2LFCA

Solution nmr structure of fumarate reductase flavoprotein subunit from lactobacillus plantarum, northeast structural genomics consortium target lpr145j
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
b'MVEPGVAKLTTYASKQATDMGAIYVNSKGDRIVNESNVYTTFRNAILKQADKVAYLVMDERTWKKVYDLLILHDFTPEEIKSFFENKGKRPVFVKGSLESAAEQAGIVVDELVQTVKNYQGYVQDGHDHDFGRDPKYLHQFEGETFYIIEQRLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase, flavoprotein subunit
publication title Northeast Structural Genomics Consortium Target LpR145J
rcsb
source organism Lactobacillus plantarum
molecule tags Oxidoreductase
total genus 44
structure length 160
sequence length 160
ec nomenclature ec 1.3.99.1: Deleted entry.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2lfcA00
3CIRA 1E7PA 3VR9A 1ZOYA 2WDRA 1M64A 2BS3A 4C3XA 1NENA 2FJAA 1CHUA 3P4SA 1KNRA 3AEEA 4YT0A 3AEFA 1P2EA 1JRYA 2H88A 1QO8A 3ABVA 2FBWA 1Q9IA 3AE3A 1LJ1A 1NEKA 3VRBA 3GYXA 1E39A 5KXJA 1P2HA 1JRZA 2WU5A 1D4CA 1JNRA 2WDVA 2WS3A 1YQ4A 2WP9A 1QLBA 3AE8A 1D4DA 3VRAA 2WU2A 1QJDA 3AE7A 2FJDA 5C3JA 3AE6A 4YTPA 2WQYA 3AE4A 4C3YA 1JRXA 2WDQA 4YTMA 3VR8A 1L0VA 3AEGA 2LFCA 4YSZA 2FJEA 1KSSA 3AEDA 3SFDA 3AE9A 3AE5A 2B7SA 1KFYA 1JNZA 1YQ3A 3SFEA 2ACZA 2FJBA 4AT0A 3AEBA 4YXDA 2H89A 1ZP0A 4AT2A 5C2TA 3P4QA 1KNPA 4YTNA 2BS2A 2B7RA 4YSXA 3P4RA 3AE2A 3AEAA 2E5VA 1Y0PA 3AECA 1KF6A 4KX6A 1D4EA 3P4PA 2B76A 2BS4A 3AE1A 1KSUA 4YSYA
chains in the Genus database with same CATH superfamily
3CIRA 1E7PA 3VR9A 1ZOYA 2WDRA 1M64A 2BS3A 4C3XA 1NENA 2FJAA 1CHUA 3P4SA 1KNRA 3AEEA 4YT0A 3AEFA 1P2EA 1JRYA 2H88A 1QO8A 3ABVA 2FBWA 1Q9IA 3AE3A 1LJ1A 1NEKA 3VRBA 3GYXA 1E39A 5KXJA 1P2HA 1JRZA 2WU5A 1D4CA 1JNRA 2WDVA 2WS3A 1YQ4A 2WP9A 1QLBA 3AE8A 1D4DA 3VRAA 2WU2A 1QJDA 3AE7A 2FJDA 5C3JA 3AE6A 4YTPA 2WQYA 3AE4A 4C3YA 1JRXA 2WDQA 4YTMA 3VR8A 1L0VA 3AEGA 2LFCA 4YSZA 2FJEA 1KSSA 3AEDA 3SFDA 3AE9A 3AE5A 2B7SA 1KFYA 1JNZA 1YQ3A 3SFEA 2ACZA 2FJBA 4AT0A 3AEBA 4YXDA 2H89A 1ZP0A 4AT2A 5C2TA 3P4QA 1KNPA 4YTNA 2BS2A 2B7RA 4YSXA 3P4RA 3AE2A 3AEAA 2E5VA 1Y0PA 3AECA 1KF6A 4KX6A 1D4EA 3P4PA 2B76A 2BS4A 3AE1A 1KSUA 4YSYA
chains in the Genus database with same CATH topology
3CIRA 1E7PA 3VR9A 1ZOYA 2WDRA 1M64A 2BS3A 4C3XA 1NENA 2FJAA 1CHUA 3P4SA 1KNRA 3AEEA 4YT0A 3AEFA 1P2EA 1JRYA 2H88A 1QO8A 3ABVA 2FBWA 1Q9IA 3AE3A 1LJ1A 1NEKA 3VRBA 3GYXA 1E39A 5KXJA 1P2HA 1JRZA 2WU5A 1D4CA 1JNRA 2WDVA 2WS3A 1YQ4A 2WP9A 1QLBA 3AE8A 1D4DA 3VRAA 2WU2A 1QJDA 3AE7A 2FJDA 5C3JA 3AE6A 4YTPA 2WQYA 3AE4A 4C3YA 1JRXA 2WDQA 4YTMA 3VR8A 1L0VA 3AEGA 2LFCA 4YSZA 2FJEA 1KSSA 3AEDA 3SFDA 3AE9A 3AE5A 2B7SA 1KFYA 1JNZA 1YQ3A 3SFEA 2ACZA 2FJBA 4AT0A 3AEBA 4YXDA 2H89A 1ZP0A 4AT2A 5C2TA 3P4QA 1KNPA 4YTNA 2BS2A 2B7RA 4YSXA 3P4RA 3AE2A 3AEAA 2E5VA 1Y0PA 3AECA 1KF6A 4KX6A 1D4EA 3P4PA 2B76A 2BS4A 3AE1A 1KSUA 4YSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIR A;  1E7P A;  3VR9 A;  1ZOY A;  2WDR A;  1M64 A;  2BS3 A;  4C3X A;  1NEN A;  2FJA A;  1CHU A;  3P4S A;  1KNR A;  3AEE A;  4YT0 A;  3AEF A;  1P2E A;  1JRY A;  2H88 A;  1QO8 A;  3ABV A;  2FBW A;  1Q9I A;  3AE3 A;  1LJ1 A;  1NEK A;  3VRB A;  3GYX A;  1E39 A;  5KXJ A;  1P2H A;  1JRZ A;  2WU5 A;  1D4C A;  1JNR A;  2WDV A;  2WS3 A;  1YQ4 A;  2WP9 A;  1QLB A;  3AE8 A;  1D4D A;  3VRA A;  2WU2 A;  1QJD A;  3AE7 A;  2FJD A;  5C3J A;  3AE6 A;  4YTP A;  2WQY A;  3AE4 A;  4C3Y A;  1JRX A;  2WDQ A;  4YTM A;  3VR8 A;  1L0V A;  3AEG A;  2LFC A;  4YSZ A;  2FJE A;  1KSS A;  3AED A;  3SFD A;  3AE9 A;  3AE5 A;  2B7S A;  1KFY A;  1JNZ A;  1YQ3 A;  3SFE A;  2ACZ A;  2FJB A;  4AT0 A;  3AEB A;  4YXD A;  2H89 A;  1ZP0 A;  4AT2 A;  5C2T A;  3P4Q A;  1KNP A;  4YTN A;  2BS2 A;  2B7R A;  4YSX A;  3P4R A;  3AE2 A;  3AEA A;  2E5V A;  1Y0P A;  3AEC A;  1KF6 A;  4KX6 A;  1D4E A;  3P4P A;  2B76 A;  2BS4 A;  3AE1 A;  1KSU A;  4YSY A; 
#chains in the Genus database with same CATH topology
 3CIR A;  1E7P A;  3VR9 A;  1ZOY A;  2WDR A;  1M64 A;  2BS3 A;  4C3X A;  1NEN A;  2FJA A;  1CHU A;  3P4S A;  1KNR A;  3AEE A;  4YT0 A;  3AEF A;  1P2E A;  1JRY A;  2H88 A;  1QO8 A;  3ABV A;  2FBW A;  1Q9I A;  3AE3 A;  1LJ1 A;  1NEK A;  3VRB A;  3GYX A;  1E39 A;  5KXJ A;  1P2H A;  1JRZ A;  2WU5 A;  1D4C A;  1JNR A;  2WDV A;  2WS3 A;  1YQ4 A;  2WP9 A;  1QLB A;  3AE8 A;  1D4D A;  3VRA A;  2WU2 A;  1QJD A;  3AE7 A;  2FJD A;  5C3J A;  3AE6 A;  4YTP A;  2WQY A;  3AE4 A;  4C3Y A;  1JRX A;  2WDQ A;  4YTM A;  3VR8 A;  1L0V A;  3AEG A;  2LFC A;  4YSZ A;  2FJE A;  1KSS A;  3AED A;  3SFD A;  3AE9 A;  3AE5 A;  2B7S A;  1KFY A;  1JNZ A;  1YQ3 A;  3SFE A;  2ACZ A;  2FJB A;  4AT0 A;  3AEB A;  4YXD A;  2H89 A;  1ZP0 A;  4AT2 A;  5C2T A;  3P4Q A;  1KNP A;  4YTN A;  2BS2 A;  2B7R A;  4YSX A;  3P4R A;  3AE2 A;  3AEA A;  2E5V A;  1Y0P A;  3AEC A;  1KF6 A;  4KX6 A;  1D4E A;  3P4P A;  2B76 A;  2BS4 A;  3AE1 A;  1KSU A;  4YSY A; 
#chains in the Genus database with same CATH homology
 3CIR A;  1E7P A;  3VR9 A;  1ZOY A;  2WDR A;  1M64 A;  2BS3 A;  4C3X A;  1NEN A;  2FJA A;  1CHU A;  3P4S A;  1KNR A;  3AEE A;  4YT0 A;  3AEF A;  1P2E A;  1JRY A;  2H88 A;  1QO8 A;  3ABV A;  2FBW A;  1Q9I A;  3AE3 A;  1LJ1 A;  1NEK A;  3VRB A;  3GYX A;  1E39 A;  5KXJ A;  1P2H A;  1JRZ A;  2WU5 A;  1D4C A;  1JNR A;  2WDV A;  2WS3 A;  1YQ4 A;  2WP9 A;  1QLB A;  3AE8 A;  1D4D A;  3VRA A;  2WU2 A;  1QJD A;  3AE7 A;  2FJD A;  5C3J A;  3AE6 A;  4YTP A;  2WQY A;  3AE4 A;  4C3Y A;  1JRX A;  2WDQ A;  4YTM A;  3VR8 A;  1L0V A;  3AEG A;  2LFC A;  4YSZ A;  2FJE A;  1KSS A;  3AED A;  3SFD A;  3AE9 A;  3AE5 A;  2B7S A;  1KFY A;  1JNZ A;  1YQ3 A;  3SFE A;  2ACZ A;  2FJB A;  4AT0 A;  3AEB A;  4YXD A;  2H89 A;  1ZP0 A;  4AT2 A;  5C2T A;  3P4Q A;  1KNP A;  4YTN A;  2BS2 A;  2B7R A;  4YSX A;  3P4R A;  3AE2 A;  3AEA A;  2E5V A;  1Y0P A;  3AEC A;  1KF6 A;  4KX6 A;  1D4E A;  3P4P A;  2B76 A;  2BS4 A;  3AE1 A;  1KSU A;  4YSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...