3VR8A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 206
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr8A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr8A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr8A04
2GMJA 2IVEA 1Y56B 1CJ3A 1F8SA 3DMEA 3NT6A 1Q1WA 4B65A 2XVEA 1NAAA 3QSEA 4Y4NA 5U25A 1RYIA 1MXTA 4I59A 5C2TA 2VVLA 3C4AA 1JRYA 1E1MA 1CF3A 2JKCA 1Z6LA 3UKQA 2BC1A 2XFQA 4RG3A 3V3NA 4H4PA 1F3PA 1MO9A 3BNMA 1EL5A 4EMIA 2OAMA 4Z44A 4Z43A 2B76A 4ICYA 2YR4A 1FEAA 4EIQA 4O5QA 2YG6A 1IUSA 3D1CA 3AEBA 5JCMA 2GQWA 2UZZA 2VRLA 4FDCB 4FK1A 4KPRA 3NTDA 1JU2A 3M13A 3IF9A 4CCRA 1VDCA 5GRTA 3GSIA 2WEUA 1PXCA 4REKA 2EQ7A 5FS9A 1GETA 1QO8A 1PBDA 1RSGA 3II4A 2B9XA 4K22A 2WP6A 2RGJA 2YR6A 2C73A 4IVOB 3LJPA 3P4SA 5JCNA 1B37A 2BCPA 3SFEA 4YSZA 1ELIA 2IIDA 3FMWA 3OZ2A 4JN9A 1ZOYA 1ZP0A 1GRBA 3KVEA 1BKWA 4O5UA 2R4EA 3K7QX 2XVHA 2VQ7A 2YM2A 1Q1RA 4GRTA 1VRQB 4H2NA 3UOYA 2PYXA 3BNUA 2ARDA 3RNMA 2WHDA 5LV9A 2BC0A 1KNRA 3C96A 4LIIA 1GALA 4NZHA 2VQBA 2Z5YA 4YKGA 2JB2A 1H84A 2GRTA 2Y6QA 2BK5A 1VQWA 5HHFA 2GB0A 3EPTA 2IVDA 3GRTA 3UTEA 1CJCA 3SM8A 3COXA 3VRDB 4K5SA 2YVJA 4TLZA 3AD7B 5M10A 2CVJA 4A6NB 2RGHA 2GH5A 1KNPA 3QJ4A 2RABA 4Z24A 4YSXA 4K7ZA 4A6NA 1NHSA 4XXGA 3FG2P 1D7LA 3ABVA 4JNAA 2B9WA 1S2YA 1L0VA 3KKJA 2DKHA 3AE3A 4GDPA 4XWRA 1OJCA 1DODA 4PABA 3ALLA 4AP3A 3F8DA 3AWIA 3GYIA 4YKFA 4DNAA 4Z2UA 4K8DA 2JB3A 3ADAB 3DK9A 2BXSA 3GWDA 4OPCA 5HYMA 4M52A 1NEKA 1LJ1A 1XDIA 2X50A 4U2SA 4UDQA 2WDRA 4Z25A 3SGLA 3AEFA 4MJWA 2VZ2A 5CKUA 4BJYA 2XFNA 1PHHA 4EQWA 4CRTA 2E5VA 1JNRA 4YSHA 1KDGA 2F5ZA 2GV8A 2YVGA 4U8JA 3P1WA 1F6MA 3AE2A 1E1KA 2WETA 3KU9A 2BA9A 4ZN0A 2V60A 3ICTA 1REOA 1OJTA 4K2XA 1PBCA 3GD3A 4TM0A 5JCLA 1KF6A 2WOVA 4DSGA 4X9NA 4UDPA 3UKLA 3BI2A 3PS9A 3AE9A 3UP5A 4OCGA 3ZDNA 4D04A 1JRXA 1L9CA 3BI4A 4EQRA 4OPGA 3UTGA 5BULA 3NYFA 1GSNA 4HA6A 4U2LA 2H88A 3UOZA 2HQMA 3NK0X 2EQ8A 4ADWA 4IA6A 4EQSA 4HB9A 3CIRA 1E6EA 4YWOA 1PXAA 3QFBA 1EL8A 4YTMA 3DGHA 2C64A 1D7YA 1XANA 2YLWA 3AB1A 1GT8A 3E1TA 4WX1A 2YAUA 3DH9A 3QFAA 4YT0A 4NEWA 1PBEA 2C3DA 2YR5A 2FJEA 3BHFA 2GAGB 1GRFA 1D4CA 2BK4A 1ZKQA 2QA1A 1Y56A 3GQKA 2R0GA 4AT0A 2NVKX 2WP9A 1OJ9A 3FIMB 1DJNA 4H4RA 3CNPA 2X99A 3K7TA 1H7WA 1BGNA 1YQ4A 1PJ6A 1CJ4A 4GCMA 3OC4A 1BF3A 2YG7A 3Q6JA 4CNKA 1CC2A 4EMWA 2YWLA 1JNZA 4J33A 3NK1X 2WPCA 1P2HA 2AAQA 4NEVA 2ZZ0A 4DGKA 3AD8B 3AXBA 3PO7A 3P4PA 2X8CA 4IV9A 4H4QA 2WOIA 4E0VA 2OLNA 4USQA 4CCQA 1TRBA 3ALMA 4USRA 2GR3A 1ZX9A 3NGCX 4RSLA 2BS2A 4A5LA 1NG4A 2VOUA 3UTFA 3REDA 3FPZA 1DOEA 2C76A 4H4ZA 1N4VA 2ZZBA 1HYUA 3F8RA 3GRSA 4H4XA 4H7UA 1NHPA 2XVJA 4ZCCA 3ISHA 1GTEA 3GD4A 3EANA 1IUVA 2V3AA 3NYEA 4H4TA 4AOXA 1H86A 4YTPA 1CC4A 1TDOA 1GREA 2Q0LA 1F8WA 2I0ZA 4BJZA 3VRAA 1SEZA 2R46A 3NG7X 4AP1A 2GR2A 4Z26A 5U1OA 2Z5XA 1GERA 3H8LA 1DOCA 2OA1A 2YLZA 2R9ZA 2BK3A 2XLSA 1LTXR 2EQ6A 3CNTA 4U8MA 5ER0A 2V5ZA 4X4JA 3HZLA 3CGDA 3GYJA 2BABA 3DK4A 4C3XA 1Q9IA 2YLXA 1DOBA 1NG3A 2JB1A 3ATQA 5DBJA 3ATRA 4ECHA 2RGOA 1GRTA 2WU2A 4H4YA 4OPIA 3M12A 3UKHA 4CY8A 4Y4LA 3KA7A 2A89A 1AOGA 4A9WA 2VVLG 4EMJA 4C5OA 4A7AA 3AEDA 3I3LA 3VQRA 4YXDA 2C75A 3AE6A 2CFYA 3NRNA 3CGEA 4TM4A 1GESA 1H82A 1PDHA 1H6VA 3SFDA 1UKVG 3G5SA 3NH3X 4U8OA 3LB8A 4A79A 4IVMB 2YLRA 2NPXA 3GYXA 4OPUA 3RP6A 5EOWA 4ZCDA 2ACZA 2BYBA 2WP5A 4J34A 1ZDLA 4U8PA 3RP8A 4AOSA 1YKJA 3CNSA 3UKPA 3AE8A 2WDVA 2YQUA 2XFUA 4BK1A 3GQHA 3BHKA 2R45A 1GRGA 3IHGA 1B5QA 2V3BA 3KLJA 3CGCA 5KVIA 2WOWA 2B7RA 3G5QA 1M64A 4JDRA 1E1LA 4D03A 2QAEA 4H4SA 3LADA 4JY3A 3VR9A 1GV4A 3K30A 2H89A 2J3NA 3P9UA 4B64A 4TM3A 1GXFA 1DXLA 1IUWA 3B3RA 4LA1A 1TDNA 2GF3A 3RP7A 1IUTA 3ICRA 1EL7A 1O5WA 4TLXA 3VR8A 2GEWA 3Q9TA 2VVMA 4H4UA 4K5RA 2XLUA 5J7XA 5IQ4A 1CL0A 3NN0X 5FS7A 1PXBA 2YG3A 2Q6UA 3NIXA 4J57A 2XFOA 1PN0A 3ALJA 3UKFA 3ITJA 2OLOA 4NTCA 1FOHA 2BCGG 2JBVA 2XCGA 3L8KA 1LV0A 2YM1A 3AEGA 3AYJA 1TYPA 5BRTA 4Z2RA 4XWZA 4J56A 3DGZA 3GMBA 2X8HA 2GVCA 2XLTA 4C3YA 3IWAA 3L1RA 4PAAA 3UOVA 1K0JA 1XHCA 5EBKA 4BV6A 4YTNA 4CBQA 4EM3A 4N9XA 1COYA 2C66A 4P9SA 1CJ2A 5M0ZA 3AE7A 4I58A 3UP4A 1MOKA 2GR1A 2YG4A 3P4RA 3AYLA 3AECA 1EL9A 2X3NA 3O0HA 2WS3A 3EAOA 1FEBA 5BVAA 1KSSA 3WE0A 1H83A 5U63A 3SUCA 4GUVA 3QSSA 1TYTA 1TDEA 1YQZA 1PBBA 1VG9A 1L9EA 4B63A 2WBAA 1ZMDA 2ZBWA 3CPIG 5FS6A 3V3OA 1EBDA 1JRZA 2Y6RA 3CNDA 3AE4A 1N4UA 2C67A 2YLTA 4BK3A 1XPQA 2OALA 2AR8A 2WDQA 3AE1A 4IA5A 1FL2A 5FMHA 1PJ5A 4J36A 2C65A 1D5TA 1P2EA 2E4GA 3BI5A 1DJQA 1H7XA 3ICSA 4H4WA 2R0PA 3IC9A 3NLCA 4C77A 1N1PA 5HY5A 1NHRA 3DJDA 2BXRA 3QSMA 4U8IA 1X31B 3D8XA 3UOXA 3GDNA 3V76A 5HXIA 2O9ZA 2WU5A 1GRAA 2XDOA 1BGJA 2PHHA 4BK2A 4TM1A 2E1MA 3DJJA 3CTYA 1H81A 1GTHA 3R9UA 3UKAA 5IPYA 4AT2A 2APGA 2R4JA 4GDEA 1ZY8A 4EIPA 3NHOX 2X8GA 3CPHG 2V6OA 4EQXA 3QVPA 1K4QA 1QLBA 4A99A 4B66A 1FECA 2WPEA 1E7PA 4U8LA 4UDRA 4H4VA 3GMCA 1CC6A 1S3EA 1PBFA 1JOAA 1ZMCA 3F8PA 1CBOA 4H2PA 3H4KA 4NTEA 5BUKA 3NTAA 1NENA 1FCDA 2W0HA 3KPFA 2FBWA 4A65A 2LFCA 3NNEA 2TPRA 4B69A 1GNDA 1M6IA 2YG5A 1S3BA 1O94A 1D4DA 3ZYXA 2C72A 3UKKA 2B9YA 2DKIA 2FJAA 1BWCA 4JY2A 4GF7A 3G5RA 5IQ1A 2YVFA 2V61A 5EB4A 5FS8A 1IUXA 1TDKA 4FX9A 5JCIA 3H8IA 1IUUA 1N4WA 2JK6A 1KSUA 2TMDA 3CPJG 4H50A 4U8KA 5EB5A 2Q7VA 1W4XA 3UCLA 1V59A 1VG0A 4NTDA 2CDUA 5CQFA 1L9DA 3DJEA 1YY5A 3NN6X 3AEAA 3LOVA 1NDAA 3FBSA 2BS3A 4OPTA 2A87A 4U8NA 4B1BA 1F8RA 1GPEA 3DK8A 1QJDA 2QCUA 4OPLA 2R0CA 5KVHA 2FJBA 4YSYA 3JSKA 1TDFA 2XFPA 5GSNA 1CHUA 4Z2TA 2GMHA 3AYIA 4H2QA 1LVLA 4LU6A 5J60A 5KOXA 4EM4A 2CULA 4FK1C 1GRHA 2QA2A 3KD9A 1PJ7A 2C70A 1D4EA 2AQJA 2WPFA 2C7GA 1K0IA 2EQ9A 4U2TA 3CGBA 1RP0A 4Y4MA 5L46A 5KOWA 2FJDA 1ONFA 2BS4A 3GWFA 1GEUA 5C3JA 2Q0KA 3IHMA 1E1NA 1NHQA 3S61A 4CY6A 1E39A 3LXDA 4JNQA 4X9MA 1LQTA 1KFYA 3QVRA 4H2RA 2VRMA 1GOSA 4J2WA 3B6DA 4B67A 3CN8A 3I6DA 2YLSA 5KWFA 2A8XA 3P4QA 2WESA 2XVIA 4APNA 2XVFA 3LZXA 3M0OA 3RHAA 4BURA 3UTHA 5JCKA 3GDPA 1B8SA 2JAEA 3NK2X 2WQYA 3DA1A 1ZK7A 4KX6A 1PS9A 3PVCA 1O95A 1YQ3A 3VRBA 3NYCA 3CNJA 5KRQA 1LQUA 2XYOA 5KXJA 3NKSA 3AEEA 4RG4A 3URHA 4C74A 1JEHA 1OJDA 2XLRA 3AE5A 3SQPA 3EF6A 4B68A 2ZZCA 2GR0A 4OPDA 3S5WA 1BZLA 3K7MX 2B7SA 3AD9B 1ZOVA 2GQFA 4J31A 3LZWA 4OVIA 1B4VA 4JQ9A 1NPXA 5TR3A 4UP3A 2XLPA 1K0LA 2BACA 4DSHA 3T37A 3C4NA 4GR1A 2C3CA 1OJAA 1LPFA 3DJGX 4WCTA 1S2QA 1IJHA 2GAHB 1Y0PA 4CNJA 1DNCA
chains in the Genus database with same CATH superfamily
2CEAA 2GMJA 2IC6A 2XSBA 3DMEA 4IE6A 2MTQA 2B1EA 3UT5E 3A8YC 5KMRA 5AQLB 1O3XA 3C4AA 1CF3A 1Z6LA 2XFQA 3V3NA 2Y48B 2OAMA 4QH4A 2WAUA 5CB4E 5ETWA 3ETUA 1D1AA 5JCMA 4HFCA 2QRXA 3UUBA 4FK1A 4X65T 1JU2A 3M13A 4OYJA 5FVKA 3GSIA 4EXTA 2EQ7A 1GETA 3J7Yq 1AR64 1X79A 3EHZA 3U78A 2C73A 4CN1A 4ZI7E 2BCPA 2IIDA 1LKXA 3NBXX 4O5UA 5IYZE 2ZM0A 2UUAT 3NRXA 4HFBA 5F8PA 2R4EA 2XVHA 2VQ7A 2YM2A 1XMQT 4XAXB 4QXCB 2LSKA 4H2NA 1EZ3A 2PYXA 5LV9A 2WHDA 2D2SA 4IL4A 3ZYKA 1KNRA 3K3OA 4IIJE 2E9XA 1GALA 4J2CA 4X1KE 4QHOA 3Q2MA 3PUVF 2XSAA 5LNKA 3SM8A 3COXA 1KNZA 3F31A 2YVJA 3PUWF 2CE7A 2CVJA 2RGHA 4U2ZA 4CXYA 3LK3B 4K7ZA 2BVMA 4HFEA 3EVYA 2ZLYA 2DWKA 4ZS3A 2B9WA 4CXWA 4II3A 4XWRA 4GDPA 3IBPA 2W0GA 1DODA 4PABA 3ALLA 4AP3A 3QB5A 3F8DA 4DNAA 2XQ6A 3ZT7A 2YN6A 3LG7A 4ILBA 4EB6E 2X50A 4TN7B 4UDQA 3SGLA 4BJYA 4PJJA 2XFNA 1PHHA 4EQWA 3LFMA 1FJGT 4CRTA 4MLKA 1JNRA 4YSHA 2GV8A 2J47A 1REOA 1PBCA 4TM0A 2ZM6T 5HCMA 5JCLA 1KF6A 3AXJA 2WOVA 3AA1B 3LBXB 4UDPA 2N9DA 3BI2A 3NKZA 3AE9A 3UP5A 4OCGA 3ZDNA 1MIVA 1IBMT 2IW5B 4U2LA 1RMU4 3JBG4 3UOZA 2RS14 2A2FX 3RC8A 4IA6A 4HB9A 5FY1A 1E6EA 4YWOA 1PXAA 3QFBA 4YTMA 3DGHA 2C64A 2YLWA 3E1TA 1GT8A 4B3ST 1YXRA 3QFAA 1RUC4 2YDSA 1GRFA 2JMKA 4DBQA 5HEHA 4ZEYA 1ZKQA 4NNJA 1W0BA 4ZS2A 2VVSA 2WP9A 4RHV4 5ABEA 5KMQA 3CNPA 1G8XA 2CM0A 2J4GA 3UU8A 3Q6JA 4CNKA 1CC2A 3Q9DA 4J33A 3NK1X 2WPCA 1XWMA 2VL8A 2ZZ0A 3AD8B 4DGKA 4IV9A 3P4PA 4UVAB 2WOIA 4H4QA 4TV8E 1TRBA 4DBRA 2BS2A 4ZZBA 4H4ZA 2A9UA 4CN4A 4H7UA 3AA7B 1NHPA 2XVJA 3BQKA 2GK9A 3K8PC 4Q4V4 1W0AA 4Z90A 2UUCT 3EANA 2HWB4 1MIWA 4H4TA 1TDOA 3BQIA 5JDHA 1GREA 1Y64B 1SEZA 2R46A 3NG7X 4AP1A 4QWNB 3SZ0A 5U1OA 2KLQA 3GWHA 3L09A 1LTXR 3CNTA 1HRV4 1ZEEA 3HZLA 4PK5A 3B57A 2CA5A 3WAJA 2I0MA 1J1JA 3ATRA 2X9XA 2WU2A 4OPIA 2V7LA 1AOGA 4Y4LA 2LJLA 3B5MA 4A7AA 4C5OA 3AEDA 3I3LA 2XQ3A 2C75A 3AE6A 2R7FA 3CGEA 4JI5T 1GESA 3G5SA 3ONXA 1H6VA 3NH3X 4AXPA 2YLRA 3GYXA 4OPUA 1WLXA 3RP6A 4ZCDA 2RR14 2BYBA 4AOSA 2D5UA 3HYVA 3UKPA 5J0ZA 2WDVA 2VKJA 4HWIB 5JDLA 2R45A 2X66A 5FXVA 3NZPA 3IHGA 3HYXA 2BBHA 1HCIA 2VL0A 4L5GA 5HXRA 3KLJA 3KBUA 3CGCA 4CI1B 2B7RA 4PDWD 3N2OA 4JDRA 2HH7A 5AQIB 1E1LA 4H4SA 5AQOB 3LADA 3VR9A 3LBXA 2W2UA 2RMU4 1DXLA 1IUWA 2V5DA 1O5WA 3IA3A 3TLUA 4K5RA 2XLUA 2IUBA 1PXBA 2YG3A 2Q6UA 3NIXA 3ZT5A 4M1PA 3ZJ1A 1D0ZA 3UKFA 5FVLA 2NW8A 2E5LT 3SZFA 4BJMA 4NTCA 2XCGA 3UU3A 2XZEA 2KT9A 2YM1A 3PV0F 1UCUA 3RQWA 3W15B 4XWZA 4J56A 4JI2T 4XZCA 4EYUA 1ZV4X 4KUMB 2XLTA 4C3YA 3UOVA 4BV6A 1COYA 2C66A 1CJ2A 4I58A 1MOKA 2YG4A 3CX7B 3P4RA 1SE7A 4PNIA 2KMFA 4ZHQE 2AXDS 1AR84 3WE0A 4O2AE 3QSSA 4DV4T 1TDEA 1PBBA 1VG9A 2VWAA 4I55E 1ZMDA 4EZ4A 4OHFA 3V3OA 1EBDA 3CNDA 1N4UA 2YLTA 4BK3A 1XPQA 4LMKA 2WDQA 4P0AA 1M62A 3ICSA 3BQLA 3IC9A 3NLCA 4X64T 3RLFF 2NP9A 1D1CA 2BXRA 1RUE4 3DJBA 2C4CA 2ODUA 1QUUA 2O9ZA 5LGUB 1BGJA 4BK2A 2E1MA 5CGMA 3DJJA 3ZMVB 4G6GA 3MJXA 1GTHA 3R9UA 4LF9T 4EQXA 1VBD4 1FECA 4UIGA 4ZI3C 4QXHB 1CC6A 2V5CA 1CBOA 3H4KA 4HFDA 5JDGA 4YY3T 4K0KT 4B69A 1M6IA 1S3BA 2X9HA 4HEAA 2B9YA 2FJAA 1BWCA 4TUYE 1T72A 2G0UA 3O1IA 4ILCA 2CLYC 2V61A 5C8YE 5EB4A 4MHCA 5FS8A 4FX9A 1R094 1IUUA 4H9PC 1N4WA 3CPJG 4H50A 4U8KA 4WW0A 1W4XA 1V59A 5DQWA 5CQFA 2CDUA 1L9DA 1VCSA 1YY5A 2R064 2PLV4 3NN6X 4B1BA 1FMVA 1GPEA 3DK8A 1D4M4 2R0CA 2VK9A 1U5PA 1CHUA 5M4YA 1LVLA 2LKGA 2V8SV 3A7MA 4KMCA 1D4EA 2WPFA 1EAH4 1YD8G 1Y01A 4XBFB 1RUI4 4EAHA 2FJDA 1HTJF 1MNDA 4AKRB 1GEUA 1E1NA 4HWCA 1N32T 4DR5T 3N9PA 2KSRA 3ZEFB 1X9BA 4B67A 3CN8A 3I6DA 4MFRA 3P4QA 2XVIA 2XVFA 1H8TD 5JCKA 2DCFA 1AL24 2WQYA 3PVCA 1O95A 2XAQB 3KDSE 5LYJE 4C74A 5KXJA 1OJDA 5LGTB 2GR0A 4P1NA 2X9WA 4Q4Y4 3ZSTA 3Q5WA 4OPDA 1BZLA 3FZMB 2B7SA 2KXPB 3H3AA 4JQ9A 3N9QA 3RHWA 5HCJA 1AR94 5IUXA 3AVRA 4GR1A 4WCTA 4HTEA 4PK4A 4CNJA 2HHHT 2IVEA 4JI0T 1SA0E 1Y56B 1CJ3A 3UUNA 1F8SA 4LF8T 5AQHB 1Q1WA 3CKDA 1NAAA 4Y4NA 3T1HT 3RRCA 5LHGB 3PURA 2RA1A 4HFHA 3UKQA 4RG3A 5HAXA 1F3PA 1MO9A 3BNMA 3DTOA 2YKSA 1EL5A 3OJAA 4Z43A 2V6YB 4ISSA 4NUUA 1IUSA 2VRLA 3NTDA 3VKHA 4CCRA 4NIQA 2ACXA 1MIYA 5L3GB 5FS9A 3A5XA 2ZM8A 1Z8UA 4FJOA 5FNVE 4IVOB 2JQKA 3LJPA 3P4SA 5JCNA 3OZ2A 4JN9A 3M65A 1ELIA 4II2A 1ZOYA 4ILAA 1ZP0A 3KVEA 1BKWA 2XPKA 3LSVA 3UOYA 2N1GA 3BNUA 3RNMA 3PE0A 1NAFA 3F57A 2H3RA 4GOUA 3ZYLA 4HFIA 5ABFA 5EZYE 3RIAA 4HGAA 3GRTA 2BKOA 2E8IA 4GAPA 4K5SA 3GN5B 3Q5XA 2EX3A 5M10A 1VOMA 2GH5A 4P09A 1NHSA 5J2UE 4XXGA 5HWXA 3ABVA 1HX1B 1WFDA 2LRKA 3GYIA 4Z2UA 3ADAB 2BXSA 3GWDA 4M52A 1LJ1A 4GK0E 3AEFA 5CKUA 4JEUB 4NWZA 3T0KA 2E5VA 3N2GE 1KDGA 3P1WA 1F6MA 3D0TA 1E1KA 2BA9A 2OLTA 1GQEA 4V1Av 3ICTA 4K2XA 1OJTA 1MQTD 1ZKEA 4PAGA 1N33T 2Q9QD 3UKLA 3PS9A 2YU2A 5HEUA 4D04A 1L9CA 3BI4A 1MMAA 3UTGA 5BULA 4UV9B 1BEV4 2WZIA 4CQIA 1VBB4 2JQQA 2CHOA 3ZJ2A 3ZN0B 3KFWX 2XTLA 2MBGA 5BMVE 4G2AA 1EL8A 3C98B 2BDEA 3H3MA 3JD74 3AB1A 1VBE4 2YAUA 3DH9A 4TV9E 1AJ3A 1PBEA 4AQFA 3HKCE 3JC6D 2YDQA 4KI0F 2BK4A 5L47A 1Y56A 3SY4A 2NW7A 4COFA 5L4EA 1OJ9A 1Z7S4 1IZNB 1DJNA 1K5MD 2JMHA 3K7TA 4G63A 2RS34 2YG7A 3SX6A 4IL9A 4L0RA 2KINB 2L8KA 3UFGA 3TLSA 2V6YA 2UUBT 5TAOA 2WSSV 1OEDC 1RHI4 4YHJA 3PUGA 2RPAA 1NG4A 2VOUA 3UTFA 5L3CB 5JTGA 3UULA 5LBMA 3HA4A 1HYUA 2R044 3GRSA 2H7OA 4H4XA 2Y8DA 4ZCCA 4IDOA 5LXTE 3NYEA 3KV5A 1H86A 1CC4A 2Q0LA 1F8WA 2I0ZA 4BJZA 3CX6B 1UX5A 3VRAA 5LHIB 4EOZB 5AQFB 4Z26A 3EUHA 3H8LA 1RUJ4 2LSGA 4AQFC 2OA1A 3N5LA 2R9ZA 4IHJE 4DR6T 3UFEA 2EQ6A 2V5ZA 4Z8XA 3TLVA 3GYJA 3E08A 4DUYT 2BABA 1Q9IA 1HXS4 4O4JE 1NG3A 3ATQA 4KP3C 2W67A 5AQQB 4GKKT 3UKHA 4H4YA 4B3TT 3GN5A 3KA7A 2A89A 3PJAJ 4A5XA 3PU8A 2UXDT 3AVSA 3VQRA 3RI5A 4UF0B 1H82A 3NVOA 3SFDA 5FY0A 4U8OA 3U3IA 1HNZT 5HEOA 1YKEB 4IVMB 4PW8A 5JVDE 3IEEA 5EOWA 4IGUA 2IMLA 2WP5A 4J34A 1WYCA 2WCAA 3B13A 4HE8A 5F3JA 4U31A 3BHKA 1GRGA 4P0BA 4HWFA 2H7VC 3QNUA 2CXDA 5KDMC 1GV4A 3SWHA 4CI3B 3ANWA 4U2YA 4TM3A 1HRI4 3R84B 4LA1A 1TDNA 3RP7A 1IUTA 2CRBA 3F2EA 2GEWA 1AR74 2VVMA 4H4UA 1S35A 4B6XA 2IC9A 4Z91A 5CFBA 3ITJA 1S94A 3VHLA 1FOHA 4ASKA 2BCGG 3UUXB 4AKGA 1LV0A 3L8KA 5EK3A 3AYJA 3UUMA 4O2BE 4TZ4C 3ESLA 3PU3A 4IDZA 5L3FB 2JJ9A 3DGZA 3GMBA 5L3EB 3L1RA 3EDVA 1K0JA 5EBKA 4CBQA 3WAKA 1T8BA 1U4QA 2C0SA 2GR1A 3AYLA 3P50A 5BVAA 1BR2A 3PJAA 4GUVA 2CLYB 1YKHB 2JQHA 5FXWA 1RUG4 5F5WA 4B63A 2ZBWA 2M6IA 1KK7A 1WYBA 3K3NA 1JRZA 3AE4A 2C67A 2XQ4A 2AR8A 4IA5A 2LKHA 2V1DB 1P2EA 3BI5A 1DJQA 3HKEE 4C77A 2LHNA 1N1PA 5HY5A 3Q5EA 4HWHA 3QSMA 3LK2B 2NTYA 5HXIA 3RX6A 1GRAA 3QK6A 4GYRA 2VB6A 3ONLC 4KHPT 1KEYA 3JAFA 3CWZB 4TWHA 2IHR1 2JIWA 1H81A 3UKAA 4X66T 2EHOD 5AQNB 1B7TA 1QSDA 1ZY8A 5L2LA 3CPHG 3RKGA 3QVPA 1K4QA 2LSYA 1E7PA 4U8LA 4H4VA 3ZPOA 2BBJA 4NTEA 5HXEA 1NENA 2W0HA 3KPFA 2FBWA 2LT3A 1GNDA 3C50A 2YG5A 1XHXA 1O94A 2C72A 3MACA 4PJNA 4UF0A 4YJ2E 4OX9T 4JUYA 2LLYA 2RM24 3FBLA 1HR0T 1N34T 5L4HA 2M67A 5EB5A 3UCLA 5LHHB 4WBOA 4DV3T 3LOVA 2KWHA 2BS3A 2A87A 1F8RA 2EHOC 2J62A 2FJBA 3JSKA 2C5JA 2GMHA 5KOXA 4LU6A 4O4HE 2CMRA 2V7JA 4LF4T 3CGBA 4U7YA 4ANJA 1HS7A 5L46A 5IHYA 5CA1E 4UEMA 1D0YA 2Q0KA 5KMSA 3LXDA 4X9MA 4CXXA 3C64A 1KFYA 1LQTA 4GB34 2YINA 2V7KA 4UV8B 3ETVA 2FUPA 3ZCJA 5LCYA 4B3RT 2WESA 3RHAA 3UTHA 2JAEA 3NK2X 3NZQA 3EABA 1YQ3A 2Z6EA 3C4WA 3KINB 5HXSA 3CNJA 2XQ9A 3NKSA 4RG4A 2XQAA 2W62A 2Y6XA 5L3DB 4B68A 2CCQA 4A97A 3AD9B 3KV9A 4AKHA 4J31A 3MZKB 1XHZA 1B4VA 4JBWF 4TX5A 4H63V 1K0LA 2BACA 3CK6A 3WI3A 3PDYA 1OJAA 3T1YT 3DJGX 3N9LA 4IREA 1DNCA 4JI1T 2DL1A 1NA1D 5U25A 3QSEA 1RYIA 3T8OA 1MXTA 4I59A 2VVLA 1JRYA 1E1MA 2JKCA 5DJQC 5EK2A 4QX8B 4H4PA 4X62T 5ADXL 5ABGA 4EMIA 4ICYA 2YR4A 2VASA 4DNDA 3D1CA 2PTFA 2HPJA 1VDCA 2WEUA 3SXIA 4K0UA 3P8CD 4ZXLA 4REKA 4A98A 3MXZA 1PBDA 1QO8A 1RSGA 4K22A 2WP6A 2YR6A 1ASJ4 1HF8A 1B37A 3JAEA 4DO0A 3FMWA 4ERRA 3I0OA 2I6HA 3K7QX 4EEDA 2VVNA 5IWAT 4GRTA 2MOZA 3E0ZA 2NW9A 5LMNT 2ARDA 3UQ4A 5ABFB 3QB5K 3C96A 4LIIA 2W61A 2BG9C 2L3LA 5LA6E 3SRZA 2X51A 2Z5YA 4YKGA 1H84A 2Y6QA 1IJ6A 2GB0A 3KVAA 2IVDA 3HL6A 4O8SA 1WR6A 2DWGA 3UTEA 4ADZA 1CJCA 3VRDB 4DR3T 4TLZA 1G73A 2X0LB 2XM1A 3OYXA 1IBLT 5JREA 1KNPA 4Z24A 5AQKB 2RABA 4YSXA 4A6NA 4DR7T 3FG2P 1D7LA 3FZLB 2JQ9A 4JNAA 3ZMSB 4I4TE 2WZHA 2BG9E 3KKJA 2PBIA 3AE3A 3CQCB 3AWIA 4DIDB 2Q9QB 2C5KT 4GKJT 2JB3A 4OPCA 5HYMA 2WDRA 3FBZA 5J2TE 4Z25A 4MJWA 2VZ2A 4DUZT 3N2KE 3PUZF 2F5ZA 2YVGA 4U8JA 1XDPA 2WETA 3KU9A 2RP4A 4AQYT 2V60A 2KNDA 1OEDB 3GD3A 3HYWA 2PW9A 4HWDA 5LMUT 4X9NA 4Q25A 3UU4A 2XASB 5DQVA 1JRXA 4EQRA 4HA6A 3RQUA 2H88A 1ZHCA 4DR4T 4DV0T 2VQFT 4ADWA 2NTXA 3BK9A 2R6GF 2UU9T 1PO14 3LJCA 1D7YA 5HYAA 2XJ7A 3KBTA 4NEWA 2C3DA 2YR5A 2SPCA 2R074 3BHFA 1HNXT 4O4IE 1BR1A 1POV0 2R0GA 4AT0A 2NVKX 4ZI2D 3TLWA 1H7WA 1BGNA 2PZSA 1PJ6A 3CMMA 1CJ4A 4Q4W4 4QX7B 2K9AA 4OK0A 4EMWA 2YWLA 1JNZA 2UXBT 2WM9A 5JDNA 2NR4A 4ZZCA 1P2HA 4X1IE 2AAQA 1MMGA 3AXBA 1FIOA 3PO7A 2X8CA 2X5ID 3J8F4 4CCQA 5FY7A 4USRA 1ZX9A 3NGCX 4DV2T 4A5LA 3SZWA 2HPLA 4C90A 2PFVA 3REDA 1FMWA 2L9QA 3FPZA 4EV6A 1BR0A 2ZZBA 4LF7T 4DV1T 3ISHA 1GTEA 4GIWA 3GD4A 5HEJA 1IUVA 4AOXA 5FL1A 4FI5A 4ZI2C 4H9OC 4WYVA 2PJQA 2JRKA 5HEGA 3RC3A 4U8MA 3QUJA 4JI4T 2CXLA 4C3XA 2JB1A 2XAJB 3FHNA 5LG3A 4AKLA 4ECHA 2RGOA 5GONE 2CBJA 3FXDB 3M12A 4CY8A 3V5UA 2VVLG 4EMJA 2VKHA 5AQGB 1YW0A 3MKDA 2ZM2A 4JI3T 4QH5A 3NRNA 3P7IA 1PDHA 1UKVG 1OXZA 4PFOA 1HNWT 2IAKA 5HXCA 4HFVA 4B3MT 3AAIA 4A79A 5KMGP 4YFSA 3C4ZA 2Q9QA 4EGWA 3VKGA 3RP8A 2XQ5A 1YKJA 3CNSA 2X9YA 3AE8A 2YQUA 4BK1A 5ABHA 1XZYA 2V7IA 4AQGA 2XQ7A 4IE5A 2CWOA 5KVIA 2WOWA 3CPZA 1D1BA 2UXCT 3FI7A 3G5QA 2E2AA 1OEDA 1I6ZA 4TNVA 1W9RA 3PTRB 2QAEA 1WR0A 3ANWB 4JY3A 3K30A 3T2YA 1COV4 2LRLA 4JI6T 4E7SA 2C5IT 3B3RA 2GF3A 3OVUA 4TLXA 2D0UA 3RH3A 2YEVC 1V9DA 5FS7A 3K3QC 2XFOA 1IBKT 3ALJA 2OLOA 2KZ7B 4U72A 2JBVA 4LFBT 3AEGA 4NXMT 3GMIA 2JPFA 1TYPA 5BRTA 5FMNA 2BRYA 2K24A 2VKDA 2X8HA 3HKBE 2GVCA 4DR1T 1VCTA 4CZZB 4PAAA 4N9XA 2Q9QC 2WWVA 1NCQD 5M0ZA 3AE7A 3KV4A 3UP4A 3LK42 3MA9A 4JV5T 3O0HA 3AA6B 2WS3A 3NWIA 1KSSA 4DV7T 1H83A 3HR0A 5KNLA 1TYTA 5AQRB 3OYZA 1L9EA 2WBAA 3AAEB 1M7KA 3G06A 3RYFE 4BAYB 3L3PA 3RYCE 3AE1A 5LP6E 1VBA4 5FMHA 4H9SE 1H7CA 3RYIE 3ZMUB 1PVC4 1D5TA 2E4GA 2EHOB 3JC6C 2R0PA 2YOEA 4U8IA 4ILUA 1LRZA 3ZC1A 5HWYA 5FXXA 2WU5A 2XDOA 3HKDE 4TM1A 1OEDE 3N9MA 2LEHA 5E0OA 4EZHA 3AAAB 3CTYA 2ZMAA 2LM9A 3FZKB 2R4JA 1R8IA 3T31A 2X8GA 2V6OA 3UTKA 1QLBA 4A99A 5JDMA 4B66A 4QKNA 4UDRA 3GMCA 4TWFA 1S3EA 1PBFA 3F8PA 5BUKA 3NTAA 2K48A 1XMOT 2MPKA 1D4DA 3ZYXA 2WBLA 3UKKA 4JY2A 4NXNT 4CI2B 1J5ET 3G5RA 5LGNB 5CA0E 1IUXA 5JCIA 4UELA 4X20E 2JK6A 1KSUA 3Q5DA 1D0XA 1NDAA 2XM2A 4U33A 5AQUB 3FBSA 4OPTA 2XY8B 2E9XD 4JI7T 4U8NA 1QJDA 3EAMA 3UQ7A 2CPTA 3O1JA 4Z2TA 5J60A 3AYIA 3ZYMA 4EM4A 2CULA 4FK1C 4EIWA 1GRHA 2QA2A 3KD9A 2C70A 3RIUA 5LG4A 2EQ9A 3SYIA 4U2TA 5FXZA 1RP0A 5J1GA 2W66A 3GWFA 4UXNB 1NHQA 4CY6A 4G6HA 4JNQA 3QVRA 4J2WA 3B6DA 4IE7A 2YLSA 2A8XA 4APNA 4BURA 1ZK7A 1PS9A 2E9XC 3IHRA 3VRBA 2X0YA 3NYCA 1LQUA 3RKOA 2DLRA 3ZCIA 3AEEA 2XYOA 1JEHA 2XLRA 1UK5A 3AE5A 3SQPA 3EF6A 4IDNA 4YLHA 2ZZCA 5AFUL 3S5WA 3K7MX 3S4UA 1ZOVA 2GQFA 1R084 1NPXA 1RUH4 5JR9B 2BG9B 2UXNB 3C4NA 2DHRA 2C3CA 4TWDA 3ZKRA 3RGLA 2GAHB 5AQSB 4YJ3E 3FZFB 3NT6A 4B65A 3OKQA 2XVEA 2WMNA 3RIUC 3O1HA 5C2TA 3LDQB 2BC1A 2CBIA 2J1DG 2QYWA 1W09A 2PYLA 4I0UA 4AKIA 2EHOA 4Z44A 2VKOA 2B76A 3CX8B 3I9WA 2W4XA 1FEAA 4EIQA 1HX8A 3JADA 4X5TA 4O5QA 2YG6A 3AEBA 5LB7B 4DV5T 2GQWA 2UZZA 4FDCB 1XNQT 4KPRA 3IF9A 3M3ZB 5GRTA 1NWMX 2BRAA 3PUAA 1PXCA 5CJ5A 4WBNE 5EK4A 3II4A 2B9XA 2V6XA 3KVBA 4F6RC 2RGJA 3SFEA 4YSZA 4H63H 5JDFA 1GRBA 2W00A 3FZHB 1Q1RA 1OOPD 5BR8T 1VRQB 1EV14 3AA0B 3UU6A 1LVKA 1MNEA 2XUEA 2BC0A 3K1SA 5FKYA 4NZHA 2VQBA 4LFCT 2JB2A 4LF5T 2GRTA 2BK5A 1VQWA 5HHFA 3EPTA 2CWYA 2ES0A 4NUVA 3I9YA 1I94T 2V26A 1PO24 3AD7B 3L39A 4A6NB 3QJ4A 4DMWA 4AI6A 1E2AA 2PYJA 1RUD4 1S2YA 1L0VA 2DKHA 1OJCA 4YKFA 1BR4A 4EEBA 4K8DA 3DK9A 5FL0A 3ZC0A 1NEKA 1XDIA 4U2SA 2K5BB 1XNRT 4NPPA 4PJLA 5JH7E 3ZLIA 2D9DA 5KX5E 5AQJB 3AE2A 4H9RC 4G9KA 4H9NC 4G73A 2BVLA 4ZN0A 1T7SA 2WWUA 2XQYA 4KBMB 4IE4A 3OBVE 4DSGA 4IT4A 4GK5E 4JYAT 1VRBA 1E1HB 5H6RB 3N9OA 2P9BA 4UR9A 4AISA 4OPGA 3NYFA 1GSNA 2HQMA 3NK0X 2EQ8A 4G74A 4EQSA 4ZOLE 2YK0A 3CIRA 5L3BB 2AE9A 1XDOA 2WY2A 4OYKA 1XANA 2IDOB 4WX1A 4OFZA 4DVDA 3T2ZA 1LVFA 4YT0A 5JR9A 2FJEA 2BG9A 5DABA 2GAGB 1D4CA 1CUNA 2QA1A 3EI0A 2LSJA 4Q4X4 3GQKA 3N9NA 3FIMB 3T2KA 4H4RA 2X99A 1YQ4A 2LSIA 4UVCB 4GCMA 3OC4A 1BF3A 2NOXA 1T98A 3AB3B 2F4VT 1SUMB 4NEVA 1WRDA 1HG2A 4E0VA 3P4WA 2OLNA 2WB5A 4USQA 3ALMA 3FB2A 2GR3A 3GA8A 4ZI3D 4RSLA 3QOFA 2X67A 2XQ8A 1DOEA 2C76A 1N4VA 3PUSA 2BZBA 3I0QA 3F8RA 3ZSSA 3TLTA 3VU7H 3C4XA 4JEHB 2V3AA 3I1AA 2LOSA 4YTPA 3X1DA 3PUQA 2OA5A 2GR2A 1IAPA 2Z5XA 5JR9C 1GERA 1OWAA 1DOCA 4LMJA 2YLZA 2BK3A 2DI4A 2XLSA 5ER0A 2QVAA 4X4JA 3CGDA 3DK4A 1VRH4 2YLXA 2BKNA 1DOBA 5DBJA 3FXEB 4PK6A 1GRTA 5LJNA 3HI2A 4GAVA 1IJ5A 4A9WA 4LF6T 3CMLA 2K3WA 2QA7A 5FP3A 2LHRA 4YXDA 3ZT6A 2CFYA 4TM4A 3ZMTB 3LB8A 3PUXF 4A56A 1PIV4 2PY5A 2NPXA 4F8HA 2CHNA 2ACZA 3OPCA 3DP7A 5JRCB 1ZDLA 4U8PA 5FYMA 2XFUA 3GQHA 4WZXA 3JCFA 3L8RA 1B5QA 4EYYR 2V3BA 4LMLA 4PJMA 1RUF4 1M64A 4DR2T 4D03A 5H6QB 2OV9A 3PUYF 4X1YE 2N2NA 2H89A 3SZCA 2J3NA 3P9UA 3CQXC 4B64A 1GXFA 3ICRA 1EL7A 3RRWA 3VR8A 3Q9TA 5J7XA 5IQ4A 1CL0A 4I50E 3NN0X 4J57A 2QGSA 2VURA 1HG5A 5AQMB 1PN0A 4UVBB 4MALA 3E22E 3TKLB 1HFAA 4U7IA 4GYSA 4JLEA 3ZMZB 5AQTB 4Z2RA 5AQPB 4O4LE 3UU5A 2XHEB 3RIFA 2I59A 3CVRA 4QH1A 3IWAA 4IE0A 1XHCA 3QC9A 4YTNA 4EM3A 1J5WA 3C51A 4P9SA 5KMPA 2YDRA 4H9QC 3AECA 4HKAA 3OTOT 3SS1A 1EL9A 2X3NA 3EAOA 1FEBA 5U63A 3SUCA 4BJNA 2CXFA 1YQZA 4HN9A 2UXXB 3KV6A 4IDQA 3CPIG 5FS6A 1FEWA 4L9IA 2Y6RA 2OALA 2BKPA 1FL2A 2M6BA 1PJ5A 4J36A 2C65A 4BA9A 1H7XA 2X68A 4ISTA 4H4WA 2W63A 1NHRA 3DJDA 4YHHT 5A1LA 4MBQA 1X31B 1UGOA 3D8XA 3UOXA 3GDNA 3CQGB 3V76A 5AQVB 3R6NA 4I43B 2PHHA 4QXBB 1US7B 2DNXA 2PG8A 3ONJA 4IDPA 3SOLA 5IPYA 4AT2A 2APGA 4GDEA 3RPUA 4EIPA 2KWIB 4LFAT 3NHOX 1VBC4 1RVF4 3T14A 2WPEA 4TNWA 3RF1A 1JOAA 1ZMCA 4H2PA 4A65A 2E9XB 5LJMA 2V7MA 4DV6T 1FCDA 2LFCA 3NNEA 2TPRA 3IF8B 2XAHB 4U3CA 2DKIA 3J9X1 1MMNA 4E7ZA 4GF7A 5IQ1A 2YVFA 1TDKA 3H8IA 2TMDA 2Q7VA 1VG0A 4NTDA 3DJEA 5JRCA 1DU2A 3AEAA 4N78D 3V5SA 3O4XE 3ZN1B 4OPLA 2QCUA 5JQGE 3O9XA 2LE8A 5KVHA 4C91A 4YSYA 4JI8T 1TDFA 2XFPA 5GSNA 2A3DA 2LOPA 3KPKA 4H2QA 2NWBA 1PJ7A 2HN1A 2AQJA 2C7GA 3MK7C 3NRYA 1K0IA 4Y4MA 5JDQA 4PFPA 5KOWA 1Z0PA 2BS4A 1ONFA 4CN6A 3H37A 5C3JA 3IHMA 3S61A 5HXHA 1E39A 4AIUA 2YU1A 2WMOA 2XAFB 4H2RA 2X0HA 2VRMA 1UUSA 1GOSA 3AXJB 2MAWA 5KWFA 2MYSA 5LBQB 3LZXA 3M0OA 3GDPA 3EDUA 1B8SA 4KHZF 2RS54 3DA1A 4DMVA 1N36T 4KX6A 4WNKA 5LOVE 5KRQA 2ODVA 2LM2A 3URHA 1WCRA 2IIUA 1MMDA 2HWC4 2A72A 2VQET 1SHZC 3LZWA 4OVIA 2XAGB 5TR3A 4UP3A 1UX4A 2XLPA 4DSHA 3T37A 1UURA 2D0TA 2HN2A 4U74A 3RYHE 1XI1A 1LPFA 1S2QA 1IJHA 1Y0PA
chains in the Genus database with same CATH topology
2GMJA 2IVEA 1Y56B 1CJ3A 1F8SA 3DMEA 3NT6A 1Q1WA 4B65A 2XVEA 1NAAA 3QSEA 4Y4NA 5U25A 5KMRA 1RYIA 1MXTA 4I59A 5C2TA 2VVLA 3C4AA 1JRYA 1E1MA 1CF3A 2JKCA 1Z6LA 3UKQA 2BC1A 2XFQA 4RG3A 3V3NA 4H4PA 1F3PA 1MO9A 3BNMA 1EL5A 4EMIA 2OAMA 4Z44A 4Z43A 2B76A 4ICYA 2YR4A 1FEAA 4EIQA 4O5QA 2YG6A 1IUSA 3D1CA 3AEBA 5JCMA 2GQWA 2UZZA 2VRLA 4FDCB 4FK1A 4KPRA 3NTDA 1JU2A 3M13A 3IF9A 4CCRA 1VDCA 5GRTA 2BRAA 3GSIA 2WEUA 3SXIA 1PXCA 4REKA 2EQ7A 5FS9A 1GETA 1QO8A 1PBDA 1RSGA 3II4A 2B9XA 4K22A 2WP6A 2RGJA 2YR6A 2C73A 4IVOB 3LJPA 3P4SA 5JCNA 1B37A 2BCPA 3SFEA 4YSZA 1ELIA 2IIDA 3FMWA 3OZ2A 4JN9A 4II2A 1ZOYA 1ZP0A 1GRBA 3KVEA 1BKWA 4O5UA 2R4EA 3K7QX 2XVHA 2VQ7A 2YM2A 1Q1RA 4GRTA 1VRQB 4H2NA 3UOYA 2PYXA 3BNUA 2ARDA 3RNMA 2WHDA 5LV9A 2BC0A 1KNRA 3C96A 4LIIA 1GALA 4NZHA 2VQBA 2Z5YA 4YKGA 2JB2A 1H84A 2GRTA 2Y6QA 2BK5A 1VQWA 5HHFA 2GB0A 3EPTA 2IVDA 3GRTA 3UTEA 1CJCA 3SM8A 3COXA 3VRDB 4GAPA 4K5SA 2YVJA 4TLZA 3AD7B 5M10A 2CVJA 4A6NB 2RGHA 2GH5A 1KNPA 3QJ4A 2RABA 4Z24A 4YSXA 4K7ZA 4A6NA 1NHSA 4XXGA 3FG2P 1D7LA 3ABVA 4JNAA 2B9WA 1S2YA 4II3A 1L0VA 3KKJA 2DKHA 3AE3A 4GDPA 4XWRA 1OJCA 1DODA 4PABA 3ALLA 4AP3A 3F8DA 3AWIA 3GYIA 4YKFA 4DNAA 4Z2UA 4K8DA 2JB3A 3ADAB 3DK9A 2BXSA 3GWDA 4OPCA 5HYMA 4M52A 1NEKA 1LJ1A 1XDIA 2X50A 4U2SA 4UDQA 2WDRA 4Z25A 3SGLA 3AEFA 4MJWA 2VZ2A 5CKUA 4BJYA 2XFNA 1PHHA 4EQWA 4NWZA 3T0KA 4CRTA 2E5VA 1JNRA 4YSHA 1KDGA 2F5ZA 2GV8A 2YVGA 4U8JA 3P1WA 1F6MA 3AE2A 1E1KA 2WETA 3KU9A 4G9KA 2BA9A 4G73A 4ZN0A 2V60A 3ICTA 1REOA 1OJTA 4K2XA 1PBCA 3GD3A 3HYWA 4TM0A 5JCLA 1KF6A 2WOVA 4DSGA 4X9NA 4UDPA 3UKLA 3BI2A 3PS9A 3AE9A 3UP5A 4OCGA 3ZDNA 4D04A 1JRXA 1L9CA 3BI4A 4EQRA 4OPGA 3UTGA 5BULA 3NYFA 1GSNA 4HA6A 4U2LA 2H88A 3UOZA 2HQMA 3NK0X 2EQ8A 4ADWA 4IA6A 4G74A 4EQSA 4HB9A 3CIRA 1E6EA 4YWOA 1PXAA 3QFBA 1EL8A 4YTMA 3DGHA 2C64A 1D7YA 1XANA 2YLWA 3AB1A 1GT8A 3E1TA 4WX1A 2YAUA 3DH9A 3T2ZA 3QFAA 4YT0A 4NEWA 1PBEA 2C3DA 2YR5A 2FJEA 3BHFA 2GAGB 1GRFA 1D4CA 2BK4A 1ZKQA 4NNJA 2QA1A 5KMSA 1Y56A 3GQKA 2R0GA 3SY4A 2NVKX 4AT0A 2WP9A 1OJ9A 3FIMB 3T2KA 1DJNA 4H4RA 5KMQA 3CNPA 2X99A 3K7TA 1H7WA 1BGNA 1YQ4A 1PJ6A 3CMMA 1CJ4A 4GCMA 3OC4A 1BF3A 2YG7A 3Q6JA 3SX6A 4CNKA 1CC2A 4EMWA 2YWLA 1JNZA 4J33A 3NK1X 2WPCA 1P2HA 2AAQA 4NEVA 2ZZ0A 4DGKA 3AD8B 3AXBA 3PO7A 3P4PA 2X8CA 4IV9A 4H4QA 2WOIA 4E0VA 2OLNA 4USQA 4CCQA 1TRBA 3ALMA 4USRA 2GR3A 1ZX9A 3NGCX 4RSLA 2BS2A 4A5LA 1NG4A 2VOUA 3SZWA 3UTFA 3REDA 3FPZA 1DOEA 2C76A 4H4ZA 1N4VA 2ZZBA 1HYUA 3F8RA 3GRSA 4H4XA 4H7UA 1NHPA 2XVJA 4ZCCA 3ISHA 1GTEA 3GD4A 3EANA 1IUVA 2V3AA 3NYEA 4H4TA 4AOXA 1H86A 4YTPA 1CC4A 1TDOA 1GREA 2Q0LA 1F8WA 2I0ZA 4BJZA 3VRAA 1SEZA 2R46A 3NG7X 4AP1A 3SZ0A 2GR2A 4Z26A 5U1OA 2Z5XA 1GERA 3H8LA 1DOCA 2OA1A 2YLZA 2R9ZA 2BK3A 2XLSA 1LTXR 2EQ6A 3CNTA 4U8MA 5ER0A 2V5ZA 4X4JA 3HZLA 3CGDA 3GYJA 2BABA 3DK4A 4C3XA 1Q9IA 2YLXA 1DOBA 1NG3A 2JB1A 3ATQA 5DBJA 3ATRA 4ECHA 2RGOA 1GRTA 2WU2A 4H4YA 4OPIA 3M12A 4GAVA 3UKHA 4CY8A 4Y4LA 3KA7A 2A89A 1AOGA 4A9WA 2VVLG 4EMJA 4C5OA 4A7AA 3AEDA 3I3LA 3VQRA 4YXDA 2C75A 3AE6A 2CFYA 3NRNA 3CGEA 4TM4A 1GESA 1H82A 1PDHA 1H6VA 3SFDA 1UKVG 3G5SA 3NH3X 4U8OA 3LB8A 4A79A 4IVMB 2YLRA 2NPXA 3GYXA 4OPUA 3RP6A 5EOWA 4ZCDA 2ACZA 2BYBA 2WP5A 4J34A 1ZDLA 4U8PA 3RP8A 4AOSA 1YKJA 3CNSA 3HYVA 3UKPA 3AE8A 2WDVA 2YQUA 2XFUA 4BK1A 3GQHA 3BHKA 2R45A 1GRGA 3IHGA 3HYXA 1B5QA 2V3BA 3KLJA 3CGCA 5KVIA 2WOWA 2B7RA 3G5QA 1M64A 4JDRA 1E1LA 4D03A 2QAEA 4H4SA 3LADA 4JY3A 3VR9A 1GV4A 3K30A 3T2YA 2H89A 3SZCA 2J3NA 3P9UA 4B64A 4TM3A 1GXFA 1DXLA 1IUWA 3B3RA 4LA1A 1TDNA 2GF3A 3RP7A 1IUTA 3ICRA 1EL7A 1O5WA 4TLXA 3VR8A 2GEWA 3Q9TA 2VVMA 4H4UA 4K5RA 2XLUA 5J7XA 5IQ4A 1CL0A 3NN0X 5FS7A 1PXBA 2YG3A 2Q6UA 3NIXA 4J57A 2XFOA 1PN0A 3ALJA 3UKFA 3ITJA 2OLOA 3SZFA 4NTCA 1FOHA 2BCGG 2JBVA 2XCGA 3L8KA 1LV0A 2YM1A 3AEGA 3AYJA 1TYPA 5BRTA 2BRYA 4Z2RA 4XWZA 4J56A 3DGZA 3GMBA 2X8HA 2GVCA 2XLTA 4C3YA 3IWAA 3L1RA 4PAAA 3UOVA 1K0JA 1XHCA 5EBKA 4BV6A 4YTNA 4CBQA 4EM3A 4N9XA 1COYA 2C66A 4P9SA 1CJ2A 5KMPA 5M0ZA 3AE7A 4I58A 3UP4A 1MOKA 2GR1A 2YG4A 3P4RA 3AYLA 3AECA 1EL9A 2X3NA 3O0HA 2WS3A 3EAOA 1FEBA 5BVAA 1KSSA 3WE0A 1H83A 5U63A 5KNLA 3SUCA 4GUVA 3QSSA 1TYTA 1TDEA 1YQZA 1PBBA 1VG9A 1L9EA 4B63A 2WBAA 1ZMDA 2ZBWA 3CPIG 5FS6A 3V3OA 1EBDA 1JRZA 2Y6RA 3CNDA 3AE4A 1N4UA 2C67A 2YLTA 4BK3A 1XPQA 2OALA 2AR8A 2WDQA 3AE1A 4IA5A 1FL2A 5FMHA 1PJ5A 4J36A 2C65A 1D5TA 1P2EA 2E4GA 3BI5A 1DJQA 1H7XA 3ICSA 4H4WA 2R0PA 3IC9A 3NLCA 4C77A 1N1PA 5HY5A 1NHRA 3DJDA 2BXRA 3QSMA 4U8IA 2C4CA 1X31B 3D8XA 3UOXA 3GDNA 3V76A 5HXIA 2O9ZA 2WU5A 1GRAA 2XDOA 1BGJA 2PHHA 4BK2A 4TM1A 2E1MA 3DJJA 3CTYA 4G6GA 1H81A 1GTHA 3R9UA 3UKAA 5IPYA 4AT2A 2APGA 2R4JA 4GDEA 1ZY8A 3T31A 3NHOX 2X8GA 3CPHG 2V6OA 4EIPA 4EQXA 3QVPA 1K4QA 1QLBA 4A99A 4B66A 3T14A 1FECA 2WPEA 1E7PA 4U8LA 4UDRA 4H4VA 3GMCA 1CC6A 1S3EA 1PBFA 1JOAA 1ZMCA 3F8PA 1CBOA 4H2PA 3H4KA 4NTEA 5BUKA 3NTAA 1NENA 1FCDA 2W0HA 3KPFA 2FBWA 4A65A 2LFCA 3NNEA 2TPRA 4B69A 1GNDA 1M6IA 2YG5A 1S3BA 1O94A 1D4DA 3ZYXA 2C72A 3UKKA 2B9YA 2DKIA 2FJAA 1BWCA 4JY2A 4GF7A 3G5RA 5IQ1A 2YVFA 2V61A 5EB4A 5FS8A 1IUXA 1TDKA 4FX9A 5JCIA 3H8IA 1IUUA 1N4WA 2JK6A 1KSUA 2TMDA 3CPJG 4H50A 4U8KA 5EB5A 2Q7VA 1W4XA 3UCLA 1V59A 1VG0A 4NTDA 2CDUA 5CQFA 1L9DA 3DJEA 1YY5A 3NN6X 3AEAA 3LOVA 1NDAA 3FBSA 2BS3A 4OPTA 2A87A 4U8NA 4B1BA 1F8RA 1GPEA 3DK8A 1QJDA 2QCUA 4OPLA 2R0CA 5KVHA 2FJBA 4YSYA 3JSKA 1TDFA 2XFPA 5GSNA 1CHUA 3KPKA 2GMHA 3AYIA 4H2QA 1LVLA 4LU6A 4Z2TA 5J60A 4EM4A 2CULA 5KOXA 4FK1C 1GRHA 2QA2A 3KD9A 1PJ7A 2C70A 1D4EA 2AQJA 2WPFA 2C7GA 1K0IA 2EQ9A 3SYIA 4U2TA 3CGBA 1RP0A 4Y4MA 5L46A 5KOWA 2FJDA 1ONFA 2BS4A 3GWFA 1GEUA 5C3JA 2Q0KA 3IHMA 1E1NA 1NHQA 4G6HA 3S61A 4CY6A 1E39A 3LXDA 4JNQA 4X9MA 1LQTA 1KFYA 3QVRA 4H2RA 2VRMA 1GOSA 4J2WA 3B6DA 4B67A 3CN8A 3I6DA 2YLSA 5KWFA 2A8XA 3P4QA 2WESA 2XVIA 4APNA 2XVFA 3LZXA 3M0OA 3RHAA 4BURA 3UTHA 5JCKA 3GDPA 1B8SA 2JAEA 3NK2X 2WQYA 3DA1A 1ZK7A 4KX6A 1PS9A 3PVCA 1O95A 1YQ3A 3VRBA 3NYCA 3CNJA 5KRQA 1LQUA 2XYOA 5KXJA 3NKSA 3AEEA 4RG4A 3URHA 4C74A 1JEHA 1OJDA 2XLRA 3AE5A 3SQPA 3EF6A 4B68A 2ZZCA 2GR0A 4OPDA 3S5WA 1BZLA 3K7MX 2B7SA 3AD9B 1ZOVA 2GQFA 4J31A 3LZWA 4OVIA 1B4VA 4JQ9A 1NPXA 5TR3A 4UP3A 2XLPA 1K0LA 2BACA 4DSHA 3T37A 3C4NA 4GR1A 2C3CA 1OJAA 1LPFA 3DJGX 4WCTA 1S2QA 1IJHA 2GAHB 1Y0PA 4CNJA 1DNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMJ A;  2IVE A;  1Y56 B;  1CJ3 A;  1F8S A;  3DME A;  3NT6 A;  1Q1W A;  4B65 A;  2XVE A;  1NAA A;  3QSE A;  4Y4N A;  5U25 A;  1RYI A;  1MXT A;  4I59 A;  5C2T A;  2VVL A;  3C4A A;  1JRY A;  1E1M A;  1CF3 A;  2JKC A;  1Z6L A;  3UKQ A;  2BC1 A;  2XFQ A;  4RG3 A;  3V3N A;  4H4P A;  1F3P A;  1MO9 A;  3BNM A;  1EL5 A;  4EMI A;  2OAM A;  4Z44 A;  4Z43 A;  2B76 A;  4ICY A;  2YR4 A;  1FEA A;  4EIQ A;  4O5Q A;  2YG6 A;  1IUS A;  3D1C A;  3AEB A;  5JCM A;  2GQW A;  2UZZ A;  2VRL A;  4FDC B;  4FK1 A;  4KPR A;  3NTD A;  1JU2 A;  3M13 A;  3IF9 A;  4CCR A;  1VDC A;  5GRT A;  3GSI A;  2WEU A;  1PXC A;  4REK A;  2EQ7 A;  5FS9 A;  1GET A;  1QO8 A;  1PBD A;  1RSG A;  3II4 A;  2B9X A;  4K22 A;  2WP6 A;  2RGJ A;  2YR6 A;  2C73 A;  4IVO B;  3LJP A;  3P4S A;  5JCN A;  1B37 A;  2BCP A;  3SFE A;  4YSZ A;  1ELI A;  2IID A;  3FMW A;  3OZ2 A;  4JN9 A;  1ZOY A;  1ZP0 A;  1GRB A;  3KVE A;  1BKW A;  4O5U A;  2R4E A;  3K7Q X;  2XVH A;  2VQ7 A;  2YM2 A;  1Q1R A;  4GRT A;  1VRQ B;  4H2N A;  3UOY A;  2PYX A;  3BNU A;  2ARD A;  3RNM A;  2WHD A;  5LV9 A;  2BC0 A;  1KNR A;  3C96 A;  4LII A;  1GAL A;  4NZH A;  2VQB A;  2Z5Y A;  4YKG A;  2JB2 A;  1H84 A;  2GRT A;  2Y6Q A;  2BK5 A;  1VQW A;  5HHF A;  2GB0 A;  3EPT A;  2IVD A;  3GRT A;  3UTE A;  1CJC A;  3SM8 A;  3COX A;  3VRD B;  4K5S A;  2YVJ A;  4TLZ A;  3AD7 B;  5M10 A;  2CVJ A;  4A6N B;  2RGH A;  2GH5 A;  1KNP A;  3QJ4 A;  2RAB A;  4Z24 A;  4YSX A;  4K7Z A;  4A6N A;  1NHS A;  4XXG A;  3FG2 P;  1D7L A;  3ABV A;  4JNA A;  2B9W A;  1S2Y A;  1L0V A;  3KKJ A;  2DKH A;  3AE3 A;  4GDP A;  4XWR A;  1OJC A;  1DOD A;  4PAB A;  3ALL A;  4AP3 A;  3F8D A;  3AWI A;  3GYI A;  4YKF A;  4DNA A;  4Z2U A;  4K8D A;  2JB3 A;  3ADA B;  3DK9 A;  2BXS A;  3GWD A;  4OPC A;  5HYM A;  4M52 A;  1NEK A;  1LJ1 A;  1XDI A;  2X50 A;  4U2S A;  4UDQ A;  2WDR A;  4Z25 A;  3SGL A;  3AEF A;  4MJW A;  2VZ2 A;  5CKU A;  4BJY A;  2XFN A;  1PHH A;  4EQW A;  4CRT A;  2E5V A;  1JNR A;  4YSH A;  1KDG A;  2F5Z A;  2GV8 A;  2YVG A;  4U8J A;  3P1W A;  1F6M A;  3AE2 A;  1E1K A;  2WET A;  3KU9 A;  2BA9 A;  4ZN0 A;  2V60 A;  3ICT A;  1REO A;  1OJT A;  4K2X A;  1PBC A;  3GD3 A;  4TM0 A;  5JCL A;  1KF6 A;  2WOV A;  4DSG A;  4X9N A;  4UDP A;  3UKL A;  3BI2 A;  3PS9 A;  3AE9 A;  3UP5 A;  4OCG A;  3ZDN A;  4D04 A;  1JRX A;  1L9C A;  3BI4 A;  4EQR A;  4OPG A;  3UTG A;  5BUL A;  3NYF A;  1GSN A;  4HA6 A;  4U2L A;  2H88 A;  3UOZ A;  2HQM A;  3NK0 X;  2EQ8 A;  4ADW A;  4IA6 A;  4EQS A;  4HB9 A;  3CIR A;  1E6E A;  4YWO A;  1PXA A;  3QFB A;  1EL8 A;  4YTM A;  3DGH A;  2C64 A;  1D7Y A;  1XAN A;  2YLW A;  3AB1 A;  1GT8 A;  3E1T A;  4WX1 A;  2YAU A;  3DH9 A;  3QFA A;  4YT0 A;  4NEW A;  1PBE A;  2C3D A;  2YR5 A;  2FJE A;  3BHF A;  2GAG B;  1GRF A;  1D4C A;  2BK4 A;  1ZKQ A;  2QA1 A;  1Y56 A;  3GQK A;  2R0G A;  4AT0 A;  2NVK X;  2WP9 A;  1OJ9 A;  3FIM B;  1DJN A;  4H4R A;  3CNP A;  2X99 A;  3K7T A;  1H7W A;  1BGN A;  1YQ4 A;  1PJ6 A;  1CJ4 A;  4GCM A;  3OC4 A;  1BF3 A;  2YG7 A;  3Q6J A;  4CNK A;  1CC2 A;  4EMW A;  2YWL A;  1JNZ A;  4J33 A;  3NK1 X;  2WPC A;  1P2H A;  2AAQ A;  4NEV A;  2ZZ0 A;  4DGK A;  3AD8 B;  3AXB A;  3PO7 A;  3P4P A;  2X8C A;  4IV9 A;  4H4Q A;  2WOI A;  4E0V A;  2OLN A;  4USQ A;  4CCQ A;  1TRB A;  3ALM A;  4USR A;  2GR3 A;  1ZX9 A;  3NGC X;  4RSL A;  2BS2 A;  4A5L A;  1NG4 A;  2VOU A;  3UTF A;  3RED A;  3FPZ A;  1DOE A;  2C76 A;  4H4Z A;  1N4V A;  2ZZB A;  1HYU A;  3F8R A;  3GRS A;  4H4X A;  4H7U A;  1NHP A;  2XVJ A;  4ZCC A;  3ISH A;  1GTE A;  3GD4 A;  3EAN A;  1IUV A;  2V3A A;  3NYE A;  4H4T A;  4AOX A;  1H86 A;  4YTP A;  1CC4 A;  1TDO A;  1GRE A;  2Q0L A;  1F8W A;  2I0Z A;  4BJZ A;  3VRA A;  1SEZ A;  2R46 A;  3NG7 X;  4AP1 A;  2GR2 A;  4Z26 A;  5U1O A;  2Z5X A;  1GER A;  3H8L A;  1DOC A;  2OA1 A;  2YLZ A;  2R9Z A;  2BK3 A;  2XLS A;  1LTX R;  2EQ6 A;  3CNT A;  4U8M A;  5ER0 A;  2V5Z A;  4X4J A;  3HZL A;  3CGD A;  3GYJ A;  2BAB A;  3DK4 A;  4C3X A;  1Q9I A;  2YLX A;  1DOB A;  1NG3 A;  2JB1 A;  3ATQ A;  5DBJ A;  3ATR A;  4ECH A;  2RGO A;  1GRT A;  2WU2 A;  4H4Y A;  4OPI A;  3M12 A;  3UKH A;  4CY8 A;  4Y4L A;  3KA7 A;  2A89 A;  1AOG A;  4A9W A;  2VVL G;  4EMJ A;  4C5O A;  4A7A A;  3AED A;  3I3L A;  3VQR A;  4YXD A;  2C75 A;  3AE6 A;  2CFY A;  3NRN A;  3CGE A;  4TM4 A;  1GES A;  1H82 A;  1PDH A;  1H6V A;  3SFD A;  1UKV G;  3G5S A;  3NH3 X;  4U8O A;  3LB8 A;  4A79 A;  4IVM B;  2YLR A;  2NPX A;  3GYX A;  4OPU A;  3RP6 A;  5EOW A;  4ZCD A;  2ACZ A;  2BYB A;  2WP5 A;  4J34 A;  1ZDL A;  4U8P A;  3RP8 A;  4AOS A;  1YKJ A;  3CNS A;  3UKP A;  3AE8 A;  2WDV A;  2YQU A;  2XFU A;  4BK1 A;  3GQH A;  3BHK A;  2R45 A;  1GRG A;  3IHG A;  1B5Q A;  2V3B A;  3KLJ A;  3CGC A;  5KVI A;  2WOW A;  2B7R A;  3G5Q A;  1M64 A;  4JDR A;  1E1L A;  4D03 A;  2QAE A;  4H4S A;  3LAD A;  4JY3 A;  3VR9 A;  1GV4 A;  3K30 A;  2H89 A;  2J3N A;  3P9U A;  4B64 A;  4TM3 A;  1GXF A;  1DXL A;  1IUW A;  3B3R A;  4LA1 A;  1TDN A;  2GF3 A;  3RP7 A;  1IUT A;  3ICR A;  1EL7 A;  1O5W A;  4TLX A;  3VR8 A;  2GEW A;  3Q9T A;  2VVM A;  4H4U A;  4K5R A;  2XLU A;  5J7X A;  5IQ4 A;  1CL0 A;  3NN0 X;  5FS7 A;  1PXB A;  2YG3 A;  2Q6U A;  3NIX A;  4J57 A;  2XFO A;  1PN0 A;  3ALJ A;  3UKF A;  3ITJ A;  2OLO A;  4NTC A;  1FOH A;  2BCG G;  2JBV A;  2XCG A;  3L8K A;  1LV0 A;  2YM1 A;  3AEG A;  3AYJ A;  1TYP A;  5BRT A;  4Z2R A;  4XWZ A;  4J56 A;  3DGZ A;  3GMB A;  2X8H A;  2GVC A;  2XLT A;  4C3Y A;  3IWA A;  3L1R A;  4PAA A;  3UOV A;  1K0J A;  1XHC A;  5EBK A;  4BV6 A;  4YTN A;  4CBQ A;  4EM3 A;  4N9X A;  1COY A;  2C66 A;  4P9S A;  1CJ2 A;  5M0Z A;  3AE7 A;  4I58 A;  3UP4 A;  1MOK A;  2GR1 A;  2YG4 A;  3P4R A;  3AYL A;  3AEC A;  1EL9 A;  2X3N A;  3O0H A;  2WS3 A;  3EAO A;  1FEB A;  5BVA A;  1KSS A;  3WE0 A;  1H83 A;  5U63 A;  3SUC A;  4GUV A;  3QSS A;  1TYT A;  1TDE A;  1YQZ A;  1PBB A;  1VG9 A;  1L9E A;  4B63 A;  2WBA A;  1ZMD A;  2ZBW A;  3CPI G;  5FS6 A;  3V3O A;  1EBD A;  1JRZ A;  2Y6R A;  3CND A;  3AE4 A;  1N4U A;  2C67 A;  2YLT A;  4BK3 A;  1XPQ A;  2OAL A;  2AR8 A;  2WDQ A;  3AE1 A;  4IA5 A;  1FL2 A;  5FMH A;  1PJ5 A;  4J36 A;  2C65 A;  1D5T A;  1P2E A;  2E4G A;  3BI5 A;  1DJQ A;  1H7X A;  3ICS A;  4H4W A;  2R0P A;  3IC9 A;  3NLC A;  4C77 A;  1N1P A;  5HY5 A;  1NHR A;  3DJD A;  2BXR A;  3QSM A;  4U8I A;  1X31 B;  3D8X A;  3UOX A;  3GDN A;  3V76 A;  5HXI A;  2O9Z A;  2WU5 A;  1GRA A;  2XDO A;  1BGJ A;  2PHH A;  4BK2 A;  4TM1 A;  2E1M A;  3DJJ A;  3CTY A;  1H81 A;  1GTH A;  3R9U A;  3UKA A;  5IPY A;  4AT2 A;  2APG A;  2R4J A;  4GDE A;  1ZY8 A;  4EIP A;  3NHO X;  2X8G A;  3CPH G;  2V6O A;  4EQX A;  3QVP A;  1K4Q A;  1QLB A;  4A99 A;  4B66 A;  1FEC A;  2WPE A;  1E7P A;  4U8L A;  4UDR A;  4H4V A;  3GMC A;  1CC6 A;  1S3E A;  1PBF A;  1JOA A;  1ZMC A;  3F8P A;  1CBO A;  4H2P A;  3H4K A;  4NTE A;  5BUK A;  3NTA A;  1NEN A;  1FCD A;  2W0H A;  3KPF A;  2FBW A;  4A65 A;  2LFC A;  3NNE A;  2TPR A;  4B69 A;  1GND A;  1M6I A;  2YG5 A;  1S3B A;  1O94 A;  1D4D A;  3ZYX A;  2C72 A;  3UKK A;  2B9Y A;  2DKI A;  2FJA A;  1BWC A;  4JY2 A;  4GF7 A;  3G5R A;  5IQ1 A;  2YVF A;  2V61 A;  5EB4 A;  5FS8 A;  1IUX A;  1TDK A;  4FX9 A;  5JCI A;  3H8I A;  1IUU A;  1N4W A;  2JK6 A;  1KSU A;  2TMD A;  3CPJ G;  4H50 A;  4U8K A;  5EB5 A;  2Q7V A;  1W4X A;  3UCL A;  1V59 A;  1VG0 A;  4NTD A;  2CDU A;  5CQF A;  1L9D A;  3DJE A;  1YY5 A;  3NN6 X;  3AEA A;  3LOV A;  1NDA A;  3FBS A;  2BS3 A;  4OPT A;  2A87 A;  4U8N A;  4B1B A;  1F8R A;  1GPE A;  3DK8 A;  1QJD A;  2QCU A;  4OPL A;  2R0C A;  5KVH A;  2FJB A;  4YSY A;  3JSK A;  1TDF A;  2XFP A;  5GSN A;  1CHU A;  4Z2T A;  2GMH A;  3AYI A;  4H2Q A;  1LVL A;  4LU6 A;  5J60 A;  5KOX A;  4EM4 A;  2CUL A;  4FK1 C;  1GRH A;  2QA2 A;  3KD9 A;  1PJ7 A;  2C70 A;  1D4E A;  2AQJ A;  2WPF A;  2C7G A;  1K0I A;  2EQ9 A;  4U2T A;  3CGB A;  1RP0 A;  4Y4M A;  5L46 A;  5KOW A;  2FJD A;  1ONF A;  2BS4 A;  3GWF A;  1GEU A;  5C3J A;  2Q0K A;  3IHM A;  1E1N A;  1NHQ A;  3S61 A;  4CY6 A;  1E39 A;  3LXD A;  4JNQ A;  4X9M A;  1LQT A;  1KFY A;  3QVR A;  4H2R A;  2VRM A;  1GOS A;  4J2W A;  3B6D A;  4B67 A;  3CN8 A;  3I6D A;  2YLS A;  5KWF A;  2A8X A;  3P4Q A;  2WES A;  2XVI A;  4APN A;  2XVF A;  3LZX A;  3M0O A;  3RHA A;  4BUR A;  3UTH A;  5JCK A;  3GDP A;  1B8S A;  2JAE A;  3NK2 X;  2WQY A;  3DA1 A;  1ZK7 A;  4KX6 A;  1PS9 A;  3PVC A;  1O95 A;  1YQ3 A;  3VRB A;  3NYC A;  3CNJ A;  5KRQ A;  1LQU A;  2XYO A;  5KXJ A;  3NKS A;  3AEE A;  4RG4 A;  3URH A;  4C74 A;  1JEH A;  1OJD A;  2XLR A;  3AE5 A;  3SQP A;  3EF6 A;  4B68 A;  2ZZC A;  2GR0 A;  4OPD A;  3S5W A;  1BZL A;  3K7M X;  2B7S A;  3AD9 B;  1ZOV A;  2GQF A;  4J31 A;  3LZW A;  4OVI A;  1B4V A;  4JQ9 A;  1NPX A;  5TR3 A;  4UP3 A;  2XLP A;  1K0L A;  2BAC A;  4DSH A;  3T37 A;  3C4N A;  4GR1 A;  2C3C A;  1OJA A;  1LPF A;  3DJG X;  4WCT A;  1S2Q A;  1IJH A;  2GAH B;  1Y0P A;  4CNJ A;  1DNC A; 
#chains in the Genus database with same CATH topology
 2CEA A;  2GMJ A;  2IC6 A;  2XSB A;  3DME A;  4IE6 A;  2MTQ A;  2B1E A;  3UT5 E;  3A8Y C;  5KMR A;  5AQL B;  1O3X A;  3C4A A;  1CF3 A;  1Z6L A;  2XFQ A;  3V3N A;  2Y48 B;  2OAM A;  4QH4 A;  2WAU A;  5CB4 E;  5ETW A;  3ETU A;  1D1A A;  5JCM A;  4HFC A;  2QRX A;  3UUB A;  4FK1 A;  4X65 T;  1JU2 A;  3M13 A;  4OYJ A;  5FVK A;  3GSI A;  4EXT A;  2EQ7 A;  1GET A;  3J7Y q;  1AR6 4;  1X79 A;  3EHZ A;  3U78 A;  2C73 A;  4CN1 A;  4ZI7 E;  2BCP A;  2IID A;  1LKX A;  3NBX X;  4O5U A;  5IYZ E;  2ZM0 A;  2UUA T;  3NRX A;  4HFB A;  5F8P A;  2R4E A;  2XVH A;  2VQ7 A;  2YM2 A;  1XMQ T;  4XAX B;  4QXC B;  2LSK A;  4H2N A;  1EZ3 A;  2PYX A;  5LV9 A;  2WHD A;  2D2S A;  4IL4 A;  3ZYK A;  1KNR A;  3K3O A;  4IIJ E;  2E9X A;  1GAL A;  4J2C A;  4X1K E;  4QHO A;  3Q2M A;  3PUV F;  2XSA A;  5LNK A;  3SM8 A;  3COX A;  1KNZ A;  3F31 A;  2YVJ A;  3PUW F;  2CE7 A;  2CVJ A;  2RGH A;  4U2Z A;  4CXY A;  3LK3 B;  4K7Z A;  2BVM A;  4HFE A;  3EVY A;  2ZLY A;  2DWK A;  4ZS3 A;  2B9W A;  4CXW A;  4II3 A;  4XWR A;  4GDP A;  3IBP A;  2W0G A;  1DOD A;  4PAB A;  3ALL A;  4AP3 A;  3QB5 A;  3F8D A;  4DNA A;  2XQ6 A;  3ZT7 A;  2YN6 A;  3LG7 A;  4ILB A;  4EB6 E;  2X50 A;  4TN7 B;  4UDQ A;  3SGL A;  4BJY A;  4PJJ A;  2XFN A;  1PHH A;  4EQW A;  3LFM A;  1FJG T;  4CRT A;  4MLK A;  1JNR A;  4YSH A;  2GV8 A;  2J47 A;  1REO A;  1PBC A;  4TM0 A;  2ZM6 T;  5HCM A;  5JCL A;  1KF6 A;  3AXJ A;  2WOV A;  3AA1 B;  3LBX B;  4UDP A;  2N9D A;  3BI2 A;  3NKZ A;  3AE9 A;  3UP5 A;  4OCG A;  3ZDN A;  1MIV A;  1IBM T;  2IW5 B;  4U2L A;  1RMU 4;  3JBG 4;  3UOZ A;  2RS1 4;  2A2F X;  3RC8 A;  4IA6 A;  4HB9 A;  5FY1 A;  1E6E A;  4YWO A;  1PXA A;  3QFB A;  4YTM A;  3DGH A;  2C64 A;  2YLW A;  3E1T A;  1GT8 A;  4B3S T;  1YXR A;  3QFA A;  1RUC 4;  2YDS A;  1GRF A;  2JMK A;  4DBQ A;  5HEH A;  4ZEY A;  1ZKQ A;  4NNJ A;  1W0B A;  4ZS2 A;  2VVS A;  2WP9 A;  4RHV 4;  5ABE A;  5KMQ A;  3CNP A;  1G8X A;  2CM0 A;  2J4G A;  3UU8 A;  3Q6J A;  4CNK A;  1CC2 A;  3Q9D A;  4J33 A;  3NK1 X;  2WPC A;  1XWM A;  2VL8 A;  2ZZ0 A;  3AD8 B;  4DGK A;  4IV9 A;  3P4P A;  4UVA B;  2WOI A;  4H4Q A;  4TV8 E;  1TRB A;  4DBR A;  2BS2 A;  4ZZB A;  4H4Z A;  2A9U A;  4CN4 A;  4H7U A;  3AA7 B;  1NHP A;  2XVJ A;  3BQK A;  2GK9 A;  3K8P C;  4Q4V 4;  1W0A A;  4Z90 A;  2UUC T;  3EAN A;  2HWB 4;  1MIW A;  4H4T A;  1TDO A;  3BQI A;  5JDH A;  1GRE A;  1Y64 B;  1SEZ A;  2R46 A;  3NG7 X;  4AP1 A;  4QWN B;  3SZ0 A;  5U1O A;  2KLQ A;  3GWH A;  3L09 A;  1LTX R;  3CNT A;  1HRV 4;  1ZEE A;  3HZL A;  4PK5 A;  3B57 A;  2CA5 A;  3WAJ A;  2I0M A;  1J1J A;  3ATR A;  2X9X A;  2WU2 A;  4OPI A;  2V7L A;  1AOG A;  4Y4L A;  2LJL A;  3B5M A;  4A7A A;  4C5O A;  3AED A;  3I3L A;  2XQ3 A;  2C75 A;  3AE6 A;  2R7F A;  3CGE A;  4JI5 T;  1GES A;  3G5S A;  3ONX A;  1H6V A;  3NH3 X;  4AXP A;  2YLR A;  3GYX A;  4OPU A;  1WLX A;  3RP6 A;  4ZCD A;  2RR1 4;  2BYB A;  4AOS A;  2D5U A;  3HYV A;  3UKP A;  5J0Z A;  2WDV A;  2VKJ A;  4HWI B;  5JDL A;  2R45 A;  2X66 A;  5FXV A;  3NZP A;  3IHG A;  3HYX A;  2BBH A;  1HCI A;  2VL0 A;  4L5G A;  5HXR A;  3KLJ A;  3KBU A;  3CGC A;  4CI1 B;  2B7R A;  4PDW D;  3N2O A;  4JDR A;  2HH7 A;  5AQI B;  1E1L A;  4H4S A;  5AQO B;  3LAD A;  3VR9 A;  3LBX A;  2W2U A;  2RMU 4;  1DXL A;  1IUW A;  2V5D A;  1O5W A;  3IA3 A;  3TLU A;  4K5R A;  2XLU A;  2IUB A;  1PXB A;  2YG3 A;  2Q6U A;  3NIX A;  3ZT5 A;  4M1P A;  3ZJ1 A;  1D0Z A;  3UKF A;  5FVL A;  2NW8 A;  2E5L T;  3SZF A;  4BJM A;  4NTC A;  2XCG A;  3UU3 A;  2XZE A;  2KT9 A;  2YM1 A;  3PV0 F;  1UCU A;  3RQW A;  3W15 B;  4XWZ A;  4J56 A;  4JI2 T;  4XZC A;  4EYU A;  1ZV4 X;  4KUM B;  2XLT A;  4C3Y A;  3UOV A;  4BV6 A;  1COY A;  2C66 A;  1CJ2 A;  4I58 A;  1MOK A;  2YG4 A;  3CX7 B;  3P4R A;  1SE7 A;  4PNI A;  2KMF A;  4ZHQ E;  2AXD S;  1AR8 4;  3WE0 A;  4O2A E;  3QSS A;  4DV4 T;  1TDE A;  1PBB A;  1VG9 A;  2VWA A;  4I55 E;  1ZMD A;  4EZ4 A;  4OHF A;  3V3O A;  1EBD A;  3CND A;  1N4U A;  2YLT A;  4BK3 A;  1XPQ A;  4LMK A;  2WDQ A;  4P0A A;  1M62 A;  3ICS A;  3BQL A;  3IC9 A;  3NLC A;  4X64 T;  3RLF F;  2NP9 A;  1D1C A;  2BXR A;  1RUE 4;  3DJB A;  2C4C A;  2ODU A;  1QUU A;  2O9Z A;  5LGU B;  1BGJ A;  4BK2 A;  2E1M A;  5CGM A;  3DJJ A;  3ZMV B;  4G6G A;  3MJX A;  1GTH A;  3R9U A;  4LF9 T;  4EQX A;  1VBD 4;  1FEC A;  4UIG A;  4ZI3 C;  4QXH B;  1CC6 A;  2V5C A;  1CBO A;  3H4K A;  4HFD A;  5JDG A;  4YY3 T;  4K0K T;  4B69 A;  1M6I A;  1S3B A;  2X9H A;  4HEA A;  2B9Y A;  2FJA A;  1BWC A;  4TUY E;  1T72 A;  2G0U A;  3O1I A;  4ILC A;  2CLY C;  2V61 A;  5C8Y E;  5EB4 A;  4MHC A;  5FS8 A;  4FX9 A;  1R09 4;  1IUU A;  4H9P C;  1N4W A;  3CPJ G;  4H50 A;  4U8K A;  4WW0 A;  1W4X A;  1V59 A;  5DQW A;  5CQF A;  2CDU A;  1L9D A;  1VCS A;  1YY5 A;  2R06 4;  2PLV 4;  3NN6 X;  4B1B A;  1FMV A;  1GPE A;  3DK8 A;  1D4M 4;  2R0C A;  2VK9 A;  1U5P A;  1CHU A;  5M4Y A;  1LVL A;  2LKG A;  2V8S V;  3A7M A;  4KMC A;  1D4E A;  2WPF A;  1EAH 4;  1YD8 G;  1Y01 A;  4XBF B;  1RUI 4;  4EAH A;  2FJD A;  1HTJ F;  1MND A;  4AKR B;  1GEU A;  1E1N A;  4HWC A;  1N32 T;  4DR5 T;  3N9P A;  2KSR A;  3ZEF B;  1X9B A;  4B67 A;  3CN8 A;  3I6D A;  4MFR A;  3P4Q A;  2XVI A;  2XVF A;  1H8T D;  5JCK A;  2DCF A;  1AL2 4;  2WQY A;  3PVC A;  1O95 A;  2XAQ B;  3KDS E;  5LYJ E;  4C74 A;  5KXJ A;  1OJD A;  5LGT B;  2GR0 A;  4P1N A;  2X9W A;  4Q4Y 4;  3ZST A;  3Q5W A;  4OPD A;  1BZL A;  3FZM B;  2B7S A;  2KXP B;  3H3A A;  4JQ9 A;  3N9Q A;  3RHW A;  5HCJ A;  1AR9 4;  5IUX A;  3AVR A;  4GR1 A;  4WCT A;  4HTE A;  4PK4 A;  4CNJ A;  2HHH T;  2IVE A;  4JI0 T;  1SA0 E;  1Y56 B;  1CJ3 A;  3UUN A;  1F8S A;  4LF8 T;  5AQH B;  1Q1W A;  3CKD A;  1NAA A;  4Y4N A;  3T1H T;  3RRC A;  5LHG B;  3PUR A;  2RA1 A;  4HFH A;  3UKQ A;  4RG3 A;  5HAX A;  1F3P A;  1MO9 A;  3BNM A;  3DTO A;  2YKS A;  1EL5 A;  3OJA A;  4Z43 A;  2V6Y B;  4ISS A;  4NUU A;  1IUS A;  2VRL A;  3NTD A;  3VKH A;  4CCR A;  4NIQ A;  2ACX A;  1MIY A;  5L3G B;  5FS9 A;  3A5X A;  2ZM8 A;  1Z8U A;  4FJO A;  5FNV E;  4IVO B;  2JQK A;  3LJP A;  3P4S A;  5JCN A;  3OZ2 A;  4JN9 A;  3M65 A;  1ELI A;  4II2 A;  1ZOY A;  4ILA A;  1ZP0 A;  3KVE A;  1BKW A;  2XPK A;  3LSV A;  3UOY A;  2N1G A;  3BNU A;  3RNM A;  3PE0 A;  1NAF A;  3F57 A;  2H3R A;  4GOU A;  3ZYL A;  4HFI A;  5ABF A;  5EZY E;  3RIA A;  4HGA A;  3GRT A;  2BKO A;  2E8I A;  4GAP A;  4K5S A;  3GN5 B;  3Q5X A;  2EX3 A;  5M10 A;  1VOM A;  2GH5 A;  4P09 A;  1NHS A;  5J2U E;  4XXG A;  5HWX A;  3ABV A;  1HX1 B;  1WFD A;  2LRK A;  3GYI A;  4Z2U A;  3ADA B;  2BXS A;  3GWD A;  4M52 A;  1LJ1 A;  4GK0 E;  3AEF A;  5CKU A;  4JEU B;  4NWZ A;  3T0K A;  2E5V A;  3N2G E;  1KDG A;  3P1W A;  1F6M A;  3D0T A;  1E1K A;  2BA9 A;  2OLT A;  1GQE A;  4V1A v;  3ICT A;  4K2X A;  1OJT A;  1MQT D;  1ZKE A;  4PAG A;  1N33 T;  2Q9Q D;  3UKL A;  3PS9 A;  2YU2 A;  5HEU A;  4D04 A;  1L9C A;  3BI4 A;  1MMA A;  3UTG A;  5BUL A;  4UV9 B;  1BEV 4;  2WZI A;  4CQI A;  1VBB 4;  2JQQ A;  2CHO A;  3ZJ2 A;  3ZN0 B;  3KFW X;  2XTL A;  2MBG A;  5BMV E;  4G2A A;  1EL8 A;  3C98 B;  2BDE A;  3H3M A;  3JD7 4;  3AB1 A;  1VBE 4;  2YAU A;  3DH9 A;  4TV9 E;  1AJ3 A;  1PBE A;  4AQF A;  3HKC E;  3JC6 D;  2YDQ A;  4KI0 F;  2BK4 A;  5L47 A;  1Y56 A;  3SY4 A;  2NW7 A;  4COF A;  5L4E A;  1OJ9 A;  1Z7S 4;  1IZN B;  1DJN A;  1K5M D;  2JMH A;  3K7T A;  4G63 A;  2RS3 4;  2YG7 A;  3SX6 A;  4IL9 A;  4L0R A;  2KIN B;  2L8K A;  3UFG A;  3TLS A;  2V6Y A;  2UUB T;  5TAO A;  2WSS V;  1OED C;  1RHI 4;  4YHJ A;  3PUG A;  2RPA A;  1NG4 A;  2VOU A;  3UTF A;  5L3C B;  5JTG A;  3UUL A;  5LBM A;  3HA4 A;  1HYU A;  2R04 4;  3GRS A;  2H7O A;  4H4X A;  2Y8D A;  4ZCC A;  4IDO A;  5LXT E;  3NYE A;  3KV5 A;  1H86 A;  1CC4 A;  2Q0L A;  1F8W A;  2I0Z A;  4BJZ A;  3CX6 B;  1UX5 A;  3VRA A;  5LHI B;  4EOZ B;  5AQF B;  4Z26 A;  3EUH A;  3H8L A;  1RUJ 4;  2LSG A;  4AQF C;  2OA1 A;  3N5L A;  2R9Z A;  4IHJ E;  4DR6 T;  3UFE A;  2EQ6 A;  2V5Z A;  4Z8X A;  3TLV A;  3GYJ A;  3E08 A;  4DUY T;  2BAB A;  1Q9I A;  1HXS 4;  4O4J E;  1NG3 A;  3ATQ A;  4KP3 C;  2W67 A;  5AQQ B;  4GKK T;  3UKH A;  4H4Y A;  4B3T T;  3GN5 A;  3KA7 A;  2A89 A;  3PJA J;  4A5X A;  3PU8 A;  2UXD T;  3AVS A;  3VQR A;  3RI5 A;  4UF0 B;  1H82 A;  3NVO A;  3SFD A;  5FY0 A;  4U8O A;  3U3I A;  1HNZ T;  5HEO A;  1YKE B;  4IVM B;  4PW8 A;  5JVD E;  3IEE A;  5EOW A;  4IGU A;  2IML A;  2WP5 A;  4J34 A;  1WYC A;  2WCA A;  3B13 A;  4HE8 A;  5F3J A;  4U31 A;  3BHK A;  1GRG A;  4P0B A;  4HWF A;  2H7V C;  3QNU A;  2CXD A;  5KDM C;  1GV4 A;  3SWH A;  4CI3 B;  3ANW A;  4U2Y A;  4TM3 A;  1HRI 4;  3R84 B;  4LA1 A;  1TDN A;  3RP7 A;  1IUT A;  2CRB A;  3F2E A;  2GEW A;  1AR7 4;  2VVM A;  4H4U A;  1S35 A;  4B6X A;  2IC9 A;  4Z91 A;  5CFB A;  3ITJ A;  1S94 A;  3VHL A;  1FOH A;  4ASK A;  2BCG G;  3UUX B;  4AKG A;  1LV0 A;  3L8K A;  5EK3 A;  3AYJ A;  3UUM A;  4O2B E;  4TZ4 C;  3ESL A;  3PU3 A;  4IDZ A;  5L3F B;  2JJ9 A;  3DGZ A;  3GMB A;  5L3E B;  3L1R A;  3EDV A;  1K0J A;  5EBK A;  4CBQ A;  3WAK A;  1T8B A;  1U4Q A;  2C0S A;  2GR1 A;  3AYL A;  3P50 A;  5BVA A;  1BR2 A;  3PJA A;  4GUV A;  2CLY B;  1YKH B;  2JQH A;  5FXW A;  1RUG 4;  5F5W A;  4B63 A;  2ZBW A;  2M6I A;  1KK7 A;  1WYB A;  3K3N A;  1JRZ A;  3AE4 A;  2C67 A;  2XQ4 A;  2AR8 A;  4IA5 A;  2LKH A;  2V1D B;  1P2E A;  3BI5 A;  1DJQ A;  3HKE E;  4C77 A;  2LHN A;  1N1P A;  5HY5 A;  3Q5E A;  4HWH A;  3QSM A;  3LK2 B;  2NTY A;  5HXI A;  3RX6 A;  1GRA A;  3QK6 A;  4GYR A;  2VB6 A;  3ONL C;  4KHP T;  1KEY A;  3JAF A;  3CWZ B;  4TWH A;  2IHR 1;  2JIW A;  1H81 A;  3UKA A;  4X66 T;  2EHO D;  5AQN B;  1B7T A;  1QSD A;  1ZY8 A;  5L2L A;  3CPH G;  3RKG A;  3QVP A;  1K4Q A;  2LSY A;  1E7P A;  4U8L A;  4H4V A;  3ZPO A;  2BBJ A;  4NTE A;  5HXE A;  1NEN A;  2W0H A;  3KPF A;  2FBW A;  2LT3 A;  1GND A;  3C50 A;  2YG5 A;  1XHX A;  1O94 A;  2C72 A;  3MAC A;  4PJN A;  4UF0 A;  4YJ2 E;  4OX9 T;  4JUY A;  2LLY A;  2RM2 4;  3FBL A;  1HR0 T;  1N34 T;  5L4H A;  2M67 A;  5EB5 A;  3UCL A;  5LHH B;  4WBO A;  4DV3 T;  3LOV A;  2KWH A;  2BS3 A;  2A87 A;  1F8R A;  2EHO C;  2J62 A;  2FJB A;  3JSK A;  2C5J A;  2GMH A;  5KOX A;  4LU6 A;  4O4H E;  2CMR A;  2V7J A;  4LF4 T;  3CGB A;  4U7Y A;  4ANJ A;  1HS7 A;  5L46 A;  5IHY A;  5CA1 E;  4UEM A;  1D0Y A;  2Q0K A;  5KMS A;  3LXD A;  4X9M A;  4CXX A;  3C64 A;  1KFY A;  1LQT A;  4GB3 4;  2YIN A;  2V7K A;  4UV8 B;  3ETV A;  2FUP A;  3ZCJ A;  5LCY A;  4B3R T;  2WES A;  3RHA A;  3UTH A;  2JAE A;  3NK2 X;  3NZQ A;  3EAB A;  1YQ3 A;  2Z6E A;  3C4W A;  3KIN B;  5HXS A;  3CNJ A;  2XQ9 A;  3NKS A;  4RG4 A;  2XQA A;  2W62 A;  2Y6X A;  5L3D B;  4B68 A;  2CCQ A;  4A97 A;  3AD9 B;  3KV9 A;  4AKH A;  4J31 A;  3MZK B;  1XHZ A;  1B4V A;  4JBW F;  4TX5 A;  4H63 V;  1K0L A;  2BAC A;  3CK6 A;  3WI3 A;  3PDY A;  1OJA A;  3T1Y T;  3DJG X;  3N9L A;  4IRE A;  1DNC A;  4JI1 T;  2DL1 A;  1NA1 D;  5U25 A;  3QSE A;  1RYI A;  3T8O A;  1MXT A;  4I59 A;  2VVL A;  1JRY A;  1E1M A;  2JKC A;  5DJQ C;  5EK2 A;  4QX8 B;  4H4P A;  4X62 T;  5ADX L;  5ABG A;  4EMI A;  4ICY A;  2YR4 A;  2VAS A;  4DND A;  3D1C A;  2PTF A;  2HPJ A;  1VDC A;  2WEU A;  3SXI A;  4K0U A;  3P8C D;  4ZXL A;  4REK A;  4A98 A;  3MXZ A;  1PBD A;  1QO8 A;  1RSG A;  4K22 A;  2WP6 A;  2YR6 A;  1ASJ 4;  1HF8 A;  1B37 A;  3JAE A;  4DO0 A;  3FMW A;  4ERR A;  3I0O A;  2I6H A;  3K7Q X;  4EED A;  2VVN A;  5IWA T;  4GRT A;  2MOZ A;  3E0Z A;  2NW9 A;  5LMN T;  2ARD A;  3UQ4 A;  5ABF B;  3QB5 K;  3C96 A;  4LII A;  2W61 A;  2BG9 C;  2L3L A;  5LA6 E;  3SRZ A;  2X51 A;  2Z5Y A;  4YKG A;  1H84 A;  2Y6Q A;  1IJ6 A;  2GB0 A;  3KVA A;  2IVD A;  3HL6 A;  4O8S A;  1WR6 A;  2DWG A;  3UTE A;  4ADZ A;  1CJC A;  3VRD B;  4DR3 T;  4TLZ A;  1G73 A;  2X0L B;  2XM1 A;  3OYX A;  1IBL T;  5JRE A;  1KNP A;  4Z24 A;  5AQK B;  2RAB A;  4YSX A;  4A6N A;  4DR7 T;  3FG2 P;  1D7L A;  3FZL B;  2JQ9 A;  4JNA A;  3ZMS B;  4I4T E;  2WZH A;  2BG9 E;  3KKJ A;  2PBI A;  3AE3 A;  3CQC B;  3AWI A;  4DID B;  2Q9Q B;  2C5K T;  4GKJ T;  2JB3 A;  4OPC A;  5HYM A;  2WDR A;  3FBZ A;  5J2T E;  4Z25 A;  4MJW A;  2VZ2 A;  4DUZ T;  3N2K E;  3PUZ F;  2F5Z A;  2YVG A;  4U8J A;  1XDP A;  2WET A;  3KU9 A;  2RP4 A;  4AQY T;  2V60 A;  2KND A;  1OED B;  3GD3 A;  3HYW A;  2PW9 A;  4HWD A;  5LMU T;  4X9N A;  4Q25 A;  3UU4 A;  2XAS B;  5DQV A;  1JRX A;  4EQR A;  4HA6 A;  3RQU A;  2H88 A;  1ZHC A;  4DR4 T;  4DV0 T;  2VQF T;  4ADW A;  2NTX A;  3BK9 A;  2R6G F;  2UU9 T;  1PO1 4;  3LJC A;  1D7Y A;  5HYA A;  2XJ7 A;  3KBT A;  4NEW A;  2C3D A;  2YR5 A;  2SPC A;  2R07 4;  3BHF A;  1HNX T;  4O4I E;  1BR1 A;  1POV 0;  2R0G A;  4AT0 A;  2NVK X;  4ZI2 D;  3TLW A;  1H7W A;  1BGN A;  2PZS A;  1PJ6 A;  3CMM A;  1CJ4 A;  4Q4W 4;  4QX7 B;  2K9A A;  4OK0 A;  4EMW A;  2YWL A;  1JNZ A;  2UXB T;  2WM9 A;  5JDN A;  2NR4 A;  4ZZC A;  1P2H A;  4X1I E;  2AAQ A;  1MMG A;  3AXB A;  1FIO A;  3PO7 A;  2X8C A;  2X5I D;  3J8F 4;  4CCQ A;  5FY7 A;  4USR A;  1ZX9 A;  3NGC X;  4DV2 T;  4A5L A;  3SZW A;  2HPL A;  4C90 A;  2PFV A;  3RED A;  1FMW A;  2L9Q A;  3FPZ A;  4EV6 A;  1BR0 A;  2ZZB A;  4LF7 T;  4DV1 T;  3ISH A;  1GTE A;  4GIW A;  3GD4 A;  5HEJ A;  1IUV A;  4AOX A;  5FL1 A;  4FI5 A;  4ZI2 C;  4H9O C;  4WYV A;  2PJQ A;  2JRK A;  5HEG A;  3RC3 A;  4U8M A;  3QUJ A;  4JI4 T;  2CXL A;  4C3X A;  2JB1 A;  2XAJ B;  3FHN A;  5LG3 A;  4AKL A;  4ECH A;  2RGO A;  5GON E;  2CBJ A;  3FXD B;  3M12 A;  4CY8 A;  3V5U A;  2VVL G;  4EMJ A;  2VKH A;  5AQG B;  1YW0 A;  3MKD A;  2ZM2 A;  4JI3 T;  4QH5 A;  3NRN A;  3P7I A;  1PDH A;  1UKV G;  1OXZ A;  4PFO A;  1HNW T;  2IAK A;  5HXC A;  4HFV A;  4B3M T;  3AAI A;  4A79 A;  5KMG P;  4YFS A;  3C4Z A;  2Q9Q A;  4EGW A;  3VKG A;  3RP8 A;  2XQ5 A;  1YKJ A;  3CNS A;  2X9Y A;  3AE8 A;  2YQU A;  4BK1 A;  5ABH A;  1XZY A;  2V7I A;  4AQG A;  2XQ7 A;  4IE5 A;  2CWO A;  5KVI A;  2WOW A;  3CPZ A;  1D1B A;  2UXC T;  3FI7 A;  3G5Q A;  2E2A A;  1OED A;  1I6Z A;  4TNV A;  1W9R A;  3PTR B;  2QAE A;  1WR0 A;  3ANW B;  4JY3 A;  3K30 A;  3T2Y A;  1COV 4;  2LRL A;  4JI6 T;  4E7S A;  2C5I T;  3B3R A;  2GF3 A;  3OVU A;  4TLX A;  2D0U A;  3RH3 A;  2YEV C;  1V9D A;  5FS7 A;  3K3Q C;  2XFO A;  1IBK T;  3ALJ A;  2OLO A;  2KZ7 B;  4U72 A;  2JBV A;  4LFB T;  3AEG A;  4NXM T;  3GMI A;  2JPF A;  1TYP A;  5BRT A;  5FMN A;  2BRY A;  2K24 A;  2VKD A;  2X8H A;  3HKB E;  2GVC A;  4DR1 T;  1VCT A;  4CZZ B;  4PAA A;  4N9X A;  2Q9Q C;  2WWV A;  1NCQ D;  5M0Z A;  3AE7 A;  3KV4 A;  3UP4 A;  3LK4 2;  3MA9 A;  4JV5 T;  3O0H A;  3AA6 B;  2WS3 A;  3NWI A;  1KSS A;  4DV7 T;  1H83 A;  3HR0 A;  5KNL A;  1TYT A;  5AQR B;  3OYZ A;  1L9E A;  2WBA A;  3AAE B;  1M7K A;  3G06 A;  3RYF E;  4BAY B;  3L3P A;  3RYC E;  3AE1 A;  5LP6 E;  1VBA 4;  5FMH A;  4H9S E;  1H7C A;  3RYI E;  3ZMU B;  1PVC 4;  1D5T A;  2E4G A;  2EHO B;  3JC6 C;  2R0P A;  2YOE A;  4U8I A;  4ILU A;  1LRZ A;  3ZC1 A;  5HWY A;  5FXX A;  2WU5 A;  2XDO A;  3HKD E;  4TM1 A;  1OED E;  3N9M A;  2LEH A;  5E0O A;  4EZH A;  3AAA B;  3CTY A;  2ZMA A;  2LM9 A;  3FZK B;  2R4J A;  1R8I A;  3T31 A;  2X8G A;  2V6O A;  3UTK A;  1QLB A;  4A99 A;  5JDM A;  4B66 A;  4QKN A;  4UDR A;  3GMC A;  4TWF A;  1S3E A;  1PBF A;  3F8P A;  5BUK A;  3NTA A;  2K48 A;  1XMO T;  2MPK A;  1D4D A;  3ZYX A;  2WBL A;  3UKK A;  4JY2 A;  4NXN T;  4CI2 B;  1J5E T;  3G5R A;  5LGN B;  5CA0 E;  1IUX A;  5JCI A;  4UEL A;  4X20 E;  2JK6 A;  1KSU A;  3Q5D A;  1D0X A;  1NDA A;  2XM2 A;  4U33 A;  5AQU B;  3FBS A;  4OPT A;  2XY8 B;  2E9X D;  4JI7 T;  4U8N A;  1QJD A;  3EAM A;  3UQ7 A;  2CPT A;  3O1J A;  4Z2T A;  5J60 A;  3AYI A;  3ZYM A;  4EM4 A;  2CUL A;  4FK1 C;  4EIW A;  1GRH A;  2QA2 A;  3KD9 A;  2C70 A;  3RIU A;  5LG4 A;  2EQ9 A;  3SYI A;  4U2T A;  5FXZ A;  1RP0 A;  5J1G A;  2W66 A;  3GWF A;  4UXN B;  1NHQ A;  4CY6 A;  4G6H A;  4JNQ A;  3QVR A;  4J2W A;  3B6D A;  4IE7 A;  2YLS A;  2A8X A;  4APN A;  4BUR A;  1ZK7 A;  1PS9 A;  2E9X C;  3IHR A;  3VRB A;  2X0Y A;  3NYC A;  1LQU A;  3RKO A;  2DLR A;  3ZCI A;  3AEE A;  2XYO A;  1JEH A;  2XLR A;  1UK5 A;  3AE5 A;  3SQP A;  3EF6 A;  4IDN A;  4YLH A;  2ZZC A;  5AFU L;  3S5W A;  3K7M X;  3S4U A;  1ZOV A;  2GQF A;  1R08 4;  1NPX A;  1RUH 4;  5JR9 B;  2BG9 B;  2UXN B;  3C4N A;  2DHR A;  2C3C A;  4TWD A;  3ZKR A;  3RGL A;  2GAH B;  5AQS B;  4YJ3 E;  3FZF B;  3NT6 A;  4B65 A;  3OKQ A;  2XVE A;  2WMN A;  3RIU C;  3O1H A;  5C2T A;  3LDQ B;  2BC1 A;  2CBI A;  2J1D G;  2QYW A;  1W09 A;  2PYL A;  4I0U A;  4AKI A;  2EHO A;  4Z44 A;  2VKO A;  2B76 A;  3CX8 B;  3I9W A;  2W4X A;  1FEA A;  4EIQ A;  1HX8 A;  3JAD A;  4X5T A;  4O5Q A;  2YG6 A;  3AEB A;  5LB7 B;  4DV5 T;  2GQW A;  2UZZ A;  4FDC B;  1XNQ T;  4KPR A;  3IF9 A;  3M3Z B;  5GRT A;  1NWM X;  2BRA A;  3PUA A;  1PXC A;  5CJ5 A;  4WBN E;  5EK4 A;  3II4 A;  2B9X A;  2V6X A;  3KVB A;  4F6R C;  2RGJ A;  3SFE A;  4YSZ A;  4H63 H;  5JDF A;  1GRB A;  2W00 A;  3FZH B;  1Q1R A;  1OOP D;  5BR8 T;  1VRQ B;  1EV1 4;  3AA0 B;  3UU6 A;  1LVK A;  1MNE A;  2XUE A;  2BC0 A;  3K1S A;  5FKY A;  4NZH A;  2VQB A;  4LFC T;  2JB2 A;  4LF5 T;  2GRT A;  2BK5 A;  1VQW A;  5HHF A;  3EPT A;  2CWY A;  2ES0 A;  4NUV A;  3I9Y A;  1I94 T;  2V26 A;  1PO2 4;  3AD7 B;  3L39 A;  4A6N B;  3QJ4 A;  4DMW A;  4AI6 A;  1E2A A;  2PYJ A;  1RUD 4;  1S2Y A;  1L0V A;  2DKH A;  1OJC A;  4YKF A;  1BR4 A;  4EEB A;  4K8D A;  3DK9 A;  5FL0 A;  3ZC0 A;  1NEK A;  1XDI A;  4U2S A;  2K5B B;  1XNR T;  4NPP A;  4PJL A;  5JH7 E;  3ZLI A;  2D9D A;  5KX5 E;  5AQJ B;  3AE2 A;  4H9R C;  4G9K A;  4H9N C;  4G73 A;  2BVL A;  4ZN0 A;  1T7S A;  2WWU A;  2XQY A;  4KBM B;  4IE4 A;  3OBV E;  4DSG A;  4IT4 A;  4GK5 E;  4JYA T;  1VRB A;  1E1H B;  5H6R B;  3N9O A;  2P9B A;  4UR9 A;  4AIS A;  4OPG A;  3NYF A;  1GSN A;  2HQM A;  3NK0 X;  2EQ8 A;  4G74 A;  4EQS A;  4ZOL E;  2YK0 A;  3CIR A;  5L3B B;  2AE9 A;  1XDO A;  2WY2 A;  4OYK A;  1XAN A;  2IDO B;  4WX1 A;  4OFZ A;  4DVD A;  3T2Z A;  1LVF A;  4YT0 A;  5JR9 A;  2FJE A;  2BG9 A;  5DAB A;  2GAG B;  1D4C A;  1CUN A;  2QA1 A;  3EI0 A;  2LSJ A;  4Q4X 4;  3GQK A;  3N9N A;  3FIM B;  3T2K A;  4H4R A;  2X99 A;  1YQ4 A;  2LSI A;  4UVC B;  4GCM A;  3OC4 A;  1BF3 A;  2NOX A;  1T98 A;  3AB3 B;  2F4V T;  1SUM B;  4NEV A;  1WRD A;  1HG2 A;  4E0V A;  3P4W A;  2OLN A;  2WB5 A;  4USQ A;  3ALM A;  3FB2 A;  2GR3 A;  3GA8 A;  4ZI3 D;  4RSL A;  3QOF A;  2X67 A;  2XQ8 A;  1DOE A;  2C76 A;  1N4V A;  3PUS A;  2BZB A;  3I0Q A;  3F8R A;  3ZSS A;  3TLT A;  3VU7 H;  3C4X A;  4JEH B;  2V3A A;  3I1A A;  2LOS A;  4YTP A;  3X1D A;  3PUQ A;  2OA5 A;  2GR2 A;  1IAP A;  2Z5X A;  5JR9 C;  1GER A;  1OWA A;  1DOC A;  4LMJ A;  2YLZ A;  2BK3 A;  2DI4 A;  2XLS A;  5ER0 A;  2QVA A;  4X4J A;  3CGD A;  3DK4 A;  1VRH 4;  2YLX A;  2BKN A;  1DOB A;  5DBJ A;  3FXE B;  4PK6 A;  1GRT A;  5LJN A;  3HI2 A;  4GAV A;  1IJ5 A;  4A9W A;  4LF6 T;  3CML A;  2K3W A;  2QA7 A;  5FP3 A;  2LHR A;  4YXD A;  3ZT6 A;  2CFY A;  4TM4 A;  3ZMT B;  3LB8 A;  3PUX F;  4A56 A;  1PIV 4;  2PY5 A;  2NPX A;  4F8H A;  2CHN A;  2ACZ A;  3OPC A;  3DP7 A;  5JRC B;  1ZDL A;  4U8P A;  5FYM A;  2XFU A;  3GQH A;  4WZX A;  3JCF A;  3L8R A;  1B5Q A;  4EYY R;  2V3B A;  4LML A;  4PJM A;  1RUF 4;  1M64 A;  4DR2 T;  4D03 A;  5H6Q B;  2OV9 A;  3PUY F;  4X1Y E;  2N2N A;  2H89 A;  3SZC A;  2J3N A;  3P9U A;  3CQX C;  4B64 A;  1GXF A;  3ICR A;  1EL7 A;  3RRW A;  3VR8 A;  3Q9T A;  5J7X A;  5IQ4 A;  1CL0 A;  4I50 E;  3NN0 X;  4J57 A;  2QGS A;  2VUR A;  1HG5 A;  5AQM B;  1PN0 A;  4UVB B;  4MAL A;  3E22 E;  3TKL B;  1HFA A;  4U7I A;  4GYS A;  4JLE A;  3ZMZ B;  5AQT B;  4Z2R A;  5AQP B;  4O4L E;  3UU5 A;  2XHE B;  3RIF A;  2I59 A;  3CVR A;  4QH1 A;  3IWA A;  4IE0 A;  1XHC A;  3QC9 A;  4YTN A;  4EM3 A;  1J5W A;  3C51 A;  4P9S A;  5KMP A;  2YDR A;  4H9Q C;  3AEC A;  4HKA A;  3OTO T;  3SS1 A;  1EL9 A;  2X3N A;  3EAO A;  1FEB A;  5U63 A;  3SUC A;  4BJN A;  2CXF A;  1YQZ A;  4HN9 A;  2UXX B;  3KV6 A;  4IDQ A;  3CPI G;  5FS6 A;  1FEW A;  4L9I A;  2Y6R A;  2OAL A;  2BKP A;  1FL2 A;  2M6B A;  1PJ5 A;  4J36 A;  2C65 A;  4BA9 A;  1H7X A;  2X68 A;  4IST A;  4H4W A;  2W63 A;  1NHR A;  3DJD A;  4YHH T;  5A1L A;  4MBQ A;  1X31 B;  1UGO A;  3D8X A;  3UOX A;  3GDN A;  3CQG B;  3V76 A;  5AQV B;  3R6N A;  4I43 B;  2PHH A;  4QXB B;  1US7 B;  2DNX A;  2PG8 A;  3ONJ A;  4IDP A;  3SOL A;  5IPY A;  4AT2 A;  2APG A;  4GDE A;  3RPU A;  4EIP A;  2KWI B;  4LFA T;  3NHO X;  1VBC 4;  1RVF 4;  3T14 A;  2WPE A;  4TNW A;  3RF1 A;  1JOA A;  1ZMC A;  4H2P A;  4A65 A;  2E9X B;  5LJM A;  2V7M A;  4DV6 T;  1FCD A;  2LFC A;  3NNE A;  2TPR A;  3IF8 B;  2XAH B;  4U3C A;  2DKI A;  3J9X 1;  1MMN A;  4E7Z A;  4GF7 A;  5IQ1 A;  2YVF A;  1TDK A;  3H8I A;  2TMD A;  2Q7V A;  1VG0 A;  4NTD A;  3DJE A;  5JRC A;  1DU2 A;  3AEA A;  4N78 D;  3V5S A;  3O4X E;  3ZN1 B;  4OPL A;  2QCU A;  5JQG E;  3O9X A;  2LE8 A;  5KVH A;  4C91 A;  4YSY A;  4JI8 T;  1TDF A;  2XFP A;  5GSN A;  2A3D A;  2LOP A;  3KPK A;  4H2Q A;  2NWB A;  1PJ7 A;  2HN1 A;  2AQJ A;  2C7G A;  3MK7 C;  3NRY A;  1K0I A;  4Y4M A;  5JDQ A;  4PFP A;  5KOW A;  1Z0P A;  2BS4 A;  1ONF A;  4CN6 A;  3H37 A;  5C3J A;  3IHM A;  3S61 A;  5HXH A;  1E39 A;  4AIU A;  2YU1 A;  2WMO A;  2XAF B;  4H2R A;  2X0H A;  2VRM A;  1UUS A;  1GOS A;  3AXJ B;  2MAW A;  5KWF A;  2MYS A;  5LBQ B;  3LZX A;  3M0O A;  3GDP A;  3EDU A;  1B8S A;  4KHZ F;  2RS5 4;  3DA1 A;  4DMV A;  1N36 T;  4KX6 A;  4WNK A;  5LOV E;  5KRQ A;  2ODV A;  2LM2 A;  3URH A;  1WCR A;  2IIU A;  1MMD A;  2HWC 4;  2A72 A;  2VQE T;  1SHZ C;  3LZW A;  4OVI A;  2XAG B;  5TR3 A;  4UP3 A;  1UX4 A;  2XLP A;  4DSH A;  3T37 A;  1UUR A;  2D0T A;  2HN2 A;  4U74 A;  3RYH E;  1XI1 A;  1LPF A;  1S2Q A;  1IJH A;  1Y0P A; 
#chains in the Genus database with same CATH homology
 2GMJ A;  2IVE A;  1Y56 B;  1CJ3 A;  1F8S A;  3DME A;  3NT6 A;  1Q1W A;  4B65 A;  2XVE A;  1NAA A;  3QSE A;  4Y4N A;  5U25 A;  5KMR A;  1RYI A;  1MXT A;  4I59 A;  5C2T A;  2VVL A;  3C4A A;  1JRY A;  1E1M A;  1CF3 A;  2JKC A;  1Z6L A;  3UKQ A;  2BC1 A;  2XFQ A;  4RG3 A;  3V3N A;  4H4P A;  1F3P A;  1MO9 A;  3BNM A;  1EL5 A;  4EMI A;  2OAM A;  4Z44 A;  4Z43 A;  2B76 A;  4ICY A;  2YR4 A;  1FEA A;  4EIQ A;  4O5Q A;  2YG6 A;  1IUS A;  3D1C A;  3AEB A;  5JCM A;  2GQW A;  2UZZ A;  2VRL A;  4FDC B;  4FK1 A;  4KPR A;  3NTD A;  1JU2 A;  3M13 A;  3IF9 A;  4CCR A;  1VDC A;  5GRT A;  2BRA A;  3GSI A;  2WEU A;  3SXI A;  1PXC A;  4REK A;  2EQ7 A;  5FS9 A;  1GET A;  1QO8 A;  1PBD A;  1RSG A;  3II4 A;  2B9X A;  4K22 A;  2WP6 A;  2RGJ A;  2YR6 A;  2C73 A;  4IVO B;  3LJP A;  3P4S A;  5JCN A;  1B37 A;  2BCP A;  3SFE A;  4YSZ A;  1ELI A;  2IID A;  3FMW A;  3OZ2 A;  4JN9 A;  4II2 A;  1ZOY A;  1ZP0 A;  1GRB A;  3KVE A;  1BKW A;  4O5U A;  2R4E A;  3K7Q X;  2XVH A;  2VQ7 A;  2YM2 A;  1Q1R A;  4GRT A;  1VRQ B;  4H2N A;  3UOY A;  2PYX A;  3BNU A;  2ARD A;  3RNM A;  2WHD A;  5LV9 A;  2BC0 A;  1KNR A;  3C96 A;  4LII A;  1GAL A;  4NZH A;  2VQB A;  2Z5Y A;  4YKG A;  2JB2 A;  1H84 A;  2GRT A;  2Y6Q A;  2BK5 A;  1VQW A;  5HHF A;  2GB0 A;  3EPT A;  2IVD A;  3GRT A;  3UTE A;  1CJC A;  3SM8 A;  3COX A;  3VRD B;  4GAP A;  4K5S A;  2YVJ A;  4TLZ A;  3AD7 B;  5M10 A;  2CVJ A;  4A6N B;  2RGH A;  2GH5 A;  1KNP A;  3QJ4 A;  2RAB A;  4Z24 A;  4YSX A;  4K7Z A;  4A6N A;  1NHS A;  4XXG A;  3FG2 P;  1D7L A;  3ABV A;  4JNA A;  2B9W A;  1S2Y A;  4II3 A;  1L0V A;  3KKJ A;  2DKH A;  3AE3 A;  4GDP A;  4XWR A;  1OJC A;  1DOD A;  4PAB A;  3ALL A;  4AP3 A;  3F8D A;  3AWI A;  3GYI A;  4YKF A;  4DNA A;  4Z2U A;  4K8D A;  2JB3 A;  3ADA B;  3DK9 A;  2BXS A;  3GWD A;  4OPC A;  5HYM A;  4M52 A;  1NEK A;  1LJ1 A;  1XDI A;  2X50 A;  4U2S A;  4UDQ A;  2WDR A;  4Z25 A;  3SGL A;  3AEF A;  4MJW A;  2VZ2 A;  5CKU A;  4BJY A;  2XFN A;  1PHH A;  4EQW A;  4NWZ A;  3T0K A;  4CRT A;  2E5V A;  1JNR A;  4YSH A;  1KDG A;  2F5Z A;  2GV8 A;  2YVG A;  4U8J A;  3P1W A;  1F6M A;  3AE2 A;  1E1K A;  2WET A;  3KU9 A;  4G9K A;  2BA9 A;  4G73 A;  4ZN0 A;  2V60 A;  3ICT A;  1REO A;  1OJT A;  4K2X A;  1PBC A;  3GD3 A;  3HYW A;  4TM0 A;  5JCL A;  1KF6 A;  2WOV A;  4DSG A;  4X9N A;  4UDP A;  3UKL A;  3BI2 A;  3PS9 A;  3AE9 A;  3UP5 A;  4OCG A;  3ZDN A;  4D04 A;  1JRX A;  1L9C A;  3BI4 A;  4EQR A;  4OPG A;  3UTG A;  5BUL A;  3NYF A;  1GSN A;  4HA6 A;  4U2L A;  2H88 A;  3UOZ A;  2HQM A;  3NK0 X;  2EQ8 A;  4ADW A;  4IA6 A;  4G74 A;  4EQS A;  4HB9 A;  3CIR A;  1E6E A;  4YWO A;  1PXA A;  3QFB A;  1EL8 A;  4YTM A;  3DGH A;  2C64 A;  1D7Y A;  1XAN A;  2YLW A;  3AB1 A;  1GT8 A;  3E1T A;  4WX1 A;  2YAU A;  3DH9 A;  3T2Z A;  3QFA A;  4YT0 A;  4NEW A;  1PBE A;  2C3D A;  2YR5 A;  2FJE A;  3BHF A;  2GAG B;  1GRF A;  1D4C A;  2BK4 A;  1ZKQ A;  4NNJ A;  2QA1 A;  5KMS A;  1Y56 A;  3GQK A;  2R0G A;  3SY4 A;  2NVK X;  4AT0 A;  2WP9 A;  1OJ9 A;  3FIM B;  3T2K A;  1DJN A;  4H4R A;  5KMQ A;  3CNP A;  2X99 A;  3K7T A;  1H7W A;  1BGN A;  1YQ4 A;  1PJ6 A;  3CMM A;  1CJ4 A;  4GCM A;  3OC4 A;  1BF3 A;  2YG7 A;  3Q6J A;  3SX6 A;  4CNK A;  1CC2 A;  4EMW A;  2YWL A;  1JNZ A;  4J33 A;  3NK1 X;  2WPC A;  1P2H A;  2AAQ A;  4NEV A;  2ZZ0 A;  4DGK A;  3AD8 B;  3AXB A;  3PO7 A;  3P4P A;  2X8C A;  4IV9 A;  4H4Q A;  2WOI A;  4E0V A;  2OLN A;  4USQ A;  4CCQ A;  1TRB A;  3ALM A;  4USR A;  2GR3 A;  1ZX9 A;  3NGC X;  4RSL A;  2BS2 A;  4A5L A;  1NG4 A;  2VOU A;  3SZW A;  3UTF A;  3RED A;  3FPZ A;  1DOE A;  2C76 A;  4H4Z A;  1N4V A;  2ZZB A;  1HYU A;  3F8R A;  3GRS A;  4H4X A;  4H7U A;  1NHP A;  2XVJ A;  4ZCC A;  3ISH A;  1GTE A;  3GD4 A;  3EAN A;  1IUV A;  2V3A A;  3NYE A;  4H4T A;  4AOX A;  1H86 A;  4YTP A;  1CC4 A;  1TDO A;  1GRE A;  2Q0L A;  1F8W A;  2I0Z A;  4BJZ A;  3VRA A;  1SEZ A;  2R46 A;  3NG7 X;  4AP1 A;  3SZ0 A;  2GR2 A;  4Z26 A;  5U1O A;  2Z5X A;  1GER A;  3H8L A;  1DOC A;  2OA1 A;  2YLZ A;  2R9Z A;  2BK3 A;  2XLS A;  1LTX R;  2EQ6 A;  3CNT A;  4U8M A;  5ER0 A;  2V5Z A;  4X4J A;  3HZL A;  3CGD A;  3GYJ A;  2BAB A;  3DK4 A;  4C3X A;  1Q9I A;  2YLX A;  1DOB A;  1NG3 A;  2JB1 A;  3ATQ A;  5DBJ A;  3ATR A;  4ECH A;  2RGO A;  1GRT A;  2WU2 A;  4H4Y A;  4OPI A;  3M12 A;  4GAV A;  3UKH A;  4CY8 A;  4Y4L A;  3KA7 A;  2A89 A;  1AOG A;  4A9W A;  2VVL G;  4EMJ A;  4C5O A;  4A7A A;  3AED A;  3I3L A;  3VQR A;  4YXD A;  2C75 A;  3AE6 A;  2CFY A;  3NRN A;  3CGE A;  4TM4 A;  1GES A;  1H82 A;  1PDH A;  1H6V A;  3SFD A;  1UKV G;  3G5S A;  3NH3 X;  4U8O A;  3LB8 A;  4A79 A;  4IVM B;  2YLR A;  2NPX A;  3GYX A;  4OPU A;  3RP6 A;  5EOW A;  4ZCD A;  2ACZ A;  2BYB A;  2WP5 A;  4J34 A;  1ZDL A;  4U8P A;  3RP8 A;  4AOS A;  1YKJ A;  3CNS A;  3HYV A;  3UKP A;  3AE8 A;  2WDV A;  2YQU A;  2XFU A;  4BK1 A;  3GQH A;  3BHK A;  2R45 A;  1GRG A;  3IHG A;  3HYX A;  1B5Q A;  2V3B A;  3KLJ A;  3CGC A;  5KVI A;  2WOW A;  2B7R A;  3G5Q A;  1M64 A;  4JDR A;  1E1L A;  4D03 A;  2QAE A;  4H4S A;  3LAD A;  4JY3 A;  3VR9 A;  1GV4 A;  3K30 A;  3T2Y A;  2H89 A;  3SZC A;  2J3N A;  3P9U A;  4B64 A;  4TM3 A;  1GXF A;  1DXL A;  1IUW A;  3B3R A;  4LA1 A;  1TDN A;  2GF3 A;  3RP7 A;  1IUT A;  3ICR A;  1EL7 A;  1O5W A;  4TLX A;  3VR8 A;  2GEW A;  3Q9T A;  2VVM A;  4H4U A;  4K5R A;  2XLU A;  5J7X A;  5IQ4 A;  1CL0 A;  3NN0 X;  5FS7 A;  1PXB A;  2YG3 A;  2Q6U A;  3NIX A;  4J57 A;  2XFO A;  1PN0 A;  3ALJ A;  3UKF A;  3ITJ A;  2OLO A;  3SZF A;  4NTC A;  1FOH A;  2BCG G;  2JBV A;  2XCG A;  3L8K A;  1LV0 A;  2YM1 A;  3AEG A;  3AYJ A;  1TYP A;  5BRT A;  2BRY A;  4Z2R A;  4XWZ A;  4J56 A;  3DGZ A;  3GMB A;  2X8H A;  2GVC A;  2XLT A;  4C3Y A;  3IWA A;  3L1R A;  4PAA A;  3UOV A;  1K0J A;  1XHC A;  5EBK A;  4BV6 A;  4YTN A;  4CBQ A;  4EM3 A;  4N9X A;  1COY A;  2C66 A;  4P9S A;  1CJ2 A;  5KMP A;  5M0Z A;  3AE7 A;  4I58 A;  3UP4 A;  1MOK A;  2GR1 A;  2YG4 A;  3P4R A;  3AYL A;  3AEC A;  1EL9 A;  2X3N A;  3O0H A;  2WS3 A;  3EAO A;  1FEB A;  5BVA A;  1KSS A;  3WE0 A;  1H83 A;  5U63 A;  5KNL A;  3SUC A;  4GUV A;  3QSS A;  1TYT A;  1TDE A;  1YQZ A;  1PBB A;  1VG9 A;  1L9E A;  4B63 A;  2WBA A;  1ZMD A;  2ZBW A;  3CPI G;  5FS6 A;  3V3O A;  1EBD A;  1JRZ A;  2Y6R A;  3CND A;  3AE4 A;  1N4U A;  2C67 A;  2YLT A;  4BK3 A;  1XPQ A;  2OAL A;  2AR8 A;  2WDQ A;  3AE1 A;  4IA5 A;  1FL2 A;  5FMH A;  1PJ5 A;  4J36 A;  2C65 A;  1D5T A;  1P2E A;  2E4G A;  3BI5 A;  1DJQ A;  1H7X A;  3ICS A;  4H4W A;  2R0P A;  3IC9 A;  3NLC A;  4C77 A;  1N1P A;  5HY5 A;  1NHR A;  3DJD A;  2BXR A;  3QSM A;  4U8I A;  2C4C A;  1X31 B;  3D8X A;  3UOX A;  3GDN A;  3V76 A;  5HXI A;  2O9Z A;  2WU5 A;  1GRA A;  2XDO A;  1BGJ A;  2PHH A;  4BK2 A;  4TM1 A;  2E1M A;  3DJJ A;  3CTY A;  4G6G A;  1H81 A;  1GTH A;  3R9U A;  3UKA A;  5IPY A;  4AT2 A;  2APG A;  2R4J A;  4GDE A;  1ZY8 A;  3T31 A;  3NHO X;  2X8G A;  3CPH G;  2V6O A;  4EIP A;  4EQX A;  3QVP A;  1K4Q A;  1QLB A;  4A99 A;  4B66 A;  3T14 A;  1FEC A;  2WPE A;  1E7P A;  4U8L A;  4UDR A;  4H4V A;  3GMC A;  1CC6 A;  1S3E A;  1PBF A;  1JOA A;  1ZMC A;  3F8P A;  1CBO A;  4H2P A;  3H4K A;  4NTE A;  5BUK A;  3NTA A;  1NEN A;  1FCD A;  2W0H A;  3KPF A;  2FBW A;  4A65 A;  2LFC A;  3NNE A;  2TPR A;  4B69 A;  1GND A;  1M6I A;  2YG5 A;  1S3B A;  1O94 A;  1D4D A;  3ZYX A;  2C72 A;  3UKK A;  2B9Y A;  2DKI A;  2FJA A;  1BWC A;  4JY2 A;  4GF7 A;  3G5R A;  5IQ1 A;  2YVF A;  2V61 A;  5EB4 A;  5FS8 A;  1IUX A;  1TDK A;  4FX9 A;  5JCI A;  3H8I A;  1IUU A;  1N4W A;  2JK6 A;  1KSU A;  2TMD A;  3CPJ G;  4H50 A;  4U8K A;  5EB5 A;  2Q7V A;  1W4X A;  3UCL A;  1V59 A;  1VG0 A;  4NTD A;  2CDU A;  5CQF A;  1L9D A;  3DJE A;  1YY5 A;  3NN6 X;  3AEA A;  3LOV A;  1NDA A;  3FBS A;  2BS3 A;  4OPT A;  2A87 A;  4U8N A;  4B1B A;  1F8R A;  1GPE A;  3DK8 A;  1QJD A;  2QCU A;  4OPL A;  2R0C A;  5KVH A;  2FJB A;  4YSY A;  3JSK A;  1TDF A;  2XFP A;  5GSN A;  1CHU A;  3KPK A;  2GMH A;  3AYI A;  4H2Q A;  1LVL A;  4LU6 A;  4Z2T A;  5J60 A;  4EM4 A;  2CUL A;  5KOX A;  4FK1 C;  1GRH A;  2QA2 A;  3KD9 A;  1PJ7 A;  2C70 A;  1D4E A;  2AQJ A;  2WPF A;  2C7G A;  1K0I A;  2EQ9 A;  3SYI A;  4U2T A;  3CGB A;  1RP0 A;  4Y4M A;  5L46 A;  5KOW A;  2FJD A;  1ONF A;  2BS4 A;  3GWF A;  1GEU A;  5C3J A;  2Q0K A;  3IHM A;  1E1N A;  1NHQ A;  4G6H A;  3S61 A;  4CY6 A;  1E39 A;  3LXD A;  4JNQ A;  4X9M A;  1LQT A;  1KFY A;  3QVR A;  4H2R A;  2VRM A;  1GOS A;  4J2W A;  3B6D A;  4B67 A;  3CN8 A;  3I6D A;  2YLS A;  5KWF A;  2A8X A;  3P4Q A;  2WES A;  2XVI A;  4APN A;  2XVF A;  3LZX A;  3M0O A;  3RHA A;  4BUR A;  3UTH A;  5JCK A;  3GDP A;  1B8S A;  2JAE A;  3NK2 X;  2WQY A;  3DA1 A;  1ZK7 A;  4KX6 A;  1PS9 A;  3PVC A;  1O95 A;  1YQ3 A;  3VRB A;  3NYC A;  3CNJ A;  5KRQ A;  1LQU A;  2XYO A;  5KXJ A;  3NKS A;  3AEE A;  4RG4 A;  3URH A;  4C74 A;  1JEH A;  1OJD A;  2XLR A;  3AE5 A;  3SQP A;  3EF6 A;  4B68 A;  2ZZC A;  2GR0 A;  4OPD A;  3S5W A;  1BZL A;  3K7M X;  2B7S A;  3AD9 B;  1ZOV A;  2GQF A;  4J31 A;  3LZW A;  4OVI A;  1B4V A;  4JQ9 A;  1NPX A;  5TR3 A;  4UP3 A;  2XLP A;  1K0L A;  2BAC A;  4DSH A;  3T37 A;  3C4N A;  4GR1 A;  2C3C A;  1OJA A;  1LPF A;  3DJG X;  4WCT A;  1S2Q A;  1IJH A;  2GAH B;  1Y0P A;  4CNJ A;  1DNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...