The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
98
|
structure length |
98
|
Chain Sequence |
KVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Translation
|
| molecule keywords |
Translation initiation factor IF-3
|
| publication title |
Solution structure of the a C-terminal domain of translation initiation factor IF-3 from Campylobacter jejuni
rcsb |
| source organism |
Campylobacter jejuni
|
| total genus |
24
|
| structure length |
98
|
| sequence length |
98
|
| ec nomenclature | |
| pdb deposition date | 2013-04-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00707 | IF3_C | Translation initiation factor IF-3, C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Translation initiation factor 3 (IF-3), C-terminal domain |
#chains in the Genus database with same CATH superfamily 2M71 A; 2IFE A; 2CRQ A; 1TIG A; #chains in the Genus database with same CATH topology 2EH1 A; 3WBM A; 4FBQ A; 2M71 A; 2H9U A; 4EO0 A; 3P04 A; 1Y2I A; 4NZT M; 1TIG A; 2P9B A; 1NFJ A; 4K88 A; 3TSQ A; 1VR4 A; 1PAV A; 4FBW A; 1NJ8 A; 1JDQ A; 1JO0 A; 3IAB A; 1II7 A; 1JE3 A; 4FCX A; 3TOE A; 1HC7 A; 4Q15 A; 3TTD A; 3QKB A; 2LXR A; 1NJ2 A; 1H4S A; 1H4Q A; 4YDQ A; 1XEZ A; 4TWA A; 3TSU A; 3ZII A; 1LN4 A; 4HVZ A; 4Z9E A; 3ZIG A; 3LVK B; 1NFH A; 2EK0 A; 1NJ5 A; 4K87 A; 1UDV A; 2BKY X; 3LVJ C; 2Q3V A; 4YKE A; 3ZIH A; 1H0X A; 3IAL A; 2L8Y A; 3VTH A; 4NZR M; 2CRQ A; 3VTI A; 3T1I A; 4K86 A; 3TTC A; 1Y9X A; 1H4T A; 4WI1 A; 1NJ6 A; 3ZIE A; 3DSD A; 4HD0 A; 2IFE A; 1NH9 A; 2Y1B A; 2GTC A; 3IAB B; 1S8E A; 3DSC A; 1H0Y A; 1VM0 A; 2Z7C A; 3HZ7 A; 1NJ1 A; 3TSP A; 4NCX A; 2A2Y A; 4HVC A; 2LN3 A; 3TTF A; 1RQ8 A; 3U6Y A; 4OLF A; 1DCJ A; 4FBK A; #chains in the Genus database with same CATH homology 2M71 A; 2IFE A; 2CRQ A; 1TIG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
