The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
TEKLNEIVVRKTKNVEDHVLDVIVLFNQGIDEVILKGTGREISKAVDVYNSLKDRLGDGVQLVNVQTGSEVRDRRRISYILLRLKRVY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the hyperthermophilic archaeal DNA-binding protein Sso10b2 at a resolution of 1.85 Angstroms
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Sulfolobus solfataricus
|
molecule keywords |
DNA binding protein SSO10b
|
total genus |
25
|
structure length |
88
|
sequence length |
88
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2003-05-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01918 | Alba | Alba |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Alba-like domain |
#chains in the Genus database with same CATH superfamily 2H9U A; 2A2Y A; 1NH9 A; 3IAB B; 3IAB A; 1VM0 A; 3WBM A; 1NFH A; 2EH1 A; 1Y9X A; 1NFJ A; 1H0X A; 3U6Y A; 3TOE A; 2EK0 A; 4Z9E A; 2BKY X; 2Q3V A; 1UDV A; 2Z7C A; 1H0Y A; #chains in the Genus database with same CATH topology 4HVC A; 3ZII A; 3P04 A; 1VM0 A; 3TSQ A; 1NJ8 A; 3LVK B; 3LVJ C; 2LN3 A; 3TSP A; 1RQ8 A; 1H4S A; 2Q3V A; 4NZR M; 2Z7C A; 1LN4 A; 1JO0 A; 2H9U A; 2CRQ A; 3TSU A; 3HZ7 A; 3TTD A; 3IAB B; 3IAB A; 4WI1 A; 1VR4 A; 4FBK A; 4EO0 A; 3WBM A; 1NFH A; 1PAV A; 2IFE A; 4FBW A; 1DCJ A; 4OLF A; 1NJ6 A; 3DSC A; 3U6Y A; 3TOE A; 2EK0 A; 2GTC A; 2BKY X; 4Z9E A; 1UDV A; 3VTH A; 3QKB A; 1NJ1 A; 2A2Y A; 4YDQ A; 3VTI A; 4K88 A; 3TTF A; 1NJ2 A; 2LXR A; 4K86 A; 2L8Y A; 1HC7 A; 1H4T A; 4Q15 A; 3DSD A; 2Y1B A; 2EH1 A; 3TTC A; 4FCX A; 1H0X A; 2M71 A; 1NJ5 A; 3ZIE A; 1H0Y A; 2P9B A; 1NH9 A; 4HD0 A; 4HVZ A; 3T1I A; 3ZIG A; 4K87 A; 4TWA A; 1Y2I A; 3ZIH A; 3IAL A; 1Y9X A; 1NFJ A; 4YKE A; 4NCX A; 4FBQ A; 1JE3 A; 1TIG A; 1XEZ A; 1II7 A; 1JDQ A; 4NZT M; 1H4Q A; 1S8E A; #chains in the Genus database with same CATH homology 2H9U A; 2A2Y A; 1NH9 A; 3IAB B; 3IAB A; 1VM0 A; 3WBM A; 1NFH A; 2EH1 A; 1Y9X A; 1NFJ A; 1H0X A; 3U6Y A; 3TOE A; 2EK0 A; 4Z9E A; 2BKY X; 2Q3V A; 1UDV A; 2Z7C A; 1H0Y A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...