The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
INVKEVRLSPTIEEHDFNTKLRNARKFLEKGDKVKATIRFKGRAITHKEIGQRVLDRLSEACADIAVVETAPKMDGRNMFLVLAPKND
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
X-ray crystallography shows that translational initiation factor IF3 consists of two compact alpha/beta domains linked by an alpha-helix.
pubmed rcsb |
| molecule keywords |
TRANSLATION INITIATION FACTOR 3
|
| molecule tags |
Ribosome binding factor
|
| source organism |
Geobacillus stearothermophilus
|
| total genus |
27
|
| structure length |
88
|
| sequence length |
88
|
| ec nomenclature | |
| pdb deposition date | 1995-08-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00707 | IF3_C | Translation initiation factor IF-3, C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Translation initiation factor 3 (IF-3), C-terminal domain |
#chains in the Genus database with same CATH superfamily 2M71 A; 2IFE A; 1TIG A; 2CRQ A; #chains in the Genus database with same CATH topology 4HD0 A; 4K86 A; 3TSP A; 4WI1 A; 4FBK A; 4NZR M; 1NFH A; 2P9B A; 1JE3 A; 3LVJ C; 3LVK B; 3HZ7 A; 2IFE A; 1Y9X A; 3VTI A; 3IAB B; 4FBW A; 1XEZ A; 1RQ8 A; 4HVC A; 2BKY X; 2LN3 A; 3P04 A; 1NH9 A; 4EO0 A; 4Z9E A; 3TTD A; 3QKB A; 1HC7 A; 1NFJ A; 1Y2I A; 4TWA A; 1VM0 A; 1H4S A; 1LN4 A; 1S8E A; 1NJ5 A; 2Y1B A; 3DSC A; 1VR4 A; 4FCX A; 4YKE A; 1PAV A; 1H0X A; 1TIG A; 3WBM A; 3T1I A; 2Q3V A; 1H4T A; 2CRQ A; 1NJ1 A; 2A2Y A; 1NJ6 A; 3TTC A; 3ZII A; 3ZIG A; 4NCX A; 2L8Y A; 3ZIE A; 3VTH A; 1NJ2 A; 1II7 A; 1H0Y A; 1NJ8 A; 4HVZ A; 2H9U A; 4K87 A; 4YDQ A; 1JDQ A; 3TOE A; 3DSD A; 2EH1 A; 4K88 A; 2EK0 A; 2LXR A; 4Q15 A; 1JO0 A; 4OLF A; 3ZIH A; 2Z7C A; 1H4Q A; 2M71 A; 1DCJ A; 3IAB A; 4NZT M; 2GTC A; 3TTF A; 3U6Y A; 1UDV A; 3TSQ A; 3TSU A; 4FBQ A; 3IAL A; #chains in the Genus database with same CATH homology 2M71 A; 2IFE A; 1TIG A; 2CRQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
