The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
106
|
structure length |
106
|
Chain Sequence |
NWESITKSYYTGFAISKTVESKDKDGKPVRKEVITQADLTTACNDAKASAQNVFNQIKLTLSGTWPNSQFRLVTGDTCVYNGSPGEKTESWSIRAQVEGDIQRSVP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Viral protein
|
source organism |
Enterobacteria phage ike
|
publication title |
Structural and energetic basis of infection by the filamentous bacteriophage IKe.
pubmed doi rcsb |
molecule keywords |
Attachment protein G3P
|
total genus |
23
|
structure length |
106
|
sequence length |
106
|
ec nomenclature | |
pdb deposition date | 2012-04-13 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Translation Initiation Factor IF3 |
#chains in the Genus database with same CATH superfamily 4EO0 A; #chains in the Genus database with same CATH topology 2LXR A; 2Z7C A; 3U6Y A; 1JDQ A; 4EO0 A; 2M71 A; 2A2Y A; 2CRQ A; 1S8E A; 3ZIE A; 3TSQ A; 1PAV A; 4FBQ A; 3QKB A; 1TIG A; 3IAB A; 4NZR M; 4NZT M; 4YDQ A; 2P9B A; 2EH1 A; 1NJ6 A; 4YKE A; 1H0Y A; 1H4Q A; 3LVK B; 3ZIH A; 4HD0 A; 2EK0 A; 3HZ7 A; 3T1I A; 3VTI A; 3LVJ C; 1II7 A; 3P04 A; 3TTD A; 1VR4 A; 4K86 A; 1NJ2 A; 1UDV A; 4WI1 A; 1NJ8 A; 1Y2I A; 2LN3 A; 1NJ1 A; 1VM0 A; 3IAL A; 4K87 A; 1NFJ A; 3ZIG A; 2L8Y A; 3TSU A; 2Y1B A; 1H4T A; 3WBM A; 1JE3 A; 1RQ8 A; 1Y9X A; 1NFH A; 3VTH A; 4NCX A; 3DSC A; 3DSD A; 4FBK A; 1HC7 A; 4TWA A; 4Z9E A; 3TSP A; 1NJ5 A; 2GTC A; 1XEZ A; 3TTC A; 3ZII A; 4HVZ A; 1H0X A; 1DCJ A; 1LN4 A; 4HVC A; 4FBW A; 2BKY X; 2Q3V A; 2IFE A; 4Q15 A; 4OLF A; 1JO0 A; 1H4S A; 4FCX A; 1NH9 A; 2H9U A; 3TOE A; 3TTF A; 4K88 A; 3IAB B; #chains in the Genus database with same CATH homology 2P9B A; 4NZR M; 3TSP A; 4YKE A; 4EO0 A; 1XEZ A; 3TTC A; 3ZII A; 4HVZ A; 3ZIH A; 3ZIG A; 3ZIE A; 3TSU A; 3T1I A; 3TSQ A; 4FBW A; 3VTI A; 4FBQ A; 3P04 A; 3TTD A; 4FCX A; 3VTH A; 3TTF A; 4FBK A; 2LN3 A; 4NZT M;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...