E1QA 1KEVA 3GFSA 1N0VC 1JAXA 1IN5A 2IIBA 3LX8A 1BHQ1 5H82A 3WAKA 4N9WA 3ZJ5A 3VDQA 4BFSA 3IH5A 1JAHA 1H2WA 3JQBC 3QEOA 3WB0A 5IHPA 2BFFB 3TLYA 3R20A 3H05A 3RK4A 3S4YA 4E30A 4JKIA 3E1SA 2QD4A 4PLVA 3K6SB 2P3OA 2JFFA 3HV2A 1KVRA 5HX7A 5TMEA 1SN7A 1VDZA 1M5RA 2XDQB 2WIDA 2X19A 3SJAA 3QV2A 2PRYA 1E2GA 2X14A 2YRFA 2YV3A 4TVBA 4O25A 4AXBA 4EF4A 5I8WA 2IBTA 1RI2A 2RAFA 1CY4A 1US8B 2CF5A 3M6MD 4AL4A 2O8BA 3CW8X 2JCBA 3ED1A 4G56A 3OZRA 1ZBDA 3ABQB 2DUWA 3DA8A 4LW8A 4UCWA 1QVVA 5ECWA 3RVRA 1UXKA 1CUEA 3RI3A 1N0HA 1TMOA 2VLBA 4EVRA 3J80A 2GZRA 1GFIA 1Z7MA 1AUOA 1U8YA 3VO9A 4II2A 1YK0A 4NK4A 4P22A 1HFWA 1WDWB 1KDRA 3IIJA 4PQYA 1V9LA 3M6XA 3EYWA 3HBFA 4UNNA 4UULA 3VH1A 2A6PA 3JQQA 4MQ4A 1JXAA 1E7YA 2NUTB 3EHDA 3FNGA 3SP1A 3O90A 3WLTA 2FPXA 2EFJA 1MOZA 2PZBA 5ERXA 4OYLA 4D97A 1G63A 4EKEA 3PPIA 5DLDA 4BMOB 1CP2A 4TTRA 1BVHA 1DMSA 5L7TA 3L84A 3Q6NA 5C81A 1MQSA 2G0AA 1FW6A 5CPFA 5HQJA 1H8EA 4NC9A 1H65A 1DAHA 2WMDA 2OR3A 3BKWA 3TD2A 4LYHA 2BLNA 5ERYA 3OA0A 3BD9A 4YEDA 3TBFA 1HTWA 3PCOB 2GKGA 4KBFA 4TTSA 3WGNA 4EG8A 3DSQA 1C8KA 2XCRB 2P1RA 2C07A 2EIXA 2C0PA 4KFUA 3R3SA 3CVUA 3NJRA 3D7SA 3VR5D 4RQEA 3LX4A 4LQ4A 1QK3A 3SS9X 4YXWA 4E5YA 1Z5PA 3HBAA 4H4DA 4FBQA 2IXEA 4DRYA 721PA 2W4MA 2ADFA 3Q6IA 1F8YA 1TFRA 5ALRA 4PR0A 1QS0A 4JB8A 2VDMB 1I0ZA 1Q77A 1VFPA 2CLMB 3AXSA 3VU1A 2WNSA 3MOSA 3UVEA 2RSLA 3R75A 4F06A 2IBMA 4RTMA 1TM2A 3O9MA 4WVFA 1CIVA 5IVDA 1RPNA 3PQDA 1JR3A 1XSEA 5M7EA 1O77A 3BZUA 5EY5B 1DV2A 4UBKA 1JBEA 2QVGA 3KUCA 2D5CA 2B3TA 3VO2A 2CFTA 5HIKA 4F7WA 3UG7A 4ID3A 4PGFA 2C9MA 5EHQA 4MJ3A 5LMNB 1BE1A 1ZI6A 3H18A 3WLAA 1AOXA 2FOIA 2X5NA 3CLTC 3EEFA 3K6SA 3LC0A 4TQGA 2JIZD 1LYLA 3HFVA 2GD6A 2JJ8A 4HQNA 4KI0A 4XX0A 3F1LA 3QWFA 4MRAA 4X71A 2PGOA 4WZBE 4U8GA 3W6ZA 3ZWVA 4G6ZA 5DSTA 3T5PA 2ZR3A 3WK7A 3OPYI 4RKEA 3LD9A 1V47A 4I1IA 4E5NA 1YJ5A 1QVRA 4DEVA 1US8A 1SZCA 1ESZA 2R11A 1P7WA 4Y98A 2VPXA 3FWYA 1MGOA 4Q7KA 3A6ZA 3LSTA 1PO7A 3ZHOA 4CKYA 3FHTA 4NESA 4Q93A 2PH7A 3GBVA 1RXYA 1TQ2A 4R6XA 3TTCA 4L8VA 2P3QA 2JKYA 3PT9A 4JSTA 4YUAA 3D4PA 4MUMA 3NMUF 1HQYE 3DF9A 1XVLA 2HMWA 2JVKA 4FMPA 5C31A 1OC2A 1QNLA 2FU5C 1XCOA 3I6IA 3AZPA 3V2HA 3IABA 2R4UA 4KQHA 4OMCA 4KJZA 2DECA 3D6VA 1WYDA 1TRHA 2NG1A 3BGSA 5LYYA 4BLRA 4BVFA 5C37A 2ZIOA 3MEQA 1T4GA 1HFKA 3IDFA 4U6SA 1KSJA 1RMTA 2O5VA 1WF6A 2VPZA 3AP1A 4WNYA 3ZV3A 2QTWB 4TYQA 1D03A 1B7GO 1F3OA 1MRZA 3GJQA 4FK8A 1NHGA 5DNYB 2C8MA 4CCWA 1SCNE 3L8HA 1JWLA 2A1TR 3A4NA 1PTJA 1A9TA 4NOJA 4FGZA 5DYYA 3FGPA 1OH8A 4I9FA 2XE4A 1OR8A 1SD2A 2I3GA 3HY3A 1ZGAA 3I52A 1P2SA 1DRKA 1SBIA 2PZLA 3KKKA 3QQPA 2H57A 4RKWA 1E3WA 1UPFA 1FDTA 3P9QA 3GVPA 2J3LA 4HAVA 4UHBA 3VPAA 3ZWKA 4AYXA 1E9RA 5KBYA 2R0QC 3G02A 1L4FA 4PV7A 3DQZA 3ADOA 4ZQCB 3IIEA 2X6TA 3NT4A 2CRQA 1JHMA 1WUTA 3WLKX 4GPD1 3RS3A 1JIVA 4RA6B 5CVDA 3V1LA 5JD5A 4DY4A 3HVUA 4KN8A 1NXVA 1S3FA 2QU8A 4KN5A 3UWKA 4CG1A 1YU9A 1MENA 5CA0F 3FWPA 3W6PA 3QF7A 1GZ5A 3D8NA 4IGEA 4MKHA 4GLLA 3AF6A 2X7JA 3KQUA 3KKNA 1HRDA 4B4KA 4U7WA 1P3JA 4AZTA 2APJA 5KKNB 1YZKA 2QTRA 2EG5A 1FTSA 1SUFA 1VKNA 2ZIFA 1GR0A 2IZ7A 4NMHA 3H4IA 3OEHA 3HABA 5CRIA 5I9BA 2OECA 3PIRA 2EJGA 2ZCVA 3PE4A 3T52A 1GUFA 5E2IA 2XB2A 5LFAA 4Z53A 1H2ZA 3U39A 1U9IC 4BVLA 1E2JA 5LLSA 1RTTA 3SE0A 4DANA 5EPUA 5AVWA 1Z6YA 3WBKA 4GHWA 3W5IA 2RGGA 2ZAIA 1F0YA 3OJ0A 4H3VA 1GTMA 3BE8A 3D0KA 3Q7RA 4PC3A 4TRRA 4Y2JA 5D1NA 2WLSA 4UU8A 3ZIIA 3OLYA 4H2WA 3RKYA 4MKRA 5THQA 1ISPA 2YV1A 3DKKA 1GILA 2P68A 3TZBA 3SXPA 4MWEA 3MELA 4MMXB 4M0DA 5DYNA 4PZUA 1QMGA 3OSUA 4YECA 1M2WA 1Q14A 2ZANA 3BTOA 3EUAA 4WY5A 5F52A 3U0VA 4AZ3A 1XEWY 4QPCA 1EVIA 2OG2A 3CUEF 3LT0A 2C7IA 4YALA 4G4SP 4UNRA 4NPAA 1TLTA 2X0IA 3MM4A 3KXDA 2WWWA 5IJAA 2XZTA 3UM9A 3OVMA 5AVVA 3TIXB 2QM7A 4RYLA 3GHHA 3NYRA 2HWYA 3HS3A 4OQQA 4AUKA 2YHIB 1G2QA 4I4CA 5C32A 1J7JA 1LZLA 4EF6A 1V7ZA 1JU4A 3AJDA 2R8OA 2PRIA 5F76A 5IC6A 5E6RB 2J41A 3LY9A 4B9EA 3L04A 3PS9A 1D2GA 3ELBA 3P0EA 1IN4A 1CZHA 4L15A 2AR0A 1ZHHA 1X2GA 2A57A 5EJ8A 1L5VA 3CEMA 1ONNA 4F04A 1TJ4A 3AUFA 1H9CA 3SU8A 3RUIA 2XLBA 1IUPA 1JHOA 3F9RA 2XSZA 3KB8A 2OT3B 1A5AB 1VIAA 2VHWA 3RHTA 3S27A 1P9LA 1Q2UA 1T35A 3I37X 1R5BA 1YMVA 1Z75A 4XW2A 1ZUHA 1E22A 1SHUX 4TMFA 4BLSA 4QDOA 2TMYA 5CIYA 4LCBA 4IUBS 1A7KA 4CM3A 1KOLA 2O6HA 5JNTA 3O9VA 3TLGB 3IMEA 3EVZA 3COJA 5JROA 2KW5A 1ZRHA 4PVDA 4RA6A 621PA 3HXQA 2R97A 1E92A 2BSQA 4CIAA 3VPHA 1W4RA 1Q5PA 1HT0A 1U63A 1EB8A 1CULC 2FRVA 2ZBFA 4XU1A 1PWZA 5JXHA 3SR3A 1JJBA 4UPDA 1F4PA 4C7KA 1UBKS 1M1UA 2XXBA 4DM4A 3RAGA 1L5MA 2VP3A 4TT8A 4TQ9A 4DBLC 3DL4A 3I83A 4AZWA 5BN5B 2VAPA 1AKVA 2ONYA 3PUJA 1A97A 1WF3A 4JUAA 3NB0A 1DWUA 4OVKA 5DK6A 4RVGA 3L8FA 3U6YA 1BO6A 3NBZC 3P5SA 1U7PA 5ENVA 1MH1A 2PMEA 4DNOA 1JSCA 3L0SA 1EUYA 4EKYA 2JLXA 2HM7A 1NXPA 3QPUA 4OHVA 3F3KA 4PE5B 3B38A 4FGSA 4DGQA 3R0ZA 5TPZD 2ZINA 1SULA 1MOSA 3AVQA 2CBZA 1OJLA 3OOEA 4LC9A 1QHEA 4PLPA 4U3JB 2L69A 2I6UA 1FDOA 3HDJA 3TB6A 1Y34E 4DIMA 5C8YF 4U7TB 1D0SA 1T6YA 3L8MA 4GX1A 1ZRMA 4Y2YA 3RUAA 4MUXA 3QE3A 1HE3A 3GAMA 4L5CA 1N25A 1W4ZA 4I46A 4MWSA 4QGBA 2NU9B 5EHZA 1RDFA 1RZRD 1R64A 2NXWA 2PX8A 3OM8A 1EEXB 3ODPA 4LI3X 2J46A 4KYUA 3U3DA 3BORA 1TQ4A 3LY7A 4ZVMA 1G21B 2YINC 1SGWA 4CF4A 1WR8A 4WA7A 4Q4HB 1EDZA 3I1YA 4XPIB 3SLKA 2YBDA 3N75A 1DC6A 4QOSA 5LJIA 2GZMA 5LZ5A 2VSYA 2ZRQA 1MNQA 3IODA 5IBRA 3G88A 3UGKA 1RWQA 1XDGA 2V0CA 2IH4A 2WIJA 2XMQA 3M0EA 1FSSA 4IYRA 1RKUA 12ASA 2IXGA 5DGIA 3FCOA 3K0CC 2YHIA 2HJRA 4QBIA 4DDMA 4F4IA 1DKNA 4KB5A 2E65A 4GP7A 3P0RA 1EE9A 3G2LA 4H4CA 5E6RA 1F8XA 1TK9A 2V7EA 3CPSA 5IT5A 1IBLB 3HN7A 4R9UC 3CEAA 1MV5A 4EI8A 2XGSA 3OLQA 1PWXA 5A3VA 4DW8A 1F7UA 3P4XA 3NDBB 3AVUA 3FF4A 4Q3AA 4C20A 3W2IA 4KW7A 3FOWA 3NBUA 5FR1A 1FIUA 1YB4A 1G5PA 2ATIA 1SKAA 2RJNA 1DEKA 1WNTA 4D46A 4UDNA 3GEGA 1K6JA 4Y18A 2DEQA 2IX3A 1RAIA 5TNXA 1I4LD 1JSZA 5F2KA 3CKLA 3TLGA 2JCSA 1A8SA 3R40A 4HWTA 3SSAA 4JXXA 3W2EA 3TECE 2LNDA 4NNPA 1FYVA 4D45A 4IIGA 1V5EA 2EGGA 4HEJA 4J3FA 3ZYCA 1PV4A 4RO0A 1MTZA 1YMUA 3EZGA 3HZZA 4RWEA 2AXQA 3KL2A 2XECA 4BLTA 4LECA 2O7QA 5AI4A 4YRTA 1NXQA 1QKJA 3N6XA 4M99A 3V97A 1Y6QA 1W59A 3TSYA 5BN5A 1T5HX 2ORIA 1J4AA 4IXMA 5ITZA 1ZK1A 1E96A 4FMCB 3NV7A 4M0LA 1YI1A 3AILA 3E4CA 4EMUA 4PIMA 1XL1A 2WSMA 5I7EA 1NMYA 1CSEE 1VJ5A 3O31A 4L74A 4R8LA 1SD5A 3RSHA 1E9DA 2TYSB 4RA9B 3STHA 1XI2A 4YREA 3WXMA 1CUUA 4HX2A 3ZD6A 2JIDA 1CEXA 1HI9A 4U3JA 4ZZ0A 1XZLA 1L4BA 3R5XA 1CVLA 1UK9A 4IFBA 1W7AA 3IKLA 3C6XA 4RIIA 1G7CA 1U7TA 1YOVB 1IM2A 2PSDA 2VHCA 4LYAA 5EJ5A 3L2OB 4KWCA 4XLTA 5ICMA 2IYAA 3MCVA 1Z17A 3PSHA 4W8GA 4BE9A 1HDXA 5CR9A 4HHEA 5BWOA 1QUEA 2EC5A 1DAKA 1RPJA 5BO5A 3QSYA 2BF7A 3GJ7A 1G6HA 2YYAA 3G5UA 4JP5A 3OCUA 4TTQA 2ZZEA 1G21A 1EFRA 1R88A 1JJAA 4Q4HA 1YCGA 4XPIA 3EQ8A 3DP9A 2YYSA 3PUVA 4PZZA 1XFAA 3L1KA 3ZEAA 2CHEA 4RC9A 2O14A 1P5RA 1JQEA 2VYFA 3IAFA 3F73A 2REXB 4V0ME 2QQEA 2ZE6A 3UV7A 5JZOA 1U2SA 1GAJA 4JEUA 2JI4A 5CLQA 3P8VA 3GEDA 3RRMA 4DQ0A 2FN8A 4EHHA 3IO5A 1WU7A 3TR0A 2RHTA 1Q7TA 4HB3A 1CFJA 4HQKA 1HY3A 3EZ7A 4OHFA 4CLEA 1JE3A 3ZNPA 2XNCA 3A4YA 1KSHA 3B2EA 3WI7A 2W37A 3ZE1B 1FXWF 5C35A 2VHUA 1GG5A 1T43A 4RD6A 4PFJA 5AVOA 2HFJA 2WSBA 1QTIA 1VYHA 3NHRA 1Q15A 4HDCA 4R16A 3U7HB 2IHNA 1CRPA 4O2AB 1OA0A 4NAVA 1P1RA 3K5PA 1MV8A 3IJRA 3D3EA 1YJAA 1TMGE 4HGRA 1P6XA 1U7ZA 2EVWX 3RUXA 2JFBA 2AF4C 3E58A 3K70C 4JUFA 5HTOA 5ILOA 3EJ6A 1PJQA 1LD3A 5B3KA 1FFSA 2VTDA 1J9EA 1TK2A 3OKPA 4UP9A 4CCAA 4GYYA 2I67A 5I7VA 2FMTA 2KPOA 4FYJA 2A3NA 5JJIA 3QLVA 1EXVA 1JQJC 3DBRA 3MD9A 1SC4A 2CEAA 3VR5A 4X6YA 3DXZA 2XPCA 4BGUA 1AZWA 3M6WA 3X1XA 3FMPB 4YPFA 1E6CA 1QIFA 2H4YA 2I1LA 3ZKWB 2WINI 3O8RA 3BFXA 3FWHA 2BOVA 2UVPB 4C7OA 2MSEB 4Q01A 3RAEC 5AVRA 1XQ6A 3AF1A 2I87A 5TMBA 3GDHA 4V0NA 3ZKAA 1NGSA 1DJLA 1ZVJA 1LJLA 3LT2A 3RIGA 2RGUA 2VRCD 3ELUA 1XTJA 2CXQA 5J40A 3ZWMA 4URVR 2JHGA 5LD2C 4WK4B 3KT3A 1XXHB 3BM5A 4FFNA 3DEZA 3NRJA 1E60A 2Z8YA 3VPGA 2J5KA 3HCWA 5JS6A 5K0BA 1B76A 1Y80A 4JD5A 3SR4A 1MB4A 3W7BA 4U0JA 4MYDA 1NF2A 1BDJA 2G77B 2JAOA 3L1HA 1NRJB 3QLUC 4O0MA 4ENRA 4CKXA 1UP4A 4TKVA 4RA9A 4AN4A 2YDYA 1ZONA 1IY1A 4FE7A 3TPFA 4Z9AA 3DPSA 5ALIA 3IMCA 1CUBA 1D0VA 1KEUA 3I9MA 3RRBA 3AF0A 2JIBA 1YOVA 4TVAB 1ZRSA 2H4JA 3FHJA 4WI1A 4FYYA 3Q3GE 1JT2A 4J0KA 2VYND 2ZRJA 2AJ8A 2G63A 2A78A 4A26A 2P79A 4V0SA 2XYPA 2AD5A 2BFBB 2RHQA 2H7YA 3Q3JB 3QYAA 2R60A 4RIGA 1IATA 4WK6A 3UMSA 5KX5F 5KYKA 2FMKA 2CDRA 2YFHA 3FNRA 3QA9A 1K7EB 4BGVA 1NJ5A 3UOWA 2V6BA 4JQZA 3RRJA 3GR6A 3INRA 4EFMA 3FNQA 5KWIA 4LF6B 1YI8A 5EXPA 5FA5A 5DHRA 5KYWB 3V8KA 2R1VB 1XD2B 2X2FA 3ORHA 2CZCA 5JC1A 3N74A 5D85A 4FKZA 3GCWA 2FHPA 3N2GB 4MV4A 1OV4A 3UYKA 3ILSA 1AMUA 1LRLA 1U3TA 3M81A 1JHXA 1PK9A 1WA5A 1AUXA 1Y7HA 3FPJA 2OUIA 4WCFB 5K0NA 1Y4AE 1FCJA 3PQ5A 2GZ3A 3LYHA 4OHXA 2JFXA 4XUCA 1V2GA 4ZVQA 2CMFA 3OP1A 3GH3A 5TMPA 3Q10A 3AV0B 5J2TF 5K6AA 2QRMA 4BWYA 1E3TA 2VYVD 3ASZA 1RRPA 3BSWA 3PNMA 3RAJA 4NJMA 2C7OA 4O2AA 3B60A 2I1WA 3KT0A 4O1MA 4PRYA 4EVQA 3PQ7A 3DC2A 3OEYA 1W5FA 4G89A 1YQTA 4J8PA 3UJ6A 4DDKA 2FY8A 4H6PA 1ZPDA 7REQB 1DT5A 2CIMA 1EJ0A 2IOQA 3FZQA 1LPMA 3K6KA 1LB1B 4OSEA 1IPEA 2Q6IA 5AK4A 4R0MA 3OFSA 1QZUA 3AHGA 4CMCA 4DSUA 4Y2UA 3FHCB 3L5OA 1SC6A 3HP4A 5FAXA 4NBKA 1HUQA 3M1YA 3MGGA 4WAUA 4JLBA 4WXYB 5JRDS 2O8CB 4N0DA 2GVNA 5U4XA 3MUFA 3H0CA 4EKIA 1VJRA 4KQJA 1H6DA 3TLKA 3OECA 1NVUQ 4NJOA 3ZKWA 1S9DA 1KI7A 4GZ5A 1QU2A 1BXKA 1Z2CA 2XYGA 1K06A 1DUIA 2UVPA 4C76A 3THYB 4DQVA 2HBQA 4BAGA 1EESA 1IYZA 4GRIA 4DBZA 3ECSA 3RWOA 3G68A 3KVNA 3OPQA 3V7CA 4EX6A 1GAWA 1XXHA 2DCUA 3PP8A 3U9SA 1XT6A 4CWAA 4M55A 1IXZA 4K81B 3EBLA 4PAMA 3D3QA 2CGHA 3DMGA 3VAZA 2ET6A 3NHLA 4MJ7A 4RABA 4XD2A 2ZTLA 5KYGA 2FXIA 3W1EA 1R5OA 1PI3A 1ESNA 2FWPA 4AMZA 1L7XA 5LQMA 3ECAA 4E08A 3MRSA 3C5EA 3PUZA 4P36A 3INTA 3JQRA 1C0PA 3T7IA 3ZJVA 2ZWMA 3NDRA 3PRYA 1HE2A 2VPWA 3CTMA 1A8PA 2C1ZA 4QXPA 3V4RA 2PD3A 3JQ9A 4U2BA 2EAYA 1W581 3F98A 3M33A 1AHPA 1U02A 1XWWA 2W43A 4IOKA 3IUMA 3I8OA 3JASB 5JOQA 4F12A 2BFBA 1OU0A 2XQVA 1KQOA 1YKGA 3K1AB 1F8FA 4LMRA 2DUJA 3FWZA 4BU1A 5F23A 5G2OA 2ZTHA 1FTGA 3V1UA 2SICE 3NYQA 3QE2A 3T6KA 2CD7A 2E87A 5HQTA 4U7FA 2JASA 3IAXA 5AK0A 1MEEA 4UVHA 5KYWA 4BBJA 1P2UA 4YI3A 3NHMA 4PQFA 3E9IA 3UO8B 1ZGGA 3GLQA 3M4YA 3N2GA 4K9NA 4B85A 2HNBA 3A1EA 4BUCA 1ZI8A 3QWHA 1G9TA 4WCFA 3K7EA 2NMVA 5A6SB 1E1TA 1QHIA 1RMQA 2XNJA 3LYUA 2W22A 2DYKA 1VIDA 3CA8A 1S8FA 1Q0RA 3BWMA 4BKQA 2FLWA 2ZDGA 1T1JA 3RIEA 5DBEX 1XNRB 1IL2A 3C3DA 2YYZA 3NP9A 4XWYA 5B12A 5I4BA 1Q0TA 4H7HA 2B25A 2HQBA 4E14A 2NZVG 4LTNA 2ZUUA 1CUDA 4UAUA 4M38A 3PFWO 3BPSA 1SAYA 3FRHA 4LJ5A 4LRSB 1F0PA 4FNOA 3F5FA 4X84A 5ALSA 2PA0A 1G5TA 1X6VA 2FCAA 2PFSA 7REQA 2W8ZA 3WJAA 2QVYX 3M2TA 1XKXA 1KY3A 2P78A 3N6VA 4ESOA 3AHJA 5HZKA 3EGEA 2OLKA 5EXSA 2BE9A 4ZZ1A 2XDWA 2E49A 2GCPA 2O3SA 4DIOA 4DGSA 1BXGB 3KZ1E 2O8CA 2ECQA 3UJDA 1YOBA 5IVHA 1OKKD 3WLQA 4RV5A 4YACA 3R7NA 4NAUA 1V9SA 3BJMA 1F12A 3PYLA 5AKGA 4Z6KA 4EYQA 1FSPA 2PGJA 1HE4A 2GFQA 3MFQA 1ZD1A 3THYA 3QKBA 4NBRA 4QOGA 2GH1A 2BBTA 2X7HA 4LGMA 2IDJA 1G7TA 3AHEA 2NZ8A 2AN1A 2R6ZA 1P80A 2H3EA 3ED5A 2IELA 4PSDA 5A3RA 2GT1A 4HD8A 5LU9A 3BIOA 3OHSX 3WWCA 1Z6XA 1JG3A 1Z4QA 2A9RA 3I2FA 3IQHX 4LY0A 4LRQA 4TPKA 4WGGA 1JTFA 3WWOA 3TMYA 3CURA 2OPHA 2ZJFA 5B2FA 9GPBA 1JKMA 3ZZMA 2PYDA 1LA2A 2P5IA 1DRVA 1OI3A 1XV5A 2YDXA 4KQ6A 3AL3A 3LKBA 2VSFA 1ZN7A 4OTZA 5BQFA 4IFTA 3KZXA 1VPTA 3QZUA 2MIIA 1SQ6A 4U02A 1GPAA 1DE0A 1JLHA 1X13A 3FPEA 2Q4TA 5FUVA 3R07A 2C3YA 1IRXA 3IAM1 3UTDA 1HZJA 4D42A 3LQFA 4OQMA 2WSYB 4TZTA 3PUIA 2Q3VA 1XTPA 2UZ0A 3AUUA 3RBZA 4F3TA 1EPUA 4P71A 3OZTA 4L5JA 2HU2A 3JASA 5DN6D 3DB1A 4HNVA 1WDMA 1LGYA 2W2PA 4UNIA 1N9KA 4F86A 4FB4A 1P61B 1Y8CA 3I39X 4LE1A 4MRPA 4S1TA 5JZSA 2EQBA 3UJ8A 2H1IA 4J07A 1CC1S 3L77A 4RPHA 3VBEA 3RJ9A 3AM3A 3HJFA 2Z3ZA 1C7EA 1PR5A 4H15A 4PZPA 4TZ6A 3UAZA 1II7A 2CLOB 3PVSA 2O0HA 2FVXA 4L4XA 4ZVNA 4ZMSA 2E37A 1FNNA 4EMTA 1YL5A 3Q7TA 4P4TA 4EYSA 1PUXA 4TX1A 4ER0A 1LH0A 1YRQA 3NXSA 3VQTA 2XQKA 2CXNA 1IZ8A 1SOWA 3COSA 1BRTA 1YULA 1JEAA 1SIWA 3CX3A 2KHZA 1KI9A 3EIOA 3KQPA 1U2GC 3O4IA 4FFOA 4DMCA 5A6SA 2NSJA 5FBWB 5EHNA 5IVIA 3A9CA 1Z6AA 4D3SA 4EJMA 5JO0A 2R5FA 1P5FA 3U1VA 3KJIA 3QEJA 4FHFA 3VU9B 2QYHA 4LJSA 4XM0A 5JAUA 3HLYA 4F5WA 1Y48E 2X3UA 1PZFA 2ZB2A 4L08A 4W9NA 4QTYA 4CM1A 2JBWA 2HMYB 4UOQA 1RJFA 5DB4A 4DR5B 1N57A 2HFKA 1R27A 2N3ZA 4KR7A 3PGA1 1QAOA 2CMDA 2JLUA 2QZSA 1C80A 1ZWLA 2RAPA 5FI1B 4E03A 1GG9A 1PZGA 2YOHA 3K20A 2KX7A 3CR3C 4I9UA 2B30A 1Z5WA 4Q12A 4JMPA 4EGQA 1V95A 1GQSA 4QDXA 4DJ5X 1IXRC 2C82A 5CUQA 1E18A 5BNWA 5KJ6A 4EARA 1NV9A 1XTBA 3OD1A 2IDZA 4EATA 3RWMB 4A6PA 1WW8A 4JT2A 4TS1A 3BB3A 3JVDA 4NZYA 4ZVVA 3ZK9A 4EHAA 3H86A 1C0EA 3HKCB 2VPTA 1THTA 5AW5A 4IVQA 2GRUA 1W88B 2O07A 4QRHA 1GDDA 3THWA 1GRNA 4JNCA 2ARSA 3S29A 5B3AA 1BD4A 2A5DA 1TYCA 3RVSA 3ZW8A 2YFYA 5LL6P 1X1BA 5FKJA 1YDHA 4KPUB 2FR1A 4RGVA 1EVZA 4NCNA 3SJ7A 3VV3A 4CGYA 1QKKA 1BBUA 2XVXA 4HNGA 1JNXX 4M60A 3H9GA 3PWKA 2OHIA 1KY5A 3K1JA 1DKPA 4KUGA 3KQHA 2DWUA 1OZHA 4EYOA 4HV4A 1C4KA 1R18A 3HVHA 1PZXA 2FKNA 3HO8A 4IY1A 4HXYA 4DKJA 4RTOA 3TL2A 4BO6A 1F4LA 2PUAA 2EGUA 5K8CA 1LSUA 3BGVA 2IKSA 4M1EA 2M6SA 5DTEA 4P83A 1SXPA 4NBWA 2ZQYA 1OFIA 1CW2B 4PZEA 3VVMA 2FEOA 3CGWA 3TN7A 2XR1A 1CZOA 5HCIA 1CDDA 2YC2C 3OPNA 4UM9D 1A9ZA 1MIHA 3EARA 4JWTA 4IV0A 4X9XA 4XWKA 4BO0A 3MTBA 2P9YA 3SZOA 1WCWA 2GVDC 4F45A 5KWVA 4ZWNA 5KYYB 2BKUA 1ASYA 1N2ZA 2QPLA 4BKPA 1WABA 2R8YA 3BWVA 1CJBA 1U4SA 3F8WA 3GRFA 1P7VA 4LWOA 3KR0A 1CVRA 1W96A 2QRHA 3UAOA 5JS7A 3CF6R 2XMDA 1U7OA 3VPFA 1N9WA 4Q66C 1XROA 3VU9A 3LYLA 3ETGA 2NO1A 3JYHA 5K1XA 1ODIA 1XTTA 4JLMA 1Y1TA 2WU1A 4ZHQF 2CKDA 2D59A 2PL1A 4F2PA 1OB2A 1Y3IA 4MDFA 3OZDA 3PENA 5DBIA 1RI5A 4H2XB 3ET4A 3GF4A 3IP1A 2E89A 3R3WA 5AMXA 5AXAA 1KWKA 4LFBB 5AQEA 1DXQA 3UUWA 2EJTA 2JA2A 3TEMA 4C6HA 3TOEA 3VR4H 3K0FB 3OJXA 2WICA 1E6EA 4J0HA 4Z4QA 2VBCA 4D8WA 2JHPA 4X1KB 4ZDJA 1M74A 1MR3F 2D8AA 1SXGA 1C0AA 3EMBA 4GI7A 4O3MA 3K6RA 4BMYA 4P7GA 4OQDA 4R83A 2ZRMA 4BQSA 1WLSA 1I4EB 3FR8A 1WETA 1NV8A 2C88A 2V59A 4I08A 3DBHB 5TC4A 1C7ZA 4HFNA 2BGGA 4L6IA 2XT6A 1BXRB 3MRTA 1NP7A 2FSIA 5F3RA 1N8SA 1UJCA 1FFBA 3A3PA 3ZHZA 2PGXA 3AVVA 3JPWA 1SHKA 2WE8A 3PT5A 3CNBA 4Q39A 4IWXA 1OAAA 3HKCA 2JFPA 4X3OA 4HLNA 1W88A 5KOYA 5I5EA 3UV6A 4EGFA 3OU6A 4LMBA 4BN0A 2WJAA 4YRCA 2BEVB 2EDAA 3FNBA 1JPNA 2WHYA 4K6FA 4MWTA 4Z9YA 3PFGA 1O95D 1U8AA 4OH1A 4URYR 2WFLB 1CK4A 2H63A 1MJFA 1UJ4A 3B82A 3V7WA 1OMOA 2VYCA 3CFYA 3GVXA 3W5AA 1YCDA 2GN2A 5JSHA 3QUTA 4LX8A 4D4HA 5EERA 4ZODA 2C3MA 1FYWA 3UB2A 3ZUGA 4WESB 1V8BA 1ZOOA 4RZSA 4UBLA 5LQKA 5D8DA 3Q2KA 3EZ6A 1V8DA 1DQSA 3G3EA 3JZAA 3IUJA 3L7IA 4Q16A 1DO8A 4ADSG 4B4OA 4YCDA 1WCIB 2VYNA 2ZRNA 2FN3A 2H1FA 3FTDA 4ZO7A 5EMKA 2O20A 2HQ1A 2Y1GA 4GNKA 1W0JA 3NTVA 4KQCA 1RXEA 1ZVMA 4PRKA 2ZJ2A 3CZ9A