4K86A

Crystal structure of human prolyl-trna synthetase (apo form)
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
497
structure length
488
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proline--tRNA ligase
publication title Conformational changes in human prolyl-tRNA synthetase upon binding of the substrates proline and ATP and the inhibitor halofuginone
doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 151
structure length 488
sequence length 497
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4k86A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4k86A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4k86A02
4DPGA 2IY5B 4H2TA 2Q5HA 4HA8A 2DU7A 2ZIMA 3FJPA 2Q7EA 1IL2A 1H4QA 2DJZA 3RIRA 1V95A 4WI1A 4RQFA 3OD1A 2ALYA 4YREA 3A7RA 4KQEA 2QHTA 3VQWA 1EIYA 4XU0A 2RHSB 5C53B 4YRPA 4NCXA 1J5WA 4YROA 4EO4A 3V8JA 3L2ZA 4H2SA 3RKXA 1WQWA 3L4GB 2RHQA 4OLFA 1QE0A 1WPYA 2DZCA 4Q15A 4WJ4A 1NYQA 3A7AA 4P71C 4XU1A 3PCOB 4TTVA 2ZCEA 1RIQA 4LNSA 3QO5A 2CGHA 3G1ZA 1JJCA 1WU7A 2E10A 4H2VA 4P3OA 2ARUA 4CS3A 2DTOA 4YRGA 2AMCB 2ZINA 2CJBA 3V8KA 2CJAA 3VQYA 1H4SA 2DQ0A 2ALYB 3HY1A 2DEQA 1B70A 2EAYA 1W66A 1BIBA 4XU2A 1EIYB 3IALA 3ERRA 3HFZA 2FYKA 3QO8A 2ODRC 3HXXA 1BBWA 1G5HA 4WF2A 4YRMA 1NJ5A 1HTTA 4PHCA 2RHQB 4XEMA 4YRTA 4YP0A 1YFSA 1E22A 3REUA 4H2XA 1YB3A 1EVKA 4YRLA 4YPFA 2PMEA 3I7FA 3BFMA 1BBUA 4TVAA 1G51A 2ZGWA 1EVLA 3QNEA 3RF1A 4ZIBA 2ZTGA 4RMFA 4XTYA 3DSQA 1WLEA 2G4CA 2EWNA 1LYLA 2ZZEA 4CH3A 4P3PA 1G5IA 3EFRA 3HY0A 3QO7A 3BJUA 4P74A 3UH0A 3MF1A 3R07A 2E5AA 4WJ3M 4YRRA 1NYRA 3TEHA 4RQEA 4HWRA 2DKGA 3TUPA 1WYDA 4J15A 4CS2A 3HFZB 3HRKA 1Z7MA 1PYSA 4L87A 1NJ1A 3UGQA 1BIAA 1GGMA 2Q7HA 3KFUA 4YCUA 4TQFA 2EJ9A 3IKLA 3VBBA 4UP7A 5E3IA 5ELOA 4YRQA 11ASA 4TVAB 1SERA 3WQZA 3L1AA 3A7UA 3A74A 2DZ9A 2J3MA 4K87A 2QHSA 2ZT6A 1ASYA 3EFSA 3RL6A 3NENA 2DTIA 4KR3A 2EJFA 2ZIOA 4CS4A 1KMMA 2QHVA 2ZZGA 3RACA 2ZNIA 2DDZA 2DXTA 4YRIA 4TVYA 3TEHB 4XTWA 4H2WA 2DTHA 4E51A 3TEGA 1SRYA 1YFTA 4P74C 5F5WA 2ZT7A 1NJ6A 3V7RA 2E41A 3P8TA 4KR2A 4H2YA 4HWSA 4K86A 1YFRA 5K1PA 3HXUA 3NETA 3RKWA 2ODRD 4H02A 3MF2A 3HXYA 1X01A 1FYFA 1H4VB 2Q7GA 4HWPA 3HXWA 3A32A 2CIMA 3VQVA 4XTXA 2I4MA 3LSSA 4G85A 1YGBA 3V7SA 4G84A 4H2UA 2ARTA 4EX5A 3ICAA 5C52B 2ZT8A 4PG3A 4P72C 1JJCB 2RHSA 4YCWA 2E65A 2I4OA 3E9HA 4BWAA 1B7YA 1KMNA 1ASZA 3IKMB 3QTCA 4YRSA 3W3SA 4X5OA 1E24A 4YRKA 1VQZA 1NNHA 1X2GA 4UP9A 2J3LA 3NEMA 1B70B 3A5ZA 4TWAA 4HWOA 4YRJA 1KOGA 2LW7A 2ZXFA 1ATIA 5HGQA 3NELA 1SETA 3LSQA 1NJ8A 2DQ3A 2I4LA 3V7CA 4H2XB 2ZT5A 3MEYA 1SESA 4ZTUB 4XEOA 1L0WA 1ADYA 1X54A 2P5IA 2AMCA 4DQ2A 1Z7NA 1WQ7A 2ZR2A 2PMFA 3IG2A 3A5YA 4YRNA 5K1XA 4P72A 12ASA 4XTUA 1EFWA 3CMQA 4CH4A 2C7IA 2ZNJA 4P75A 1B7YB 2ZZFA 3HFVA 1USYC 3E9IA 2E1HA 3HRIA 1ADJA 3P8VA 3P8YA 2AKWA 1HXDA 2C8MA 4BW9A 2DXUA 1B76A 4XTVA 4RDXA 2P0LA 1PYSB 3V8LA 4XTZA 2QHUA 1HC7A 1B8AA 4TQDA 4P73C 5ELNA 2EJGA 2HNIA 3RKYA 4YRCA 3VQXA 4UPAA 1X2HA 4Q6GA 2XGTA 2XTIA 2E3CA 3PZCA 4CH6A 4HVCA 3REXA 1E1TA 5KNNA 1E1OA 3RGLA 4CH5A 4AH6A 2IY5A 4XU3A 1WNLA 2EL9A 2I4NA 1NJ2A 2ZR3A 3HTZA 4OP0A 4TVWA 1EQRA 4ZTZB 1X56A 1USYA 3LC0A 2E64A 4HWTA 2ARSA 4P71A 2AKWB 4P75C 4YYEA 1QF6A 2Q5IA 3L4GA 3M4PA 4P3NA 2DVEA 1C0AA 3HXVA 4O2DA 3PCOA 4P73A 1N9WA 3UFGA 3M4QA 3UGTA 4UP8A 4YRFA 4K88A 2CJ9A 1X55A 3RUXA 1H4TA 2DU5A 4YDQA 1EOVA 5C51B 3HXZA 3A31A 4YCVA
chains in the Genus database with same CATH superfamily
3G5TA 3I6QA 2G06A 3H83A 1SKQA 1MH1A 1SU4A 1V8ZA 1WA5A 1WV0A 2H1FA 1T6YA 2VLBA 1PO7A 3RVQA 3JZIA 2Z5FA 2DKFA 3TTWA 4ED9A 1EWRA 4WI1A 3HY6A 4L22A 1CNFA 4YREA 3NHLA 4Z9FA 4BJ5A 5DNEA 1IZZA 1EZZA 5KMGB 4AMGA 4TRMA 5BNWA 4KSCA 3VQWA 1EIYA 3AETA 4B9AA 2VSNA 5T4BA 4QDJA 2FFJA 2Y68A 2C4UA 4QNRA 4S0ZA 4QT4A 3VC1A 1J5WA 1XQ1A 3JQDA 4J9UE 1UK9A 2IEYA 3PTZA 5FL7A 1FMCA 1GFWA 5L7YA 2IPMA 1YQTA 4IFEA 4EFKA 3RKXA 4LS3A 2WZBA 3ITDA 3BXFA 2J0VA 2J67A 4EX6A 3I8XA 2XPCA 2ZYIA 1L5WA 1O0CA 1DLIA 4MWTA 2WRZA 2LGJA 2GCIA 1H6AA 4ZV7A 1ZESA 3QVGA 4NXMB 4KGZA 2O2HA 3UV7A 1G8KA 4ERXA 2C77A 4AP5A 4CT4B 1RRCA 3MGGA 1U2QA 1ODLA 2QL7A 1QLHA 3EC2A 1EH5A 3E3MA 4TMFA 3WZMA 1BVUA 4CBVA 4DXAA 1AV6A 1IH8A 3A36A 4HADA 4BLVA 1NR1A 3R4VA 2HMSA 3BMNB 5I5GA 4AQYB 3X0DA 1SB8A 1HETA 2C5GA 2H3HA 2VBFA 1BEUB 4YS6A 2AXNA 2XE7A 2ECFA 5AK4A 1AA6A 1V5FA 1JJCA 2O57A 4UJ3A 4H3KB 3WJ7A 2G07A 2E10A 3CJQA 3CY6A 3TOSA 2ZCVA 1KJZA 3L1VA 3VR5A 2C2ZA 2OGWA 2FEWB 1MENA 1OYWA 3EZXA 5C8YA 3TOVA 2P1RA 5LP6B 1PTJA 3E4CA 4FP9A 4NNOA 1G1AA 4PZYA 1NW3A 5T8KC 2CJAA 1TYCA 1U4OA 4TVSA 3WLKX 3QK7A 3X1JA 2PUTA 1FMLA 3C3CA 3I9FA 4F4CA 3ER9A 3HY1A 2I3BA 4D4LA 2YWCA 3H1AA 3L0YA 3ZE0B 1TKCA 1EQUA 4MQ6A 2H2WA 1NVWQ 3O91A 1TVMA 1YJAA 1N8KA 4HX9A 4RY8A 4Z0PA 4IRXA 2W2NA 1VYUA 1T9GS 2NTJA 4O1MA 2D0OB 3U17A 3V1UA 2PUDA 1OIWA 3MS2A 4YNBA 2K6GA 3ZYCA 4RADA 3F98A 1VIYA 1Z16A 5A2GA 5JVDA 2NNLD 1C3JA 1C2TA 3R3XA 1L9KA 4XDGA 1CRPA 4KFSA 4M55A 5FBLB 2Q6TA 4DWOA 2YRWA 3FUVA 4LOIA 4DYHA 3SBOA 3U49A 3U3OA 2P6RA 1LSOA 2C82A 3FOWA 3EF0A 4Z9XA 2H2IA 1OX4A 4HP8A 4YMIA 4EH1A 3PA6A 3VKVA 3T38A 2EAUA 1VE7A 3O73A 3H9CA 3RUFA 1Y5NA 3GBPA 4NATA 5LN1A 2ODNA 1UDRA 4PHGA 3CUKA 4BQSA 3C6BA 1U7WA 4A2CA 1QWSA 3I23A 1XVAA 2OE2A 3Q0TA 4HDCA 4ZTBA 4BTLA 4NBTA 2BRUC 2ZYHA 4XARA 5GJCA 4K6OA 3GV0A 3H9UA 4MRSA 5DKFA 4BFVA 1MIOB 3VUEA 2YDXA 4OHVA 1LK5A 2AUNA 2X22A 3TNYA 1ZINA 3G2IA 2XZOA 1M2EA 2Z2JA 4MQBA 3SM3A 4N0QA 3C1TA 1YJCA 3HI4A 3BD9A 4O2AA 2CVOA 1AG9A 3K1AB 5AXAA 1SUCA 3L0IB 3HN2A 4O8ZA 2ZJ3A 1Q0SA 2OCLA 3C8HA 3PEEA 3QF4B 4QYMA 2ZYRA 4R6WA 2FETA 1AUVA 1DBRA 4DLWA 1OLOA 2IQIA 2P62A 4L4SA 2IDKA 5T6MA 1DAIA 3TO5A 3IMCA 1ZGJA 3ZZ0A 5F7XA 1TQ4A 3RVNA 1V3TA 2Q2QA 5LYYA 1A4UA 1IZ7A 1KR2A 1MB4A 2MYTA 1UP4A 4DSNA 4DZTA 4RV5A 1Y4SA 2O5RA 3K9WA 4DUYB 2A33A 4UJ5A 4E4YA 4MK4A 4MCHA 1C7EA 3E22A 1Y48E 5AOBA 4JQZA 4K9MA 2FSFA 4AY4A 3W5AA 2QGFA 4PM4A 1L5HB 3UGQA 2J0UB 3T6KA 4KN8A 1TAUA 5JANA 1XLVA 3U4CA 1NRWA 4LOAA 1R3UA 4TLAA 4UNQA 1I3NA 4BVKA 4J0EA 2IY9A 3VU3A 4BPBA 1IAVA 2B0CA 2PX0A 2NU8A 3SJBA 3P52A 3UIEA 4AZ0B 2OCIA 1QFSA 3HJAA 3VGJA 2CL0X 1W1IA 3GGSA 2QBYA 2ODBA 3S3TA 4YC7A 3GT4A 5CD1A 1FRNA 1U1FA 3GJYA 1RAFA 4JV5B 5EA2A 4ZHQB 3ND7A 5CT6A 3X1YA 1IPHA 1TVKA 2EQ5A 5A9SA 1QZUA 3AMVA 4RK1A 4HSGA 1DRVA 1HFWA 1K75A 3NRJA 3H3JA 4AZ3B 1B74A 1RI3A 1QP0A 3GJQA 4EI2A 2FJ0A 1F38A 1FW8A 3M3HA 2XZLA 1NUUA 4N3GA 2V54A 4BDTA 2VHXA 3WA6A 5KCZA 2G63A 1T6XA 2ZT6A 3C3WA 1KAHA 3LXUX 4MWBA 1D4AA 3LOPA 1IN6A 2GTPA 4LDJA 4YRAA 1QP4A 3LUDA 3ZLJA 4KYIB 3JYPA 3E3NA 3LKZA 1T5TA 3LCUA 4UUPA 1DIRA 4ZAGA 1WNFA 2HLPA 1XTQA 1YZUA 3WIBA 1G59A 1G5QA 4B3TB 1TYAE 3U37A 3QWIA 1IOWA 5D3KA 1BXZA 3D8TA 4GI7A 4OXQA 4WNAB 1XTJA 1ZONA 1RRMA 2NUPB 4E46A 4N8DA 3C74A 1XRJA 1DEHA 5EPOA 4ZEWA 3BREA 5H9VA 1DBVO 3M5CA 1Q6ZA 1SUEA 3G82C 1H6BA 1ECGA 4KODA 4CF3A 1VLLA 1M7GA 2VRWA 5ALTA 1LEHA 2X0EA 3FMVA 3UJHA 3RVLA 1E6KA 3MMSA 1GA4A 1JSZA 1NXSA 1GL3A 3RB8A 1DJPA 3ABSB 3DHEA 1NVAA 2GYWA 5SY4A 5ETJA 2C98A 3NRBA 3W6OA 1N8TA 4CIWA 2ID8A 3ZDEA 4ITRC 4N7BA 1HLPA 4MDFA 4ER0A 3ZJVA 3K0CA 2YV4A 4BIMA 4L2IA 1P81A 5JDIA 3W3ZB 4HDNB 5KBYA 5KC9A 3K1ZA 1GUZA 1YNOA 1DQNA 1SO8A 1DCJA 3NT2A 4EY6A 2Y2UA 1C0LA 2C4NA 3A3YA 3QA9A 1NI3A 4EQ6A 1XVIA 1VP3A 3BGDA 1DV1A 5KVSA 2HZBA 5ANRB 4U2EA 3RHTA 4H6PA 4I1PA 2PUFA 4QM6A 2ZJ2A 1YS1X 3EUWA 1NI4A 4C4PA 4M7OA 3AFGA 1FYFA 4PLFA 1S01A 5LLSA 4YCSA 3UJ8A 3G3EA 1OGYA 1Z74A 3COWA 1K66A 4BNYA 3MHTA 1PQUA 1SQSA 1Z5VA 2Z57A 4QODA 4MJ7A 2L82A 5F21A 4GYWA 5IS2A 1E2JA 3OFJA 3JATA 4JYAB 4K6FA 2X41A 4JB2A 4TLDA 4E2ZA 2GZHA 3FZQA 2P40A 1LBSA 1I36A 1BS1A 1Q3TA 3O26A 5BSKA 5C9ZA 5JLJA 1HNWB 4ECAA 5IJ9A 2GJ8A 1XA3A 2ZW9A 3JQ7B 2UU9B 5HGXA 4BMYA 1QRTA 3REFA 3I09A 5DCLA 1G9TA 3AW8A 4GMXA 5F73A 2ZUWA 4BO1A 4NFYA 4ACBA 3L40A 4CM9A 2MJLA 3KALA 4JL8A 3FPCA 1PLLA 2Y1OA 3ZU4A 5JD6A 4MAMA 4QLAA 4YCWA 2Q8QA 3ZWNA 4YMWA 1M7BA 2A58A 2QPTA 2VUIB 3OP4A 3GNLA 2X0RA 4ZVQA 2N46A 4AJNA 2C20A 5B3AA 4QQFA 5J4KA 3NM4A 2ZWPA 4ZXPA 1LTQA 2VKTA 3GN1A 1PWHA 1TCVA 3KKNA 5BR4A 1AGYA 1QCZA 2AZ4A 2B5OA 3L6RA 2DRIA 3DPUA 1JMKC 1M8JA 1ASZA 2J7PA 4LY3A 1FDRA 4IIJA 4PXAA 4W1QA 3RABA 5G0WA 3NM5A 4N39A 4CLDA 5EZQA 1W5FA 2NU7A 3B9RA 2VNIA 1QXSA 3BXEA 3QG5A 1U1EA 3IERA 2I4RA 3A1CA 5ESXA 1DB3A 5ILGA 1NRJB 2CF5A 3HR8A 3B53X 4YACA 3K9QO 1C7JA 1ACMA 1KIAA 3OPYI 4J16A 1ESZA 2XTNA 4E5KA 5JNTA 2C3YA 1RABA 2FMUA 3PFNA 3QTTA 4F3RA 3AB7A 2XUOA 4AUEA 2GZ1A 5D87A 2I71A 5F1OA 3E7DA 1Z0ZA 5A1JA 4TTSA 4YXWA 4IMPA 4GOLD 1A8IA 1JU9A 1PZXA 3EMKA 4H1VA 4DV4B 2PRIA 2WKQA 2BGNA 1AN9A 3V2IA 3F2VA 1NJ8A 2OO7A 1FVXA 3L84A 1RHRA 1RM5A 5LP6F 3HBLA 3MTAA 3O7MA 1SUDA 2OCKA 4LYGA 2WIGA 1RI5A 2POQX 4M1KA 3AF3A 1C1YA 2VDKB 1S96A 2VF5X 2J5KA 4UQLA 4D3SA 1L0WA 4TV8F 5B1YA 5KQLA 3TSWA 1Y9DA 3HCBA 3DT9A 2PSDA 4QPZA 2FVYA 3DE2X 4DQ2A 4Q9IA 4GVLA 4B33A 1L7MA 2DY0A 4FHGA 4C2UA 4L0DA 2OPBA 1WM1A 4GX5A 1HPLA 2J48A 3I42A 4YRNA 4U7HA 4ESVA 1QG2A 4CFYA 2JK0A 4YCAA 4CQLB 4HDSA 1SXQA 2E4VA 2E48A 3HU2A 1PJ4A 4CLXA 2AKEA 1KJYA 1KZ9A 3AM4A 3G2PA 1Z2PX 1Z6ZA 4IM7A 4MIYA 3RYFA 1KQFA 1QRSA 4E14A 2OXEA 3IUNA 2KWIA 1WF6A 2ERXA 1NTOA 1JHAA 1XRRA 1GG8A 3JCZA 2ZZFA 3WLIA 4NJMB 4LNAA 4RHEA 5EUQB 1F20A 3VR4H 1TX4B 1NQTA 1IUOA 1W0JA 4IKEA 1IIBA 1O58A 3PNKA 1PVVA 1TI7A 4AO8A 5IJWA 4ZQIA 3THXB 3A4YA 5ILOA 1XQYA 4GW3A 2C03A 2VJPA 3DAPA 3DLCA 3FCSB 4AM8A 3M6IA 1N5MA 3BE4A 1IPEA 4JBIA 3IQGX 3GCGA 3P8YA 5AJZA 3TIXB 1P17A 2MSWA 1HSOA 2HBZA 2V5UA 3LRXA 2HNKA 2ORWA 3ABOB 3R8CA 2BD0A 3O95A 1UJMA 1BGXT 3TTTA 4A8JC 4MP6A 4Q00A 4GLFA 2F62A 3NBFA 3G0BA 3N74A 4CM1A 5JS1A 3V8LA 1WF3A 3GGCA 4JEMA 3VR3A 5JAPA 1XPUA 3DE5X 2UUOA 1VKZA 3B89A 3D1LA 4TQDA 2FMHA 1YR8A 2IGTA 2XNDD 3ZVNA 1BH6A 3D7LA 5FWXB 2GUWA 2ZJ0A 1JA0A 2P11A 4MA0A 4RTLA 4PZEA 1ZGHA 2VTDA 4QU8A 2PGXA 5DBIA 1XR3A 4AJEA 3HCDA 4DA6A 2XWPA 1GZSA 1QF7A 3DPSA 1E2GA 8OHMA 5L3SB 1LDBA 3QU4A 4B6FA 2MDTA 3PYLA 4HGQA 2FW9A 2C3OA 3NU1A 4HGOA 4LRQA 1E2EA 3UB2A 2GILA 3A3KA 1RCUA 4P6VF 4EVSA 3IE1A 1B16A 1NQ5A 2BKVA 3KPUA 4WERA 5HHTA 1XNRB 1ZIDA 4K81B 4OHFA 3WLOA 3T1HB 4IO0A 2JKVA 3DYVA 4TT8A 1P2UA 2G1AA 4CKEA 1QHIA 1TO1E 2B2XA 4RABA 2A9PA 4Q24A 1J24A 3LUGA 1Y42X 1FCJA 2VPYA 2AJLI 2CXRA 4CKBB 1SQ6A 2O2EA 3DZJA 3IA2A 4OP0A 4PSUA 1GM5A 1VBFA 5IBQA 3UXMA 1GDDA 4EAQA 1P80A 2QX8A 2OHXA 4BX3A 1PV4A 3L4EA 2JZCA 3TQOA 4MPRA 2C0PA 3PV0A 2CFSA 2XVYA 2Z4RA 5C1BA 5FA8A 1M8PA 1AS3A 3BWEA 4WPGA 4OQFA 4D97A 1VZ2A 3NHPA 4LX8A 1DKPA 2XI4A 3TBFA 3EH2A 2EFCB 1Z5GA 1RC0A 3TSUA 2I7TA 4NFSA 5DCWA 5K20A 1X92A 5CB6A 4KYVA 5EIWA 5IC5A 4FC6A 4TKUB 5FHRA 5IJ0B 5IX8A 4HNSA 1LLDA 1TW3A 1FQOA 4IAOA 2AJTA 4L75A 2ZB7A 3IXQA 1UKCA 3Q5EA 5DPMA 1F4LA 3ESXA 5TE9A 1NATA 3RHSA 1VHWA 5EN4A 1GJRA 2E1PA 3VH1A 2XZPA 4PVDA 1ECFA 4X66B 1AA9A 4HAWA 4CKYA 1QRDA 4RA9B 2VZEA 4UP8A 1XEXA 1H2BA 3H17A 4KAJA 2XMQA 3T0IA 4KPEC 2XY4A 1NMEA 4NYMR 4YFYA 2W4MA 1M67A 5DWVA 4O4JB 3P0IA 2VAWA 3MUNA 2G9UA 4NZOA 5FHQA 4EL0A 2GX6A 1UXKA 3A1EA 1SUBA 1D2EA 2FV8A 2CE2X 2RGAA 4R54A 4DVJA 2RB5A 1LV8A 1SOMA 2AW5A 1W4RA 4DIEA 2FN4A 3NH9A 3CMCO 3SZOA 3WY9A 1FFHA 3OTQA 1Z0JA 5HR5A 1AZLA 1R5JA 3KKPA 1GSIA 1P7YA 2IBMA 1QGUB 1WHSA 1IJBA 4G2TA 4QZVA 4LNUB 5C18A 1TQHA 4C0SA 1OFTA 4D6YA 5E38A 2C07A 1ONNA 2Q5CA 4IL5A 4TS3A 4FW9A 1N4AA 4DRYA 5NULA 3V6MA 3EY4A 5FQOA 1IY0A 1HYQA 2QUJA 4PR3A 1HLDA 2R6FA 1WAMA 1YVUA 5JSZA 1NP6A 1WVGA 2BM0A 1B6SA 4X3CA 1BEEA 4TUYA 5D00A 4NBNA 2HNAA 1XEZA 3TVTA 2PFKA 2XSZA 4HAZA 4HEHA 4ID9A 3ZC3A 4A2QA 3FCXA 2HA0A 4JKIA 4YGYA 2E5LB 5FWYB 4EO4A 4RANA 4CTJA 3UUWA 3GCDA 1XNGA 4DRXA 5CCBA 1Q0TA 4V0OA 3M4ZA 1KU6A 3VMFA 1MVNA 2F3PA 3JZDA 4ZDKA 3GO4A 3GJ7A 2I2WA 4ZC8A 2VZLA 5H70A 4A8JB 2R3SA 1QGZA 2YC4C 4HNVA 3X2FA 1NUSA 1P7ZA 1UBEA 2OESA 4E88A 4MYHA 2WMYA 1D1PA 1O3YA 1K92A 2BHNA 3PGXA 4YFVA 1ADGA 2UZ4A 3C2QA 1IB0A 1UJ2A 2UZ1A 3CSSA 3LHSA 4PVCA 3HJBA 4FEGA 1SJ9A 1QGDA 5TS2A 5JQWA 3BAFA 1X3LA 3P9IA 4FN5A 2MT9A 4B4DA 4LY6A 3IT2A 4MPJA 2Q45A 4S1VA 4UZSA 1H42A 1U0RA 3B3QA 4LDNA 2OG1A 4WZBA 1KJ8A 1X7YA 2WJIA 2RBGA 3ZTYA 4DCNA 1RM4A 2IU3A 4Q66C 2W2KB 2AOTA 5AJYA 3SHFA 2DHQA 4LOHA 4KE6A 3VO9A 3KUKA 1ZG3A 3HCWA 4ITVA 5JMWA 9GPBA 4AKHA 1JGTA 2FRDA 4HJXA 5JAQA 5C0OE 1KI2A 2R8EA 3LXRA 3T4XA 5JQGB 3DDWA 3ZHRA 3ZN2A 1G291 1HYGA 4CS3A 4URYR 4X1KA 4MP3A 4YDRA 1SBIA 5TJHA 2VDUE 3C6XA 3W05A 2BFBB 1T5BA 3PQ7A 3SMQA 1G8YA 3TE6A 1NW8A 4DNPA 1DAGA 1MIHA 1MGOA 1ZM7A 2OBNA 4EW2A 4V0QA 5CD9A 2ALYB 4BKUA 2HRQA 2RBEA 4FONA 4WAUA 2I3DA 1P0FA 1NBME 1Y1LA 2EJCA 1BKYA 4UNNA 4QJ3A 4EZBA 4ZI7A 4YCLA 3IALA 5H02A 3VVBA 4LCJA 1MX1A 2NVBA 1IN5A 1SCNE 5EQFA 1HEUA 4Q7QA 4N7JA 2V3WA 5KEIA 5E6UB 5EEHA 4DCSA 1TYEB 5KOIA 1CG6A 3E5HA 3ELDA 5IKEA 3OTGA 5ULLA 4PYIA 4MRNA 4LY0A 1QG4A 4NHEA 3FYSA 3GFTA 1VFPA 4UHEA 2E4WA 1W9MA 3COPA 5KQMA 1TEZA 4DSUA 3IQZA 2POCA 1Z36A 2V6FA 2XITA 4JOCA 4X94A 4AUKA 4H2XA 1DJOA 4C05A 2EV9A 2MSNA 4M53A 1Y1QA 4RH0A 2G77B 3A3OA 5F3DA 1MG0A 4WIAA 3NBUA 3VYWA 1ZRHA 4DG8A 1ZUWA 2JHFA 2VDWB 2F43B 2XMSA 3EZYA 4KO8A 2EU8A 4KX3A 4M7PA 4PYLA 2YN0A 4RK0A 4YJHB 4ZYYA 3PHJA 5JI2E 1V3UA 1P5FA 1KTIA 1FZTA 2PJRA 2EH1A 4MB0A 3VZSA 3SZUA 1INLA 2PANA 5AM4A 2HPVA 3BHIA 2WWYA 4NJEA 2O8VA 2VLIA 1W35A 2WSBA 4AQ7A 3JAKA 4KQWA 1XP8A 3C1AA 1X1BA 4WNIA 3KQUA 3FPFA 4IUDS 1ZGZA 4H35A 3K1TA 3OX2A 4LY9A 3P26A 4XVHA 4FM9A 5F12A 4NZNA 4KV7A 2PVSA 3DCNA 3JD0A 4UU7A 5J58A 2AFIA 4CH3A 1UH5A 2YW2A 2H31A 3QU9A 4C0XA 5L3QA 1DBWA 3R76A 1YUBA 2DMRA 2XUPA 2Z09A 3OKAA 3TZKA 1GT91 4KGVA 2QKYA 3PGMA 5IMSA 5TB5A 1L5NA 1U5CA 2EBFX 3P5BA 1WDMA 1EXWA 3MJTA 3ULKA 4FDAA 5JD4A 1ILEA 4G4IA 1SEVA 1U7UA 3ZHOA 4BP9A 2J59A 1Z6GA 3B1JA 3EN0A 1IBKB 3LRTA 5K1ZA 3QY9A 1U1IA 3RT7A 4NJMA 5CX1B 1A76A 5B37A 1ICIA 5KJEA 2BTQB 1P2SA 2Q41A 3GEHA 3EG9B 4WACA 1DCTA 4F92B 4OSPA 1HDOA 1PTJC 1RAEA 5DYYA 1E79D 1Z7MA 2PSHA 1SXJE 4G0QA 1XRPA 3J7AC 1Z38A 2QYHA 3M9XA 3RAJA 1JKFA 5LYJA 5TRTA 5I6DA 1ABFA 3M6VA 3H4IA 3UYLA 2XLCA 3BDAA 4WGGA 4DREA 2HLHA 2BP7B 3QNWA 5B55A 2PKCA 3FYUA 3I37X 4GM0A 5EMNA 3QPWA 5D7BA 1J8MF 4OU5A 1DBSA 1XAIA 3ROFA 3CF2A 3GRKA 4XVQA 2BHLA 1YAJA 2CLIB 2I5PO 3SBDA 1FRZA 2D2VA 2J09A 4QOIA 5K9ZA 1GPH1 9LDTA 3DE7X 1HYEA 3EGDB 1DTEA 3ABQB 1AUOA 5ELOA 3HL0A 2ZJ1A 1ZBDA 1SURA 2DH6A 3AHIA 4MUKA 1AB5A 3CR7A 2DBYA 3K9CA 4I50B 2ISQA 3SSAA 1MQSA 2Y1LA 4TMXA 5KTSA 2WTUA 2J3MA 4P84A 2YRXA 5CUQA 4MWCA 1DQSA 3ILXA 5BSMA 3A58B 1A2QA 1T8TA 2R25B 2BFFA 2Z9DA 3EFOB 1KI3A 3L9XA 4UUOA 4KE7A 5CJ2A 5TVGA 1NV9A 5EP2A 3H7AA 2SCUA 5KSPA 3GPCA 2WIFA 4LC9A 4B46A 5DF1A 5BSUA 3TD2A 4C6HA 3TGLA 2AC4A 1CUJA 1AU9A 1K86A 3K96A 5ICGA 5IYZA 3I04M 2BKXA 3C7TA 4R1MA 1AOXA 4FGKA 2VYVA 4CQJA 1W96A 4PSCA 2P6NA 3SI7A 3H11B 3U4IA 5JSHA 2P3LA 3D5TA 2ECQA 3G9UA 2QAGC 3ITEA 4QGAA 2VYFA 4XA8A 1DL5A 4I6EA 1KK0A 5KYWA 4BV8A 4BWVA 4K8OA 3BL6A 3A9SA 3LC1O 2ZBGA 1SRYA 3GJZA 3FUUA 4MEJA 5B53A 3QLVA 1NL3A 3V4VB 1NVUQ 1UBCA 2ROQA 3CURA 1U3WA 4X54A 2O0MA 2ZT7A 1HBJA 4ODIA 2GZDA 3T5GA 1N75A 1O6ZA 2RIRA 3RUCA 4K0KB 4Q6BA 1W88A 4XZ3A 3OLZA 2GEUA 3KZMA 3BH7A 5ALUA 5CPFA 1KJNA 1XD2A 2DWPA 2WQZA 5G1PA 2A5YB 5HRAA 2CJPA 3PPVA 5EXXA 4HNUA 4MS3B 4H59A 4CR6A 2YJNA 3ICCA 1GPLA 2I99A 3QPCA 1RYNA 4NBRA 4ZVNA 4F6CA 2VHYA 1C9EA 4OAPA 1XZGA 5K3DA 2QGZA 3UJ7A 4F5EA 2IL1A 3H86A 1UQTA 1FP2A 1NT4A 4JX8A 3BVPA 4Y67A 5HK8A 1KERA 2P78A 1OE0A 2PXXA 1YZKA 2V0NA 2ZI6A 2B1JA 4FIZA 4MR8A 5DHAA 1F0PA 5KSOA 4AXBA 4INZA 4OJTA 4HWPA 1F1JA 1VDMA 3BFJA 4LF9B 1EGQA 3S2FA 4IUCS 1NNUA 3SQMA 5DK4A 4ZDWA 3BICA 3O8QB 3UOWA 1HM5A 3ZW8A 1YIDA 3E03A 5JNWA 3ZU6A 1XEWY 3KQKA 5FL7D 1GFZA 4E33A 2OZVA 1N1DA 3GRAA 3OLCX 4P5PA 2H6EA 1BQ3A 4JOSA 1XX6A 1Z2DA 3B1YA 2CDNA 3DBLB 1FK8A 3KM0A 4FDMA 2PK3A 1WPRA 4JFAA 4WLVA 4AI6A 1GV0A 3ZKWB 4H3VA 1XZEA 1JMYA 3Q3EA 3W34A 5KYTA 1CTQA 5FBWB 1WG8A 4L3OA 2Q07A 3FFBA 4YAKA 3VR6H 1JJCB 1QTRA 2ZWAA 3BJRA 2R6DA 3UAZA 2YOGA 1XALA 4FZJA 1W0CA 1ZKMA 2LDBA 4OREX 2OCYC 5TX7A 3ZVMA 4Z2YA 4IX9A 4YIHA 2WJPA 2CFOA 2F1OA 4LYHA 4EA9A 4QLBA 2H92A 1KMNA 1N0IA 4S1NA 3UW3A 4MUHA 1WMAA 3A2LA 5FPKA 4X5OA 4AZSA 1E24A 2FGJA 3TR5A 1SU7A 2OD2A 1M5TA 2G67A 4QTXA 1XXHB 1YBHA 5MGBA 3HXLA 5AKEA 1NW5A 3HNRA 3P0JA 4HH0A 4YJ2B 1NNHA 4A15A 3AJ8A 2CDAA 3DOUA 1LLCA 1B7GO 4NJOA 3IQWA 2HSGA 3AJ9A 2QMHA 1AKQA 1RRFA 3C5VA 1X7WA 3ZOKA 1DKMA 3BB3A 1C14A 4H6XA 3BWDD 5EE9A 4C88A 1B2RA 2R47A 4X24A 3JWEA 3FETA 3WLPA 5HGQA 2PZJA 2JFPA 4WZZA 1GR0A 4AC9A 4CM8A 4UCQA 3K0CC 1VCNA 2OHVA 2O50A 3CZ4A 3EVBA 1U8UA 5BSWA 3I52A 5JDIC 1QVRA 5JQGF 3A6LA 2QX9A 3W5SA 2D1RA 2FPPA 2J4DA 1W73A 1XVUA 4DMCA 2IWHA 4AK9A 5KWSA 1SBNE 1YS2X 2H0RA 3HR7A 2APJA 4R8RA 4TSRA 3IIIA 1N92A 5DU2A 3M9WA 3RHFA 5FXMA 4LXUA 1OX4B 2F1KA 1I2BA 3RFVA 1GU1A 3M1IA 4URWR 3GLFE 2A1UB 2PNFA 3AZPA 3MCZA 5F2NA 5JYCA 2W0MA 4O4HA 2CLKB 1NDUA 2XOXA 1ZK4A 1KYWA 3UJDA 2NQ8A 4QPPA 3DT8A 4UOZA 5HZHA 1ODTC 3PQ6A 5ARCA 1SHJA 2OT3B 1LJ8A 1FFWA 2Y2VA 3FSJX 1KTVA 4QTZA 2J5QA 4LUCA 2BBTA 3RYIB 3P7MA 3SOPA 3F9RA 4RJTA 1E9EA 2QAGB 2PX6A 1FRFS 1GOTA 2ZJ5A 1B93A 1P0IA 1TECE 3HU5A 2IUSA 3N28A 1Y5IA 2GZAA 3EIUA 4FFLA 4P92A 3GAZA 5BUQA 2DHCA 3DMGA 3SC2A 4MS4A 5FPQA 3OM0A 5CURA 1ZOLA 2R48A 5KKNB 3ZV4A 3KJHA 3R3HA 3V8MA 2JFNA 5EZYB 1U2DC 2CDCA 3R7BA 2YFHA 3KKKA 3A9VA 4BBPA 1X1TA 4KWIA 4LFBB 2AWOA 1GVHA 4TGLA 3U80A 4QC2A 1HT3A 2F48A 4RD0A 1E6MA 1SKYB 3ED5A 4BJ6A 2F9LA 3WWCA 1MXFA 2QJRA 2X58A 1UPUA 4PLPA 1E6CA 4PC2A 4Q7KA 5AI6A 4DSAA 3VQTA 1N9ZA 2B1IA 1B8OA 1B8UA 1I5RA 1J99A 2VPIA 2WUFA 3B6EA 2I76A 4O5OA 5H4HA 2FUG6 2PGIA 4G8BA 1EFAA 2MINA 1DWPA 1P6UA 1L7XA 2ONCA 3YASA 1II8B 2R2AA 2P5SA 3CZRA 1OWMA 3ESBA 4RPHA 1NZDA 5JD5A 3VHRA 3FHTA 3FG9A 1MT3A 3KYCA 1DQYA 1BDIA 3T4PA 5HJ5A 3SBXA 1T8SA 2R8XA 3P2YA 4P73C 2E3JA 1ZOPA 3NHKA 3NKVA 4LDQA 4PANA 5FLYA 3Q72A 2PIAA 4CCYA 5GONF 3RKYA 4U2CA 5JH7F 3WVNA 3MRTA 1Z8HA 2Q6KA 4TS4A 1Z7YA 4LWZA 4IOMA 3ZW7A 3SZMA 5CDUA 3GLGA 3CLTC 4PLHA 4FEYA 1EIZA 3Q85A 1OFUA 1WB6A 1SGWA 4YAGA 1XTRA 4P3XA 1E0SA 5A9SB 1DZIA 1NQOA 3B52X 3AY0A 1NVKA 4L51A 1CIVA 3ZD8A 5BY2A 1XNQB 3BGVA 3N76A 2P9YA 2I1WA 4JQOA 2AD1A 3SLKA 4DBZA 3H4MA 3L1UA 2Y66A 3REXA 3TTCA 2JGFA 3HB9A 3C3DA 1H3EA 2HJGA 1VMEA 1N7GA 1CR4A 2YV3A 3B78A 3PI7A 4IIYA 3RADC 4WVFA 3U1BA 3STUA 2CFCA 2I34A 1E1CB 5IAOA 3HDHA 3N8DA 1FS5A 3BT7A 1VYVA 1D0VA 3HTZA 2ZTSA 3QVSA 1O7JA 2WF7A 3OU2A 2FJUA 4CL0A 3HKCA 4CMAA 3OZWA 2FNAA 2YJ6A 1EFKA 3BIFA 2JGEA 3C4QA 3RREA 4M1MA 3ZLBA 4CMIB 2FR0A 1FLAA 4EM6A 4R2LA 5FB3A 1DCMA 4Y98A 2RGEA 2FF5A 1D2AA 2OP0A 4AVYA 3V5NA 1QOQB 3FN4A 4NZMA 1E3WA 3ID6C 4E5SA 1SHTX 3TLMA 4R0VA 2IT1A 2LVBA 1OBCA 1OIXA 2E6UX 4D9CA 3DHNA 3O1IC 1Y7PA 5KTTA 2RHOA 1JPNA 4BMZA 4KIJA 3DZ8A 2LZ0A 4LZPA 1BXRB 2I6UA 2O0KA 3IR7A 3ABZA 1WSBA 1P1BA 2QMUA 2X8AA 2CK3A 1S8FA 3P9YA 4BX9A 3X1KA 4IHAA 1SCBA 3NG1A 1W75A 4XFJA 4L2IB 3HXVA 1Q22A 5C7YA 3U4AA 1SBHA 3RJ9A 2PQMA 4TKLA 1U7XA 1Z75A 3H1PA 2AI1A 3GLSA 4ZOLB 3M4QA 4HATA 3OKFA 4XGNA 4KQKA 2Q7OE 3WICA 4Z49A 1K4KA 2QNRA 1MDFA 2XKAA 3DB2A 4DFDA 3K9FC 4TMTA 4N41A 5F9FA 3KDSE 4L5YA 5IK2A 3SDSA 2QLMA 1W30A 4MVJG 4EUHA 5LOVA 1IM5A 4BGEA 1QKJA 2F3TA 4OPMA 1RP1A 4XJSA 1JQBA 1FYWA 4U3JA 5ARDA 2IX9A 3FPSA 1P5JA 3FBGA 3PD0A 3CO5A 3ZWXA 1FVHA 3ZWBA 1SULA 2P9EA 3N87A 3FBWA 2GBPA 4X6UA 5EXEA 4N48A 3O31A 4G8DA 3H18A 4Z4QA 1FTYA 3EZNA 5KWEA 2EX0A 2VHEA 3MTEA 5KDDA 2N75A 4FFWA 4F46A 2ZAGA 2Y0BA 3BGWA 1NXPA 1RMYA 1YFZA 3FJPA 1YVDA 2FWMX 3P2JA 4JNKA 2O14A 4XVCA 2P2SA 1IL2A 1H1LA 2GJSA 3NC4A 4MKZA 1YI1A 4TM8A 3RT1A 4ZYTA 5A3RA 3VR2A 3FROA 5E6SA 4CIDA 3OD1A 1NQWA 2VDNB 4A0GA 1RQXA 3VX3A 1F8FA 4F0JA 4QG3A 1O2DA 3A7RA 2AV6A 3HUEA 1CKEA 5LIRA 4ENRA 4KQEA 2BT4A 2CB0A 1YVEI 1E9CA 2WNSA 1ZJ4A 3CR3C 4KKXB 5H4GA 3DA8A 1WZ2A 5SV2A 3C87A 2Z8ZA 1YJ5A 3QOXA 4GDMA 4NCXA 5WRFA 1RVV1 3G6KA 4H0FA 2OGUA 3O94A 3E15A 2QRLA 2W2QA 4C0LA 1JEDA 2EOAA 2A4MA 1YQWA 6ABPA 3NTUA 3NDJA 4BLUA 1BH2A 2CVPA 1W85B 3LYUA 4KXWA 2FWPA 4CM9D 1UPTA 3F7TA 1VL0A 1B4DA 4YLGA 3SXPA 1YGYA 4MQLA 4UE6A 4Q15A 2BHRA 4C1BA 4EF4A 3VHQA 1F9EA 3P9PA 2O05A 4LKRA 4WFQA 5GIPE 1G21E 3PCOB 2UZAA 3FB1A 4UHBA 1QR6A 1DX4A 4NHOA 2GF2A 4TTVA 5F5NA 5JG7A 2JLUA 3JD1A 4LZAA 4XJTA 2ZU6A 2OL4A 4ZO9A 1NUHA 5AW9A 4BMVA 3ER8A 2NU6A 2Q5QA 3CXUA 3AP2A 1GVNB 1QC5A 3E7FA 1YA6A 2P1ZA 3HDGA 1U0JA 3R3YA 2O23A 3LCMA 3C39A 2J7PD 3K0EA 1IJEA 1WLYA 2NO1A 2JJQA 3SY8A 4WUVA 4P3YA 3WBKA 3QV2A 4IEFB 2NP7A 3UAWA 3LWNA 3TM4A 4PPNA 3TTDA 2ZYSA 4R3WA 2EC5A 4IDNA 4IICA 3S2UA 3ZGXA 3HXKA 1CZUA 3HHEA 3JWPA 4AQDA 1ZD4A 3T1VA 4M9XA 5TPWB 4DR2B 2C7BA 2OHJA 1OTYA 4NR0A 4HUTA 2QUBA 3RYHA 4G09A 3E58A 3GN2A 1SG6A 3TRJA 3LBFA 3IQXA 4IWNA 1Z37A 3VR0A 4WTOA 2IYFA 4D42A 3KLPX 1RWMA 2Q6IA 3CLTD 1YAHA 1RJFA 1CJBA 1K06A 2VJOA 2XR1A 1MAWA 3OQPA 2I9KA 2ZTHA 4TQGA 1M33A 3DEFA 2GDZA 2JGKA 1XXLA 3JQ9C 3QSYA 1Q0RA 1QHHB 3SIXA 1EM6A 2QVGA 3WR5A 4HDSB 1PQWA 4M89A 2JH3A 3KKMA 1PJZA 5AI5A 1FF9A 4YLYA 5JVDF 3A27A 3D3WA 4JLMA 4Q4JA 2PX4A 2XGOA 1HY3A 3SJAA 4BOYA 4YV1A 1PEKE 4A8HA 1XELA 3IODA 4GP7A 4PNHA 3GJRA 3M33A 2Y4OA 3HM2A 4OMFG 4JCOA 4XX0A 5D3MA 4N6GA 1TD1A 3TZHA 2GZRA 3RU7A 1U1DA 1E0JA 2GPTA 4B75A 1SUPA 1PNRA 3TXXA 3LYLA 3L43A 4J1NA 4F2HA 4OFXA 3U3ZA 1AGXA 1JFFA 4XJXA 1UQUA 1QM5A 3ZCQA 5LU8A 1U63A 3Q7TA 3SJUA 1YS4A 4URHA 3LGAA 2I6FA 1KDZA 4EZIA 3R3SA 4JU9A 1SR8A 2GN8A 3FOCA 1PR0A 1S2LA 1VBNA 1BBUA 2UYOA 3EWNA 4IJQA 5I8ZA 3T5AA 5H80A 4B3BA 4H1WA 4KLRA 1W0JD 4TV9B 1R0CA 5KVQA 3VPDA 3DEYX 1F2TA 4AICA 2UV8A 1KNXA 3IP8A 1KH2A 3ZI0A 1E4YA 3WLHA 3DZKA 2D13A 4HVLA 1PJ3A 4O2AF 3CR8A 4L0CA 4TQ9A 4C07A 5EXSA 1QP8A 3OZUA 3E27A 3A6EA 4JAVC 4LDAA 4ARAA 1NVMB 5ALIA 4JBHA 4L4UA 4RGQA 1K8XB 5HZKA 2QTVB 1L4NA 3EFRA 2QW8A 4LAFA 4C4OA 2X23A 2EWVA 2ZU0C 2OAQ1 3QO7A 3QOWA 3BJUA 4LBVA 3VR3D 2G28A 4S1PA 2P5TB 3KKZA 4JI7B 2DJIA 4DJJA 2IYTA 3FDIA 3OLYA 4LVMA 4MLCA 1SU6A 1H66A 1JYSA 3MWJA 2FX3A 2YS6A 2JCXA 4EG4A 1FJXA 4DUZB 1DNPA 3I8SA 4KB5A 2FRDC 1IBLB 2FG6C 3TUPA 4CKEB 1YQUA 2IZ1A 1YDMA 3KTOA 4LTDA 3GLFA 3U6YA 2VS1A 2CJWA 1YJ8A 4DLUA 5T3YA 4DNOA 1Y0BA 2OFOA 3T8YA 2HQSA 3KAJA 4G63A 4K9PA 2PUAA 4EIWA 4F3NA 3RFXA 1J2EA 1TQ8A 2QT9A 3AGQA 1YBMA 4AJPA 1JLLA 3ET4A 1OXTA 3KFUA 2ZRPA 3H19A 4B6JA 3W5JA 4JGIA 3M83A 4M1YA 4C4ZA 3GLQA 4AU1A 1QAMA 3A04A 5BV7A 5GIOE 4KR7A 4TTTS 3UHJA 1T2FA 5B2FA 3EJ6A 2PUGA 1QTNA 4IDPA 3GR6A 5A06A 1KMIY 2X2OA 1U9IC 2YYYA 5KTKA 5E3IA 3K2IA 1GUYA 4UZFA 2RGNA 2XVMA 4R51A 4WNYA 5JZ9A 2ZI4A 3HWX1 3LV8A 4LYEA 1OSNA 5E9QA 3W2IA 5HF8A 2XZTA 2WAAA 1GGFA 3A74A 4LJ7A 1RLUA 4CLOA 4BXOB 1QG0A 4ZI2A 5JRDS 5KNBD 2Q4TA 5K0NA 2XDYA 4LMBA 5KNCH 4EYQA 1DKQA 1A7AA 2Z3VA 4QEZA 1GDTA 1GFIA 1ZPDA 2DWQA 1PWZA 4GPEA 3FLMA 3VJLA 5LPNA 2GAIA 1A9XB 3HCEA 8ABPA 1IE3A 4R1LA 2D0PB 5BWOA 2Y0EA 4CKWA 3CRW1 4H0CA 2NU9B 5EIOA 2C5LA 2NPFA 2RAUA 4LV8B 5KYVA 3IMGA 3DLBA 2JC3A 2Y1DA 4CIAA 4UVHA 2BEUA 2XTAA 3RW9A 5K0CA 3OIYA 3IEXA 3G85A 4YV0A 4FYIA 1CY6A 3KEQA 1QX3A 2IZ5A 3IB3A 3W9YA 1K27A 5K2OA 3ICOA 2XGJA 4A7PA 4HPWA 1VP9A 1Z29A 1P73A 1M6EX 1UJ4A 1CUAA 2BF4A 1N5DA 4PIPA 1SVMA 4KIWA 3VZDA 3WWDA 3D6UA 3QEBZ 1XZBA 1L5GB 4OJYA 4PZ0A 3DTYA 2NSJA 3TBKA 1R00A 1WQ1R 4A9AA 3V7RA 2GO7A 4R1UA 2GSWA 3KQSA 2XKBA 3BJZA 1G55A 2HZ7A 4X3OA 4AIIA 5BMVA 2UYCA 1Y6ZA 4NENA 1P75A 1ZD5A 4IJKA 3PFHA 5I51A 2Q9BA 3QM1A 5JSZB 4PX3A 1W581 2DFDA 5A62A 4TUYB 3G68A 1Q1NA 2WYVA 3ZS8A 5CBKA 4DA0A 4JXZA 1TADA 1CUVA 2VAXA 4JJ4A 1TA9A 4X95A 5IP5A 4O25A 3ZX5A 3RSZA 3EJWA 3VV2A 1S2NA 2PMCA 3SJCA 3W5DA 1Y5LA 1NHWA 3DKPA 5MN4A 2AC7A 1H5UA 3E23A 3MSCA 1OJ7A 4A6EA 3C1OA 3QX9A 4ND2A 4AW9A 5IN4A 1CZLA 3L82B 1KYYA 3HXYA 1QZZA 3OQNA 3RR2A 3NI2A 1NU6A 1G20E 2II6A 3NT4A 1Z3CA 2W6IA 2WUVA 3E8SA 1CUWA 1RYYA 3W3AA 4TKMA 3FYUC 3QGMA 2A5LA 5DHPA 5SY6A 3HRHA 2X9NA 3O8CA 4I1SA 2JA2A 4LGYA 5HKLA 2FWIA 3TZLA 1A95A 2UZ1B 1AQ6A 1ZN9A 2XSZD 2M32A 2RARA 3TCKA 4C04A 1E4VA 2QTWB 2P9GA 2IYVA 4PCAA 1T5IA 2D2EA 1M2OA 4ZRDA 3RK4A 1C7RA 1SUSA 4PZCA 1U2TA 4EB6A 2J6CA 1EWYA 2X8WA 4BL5A 4ZXFA 3ZVKA 4DIBA 1NASA 2HSWA 1H65A 3AH8A 1G7CA 4W5JA 4WK0B 3FPGA 4X62B 3B36A 4D3FA 4WZBB 1K4YA 1I32A 2ZT8A 1X7YB 4NRDA 3RT9A 4PG3A 2HMVA 3SYRA 3HO6A 3M89A 4ZAZA 3TCXB 2OBMA 4HRAA 1LCIA 3R6LA 2CSUA 4MI1A 2L2QA 2A2ZA 3TMAA 3VPAA 4MUGA 4R6XA 3WOVA 4A5SA 2BM8A 4IIJF 4I6JA 4G0PA 5L3RA 1NLYA 1E9FA 3VYSB 1UINA 2E37A 2ZREA 3N2GA 1I30A 4DSOA 4D02A 2XTZA 4OJNA 4GS5A 1B7YA 1OTHA 3CIOA 4IJMA 3CRRA 5K09A 2J3IA 4IS3A 1N5RA 1ZD1A 3DFMA 2BMFA 2FWJA 4GQBA 4IDAA 5AKLA 1G8GA 4X20A 3HPQA 1I3MA 1RDFA 3ASUA 3GFQA 1CQXA 1FLVA 2VWQA 1EAYA 2W00A 3AKYA 4IJUA 1ZC4A 3I1IA 2IUUA 3SSMA 1VGQA 2FN7A 3CFYA 3GMIA 4BASA 4D9NA 5BV8A 3TFWA 1SCIA 2B4TO 1ZAKA 4JLKA 1A72A 2J3LA 2JLXA 1BD3A 4ZYVA 1OZFA 2A94A 3DP7A 4D46A 4ZI7B 5A4IS 5KYYB 3QLVC 2WA1A 3B1VA 4QO7A 3WB1A 4RTOA 1NBIA 4FFOA 3RS8A 4CVNA 1FFYA 2O2DA 2XBMA 2GVZC 5FPPA 3UK6A 2PKEA 2WR8A 4CV0A 1U3DA 3TQTA 3ASVA 1OWPA 2XIQA 4TMWA 5M5BA 3NELA 1EHYA 3P2OA 4AJ2A 3JQEA 3OO1A 4N5MA 4CUKA 1IHDA 3OF3A 2H1HA 3QNUA 4QGHA 1QK4A 1U0GA 3Q3IA 3OX1A 2JJYA 1U8TA 4L02A 3N58A 1RE0A 4H2XB 3CH4B 4TZ0A 1ZWLA 3WGQA 1RLIA 3IDAA 4GKKB 4EHIA 1Y6JA 1V2HE 1X0VA 1NM5A 2B7LA 3AUXA 3C3EA 3H2GA 5D51S 2YJGA 4DHEA 5ICMA 1X54A 1N1EA 1XI2A 1W2GA 5KWIA 3OTOB 1B6RA 1X9IA 4TSFA 1O57A 2Z9BA 3E3OA 3WAGA 4CHTA 1KO7A 3LP6A 1GDHA 1WPXA 1ZD9A 3DWGA 2RD2A 1C4WA 4KQHA 2QEQA 5JAUA 4HMPA 2XA9A 4OYYA 1K3TA 4Y9UA 3DKRA 5DTJA 1GPMA 3RUEA 1W5TA 2L0XA 3DO8A 1HE5A 2J32A 5A9RA 2GCOB 3QMMA 2JFYA 1TC2A 1YZNA 4ZIRB 1V11B 4GWKA 3SVZA 4BLQA 1KIMA 3LC7O 5AK5A 3NC1C 2V96A 4BCCA 1C7FA 3FRJA 5KC8A 1MB9A 1HQDA 3NHFA 4BUZA 5KPDA 3PQDA 2J5BA 4C08A 3WFZA 3DEHA 1D09A 1A8HA 4HD0A 2GB4A 2WMOB 2CCJA 2AOWA 1WXXA 2AFHA 4U7DA 4FYHA 4N8SA 1EVQA 4C30A 5CR9A 3ETGA 1L7VC 2TS1A 3UXEA 3ELUA 4O6VA 3V1YA 1OYOA 1KRXA 1UMCB 2R00A 3UWKA 4BWGA 1MV8A 5AW0A 1Z07A 1I2DA 4HY3A 3MS7A 4B85A 1JE3A 4RDXA 1XQ6A 2Y4NA 3UMJA 4CQNA 5BQ3A 5EZ6B 1RS0A 4C29A 3OHSX 3IL2A 2XDAA 3JPYA 3TLKA 3PE4A 4DIMA 4DG5A 3MCTA 2V4UA 4QBGB 4IFIA 4B80A 2WJWA 2VDVE 3NW9A 5HOEA 2GR9A 3GFSA 1YBAA 1RRPA 3PDIA 4JLBA 2YZ7A 1G3RA 2VJQA 2WHXA 2EARA 4LJ8A 4MGYR 4U7TB 4FQ8A 4XJVA 3IO5A 4YO7A 2QTHA 5D5QA 1X2HA 4YA6A 3G2HA 2OD7A 1T25A 4U2GA 1DPGA 2FPGB 3QW2A 1PN3A 4C0JA 4EHHA 3SKXA 4A3SA 3BK7A 4Z4FA 2JHGA 4C7XA 1E1DA 4L15A 3RF6A 3CONA 3U3DA 4K9NA 2VATA 2KJQA 1LLQA 1IOZA 3F6RA 2PWAA 5DHTA 4BNTA 3QU2A 4AH6A 4KQ1A 3FDXA 4EJ2A 1JFVA 2W9XA 3MVEA 4QRDA 1NY5A 5FNVB 2SCUB 2PO7A 1QP7A 1HL3A 4POAA 4F8YA 3HXMA 4GLLA 3D7NA 1XVLA 4P7KA 2C2HA 3G2KA 2ACKA 1OVGA 4L57A 2SICE 3ZCPA 1KBZA 5K3SA 4JMLA 3ANNA 4RQAA 3CF4G 3PC8C 1Z45A 4QARA 4WZAA 4COKA 3M49A 1RD4A 1G18A 3T7JA 4PR0A 2QRMA 4GMGA 1TT5B 1TM5E 3MOSA 1QMPA 1HT0A 1UK8A 4CT0A 3ECSA 3IOEA 4KDFA 3AOEA 2GD6A 4ZVLA 1HKHA 2JGIA 3QELB 2J3JA 5JNLA 2DBRA 3P71T 4PQEA 1IHYA 1JEYA 4DLRA 3JVEA 3V1MA 2ALJA 3E5NA 3BRSA 2Q3BA 2D7DA 3ROPA 3PQFA 3MSXA 2HCRA 4F4IA 2VYVD 2MTBA 3VAZA 2GGSA 4P3NA 1C1XA 3F3KA 4ROTA 3IT1A 1R0ZA 5G4LA 1N36B 3PWTA 2EFJA 5LKRA 3I83A 4FWTA 4M22A 1Q0ZA 2PEYA 3D8HA 3NRCA 4G1UC 2H5LA 3GAMA 1MN6A 3KXKA 2CFIA 1DHRA 3HDTA 1ZLYA 1IHUA 3EF1A 1FP1D 3LY8A 2ZUTA 5F1PA 4QXOA 4I3FA 1R0RE 4YRFA 5T6BA 1IBSA 4J0HA 3GLTA 1V8DA 3PQ3A 4OI1A 2UYYA 2OLKA 4LF7B 2FI1A 3NQ41 2UZIR 2FEOA 2A2YA 2DU5A 2AQHA 2JK1A 2WHRA 1BS2A 1H05A 3QKUA 3GHHA 2X14A 3RIYA 1ZM2A 2Z5VA 4LF8B 3NTOA 1VXRA 1JG2A 1XK7A 3EA4A 3Q3CA 5LZ8A 2XHZA 4F6RA 3P04A 2JFQA 3AFMA 3KTAB 4WKGA 3DTVB 4H2TA 1WCV1 2EFYA 3LMKA 1Q50A 4JI3B 3S55A 9ATCA 2B3TA 4B6PA 2DU7A 4DR1B 4ZK6A 3HU1A 2EWMA 4JBXA 3M5DA 4IXTA 4MVJE 2FUEA 3ER6A 3AL2A 4HB3A 4TUYF 3R3VA 1H4QA 1BN6A 4XM0A 2IS4A 2Z4TA 2DM6A 1TGYA 2EFEB 4OFWA 3V2HA 1K6IA 4W99A 1P2VA 1QE3A 4LSWA 5AVRA 2X6RA 5IJXA 3RBAA 3D0QA 3IR6A 1B0ZA 3L7BA 2UUBB 3L0OA 1B41A 1AS2A 4TRJA 4ML3A 4MZDA 3RTCA 1YK1A 2Q7XA 2J0EA 2OXRA 1RXUA 3DTVD 1LZKA 3FMIA 4ZVOA 3RTBA 4G0XA 1E8NA 3RJ5A 4RPJA 4ISCA 1JKJA 3NALA 4S05A 1BDJA 3BJIC 4H6WA 5IHPA 3LUPA 4RSRA 2WM2A 2JIBA 4UU0A 3TDMA 2BH2A 3D8NA 4OLFA 4MIOA 4TXHA 5EWJA 5FUMA 1JN0A 1UADA 2HT6A 5JDCA 2HMWA 1PJTA 1NAHA 3OF5A 1QIMA 2O2SA 2A9OA 4E2FA 1TZKA 3EYAA 4IXWA 4RJIA 1CD5A 2ZB8A 3W8FA 1DIOB 1FLNA 2P77A 1GPWB 2W4QA 4ZODA 4QBHA 1P31A 2FDRA 4G0VA 3KKOA 1VMAA 1H2AS 4WN9B 3SYNA 4TKVA 2J9YB 2QY9A 1LN4A 2H4ZA 2X86A 4S1OA 3GZTB 5A7GA 3VBEA 4DV6B 2J4FA 3GRFA 2ZDQA 4D0GA 4FCWA 3KYDA 3FAKA 5KSYA 1IC6A 4TZ6A 1NE7A 2OKGA 2YZGA 3WZLA 2XT6A 1GCUA 4O1HA 3DS8A 1VKOA 3HZRA 2OXCA 1BJRE 2DCUA 2I4TA 2A59A 5H3LA 5K0TA 1SXJC 3HCOA 4RETA 1IDN1 5BO5A 3RBVA 1VPLA 1AXEA 1R9MA 1ML3A 2B4YA 4Q3EA 2ZSHA 4L9WA 2QMEA 2XKKA 5H8WA 2RC5A 2RSLA 2A14A 1CUUA 2YHIA 1N57A 3E53A 3HCNA 3QLEA 1A5BB 4QATA 4TS9A 1NXQA 1J06A 5JSQA 2ZI7A 2QN6A 3ML1A 3K35A 5DHSA 3TWOA 3VQYA 1OC2A 2C3MA 2GRUA 1N25A 4RL4A 4PX9A 4ZI7F 3DMTA 2C61A 4QULA 2CL5A 2PT7A 1V5GA 5IANA 1FTWA 5BSRA 1DQZA 1CFZA 3NHWA 2ZSJA 2HXSA 3INGA 5KVCA 2KPOA 3U0VA 5HUJA 1B70A 1KYQA 1U8YA 2HRRA 2VBGA 1BIBA 1WDTA 3HMKA 2LD4A 3IIEA 4OM8A 2X15A 1W4LA 3PPWA 4XGQA 2JZNA 5I5EA 2Q6OA 2PCJA 1ZZEA 2OCGA 4CF4A 2C9DA 3GLGE 4FMDF 1M1ZA 1ZSYA 2ES4A 3DEIA 3K9HA 3SNHA 2QI9C 3WLFA 3SC2B 4D8TA 2G76A 3W2GA 4F96A 4CGYA 4LBWA 2XJ9A 3NVMB 2G5TA 3R74A 4B2IA 4XEMA 1D7AA 3OEHA 1A9QA 1QLWA 1VI5A 2CLCX 3LCVB 2FRVA 1PQ4A 4RY2A 3D2LA 3G1TA 3G0OA 4GWGA 4HV4A 5CXUA 5ISMA 1FFDA 3AF6A 2WABA 2R7AA 2H9UA 1JU4A 2ECOA 3TB6A 1NZJA 3EODA 2OFWA 4F4HA 4EABA 5KQGA 2GPSA 4QUDA 1CR2A 4H1TA 2O7SA 3HA2A 4PPGA 2P0AA 5IRCD 3SJ7A 2YMLA 1CF4A 2ZGWA 3EXHA 2C1XA 5BWLA 5P8WA 4MQEA 3L7YA 3LWDA 4HNTA 2DHEA 2J07A 2P3QA 1OAKA 4XSVA 3BRCA 1CE8A 4F21A 2YHUA 3QUBA 1E3DA 3F6SA 3RVKA 2UXCB 4QU9A 1YZTA 4UBKA 2F9MA 1ESCA 1TCUA 1GNQA 2XRYA 3ZTTA 5MN6A 1WLEA 1U7DA 3SWWA 2GNAA 1LYLA 1Q14A 3ZCXA 3KETA 2OV2A 2WYHA 5THKA 3ZZNA 2PZBA 4G89A 2ECPA 1XFDA 2Z6VA 1UXOA 4IDQA 3SLGA 4A4DA 4ZGGA 3ESQA 4OHZA 3SPXA 1RPZA 4UPVA 4DV3B 2O4CA 2RG7A 3UH0A 2FMFA 4G5HA 1NBMD 3S2GA 1F1BA 1G6KA 3K70C 3GUHA 4RQEA 1IDOA 3ZUPA 4OA8A 4M1WA 2B1QA 3ROZA 1RWNA 4GEKA 4U0KA 3DEAA 5CA0B 5LYJF 3HE3A 1CNMA 2B61A 4M7WA 4FB5A 4I0WB 4WY5A 2DBZA 4PG4A 2ZSKA 5D3ZA 3F67A 4AB1A 5IASA 2IH4A 1DT5A 3UBTA 1UBJS 3DAOA 3S2EA 1ABEA 4NWIA 5H16A 1Q3HA 4QGSA 5I45A 1KAQA 3NHSA 1P7VA 1T9HA 3IPRA 4IGEA 3M4JA 1QHNA 1S4QA 3I5MA 3S28A 3UWSA 4B4VA 5DIFA 1W36B 4YV7A 3U5ZB 4OHYA 2EJ9A 1JPUA 2GZ2A 3RH0A 4BAGA 4NZPA 5LQJA 2XB4A 1KAMA 3P94A 4NU0A 2GDJA 1E3WB 5C4GB 1CY7A 2DPGA 5TMEA 1BVHA 3L8YA 4ZQGA 2PO5A 4EUNA 5I9BA 3N1UA 3ZIIA 3I4CA 4K03A 4M1SA 3EGVA 2BCGY 1R6TA 4TVAB 1D1TA 2DFTA 2FPLA 4R31A 4WKOA 4J4TA 1VBMA 4LVCA 2UYHA 1PX0A 4XXHA 2FWRA 3GNSA 3I30X 2PUBA 3KJQA 3N0XA 1ISFA 2BAGA 3LHKA 4RZIA 1XC7A 3WB0A 4YAJA 3JASA 4XDYA 4AZVA 2PZKA 2PKRA 4I9GA 1T4BA 1SC6A 5IYZF 2Q9UA 5AJWA 3GJSA 4ZU6X 4KPYA 1N6KA 1SXJB 4ND8B 5K0JA 3UK0A 1PHRA 2D1QA 2MWMA 4JJAA 5HF5A 4D44A 2R96A 3FE2A 2HJHA 1DCKA 2FG5A 1V5IA 3V4OA 1JG7A 3M81A 4ZHSA 4PLVA 1O87A 5LOVB 1QMGA 1WTCA 2CCKA 3BQMB 4PC3A 1YQGA 2CK3D 3UAXA 4BZQA 3KSRA 2V4MA 2YC2C 1RKVA 3KLNA 4JP8A 4CEJA 4RWEA 3R0IA 4U3JB 3BD8A 3X1DA 5ADVA 3AKDA 2A8YA 3IUPA 3QKSA 2XNKA 5CLQA 1EG2A 3SFVA 5IDXA 4XTWA 1RZ3A 3LECA 1SXJD 4E51A 3OEEA 4WXPA 1CJUC 1B0AA 1G8AA 1IJKA 2FKNA 4IGFA 2HJRA 4EPVA 1MABA 2VQDA 4Q7EA 4ZALA 5KKAA 5IK2D 1KYVA 1B6TA 2C99A 2NQTA 3AK4A 3K73O 3E7WA 2CKMA 4KRYA 4MGZR 4RF5A 3W4KA 5EMKA 4ZK2A 4UMDA 2BKEA 4FYVA 4ZT4A 5CLLA 5D5HA 3T35A 2B35A 2JCBA 2HV8A 1BGVA 2PU5A 3NBXX 4F8JA 5IC4A 3EF3A 2HYDA 4KG7A 5HQJA 1I4LD 3QIAA 4N1AA 2GEVA 2WEKA 1H8EA 3G79A 2RE8A 5CB0A 3OLXA 2ZYDA 1VSBA 1YQEA 2XGGA 1KSFX 4H7IA 4YN3A 3VR2D 1DTWA 2X5OA 4R2IA 3UM9A 3DZIA 4UTZA 4DSTA 1OXXK 2ZPAA 2Q7GA 2CV1A 1I4DD 1R1DA 5A6SB 3DZCA 3BE5A 3UW1A 3LIPA 2VPPA 3NYRA 2A5FA 3PLAE 1OZAA 4H7EA 3R6GA 4CMGA 4AFNA 2RGNC 4B5KA 1F12A 1DG1G 1LI5A 3LSYA 4R7TA 2JH9A 1P2TA 2QF7A 3AEYA 2PGNA 5AOCA 5EZSA 2X0DA 3RS5A 4GBGA 1VR4A 1QGED 4IRMA 3OM8A 4CMKA 3ICAA 4BVEA 1SPXA 4DM7A 3PFIA 4GI2A 3PTLA 1P9LA 1QS0B 1RMTA 4FYJA 3BFXA 1QH8B 3AGPA 3AVOA 2FP4A 4X1YB 5EHGA 4CM3A 3KO8A 4F85A 1UMDA 4UUQA 4J0GA 3K70B 4MIEA 3FJOA 1J25A 3LPLA 4J4BA 2ZZNA 3H1FA 3ICQB 3ROMA 5BQ5A 4BDSA 2G1JA 3ZE7A 5AM3A 4L4YA 1T5LA 3PNPA 3RYHB 5K3EA 1CBUA 1OAOC 2XTMA 1TRKA 1C7QA 1HX7A 3VKFA 1RTTA 1KZ7B 1JF8A 1GQSA 2RGUA 3QKIA 1X6VA 2DPXA 1EWTA 3PD1A 4KQ6A 1EX1A 1QYXA 2D6FA 1Q83A 1Y9EA 5LU9A 1CR6A 3KUUA 2W71A 2FJPA 2ZAIA 4JLDA 4PW0A 3V7UA 4BE9A 2VJKA 3SEQA 1X2GA 4QBFA 3K70D 4XH9B 3V4RA 3IUJA 1CERA 2PCLA 1A8QA 1HO3A 1EX9A 2RKOA 3E5MA 2HYIC 1QV7A 4MVJA 2YUTA 3Q8LA 2MOKA 2ECKA 4CEHA 4Q4JB 2WV7A 5K2MA 5IUNC 1DWUA 1ZCZA 3DOIA 5DASA 2AOUB 3H4TA 2X6TA 2ZXFA 4FLMA 4JGBA 5JCJA 4BO8A 4QRIA 5KNDD 2JLVA 2A67A 2ORIA 4Q47A 2AH5A 4XX0B 1XCGB 4ZCTA 1ZD8A 2H2AA 2MYNA 3R5SA 4W7HA 1WETA 5FTMA 3GFBA 1D4OA 3HV0A 4E7OA 2XWBF 4JLPA 2VDRB 4IZHA 3NJRA 2JNWA 4XEHA 4PZLA 4YMUA 3LP8A 1JFFB 2TSYB 4OP1A 4O4HF 1S8NA 3EWIA 2HL6A 1FUUA 3D6FA 2QM3A 4XB2A 3RUHA 2W2LD 3UMRA 4YONB 4I3HA 1FFEA 2ZTMA 5J1TB 2JLBA 4MUJA 1GQFA 3KFVA 3SX2A 4H7HA 5IABA 1QIKA 3N9IA 4ESHA 2PZGA 2RC6A 1K1EA 2IYPA 4XLLA 5TMBA 2C0QA 4WX2B 2NUTA 3SU8A 4I7EA 3R9XA 2QR5A 3N53A 1E8DA 4JUIA 3ENZA 5JALA 3S2IA 1J2RA 4RQUA 4KPFC 2XNJA 3IABB 3IBTA 3GJ6A 1ES9A 13PKA 4EGSA 5JEDA 4MDEA 3RBZA 1SIBE 4R16A 4BWFB 4LWQA 2OUKA 2QQGA 2HXGA 1A5AB 2FUNB 1U94A 1IOVA 2XQJA 4M8SA 4OLJA 3VZPA 4E5VA 1B1CA 2N3ZA 4YCNA 1YD7A 4L78A 1X1QA 4N3NA 3W7AA 1DO2A 3WYBA 4FINA 1YB7A 2PUEA 4G07A 4OQPA 2W8ZA 3NZEA 4U2BA 1EINA 3N2EA 2O52A 2D8MA 2QZPA 3E8XA 1N2SA 1XMXA 4TVOA 8ATCA 3JQFA 4KJXA 2M6LA 3EXEA 1HKUA 1RMQA 1UQRA 5IKOA 4RELA 1E99A 2C8MA 1AHNA 3GLFB 4A6XA 3F78A 3GPIA 3U16A 2XXAB 4XASA 2CJWB 2HTEA 1RW4A 3EQ2A 1EM8B 1O08A 2AI2A 3IVCA 2R65A 5HJ2A 3TMKA 2CYCA 4HQ0A 4ZMSA 2AE2A 1WUIS 3B6JA 4CU2A 2FN3A 1T8YA 5EHIA 2OCXA 1Y89A 2PT9A 3MZ0A 1QVZA 1XJCA 4I5DA 1JLLB 2P7IA 5DXFA 3USCS 4KXXA 4HCJA 2RKWA 3N0WA 1MB2A 2QD4A 4EHDA 5IAGA 1J22A 4UAVA 1FX1A 2G7MC 3THYB 3KZCA 2ATEA 1DKNA 3KXIA 1FJ2A 1AKUA 1JQKA 3FAZA 4HXGA 1LPNA 1KRWA 2O07A 1NR7A 3FMOB 4UPAA 2HEIA 3QE3A 3I2YX 1O8CA 2M6RA 4OKNA 4PO3X 1UC5B 2X8LA 2YH2A 2H9IA 5J2TB 2ZQ5A 4FNMA 4HF7A 1QNLA 1JQDA 3HDJA 3MTBA 4RVNA 4X71A 3PZCA 1TW2A 2C2KA 3BMOA 4UHJA 3VHLB 1SCAA 3EW9A 4BAUA 2ZIZA 4CLOB 4WXYB 5KNNA 1HGXA 1HRKA 2CJYA 3STWA 3TD6A 1OX6A 4EGAA 2J9RA 2JLCA 4KRFA 2IY5A 4EVQA 5HIAA 3PDHA 5DHFA 1NM5C 3VDRA 2EL9A 4RS3A 4CM4B 1AMNA 5IT0A 3STHA 3ROTA 2BTOA 3G7NA 2HDHA 2F59A 5BW6B 1DXOA 1T15A 2Z2IA 5CFNA 1EP3B 2O8DA 4B74A 4M49A 4UUMA 1L7AA 3L8GA 3B1WA 2ZSEA 1NAIA 3MLEA 1SU8A 1E7QA 3IT0A 3ENWA 3CGGA 4KFRA 4L28A 5AHOA 1L7QA 3H87A 5JHGB 3AF2A 4AN1A 1M6YA 1UP7A 1VI6A 2C4MA 3GUYA 3STXA 3W2TA 4B3DA 5TY0A 3W90A 4HWTA 2PUCA 4FOTA 2FZKA 2EW1A 4Z3KA 1QO9A 5C34B 5BT8A 4CGZA 2Q0HA 2K2QB 4IJ5A 1T8UA 2ZWOA 1G4AE 4B8YA 4CF5A 6REQA 1DEKA 1S2GA 4FGUA 3TZEA 3LQFA 2V4ZA 2CNLA 2YXLA 4E1BA 2XAAA 1WTAA 2I54A 1FPMA 4B7UA 5LQMA 4QECA 3PUVA 3H84A 2RH4A 3PSAA 4NYIR 3LT4A 1GNVA 3D3QA 2BFEA 3ONNA 1Y3FE 4AP6A 2H1WA 1WUTA 1EMDA 2DVEA 1T0HB 1E20A 3L2OB 4Q5IA 2AQ8A 1JTVA 2HDWA 1W87A 2WZQA 2O06A 2JLQA 3GDOA 4L95C 5HJ7A 1D5WA 4JI0B 1S9HA 1FIUA 1MD9A 2Q9CA 5LOVF 1WOYA 2JFUA 2GBFA 1JLRA 2CJ9A 3HVIA 5HCNA 2VQ6A 3TJZA 4DBLE 2NPOA 1TMYA 3V7NA 1KJIA 4I55A 3L93A 2UXDB 1SIUA 2OGTA 2Y1GA 5ERYA 1QGYA 5KZMB 3QYAA 4LF5B 4ZVUA 4DEYA 1CF2O 3CZ9A 3ZNQA 1F3OA 1NUAA 3VGPA 2ZK7A 4F45A 2NYVA 1CQJA 1T1RA 5EHXA 3WWEA 1M0WA 3FNEA 3BZWA 1T6BY 4DPGA 4ZRNA 5B3KA 3SYTA 2I80A 1VYTA 2Y9MB 3T1YB 4DJEC 3B5JA 1W7AA 7YASA 3P96A 2O8EB 4I9NA 2ZIMA 1VHQA 3TX2A 4XUCA 1KOFA 4G56A 3IURA 4KN6A 1CHDA 3EK2A 3LHDA 3AHJA 2BIFA 1MW8X 3H97A 1R6AA 1GPDG 2W6ID 4IHJB 1TMKA 5I9SA 2AMLA 2E55A 3C97A 4Y6RA 3W3AD 1GYQA 2YJ3A 5JPDA 1G16A 1SXPA 1IVSA 3AESA 5A3JA 2NLOA 2PS0A 4CWAA 4LZLA 1ZAYA 1UANA 3AJAA 3I0NA 4O2BA 4YRPA 1OFIA 4UVDA 1KQPA 2R751 3PTAA 3EFEA 2CXUA 2I78A 2D4AA 1QHFA 3EOBI 3IAXA 2NSDA 3QWBA 2Z2YA 3G2JA 3I4FA 3Q3JB 1H69A 2IH2A 1HSZA 4JC4A 3NWJA 4K9DA 1TEXA 5HX7A 3DL2A 4FQ7A 2YMMA 2VSQA 4X20B 3SS8A 5BW4A 5COBA 1OTXA 2GTCA 1RXYA 1HYBA 2HIHA 4KO2S 3OQJA 4RD2A 3QVWA 2DR0A 1UBMS 3TRFA 2I9PA 4BVLA 5HGJA 4W5QA 1FSPA 3THRA 5IZCA 3WBJA 4KQFA 4DC0A 3QLUA 1QHEA 1DINA 1ZZGA 4C3UA 2ZSIA 2JARA 4M8KA 4DEXA 2O4UX 3BXXA 3EPRA 5D85A 1RBYA 3AEKA 2C9MA 4OG2A 1ZI8A 1USUA 4A27A 3PUXA 2CEKA 3CTMA 1CNEA 6AT1A 4OBBA 1XMSA 4WRRA 3OPNA 1AH2A 3ABIA 2UUCB 3U81A 3D5QA 2X5NA 1X8KA 1S7GA 3AR6A 4Q93A 1TQ2A 2HCJB 2E4ZA 2J9FA 3F47A 3DXFA 1UC9A 3LF2A 1OLUA 2P27A 4OQQA 3WRXA 4P3OA 4AG5A 2ZVQX 5A3SA 5EIXA 2ARUA 1VBKA 4Y6QA 1JWAB 3ZVLA 2R7KA 3A3NA 1BMFD 5DBFA 1NNLA 3DM5A 5FL3A 4DWJA 2IDZA 3A6DA 3V42A 4GH5A 5HIMA 3RROA 1KL7A 2QRZA 4FN4A 3VDXA 3KFXA 3ZGZA 3MD0A 3I0MA 1J9EA 1G21B 1RCFA 2ZUBA 1DBPA 4PRLA 5H3CA 4V1CI 3R3WA 4KMRA 7REQA 1ESMA 1MC8A 1QKKA 5EJ2A 3D4IA 2X9LA 4GPAA 1GL9B 4CYMA 3HFZA 1V4BA 4RXUA 3GF4A 4RDHA 3IO3A 2PZEA 4MP8A 1NNEA 3H1GA 3E1SA 3HBJA 1P7CA 3C14C 1BBWA 3QI7A 4HGPA 3QPDA 2Y1BA 1TU3A 4G6ZA 4W7IA 4W1SA 3PICA 3TSQA 1QYIA 2QNIA 1F2VA 2Y1EA 3C3KA 2P3OA 3DMNA 2BMWA 2CV0A 2DUNA 3CT6A 5ICCA 3HJUA 3EZ9A 3LLVA 4OUKX 1H8HD 4BMCA 4NCAA 3B51X 2EZ9A 2IBTA 3E9YA 1YFSA 1A2KC 3QUCA 2RIPA 3E8MA 4BLSA 4L5AA 5DGTA 2AFHB 4DJFC 3K3PA 4M1QA 4I8DA 1QYRA 2XOKA 2HBQA 1IK6A 4TMYA 2NP6A 2GFHA 4EPXA 5IH3A 4R1TA 3VKGA 1JRLA 1TYDE 4ZO7A 1UWLA 4DDWA 1UT6A 1JDBC 1BRTA 4FBLA 5IKPA 1D6JA 2XE8A 2Z98A 4KLCA 2Y67A 4G9BA 2A1IA 2N9UA 1IQ0A 1BRMA 4HNRA 4IOLA 5JDCC 5F33A 3VH3A 2IXFA 4F9TA 4RMFA 1J2JA 5CB4A 2OM6A 3Q5GA 3AB8A 1U5AA 5KPJA 4HVZA 1V6CA 3AB3A 1LSUA 1WXDA 4Q9HA 2HPAA 3ANSA 3KLOA 1NH9A 3WLEA 1TAQA 5DI9A 5ITSA 1R37A 4DCJA 2WQ7A 2NZ2A 2GZSA 1I9CA 2JD0A 4DARA 3SS7X 3IJRA 2FRXA 3E61A 1PSWA 3HHPA 4IJWA 4MOWA 3B7GA 1CU1A 3KX2A 1AC5A 1N5IA 3CSDA 3MF1A 3U60B 1MH9A 2OY0A 1PJSA 1RXIA 2DUMA 3FLAA 3SSOA 4JT8A 4D9FA 3Q88A 5CX4A 3BMCB 4BNUA 1MG5A 1KJ9A 1EDOA 2WKWA 1D6NA 3FKJA 3FXAA 3UCXA 1V1RB 2W8BA 5AKYA 3KFLA 4XPIA 2BZGA 1C3XA 1GL7A 4J15A 4W82A 2R62A 3HH8A 2FWAA 3M70A 4FZRA 5F4BA 2ZOSA 2FEKA 5K3BA 1XMIA 4MV7A 4FK8A 1MEOA 4TYMA 5BV2P 1AUXA 2R1ZA 1DEAA 3U4DA 2GCGA 4QUKA 4ARIA 5M2QA 3TSZA 4P4GA 4G0MA 3GP5A 4JI1B 1S3FA 2FEPA 4URXR 5K0LA 1Q44A 2OCAA 2VF8A 3IKJA 5I9MA 1ZJ6A 1Q0QA 1UKZA 2PD6A 1UBNA 3DOCA 2F55A 1JG4A 3KWMA 3Q4GA 4R9RA 4DT1A 1A77A 3OU6A 3FCAA 2PT6A 2E2WA 4F9GA 4FCTA 3IEIA 4OP2A 3LQRA 3A4LA 3FI0A 4Y9DA 4YRQA 1JHDA 5CITA 3C6KA 1DV2A 3H42B 4OHUA 4YCDA 4WLOA 3AVQA 5AI4A 4PINA 2PQ0A 1G17A 1PGQA 4EKNB 4GUDA 3UFXA 1EUZA 1SRRA 3WI7A 5B2EA 1DMRA 3WYGA 2ZZMA 1RSZA 1S5PA 4GC5A 4RJLA 4BRWA 3TW6A 2FPMA 1YT5A 2QU7A 2DTEA 5D8DA 2UYQA 4MH0R 5TPZA 4C6TA 3Q8KA 1QZXA 2E5WA 3QVXA 4WEOA 2J0QA 3EXHC 3PJFA 4GFDA 2C0CA 2EJFA 4R3UC 3RJTA 3T1OA 1RXWA 1XCPA 2B2NA 3H9GA 4R8KA 4AULA 3I1JA 1U8AA 3WQHA 3NFRA 1E94E 2YYAA 4FHEA 2PBFA 2HOQA 4TYYA 3A1DA 4YRIA 2QXTA 2AXPA 2GERA 1L3BA 1M6NA 3U6BA 4PY2A 3JQPA 4Z8YA 5BMVF 2P4HX 1C0EA 5JSUA 4XSHA 2UZ3A 2GXUA 1E92A 5F5WA 1YR1A 2JRLA 1K8ZB 1QH0A 3BBPA 3E3LA 1PWYE 4RH3A 3LDFA 2HFKA 3VTKA 5BSEA 2RI0A 2WJHA 2ICAA 2YV1A 3BGIA 3GP8A 3E9MA 1CV2A 4ZVRA 3QEMA 1UFQA 4ZCLA 2I2CA 3PUHA 4N7MA 4E5DA 1ACLA 3EXFA 2BGKA 1C0KA 4A10A 2ZUDA 5BUZA 4N4AA 3A28A 1ZN8A 4PCUA 3NHYA 3HSYA 4AD8A 1NYTA 4UM7A 1CWUA 1J00A 1TA4A 2RHBA 3TEFA 4CODB 1Z8DA 2J5XA 4LVLA 3H13A 2ZJ6A 3JQBA 3DCJA 1CY2A 1JDBB 4BCDA 2XH8A 2BEVB 4ZAVA 1R9NA 4CI0B 2WSYB 3UQYS 3ESZA 2ZP1A 1R0WA 3DKKA 5F52A 4PSVA 2ZSUA 1DIHA 1H4VB 2P79A 3B1FA 4LOLA 3L4JA 2F8SA 2AYXA 2Y99A 2HLDA 4RHTA 2NV6A 1OXVA 2I2AA 3J80A 5ICEA 2WPNA 1JDQA 3PNYA 1FNCA 4P4TA 5J2UB 3GLRA 1UZAA 3KS9A 3F46A 2VTBB 3HDYA 1X77A 1U8EA 5HRCA 4MLZA 2GTIA 2OV1A 3PRKE 4OH1A 5I8PA 3WGJA 5FYDA 4G84A 1Z82A 1OHHA 3CF4A 3HB5X 3R24A 1NJSA 2H11A 4QVGA 3HMQA 5JY1A 1MVOA 4RFSA 3D9QX 3EIWA 2BR4A 2BBSA 1S9DA 3DV2A 4RNDB 1OU4A 1C3VA 1RWOA 2Z04A 2P75A 3C8MA 3DE4X 3M1YA 4ZQHA 5TV2A 4CN9A 3IJ5A 3V2UA 4E30A 4K9LA 3VU8A 1Q1QA 1Z13A 3OCCA 4Q03A 5HFJA 2H1SA 1C9YA 3IQDB 1P62B 2XQGA 5FFNA 1DBQA 4IXNA 4OGGA 4H27A 4AX4A 5DULA 3I01A 3M6UA 4QJ5A 1G20B 2A88A 1L3IA 4KSYA 1E5XA 2VDLB 4A1FA 5C80A 1ID1A 1AZWA 1H5QA 1WD5A 3D3EA 2JLYA 4YRSA 1WMDA 3W3SA 3VKWA 1KO8A 4JA2A 3RSCA 5K8VA 2A9JA 5K03A 3ZU3A 4DR5B 4ID3A 2EW2A 2GT1A 1KI1A 1O4WA 3KDAA 3QBTA 3TZQA 2N1BA 4FR5A 3T7KA 1KK3A 1B70B 1FW6A 3OOHA 1VM0A 1ZXBA 3CISA 5D84A 2BJWA 4TWAA 2GN2A 2LW7A 3CCBA 3PKJA 1L4HA 3OPMA 4NMMA 3VSAA 3GJ4A 1A27A 5IT5A 1U0LA 3ONVA 3TPZA 4YR9A 4F4FA 3KEGA 4PG5A 3EVNA 2IIBA 2AMYA 4RKRA 2V7TA 4L6AA 3PX2A 5JROA 2DQZA 4ATNA 3FGOA 4DMFA 5CG1A 3ZHXA 4Y0AA 1SETA 2ID9A 3LSQA 3UMCA 3DYBA 1JHOA 2DQ3A 1E9SA 5DBOA 3ZU5A 3ZWOA 4WA7A 2OKCA 4AG3A 4DAEA 3V7CA 4IUBS 1R6DA 1T43A 4UTOA 1ZM9A 3N8IA 5JISA 5BN3A 4EARA 5KWVA 4DPMA 2XCRB 3U13A 3OUUA 3UAVA 5DWDA 3BRWD 4LZOA 2FP3A 3W78A 5K3OA 2HWUA 2H4JA 2F2TA 2IHZA 3I2HA 3K94A 4N6OA 4QFDA 1JHVA 3DXZA 2JI7A 2AMCA 4TVBA 4WNCA 1CUZA 4MQ5A 1Y6FA 4QXQA 3ZV6A 3QFSA 1AMOA 3U44A 5FOVA 2Q5OA 5GOTA 3OEHD 1Q7BA 4RVUA 4RTMA 1Z7EA 3UHOA 4P72A 2O3UA 3B82A 4XQGA 2ZS8A 5CLIA 3UANA 5K3AA 3WTBA 1AKMA 2G4VA 2O7RA 3QKRB 2PQ2A 2PMWB 3M0EA 5L53A 2E21A 1CUGA 1M5RA 1NMYA 1XAGA 3IJPA 3RQIA 2EYUA 4YHHB 5J5VA 3IDSA 3O1JC 4TZKA 2ZNJA 2WG1A 3NHZA 4PGMA 4UBLA 4AWAA 1MAVA 3IBSA 5CNJA 1BDBA 3GGPA 4MV3A 4GGPA 1USYC 1C50A 2Q3EA 2PKYX 3C7CB 3OP1A 4RE5A 1CUCA 3D02A 4ZJPA 3V1TC 5IWCA 4KNYA 3AF0A 1VHTA 4FXPA 3RTEA 3KRTA 3B6KA 4KE9A 1F4PA 3NEPX 1VYHA 2ZGVA 3BZBA 5DCUA 4DV5B 2AOVA 1OBHA 3ESCA 3L0PA 2BFCB 1E66A 5DX8A 1MQ9A 3EC7A 1QVWA 4UPEA 3IBCA 1YR6A 2Y8EA 4XCQA 1PQYA 2WWHA 3T12A 1Z4JA 4QHTA 3HK2A 5AESA 2WJVA 2CN1A 2OZEA 5BN4A 3L8FA 5B3JC 2OMEA