2M71A

Solution structure of the a c-terminal domain of translation initiation factor if-3 from campylobacter jejuni
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
KVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the a C-terminal domain of translation initiation factor IF-3 from Campylobacter jejuni
rcsb
molecule keywords Translation initiation factor IF-3
molecule tags Translation
source organism Campylobacter jejuni
total genus 24
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00707 IF3_C Translation initiation factor IF-3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.10 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation initiation factor 3 (IF-3), C-terminal domain 2m71A00
2CRQA 1TIGA 2M71A 2IFEA
chains in the Genus database with same CATH superfamily
3LVKB 4K88A 1H4SA 2M71A 2Z7CA 4NCXA 1Y2IA 2BKYX 3U6YA 1Y9XA 4WI1A 4OLFA 4YDQA 3DSDA 2Q3VA 1NJ1A 3ZIHA 3TTCA 4Z9EA 1JO0A 1TIGA 1II7A 2P9BA 1H4QA 3DSCA 2A2YA 1NJ6A 1JDQA 3ZIIA 3ZIGA 1RQ8A 2Y1BA 1H0XA 1XEZA 1NJ8A 4FBKA 1H0YA 1NJ5A 3IABB 1VM0A 1LN4A 1UDVA 4FBWA 1HC7A 1NJ2A 3HZ7A 1NH9A 2H9UA 3VTHA 3VTIA 4K87A 3P04A 4YKEA 3TTFA 2LXRA 1VR4A 3TSQA 1DCJA 3TOEA 1H4TA 2GTCA 4TWAA 4EO0A 1NFJA 3TSUA 4FBQA 3T1IA 4HD0A 3WBMA 2EH1A 4Q15A 2CRQA 3ZIEA 3LVJC 4FCXA 2L8YA 2LN3A 4HVCA 4K86A 3QKBA 4HVZA 2EK0A 1JE3A 1PAVA 3IABA 3TSPA 4NZRM 1NFHA 2IFEA 3TTDA 3IALA 4NZTM 1S8EA
chains in the Genus database with same CATH topology
2CRQA 1TIGA 2M71A 2IFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRQ A;  1TIG A;  2M71 A;  2IFE A; 
#chains in the Genus database with same CATH topology
 3LVK B;  4K88 A;  1H4S A;  2M71 A;  2Z7C A;  4NCX A;  1Y2I A;  2BKY X;  3U6Y A;  1Y9X A;  4WI1 A;  4OLF A;  4YDQ A;  3DSD A;  2Q3V A;  1NJ1 A;  3ZIH A;  3TTC A;  4Z9E A;  1JO0 A;  1TIG A;  1II7 A;  2P9B A;  1H4Q A;  3DSC A;  2A2Y A;  1NJ6 A;  1JDQ A;  3ZII A;  3ZIG A;  1RQ8 A;  2Y1B A;  1H0X A;  1XEZ A;  1NJ8 A;  4FBK A;  1H0Y A;  1NJ5 A;  3IAB B;  1VM0 A;  1LN4 A;  1UDV A;  4FBW A;  1HC7 A;  1NJ2 A;  3HZ7 A;  1NH9 A;  2H9U A;  3VTH A;  3VTI A;  4K87 A;  3P04 A;  4YKE A;  3TTF A;  2LXR A;  1VR4 A;  3TSQ A;  1DCJ A;  3TOE A;  1H4T A;  2GTC A;  4TWA A;  4EO0 A;  1NFJ A;  3TSU A;  4FBQ A;  3T1I A;  4HD0 A;  3WBM A;  2EH1 A;  4Q15 A;  2CRQ A;  3ZIE A;  3LVJ C;  4FCX A;  2L8Y A;  2LN3 A;  4HVC A;  4K86 A;  3QKB A;  4HVZ A;  2EK0 A;  1JE3 A;  1PAV A;  3IAB A;  3TSP A;  4NZR M;  1NFH A;  2IFE A;  3TTD A;  3IAL A;  4NZT M;  1S8E A; 
#chains in the Genus database with same CATH homology
 2CRQ A;  1TIG A;  2M71 A;  2IFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...