3VR8A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 206
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr8A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr8A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr8A04
1KFYA 4K22A 4K7ZA 1GRTA 1LPFA 3Q9TA 3RP7A 3V76A 3M0OA 2Z5XA 3LJPA 4TM0A 2GB0A 1BF3A 2HQMA 1CHUA 3P4SA 2QA2A 1K0JA 1COYA 4OCGA 2R0PA 2ZZ0A 2XYOA 5J60A 1M64A 1VDCA 1CC2A 1O95A 3GSIA 2C3CA 3CIRA 1NHRA 2OA1A 3KU9A 2VZ2A 4C74A 4AT2A 1PJ5A 1L9DA 3GWFA 1JRZA 1XANA 4XWRA 1D7LA 4CNKA 5BULA 3NYEA 2R4JA 2WQYA 1NHPA 4YKFA 1X31B 3D8XA 2C70A 2YG7A 1PN0A 5BUKA 4GCMA 2C3DA 4LU6A 4ZN0A 2C76A 2OLOA 4K8DA 4BK2A 3AEEA 3ICTA 4U8IA 1FCDA 1Q1RA 2WEUA 2YLZA 1Y56B 4C3XA 4XXGA 1CC6A 2BACA 1PBEA 1TDEA 3HZLA 2O9ZA 3KVEA 2WPCA 4GDEA 1VRQB 2XLRA 3IC9A 1B5QA 4A6NB 4H4RA 1PBCA 4PAAA 3QFAA 5GSNA 1GSNA 5L46A 2XFNA 4H4YA 4U2SA 2X3NA 3NN6X 1XPQA 4B63A 2BA9A 3DGZA 4IV9A 2Q7VA 4GF7A 4BV6A 3ZYXA 3G5RA 3GWDA 2WOVA 1JOAA 4U8NA 1DXLA 2XFUA 4YTPA 2J3NA 4TLZA 3LZWA 1M6IA 2FJEA 2EQ8A 4FDCB 3NK0X 4I59A 2OAMA 2YLTA 2Q0KA 2XDOA 4M52A 1DOBA 2GAHB 3M12A 1CC4A 4TM3A 2E1MA 3ADAB 2FBWA 5FS9A 3UOZA 2Y6RA 1NHQA 4NEVA 4C5OA 1K0LA 4U8KA 1NAAA 2BK4A 3CNDA 4PABA 4BJYA 2YG4A 3UP5A 1FL2A 2ZBWA 1OJCA 1VG0A 1B4VA 3KKJA 3AE4A 2AQJA 4TM1A 1GRHA 2I0ZA 2BS3A 3B3RA 2CDUA 1DOCA 1PJ7A 2H88A 1LQUA 2RGOA 4ZCDA 4H4SA 1GRBA 5IQ1A 3S5WA 4AOXA 1NEKA 1CJCA 4H4WA 3CNTA 3KA7A 4H2PA 1Y56A 3L8KA 3C4NA 1L9CA 3UOXA 2WP5A 3UKAA 5EB5A 1ZDLA 1MOKA 1GALA 1PBDA 5KOXA 2R0CA 3FBSA 1YQ3A 3I3LA 1GOSA 3FPZA 1H6VA 1F8WA 3SFEA 2GRTA 1UKVG 4Z25A 1DOEA 3LB8A 5IPYA 3AEAA 3GRTA 2YAUA 4H2NA 3NNEA 3SGLA 1KNRA 3T37A 4Z26A 4U8MA 1E1KA 4XWZA 1H82A 3S61A 4YTNA 2GR3A 5CKUA 1LV0A 4NTCA 4JY2A 2JB3A 2YQUA 3KLJA 5KOWA 4JY3A 3UTEA 1EL9A 1GETA 3AE9A 2AR8A 3NTDA 4RSLA 5ER0A 3WE0A 4YTMA 2GR1A 2XLUA 4B66A 4KX6A 4IA6A 2WP9A 1F8SA 2BCPA 4LA1A 4P9SA 3DMEA 4Y4LA 1NDAA 2GVCA 4I58A 3K7TA 4IA5A 4J36A 4RG3A 5JCNA 3AE7A 3H4KA 2WS3A 1DJNA 2B9XA 2BYBA 3UKLA 1RYIA 5HY5A 3NH3X 3CGEA 4OPDA 3BI5A 1RSGA 4J31A 4A99A 1IUVA 1NG3A 2VRMA 1YQ4A 1ZOYA 1EL8A 1OJDA 3EPTA 4IVOB 4FK1C 1GNDA 2R9ZA 5KVHA 3FIMB 4D04A 2WPEA 1FEBA 4Z2UA 2WU2A 2YR4A 1YY5A 1YKJA 2YG3A 1ONFA 1P2HA 3GQKA 1CJ4A 4JNAA 4DNAA 3ALMA 4J2WA 4CCRA 4TLXA 1SEZA 1GERA 1QJDA 2GF3A 3AYJA 2VVMA 3BNMA 1H83A 3GMCA 1OJTA 2NVKX 4EM4A 3DA1A 1GXFA 2XFQA 3CPHG 4J56A 2DKHA 5FS6A 4EQXA 1L9EA 2FJBA 2JK6A 2YM2A 1L0VA 3GYXA 3SUCA 1IUSA 1K4QA 2VOUA 4B68A 1B8SA 4H2QA 1E6EA 3QSEA 1S3BA 3NLCA 1DNCA 1ZY8A 4EMJA 2H89A 1GPEA 4UDQA 3GYIA 4WX1A 4KPRA 4USRA 1RP0A 2YLXA 4B64A 3DJGX 1PS9A 2C73A 3V3OA 3CNPA 5DBJA 3BHFA 2GQFA 4OPCA 5BVAA 2R0GA 3P1WA 3P9UA 2GEWA 1E1NA 1E1LA 3GDPA 3UCLA 2GR0A 4H4UA 4H4QA 4U8OA 2XLPA 3EANA 1IUXA 2JB2A 3C96A 2XFOA 3QJ4A 5FS8A 4OPGA 3CTYA 4Z43A 3G5SA 2V6OA 3VQRA 1IUWA 2C72A 1ZP0A 1FOHA 2F5ZA 4JDRA 4X4JA 2PHHA 1REOA 3LXDA 3AYIA 3UKHA 1BZLA 1DJQA 3AEBA 2TPRA 4H2RA 1TRBA 2Y6QA 4LIIA 1JRXA 2QAEA 4GUVA 3SQPA 4A5LA 3K7MX 4BJZA 2YLWA 3AXBA 3UKFA 3K7QX 4YSXA 4IVMB 1H7XA 1E39A 4EQSA 4DSGA 4K5RA 2GMHA 4N9XA 3AEGA 1N4VA 2XVFA 3LZXA 4U2TA 4B67A 1O94A 1PDHA 4CY6A 1TDKA 5C2TA 3CN8A 1CJ2A 2CULA 3PO7A 4JQ9A 1N1PA 4H4XA 2VRLA 3F8PA 1MXTA 1ZMCA 3ATQA 1Q9IA 1JNRA 3II4A 2PYXA 3AE1A 1KSUA 5U25A 5FS7A 2WOIA 2B9WA 1KF6A 2XLSA 3IWAA 2BABA 2B7SA 3OZ2A 4UDPA 2GR2A 1P2EA 2GH5A 4JNQA 2DKIA 4YSZA 3VRAA 4CNJA 2UZZA 2OALA 4GR1A 1CJ3A 1S2YA 1D5TA 3V3NA 1ZMDA 3QVPA 3KPFA 2LFCA 2E4GA 3DGHA 3DH9A 4EM3A 2YLSA 4K2XA 3CGCA 5KVIA 2A89A 4Z24A 1MO9A 5HHFA 2EQ7A 3NT6A 3DK9A 3NIXA 4H4ZA 2IVDA 2B76A 3AECA 1PXCA 2WESA 2C7GA 2C75A 3E1TA 2EQ9A 2WDVA 4OPLA 3JSKA 3AD9B 2BK5A 4U8LA 4EQWA 1PXBA 2QA1A 1HYUA 3SFDA 1GT8A 2YVFA 3AWIA 2BC1A 1TDFA 1W4XA 3QFBA 2R4EA 1KSSA 2RGJA 3IF9A 1TDNA 4J34A 1FEAA 1GREA 1ZOVA 4K5SA 3UKQA 3FG2P 4A65A 3NRNA 1PBBA 3EF6A 2QCUA 2W0HA 2BK3A 4U8PA 3D1CA 5KXJA 1O5WA 1LJ1A 1IUTA 3CNJA 4FX9A 4H4PA 3VRBA 1F6MA 3CPJG 3REDA 4ADWA 4DSHA 5M10A 1N4WA 2YVJA 4YSHA 2ACZA 3R9UA 3AE8A 3LOVA 3I6DA 4NZHA 4X9NA 5J7XA 4AP1A 1PJ6A 3H8LA 4BURA 2YWLA 4J57A 3Q6JA 1JEHA 1GRGA 5JCLA 3RHAA 1GTEA 1KDGA 5HYMA 1ZKQA 1CF3A 2Q6UA 3ISHA 3IHMA 2CFYA 2XLTA 4NTEA 4Y4MA 3VR9A 1IUUA 1H7WA 3ZDNA 1BGNA 2V5ZA 3ALLA 3B6DA 3BNUA 3F8DA 3AYLA 3CGDA 3VR8A 2ZZCA 3P4QA 3PVCA 4USQA 4WCTA 2V3AA 5CQFA 5M0ZA 3RP8A 3DK4A 4C3YA 4REKA 3UOVA 2V3BA 2CVJA 2VQBA 4Z2TA 2XFPA 1EL7A 3QVRA 3BHKA 1BWCA 4ECHA 2WOWA 3BI2A 1QLBA 1LVLA 2BS4A 5FMHA 2WP6A 4BK1A 4GRTA 2C66A 2X8GA 4RG4A 3UKPA 5KRQA 1BKWA 3AEDA 2RABA 2VVLG 1ZX9A 1ELIA 2BXRA 1H81A 1H86A 3DJDA 5EB4A 4FK1A 2C65A 3CPIG 1F3PA 1Z6LA 2YG5A 3NN0X 3UTGA 4CY8A 3COXA 1VG9A 2BXSA 2WU5A 4YSYA 3CGBA 4UP3A 4DGKA 2R45A 3VRDB 1B37A 2XVJA 4O5UA 3L1RA 4EMWA 3NYCA 5JCIA 1OJAA 1H84A 1D4CA 3FMWA 3KD9A 4YWOA 5C3JA 1NENA 4U8JA 3DJEA 4H4TA 2GQWA 1IJHA 2X8CA 4MJWA 3GRSA 4HB9A 2Q0LA 3UP4A 2EQ6A 2V61A 2BS2A 5KWFA 3O0HA 1GEUA 3NG7X 3URHA 3AB1A 2OLNA 2NPXA 4OVIA 4B65A 2WHDA 2X99A 2YG6A 5EOWA 4YXDA 3DK8A 4ZCCA 2YR6A 1BGJA 2V60A 2AAQA 2IIDA 3AE6A 1JRYA 4B1BA 2ARDA 2R46A 3RP6A 2WPFA 2YLRA 2WETA 4A7AA 1NG4A 2B7RA 1PHHA 2YM1A 3QSSA 4A79A 4AOSA 1XHCA 2C64A 1F8RA 5TR3A 1E7PA 4AP3A 4YKGA 3IHGA 2FJAA 3RNMA 4CRTA 2GMJA 3P4PA 3GYJA 3NYFA 4OPUA 4Z2RA 2YR5A 3DJJA 2A8XA 2WDQA 1CL0A 2XVIA 4H7UA 3AE2A 2JBVA 3M13A 3NK1X 3CNSA 3NK2X 3NKSA 2E5VA 4GDPA 3UKKA 4X9MA 4TM4A 2C67A 2ZZBA 1VQWA 5EBKA 4D03A 5HXIA 1Q1WA 1TYPA 2GAGB 1V59A 4HA6A 4H4VA 4O5QA 1XDIA 4Z44A 4A9WA 3G5QA 3UTFA 2TMDA 3ALJA 3NTAA 4NEWA 4Y4NA 2VVLA 1CBOA 4C77A 4E0VA 3AE5A 2JAEA 4EIPA 3ABVA 1D4DA 1OJ9A 1Y0PA 1PXAA 3F8RA 2BC0A 4EQRA 1N4UA 3H8IA 3AE3A 1EBDA 3C4AA 4A6NA 4YT0A 3K30A 3P4RA 1DODA 1JU2A 3GD4A 5IQ4A 1GTHA 2GV8A 4H50A 4OPIA 4EIQA 3AD8B 3GMBA 1QO8A 5U63A 1PBFA 3OC4A 1E1MA 3GDNA 4OPTA 3AD7B 4CBQA 2YVGA 4CCQA 2X8HA 1GESA 3ITJA 4UDRA 1TYTA 2RGHA 2Z5YA 4U2LA 1TDOA 3ATRA 2XVHA 4J33A 3NGCX 1K0IA 3ICSA 5BRTA 2JKCA 2FJDA 3ICRA 5LV9A 2A87A 2JB1A 2X50A 2XCGA 3GD3A 3NHOX 1NHSA 1YQZA 1LQTA 1JNZA 1GRFA 2XVEA 3UOYA 3GQHA 4ICYA 4BK3A 3SM8A 1S3EA 3QSMA 1GRAA 2WDRA 1D4EA 2VQ7A 3EAOA 1KNPA 1S2QA 1D7YA 2BCGG 2WBAA 3PS9A 1EL5A 4B69A 1GV4A 2APGA 5JCKA 3BI4A 1NPXA 2B9YA 5JCMA 1LTXR 3LADA 4NTDA 2IVEA 3UTHA 4APNA 1AOGA 4AT0A 3AEFA 4EMIA 1FECA 5U1OA 4JN9A 5GRTA 1ZK7A
chains in the Genus database with same CATH superfamily
4K22A 1NCQD 3O1HA 3V76A 5L3DB 4TM0A 1VBA4 4HFHA 1VBB4 2A2FX 3GN5B 1CHUA 2Z6EA 2QA2A 4EXTA 1K0JA 3PUQA 3AAIA 1M64A 1O95A 3GSIA 4DR1T 2CMRA 4TN7B 1L9DA 2WCAA 3BQLA 1YXRA 5BULA 3L39A 1NHPA 2YINA 2EHOA 4GIWA 3ZT7A 3OTOT 4PK4A 4H63V 2RMU4 2C76A 2OLOA 2W00A 4WBOA 2W2UA 4U8IA 4IIJE 3CKDA 1ASJ4 1FJGT 1PBEA 2NW7A 2XQYA 1VRQB 4QXHB 5GONE 2NOXA 4XBFB 3LJCA 1Y64B 2X9YA 3QFAA 1GSNA 4DUZT 3NN6X 4B63A 2CWYA 2BKNA 3HL6A 2C5IT 2BVLA 2J3NA 4O2BE 2LRLA 4HEAA 2Q0KA 5LYJE 5AQVB 4UF0A 3M12A 3JADA 1CC4A 2MBGA 3UOZA 5BR8T 1NHQA 3LK3B 4NEVA 5L3GB 1K0LA 3TLTA 1OEDE 2X68A 2M6IA 2YG4A 1FL2A 4JI7T 3RF1A 3UU4A 2LRKA 1B4VA 2JPFA 3KKJA 4JI2T 3B3RA 1PJ7A 5IQ1A 5JDLA 3T1HT 1CJCA 3CNTA 4JI6T 4H2PA 4ZZBA 3L8KA 3C4NA 2LT3A 4UXNB 1GALA 5KOXA 3I3LA 3AA1B 1GOSA 2WWUA 3W15B 4AI6A 4Z25A 4PFPA 3LK2B 3SZFA 4H2NA 1KNRA 5LGNB 3QC9A 1PVC4 4XWZA 3S61A 4YTNA 3O4XE 4DV7T 3AA0B 2XQ4A 3AA6B 2YQUA 2XSAA 3LBXA 3C51A 3PUSA 4QKNA 1EL9A 1GETA 3WE0A 2XLUA 4IA6A 4Y4LA 1NDAA 2JQKA 3K7TA 2HH7A 5JCNA 1M7KA 3ZJ2A 3H4KA 2WS3A 1DJNA 5HY5A 3WAKA 5BMVE 3BI5A 4J31A 5LHHB 1IUVA 1NG3A 1ZV4X 3MKDA 3PUWF 3UFEA 1YQ4A 4EB6E 1GNDA 3FIMB 3RQUA 4ERRA 2WU2A 4ZI2C 3RIAA 1ONFA 1P2HA 4JNAA 3ALMA 5JDFA 1SEZA 1QJDA 4K0UA 1UGOA 2GF3A 4QXBB 1H83A 4CI3B 3L09A 3PUZF 3CK6A 3VKHA 2XPKA 2DKHA 4EQXA 3SUCA 1K4QA 4UVAB 2VQFT 1B8SA 2VK9A 4OFZA 5AQUB 4AKHA 3K8PC 1ZY8A 2H89A 1PO14 1GPEA 5HWXA 4KPRA 2F4VT 1XMOT 3DJGX 2L3LA 3FBLA 4Z91A 4IDZA 5DBJA 4GAPA 3RPUA 3N2KE 5HEGA 3LFMA 1EAH4 1KNZA 4ZEYA 5FL0A 1E1LA 2LM9A 2X9HA 3C96A 3QJ4A 4OPGA 3CTYA 4Z43A 1W0BA 2LJLA 1EZ3A 1IUWA 2C72A 3VU7H 4UELA 4G63A 4TUYE 4UV9B 5HXHA 3RKGA 2BG9A 1SHZC 4LIIA 2XZEA 1JRXA 4A5LA 3K7MX 1M62A 3K7QX 3LK42 5FL1A 1H7XA 4AKIA 2NW9A 4GYRA 2VWAA 4EV6A 2E8IA 3LZXA 4B67A 4GB34 3OPCA 4EEBA 5FXWA 1TDKA 1NAFA 1AR84 3FZLB 3PO7A 2CULA 2P9BA 1WLXA 1MXTA 5JTGA 1VRH4 3II4A 1JNRA 3HI2A 3AE1A 1KF6A 2BKPA 3NBXX 1D0ZA 2LKHA 4GOUA 3IWAA 3OZ2A 3RI5A 4PNIA 2E2AA 3ZEFB 4YSZA 3J9X1 4P0AA 3DGHA 1XHZA 4NXMT 2BRYA 5KNLA 3NT6A 4P1NA 1HS7A 4DO0A 5J1GA 1PXCA 2C75A 3E1TA 3AD9B 3I9YA 4U8LA 4EQWA 2QA1A 1RUD4 5JR9B 3IF9A 5AQSB 3RQWA 3UKQA 3EF6A 2W0HA 4FX9A 4H4PA 1IUTA 1T7SA 3VRBA 4DSHA 2ACZA 3R9UA 3AE8A 2XAQB 4GYSA 4I43B 2CM0A 4NZHA 1N36T 3Q5DA 3JC6C 3MXZA 1WCRA 4J57A 5JDHA 1UX5A 1CF3A 5AQOB 1UURA 2KXPB 3IHMA 1IAPA 2XLTA 1U4QA 3ZDNA 2Y48B 3F8DA 3AYLA 3CGDA 5M0ZA 3RP8A 4AXPA 4REKA 5LHIB 2VQBA 4DR5T 4Z2TA 4H9PC 3BHKA 2H7VC 4QX8B 3BI2A 1QLBA 2BS4A 2X5ID 4BK1A 5AFUL 4RG4A 4F6RC 5KRQA 4ILUA 2LSYA 2RABA 5ETWA 1ELIA 2BXRA 1H81A 3DJDA 2JMHA 4FK1A 5EB4A 5C8YE 3OYXA 1N33T 2BXSA 3ZMUB 4YSYA 4UP3A 4DGKA 2R45A 4O5UA 4II3A 5JCIA 5JVDE 1H84A 2LSIA 2UXDT 3BQIA 2V7MA 2ZM8A 2X8CA 4MJWA 2VASA 2Q0LA 5L3BB 2BS2A 1GEUA 3NG7X 2KT9A 3R84B 1D1CA 4OVIA 4ZI3D 3HKDE 3DK8A 1BGJA 2Y6XA 2J1DG 5HXSA 1XDOA 3RP6A 1U5PA 2WPFA 2YLRA 4A7AA 2B7RA 4AOSA 4CZZB 4FI5A 1XHCA 1F8RA 5TR3A 2V6XA 4AP3A 4YKGA 2D2SA 2FJAA 3RNMA 3GN5A 2YKSA 2GMJA 3GYJA 3NYFA 4TWDA 5JDMA 3DJJA 4G9KA 1CL0A 2XVIA 2UUBT 3AE2A 3M13A 3NKSA 4YHHT 4DV1T 4JYAT 4TM4A 1VQWA 1MQTD 3P7IA 1SA0E 1TYPA 3I1AA 2GAGB 1XDIA 3NRYA 5DJQC 4AQGA 3G5QA 4AKLA 3KVBA 3NTAA 4Y4NA 5KX5E 2KNDA 3AE5A 2UXBT 3L3PA 1Y0PA 3F8RA 4IDQA 4MBQA 3RYHE 4LMJA 1POV0 3AE3A 4OYJA 1JU2A 3RHWA 5ABFB 4H50A 3N2GE 1BEV4 2JRKA 1J1JA 3VHLA 1S94A 5CA1E 1PBFA 1E1MA 4TV9E 3OC4A 2R064 1VCSA 4PJJA 2Z5YA 2BDEA 2WB5A 2RR14 4J33A 3SRZA 3CVRA 5FP3A 2JQHA 3NHOX 1YQZA 4O2AE 1GRFA 5FVKA 4LF4T 2XVEA 2VKJA 5AQFB 4MALA 2DL1A 2J62A 3SM8A 3PU8A 3ETVA 3C50A 3Q5WA 2JQQA 2XQ5A 2JJ9A 3IBPA 3C4XA 3PU3A 4Z90A 3UTHA 3AEFA 4O4LE 2BZBA 1FECA 4JN9A 1KFYA 4H9SE 4X5TA 1GRTA 3Q9TA 1EV14 3LJPA 4HWIB 4U74A 3P4SA 3PUAA 3RYFE 4G2AA 5KMPA 2PYLA 1WRDA 4X64T 2R0PA 5J60A 1NHRA 1B7TA 2VKOA 3RKOA 3IF8B 1UX4A 5A1LA 1PJ5A 3UULA 3RIUA 3KV9A 1I94T 4JBWF 3CX7B 4CXWA 4E7ZA 4G74A 2C70A 3PE0A 5KMRA 4ZN0A 1RUF4 3QOFA 4BK2A 3AEEA 3ZN0B 4HFEA 1FCDA 2XAFB 5TAOA 1Y56B 4XXGA 4HWHA 2BACA 2YN6A 5DQVA 2V5CA 2HPLA 2WPCA 2PY5A 4ZXLA 1PBCA 3CX6B 5GSNA 2QVAA 3DGZA 2WSSV 4IV9A 1WR0A 2XY8B 3TLSA 3ZYXA 1HG2A 4TNWA 5AQLB 3G5RA 3GWDA 2WOVA 2Q9QB 3ANWB 1JOAA 3BK9A 2XFUA 2FJEA 4FDCB 3NK0X 4IDPA 4ZS3A 4I59A 3AXJB 2LSGA 4KP3C 3QK6A 1DOBA 2GAHB 4E7SA 4J2CA 4L0RA 5LGTB 4U8KA 1NAAA 2MAWA 2BK4A 3CNDA 4PABA 4BJYA 2CHNA 2CDUA 4UEMA 1LQUA 4ZCDA 4H4SA 1GRBA 1NEKA 5F3JA 2PFVA 3PUGA 3AAAB 5LOVE 1ZDLA 1MOKA 2R0CA 3FPZA 1H6VA 2KLQA 5IPYA 2X67A 1DOEA 3AEAA 5EK3A 1HX1B 3ETUA 5FKYA 1T72A 4NUUA 2H3RA 3T8OA 3T2KA 4JY2A 3M65A 4ADZA 3UTEA 2V7JA 3C4WA 3B57A 3AE9A 2AR8A 3NTDA 4RSLA 2DNXA 2WP9A 1F8SA 5AQHB 3DMEA 3K3NA 1BR4A 2I59A 3AE7A 2BYBA 3EHZA 3CGEA 3F57A 5CFBA 1EL8A 2XJ7A 3RIUC 2R9ZA 3ZYMA 4D04A 2DLRA 2B1EA 2I0MA 1YY5A 1G73A 1WFDA 3FB2A 4GAVA 3EVYA 4U2ZA 4CCRA 3JCFA 1GERA 4XZCA 1SE7A 3AYJA 5JQGE 2C4CA 2OA5A 1XNRT 4DV6T 2NVKX 3KINB 3DA1A 4J56A 4TV8E 2PW9A 5FS6A 4G6GA 2YM2A 4C91A 3OKQA 3KPKA 1QUUA 4B68A 1E6EA 3FZFB 1S3BA 3N2OA 5U1OA 1DNCA 4EMJA 4LF9T 3N5LA 3GYIA 2QGSA 3Q2MA 2N1GA 1IJ6A 2CXFA 5FMNA 4HWDA 5IUXA 1PS9A 3CMLA 2C73A 3V3OA 3CNPA 1ZHCA 4U31A 5BVAA 2XQ9A 4OPCA 3PTRB 5JR9A 2MOZA 1E1NA 3GDPA 2XLPA 3EANA 1IUXA 5LMNT 3G5SA 3ONLC 3T1YT 4MFRA 3VQRA 2K48A 2F5ZA 2PHHA 3A7MA 5ADXL 4IL4A 3AYIA 5AQGB 1BZLA 1ZKEA 1WYCA 2G0UA 2PTFA 2QAEA 2X51A 5ABGA 3SQPA 4COFA 3IHRA 2UXCT 2UXXB 4WZXA 3CQXC 2K9AA 4BAYB 2HN1A 2CLYB 2IHR1 4EOZB 2MTQA 1O94A 3RX6A 2EHOD 4ZI2D 1IBMT 4BJNA 4II2A 3ZKRA 4JEHB 4I50E 2V7KA 4DV0T 2VRLA 1ZMCA 4G73A 1Q9IA 5LB7B 4DBRA 4Q4Y4 2E5LT 5U25A 1T98A 2BABA 4UDPA 2GR2A 2GH5A 5DQWA 3VRAA 2UZZA 1OEDB 3GWHA 1S2YA 3V3NA 1ZMDA 1E2AA 2E4GA 4DR4T 3CGCA 4K2XA 2LSJA 2A89A 4Z24A 4YJ2E 3KBTA 2B76A 2IVDA 2BKOA 3CX8B 1H7CA 4HWCA 3AA7B 2EQ9A 5KMSA 5HXCA 2V6YA 4OPLA 2PG8A 4JI4T 1PXBA 3SFDA 4LF8T 2L9QA 2YVFA 2K3WA 2BC1A 1W4XA 3UUMA 3QFBA 3O1IA 3PJAA 1TDNA 4AKRB 1FEAA 4K5SA 2EHOC 2W66A 1SUMB 4Q25A 2BBHA 3RC8A 4JEUB 4JI1T 4U8PA 2V26A 2YVJA 4EZHA 3I6DA 4X9NA 4AP1A 3H8LA 2E9XB 5JR9C 1XHXA 2RS54 4CI1B 1GRGA 3DJBA 3SOLA 4KBMB 2ZM0A 4EYUA 3RHAA 3SXIA 5HYMA 3UFGA 3E22E 5HXRA 2Q6UA 3K1SA 1HNXT 1H7WA 1YD8G 3VR8A 4WCTA 5DABA 4DV4T 3DK4A 1D0XA 3KV4A 4C3YA 3FHNA 3F31A 2V3BA 3NKZA 5ABFA 2VKHA 1BWCA 4ISSA 4BA9A 1LVLA 1RUG4 4YY3T 2X8GA 2AE9A 2ES0A 3UKPA 3TKLB 2VVSA 1ZX9A 2VVLG 3TLUA 5H6QB 3CPIG 1Z6LA 1XNQT 3T2YA 1MMGA 2ZLYA 4CY8A 4L5GA 4NXNT 1B37A 3O9XA 3J8F4 3FMWA 3QNUA 1HXS4 4DBQA 4U8JA 3DJEA 2KWHA 4CN6A 4IL9A 3UP4A 3FXEB 3RRWA 5JRCB 3H37A 4B65A 1HFAA 2IIUA 2YG6A 5EOWA 4DV2T 4B3TT 4B1BA 2RP4A 1NG4A 4MLKA 2YM1A 2HPJA 3QSSA 4DV5T 5ABHA 3IHGA 4CRTA 5H6RB 2KSRA 3EDVA 3E08A 4H7UA 1W09A 2JBVA 3JC6D 3UKKA 1J5WA 2ZZBA 4QH4A 1Q1WA 4B3MT 3OVUA 4TWHA 3HYVA 3UTFA 2VVLA 2C0SA 3ZMZB 1E1HB 3UU5A 4A98A 4ZZCA 4EIPA 3HR0A 4IE5A 1IBLT 4IDNA 3ABVA 3N9LA 4ASKA 1OJ9A 2BC0A 1EBDA 3C4AA 4YT0A 2LE8A 2WZHA 4O4HE 2RM24 3GD4A 2GV8A 4OPIA 3AD8B 5U63A 3PUYF 2M6BA 1RUH4 2EX3A 5L3FB 2Q9QA 3ANWA 5L3EB 2YVGA 3HYWA 4CBQA 4BJMA 4NNJA 1HR0T 1GESA 2RGHA 4GK0E 1MNEA 5LHGB 4DV3T 2JMKA 4I55E 3NGCX 3ICSA 2FJDA 1LRZA 2JB1A 2D0TA 4EEDA 4H9NC 2I6HA 5IWAT 3TLWA 3ZC0A 1MMNA 3CPZA 3UOYA 3GQHA 4ICYA 1COV4 2X0LB 3FI7A 1S3EA 2WDRA 2W67A 2VQ7A 4DR7T 2BCGG 3PS9A 5JCKA 2A9UA 2VKDA 5JCMA 2VURA 4IE4A 4UIGA 4H9OC 1XWMA 4APNA 1AOGA 4AT0A 5GRTA 2BG9C 1ZK7A 4K7ZA 3MACA 2YDRA 3LDQB 4CQIA 5HCJA 1KK7A 3M0OA 2Z5XA 2GB0A 3N9OA 2ZZ0A 2CA5A 3ESLA 3P50A 4WYVA 1YKEB 2C3CA 3CIRA 3ZSTA 3KU9A 2VZ2A 4C74A 2C5KT 1D7LA 1MIWA 4CNKA 3RH3A 3NYEA 2R4JA 1W9RA 4P0BA 3RYCE 2CBIA 2WMNA 3B5MA 1X31B 1HF8A 1PN0A 5BUKA 4GCMA 4OHFA 1LKXA 2C3DA 4LU6A 2LSKA 3Q9DA 4F8HA 2YLZA 1BR2A 2BRAA 1DU2A 3HZLA 1RUJ4 3KVEA 1VCTA 2J47A 1B5QA 4A6NB 5FXVA 2PYJA 4ANJA 5L46A 2CE7A 2CEAA 4H4YA 2X3NA 2CCQA 2BA9A 2M67A 4Z8XA 3UU8A 2Q7VA 4PAGA 2UXNB 2PBIA 3ZLIA 4U8NA 4YTPA 1NWMX 3LZWA 3N9NA 2YLTA 1Y01A 5FY1A 4M1PA 4TM3A 2E1MA 4C5OA 4HN9A 3AB3B 2Q9QC 3UP5A 2XQ7A 1VG0A 3AE4A 4TM1A 1VBD4 2BS3A 4KI0F 2RS34 2QA7A 4GK5E 3KBUA 3KV6A 2WP5A 3UKAA 5JREA 5HAXA 3FBSA 3HKCE 1AR64 2GRTA 2YAUA 3PJAJ 3SWHA 3NNEA 1MIVA 2Y8DA 4U8MA 1E1KA 3OJAA 5AQRB 4GKKT 1H82A 2SPCA 5LG4A 2GR3A 5CKUA 1LV0A 4LMLA 2JB3A 5JDNA 2R6GF 5ER0A 5AQMB 3S4UA 2V7IA 4YTMA 1R084 2BG9E 1UCUA 4KX6A 3I9WA 4LA1A 4P9SA 2GVCA 3UU3A 4I58A 4J36A 4RG3A 3NVOA 2B9XA 1CUNA 1RYIA 2GK9A 3NH3X 5FXXA 1ZOYA 3EPTA 4FK1C 1MIYA 5KVHA 1HRV4 2WPEA 1FEBA 4Z2UA 4K0KT 1YKJA 2YG3A 1HNWT 4DNAA 2A3DA 4J2WA 2NP9A 3ZCIA 3N9QA 3VKGA 3HKEE 3BNMA 2VVMA 3ZN1B 4AQFA 1GXFA 1L9EA 1OEDA 2FJBA 2NWBA 2JK6A 4LF6T 3GYXA 5CJ5A 3TLVA 3J7Yq 2VOUA 4H2QA 4Q4V4 3NLCA 4HFBA 4YHJA 4UDQA 4USRA 1RP0A 4HFIA 3ZYKA 3BHFA 4JI5T 2GQFA 2R0GA 3SZWA 2ODUA 2QRXA 5E0OA 2NTYA 5HXEA 4EAHA 2ZM6T 4LF7T 4U8OA 4H4QA 4EMWA 4HWFA 2V6OA 3MA9A 4PW8A 1ZP0A 1FOHA 4JDRA 3F2EA 2FUPA 5HEOA 2R044 5LP6E 4DR3T 3I0OA 3LXDA 3UKHA 1D1BA 3AEBA 4OYKA 2E9XA 1RUI4 2Y6QA 3ONXA 3OYZA 2YLWA 2YOEA 4H9QC 2CHOA 4YSXA 4IVMB 1E39A 4DSGA 2GMHA 1YW0A 2QYWA 2XVFA 2XHEB 5IHYA 2BVMA 5FXZA 1Z7S4 5C2TA 3NZPA 5CGMA 1CJ2A 4JQ9A 2DI4A 4O8SA 3JD74 3SY4A 3MZKB 2KINB 4IE7A 5LGUB 4H4XA 3ONJA 1KSUA 5FS7A 1ZEEA 2B9WA 2WOIA 5HWYA 2XLSA 2B7SA 2IC6A 4JNQA 3UUXB 1P2EA 1WYBA 2XQ8A 3NWIA 2OALA 1D5TA 3QVPA 2LFCA 4EM3A 3DH9A 2YLSA 1IZNB 1AJ3A 3UUBA 3ZJ1A 1MO9A 2DHRA 2W61A 4LF5T 4H4ZA 2KWIB 1W0AA 4PK5A 4IREA 4UVBB 2WESA 4AQFC 2W4XA 4KHPT 2WDVA 5JRCA 1LVFA 5L4HA 4DVDA 4TX5A 1V9DA 3M3ZB 2NR4A 1GT8A 3AWIA 5J2TE 2UUCT 2LOSA 1KSSA 2RGJA 4J34A 3H3MA 3CQCB 5L2LA 2LHRA 1XMQT 1ZOVA 3UTKA 2UUAT 3PUVF 5LBQB 1PBBA 4JI8T 2BK3A 3D1CA 1N32T 5F5WA 3CNJA 2HHHT 3REDA 3UQ4A 1N4WA 2ODVA 5LJNA 1PJ6A 3P4WA 4CXYA 2NW8A 2YWLA 5LMUT 3Q6JA 1JEHA 3IEEA 2D5UA 5JCLA 1N34T 1GTEA 3C64A 2XAJB 3C98B 4TWFA 2CFYA 4NTEA 3O1JA 3VR9A 1IUUA 2X0HA 2N9DA 2V5ZA 2X0YA 3BNUA 5FY0A 5HCMA 2ZZCA 2R074 2E9XC 4KUMB 4HFCA 4NWZA 2CVJA 3HKBE 4JLEA 2IW5B 2XFPA 5CB4E 3QVRA 2LEHA 2WOWA 5FMHA 2WP6A 4GRTA 1OXZA 2V7LA 3AEDA 4P09A 1H86A 4JI0T 2K5BB 2C65A 2YG5A 3NN0X 4X65T 3CMMA 3L8RA 2MPKA 3VRDB 2XVJA 4U3CA 2C5JA 3L1RA 4B6XA 2RPAA 3FBZA 5CA0E 3FZKB 4H4TA 5KMGP 2GQWA 1IJHA 2HWC4 4DIDB 5LNKA 2EQ6A 2V61A 3O0HA 3URHA 3GA8A 1D1AA 3UUNA 4HKAA 2WHDA 4U7YA 4HFDA 2X99A 2VB6A 4YXDA 4ZCCA 2YR6A 2WY2A 2AAQA 2IIDA 3AE6A 2J4GA 3ZC1A 1JRYA 2ARDA 4IE6A 2WETA 1PHHA 3Q5EA 2C64A 4HFVA 2YU2A 3KDSE 1E7PA 2IAKA 4OPUA 3PDYA 4Z2RA 2YR5A 2AXDS 3NK1X 3CNSA 3T31A 4WW0A 4O4JE 2XM1A 4C90A 4D03A 5EBKA 5HXIA 4DMWA 1V59A 4HA6A 4H4VA 3ZT5A 3N9MA 3G06A 4O5QA 4NUVA 4TZ4C 2TMDA 1H8TD 1CBOA 4C77A 3QB5A 2JAEA 1HTJF 4UV8B 1PXAA 1HX8A 4EQRA 3NZQA 4A56A 4PJLA 3K3QC 4PJNA 4A6NA 3K30A 3P4RA 5JDGA 4V1Av 4CN1A 4KHZF 4EIQA 1R094 3I0QA 3GMBA 1QO8A 2HN2A 4OPTA 4PDWD 3AD7B 4EGWA 4CCQA 3WI3A 1XZYA 2D0UA 3ITJA 3UU6A 1TYTA 1VOMA 4U2LA 1TDOA 3ATRA 4I0UA 1K0IA 3SZ0A 2XQAA 4DMVA 2JKCA 3ICRA 4AQYT 2X50A 2XCGA 3GD3A 1NHSA 5FYMA 1LQTA 4MHCA 1OOPD 3WAJA 3EUHA 4BK3A 4GKJT 3QSMA 1KNPA 2WBAA 1D7YA 4CI2B 1EL5A 4U7IA 4X1KE 4ILAA 1GV4A 2APGA 4A97A 1NPXA 2PLV4 1LTXR 3LADA 4NTDA 4EMIA 4L9IA 3T0KA 3EABA 5EZYE 4IT4A 1LPFA 3RP7A 4IE0A 4HE8A 1BF3A 4JI3T 1T8BA 2HQMA 3FZMB 3BQKA 1COYA 4OCGA 2KMFA 2XYOA 1AR74 1VDCA 1CC2A 4LFCT 4DR6T 2OA1A 5LG3A 4AT2A 3GWFA 1JRZA 2DCFA 2YDQA 2LHNA 1XANA 3U3IA 4XWRA 5L47A 3EDUA 2WQYA 3ZMVB 4YKFA 4PFOA 4YLHA 4JV5T 3D8XA 2YG7A 5AQIB 1D0YA 4K8DA 4Q4W4 3P8CD 3ICTA 4XAXB 1Q1RA 2WEUA 2CXLA 3RLFF 4C3XA 1CC6A 1TDEA 2O9ZA 3ZT6A 4WNKA 4GDEA 2XLRA 3IC9A 3SYIA 4H4RA 5IYZE 1G8XA 4PAAA 3B13A 1K5MD 2WBLA 2XFNA 4U2SA 1XPQA 1HCIA 4YJ3E 4GF7A 3ZYLA 3HYXA 4BV6A 2LKGA 3DTOA 2OV9A 2LM2A 5LA6E 1DXLA 4B3ST 1WR6A 3FZHB 2IMLA 4TLZA 1M6IA 2EQ8A 1AL24 2OAMA 3T2ZA 5EK4A 2XQ6A 2XDOA 4M52A 4PJMA 4QWNB 2XUEA 2FBWA 3ADAB 5FS9A 2Y6RA 3RRCA 5LBMA 4X1YE 2DWGA 3ZMSB 2ZBWA 1OJCA 3LSVA 2AQJA 1GRHA 2I0ZA 4X1IE 1DOCA 2H88A 2RGOA 3S5WA 4FJOA 4AOXA 4H4WA 3KA7A 1Y56A 3UOXA 1L9CA 5EB5A 3C4ZA 3H3AA 4RHV4 1PBDA 1HNZT 1HG5A 1YQ3A 5AQPB 1F8WA 3SFEA 1UKVG 4TNVA 3LB8A 4QH5A 5FNVE 3GRTA 2PJQA 2XAGB 1LVKA 3SGLA 4Z26A 3T37A 3CWZB 3RYIE 3V5SA 1UK5A 4NTCA 5KOWA 3E0ZA 3KLJA 1IBKT 1Z8UA 4JY3A 4LFBT 1RUE4 1YKHB 4U72A 3UT5E 5J0ZA 3AXJA 1RVF4 2GR1A 4B3RT 2EHOB 2MYSA 4B66A 3T14A 2BCPA 5AQKB 4IA5A 4OK0A 3UKLA 4DUYT 4OPDA 1VBC4 1RSGA 4A99A 2VRMA 4IVOB 4I4TE 2XSBA 1OJDA 2YR4A 5FY7A 2D9DA 3GQKA 1CJ4A 3ZPOA 4TLXA 3SX6A 2LOPA 3GMCA 3JAFA 1GQEA 1OJTA 3DP7A 4EM4A 2XFQA 2ZM2A 3CPHG 2YDSA 5AQQB 4UF0B 4WBNE 4EZ4A 4X66T 4EIWA 1IJ5A 1L0VA 3AVSA 2XAHB 4YFSA 1IUSA 3CQGB 5HYAA 2Q9QD 4A5XA 5FVLA 2JQ9A 3QSEA 1PIV4 2RS14 2XASB 3N9PA 1X9BA 4WX1A 4KMCA 2YLXA 4B64A 3MJXA 2N2NA 4PK6A 1O3XA 2W62A 3AVRA 4DR2T 3P1WA 3P9UA 3EAMA 2GEWA 4QX7B 3X1DA 1BR1A 3UCLA 2GR0A 2LLYA 4H4UA 4ZS2A 2JB2A 5FS8A 2XFOA 3HA4A 2YU1A 2IDOB 4X4JA 1REOA 2PZSA 2VVNA 2V5DA 2H7OA 3LBXB 1MNDA 4X62T 1DJQA 2X9XA 4OX9T 4NPPA 2TPRA 4H2RA 1TRBA 4EYYR 1R8IA 3OBVE 3KVAA 4U33A 1J5ET 4GUVA 4BJZA 3ZSSA 4ZHQE 3AXBA 3UKFA 1HRI4 2V6YB 4IGUA 2WWVA 2HWB4 2DWKA 4EQSA 1QSDA 4K5RA 4N9XA 2WM9A 5AQNB 3AEGA 3QUJA 1N4VA 4U2TA 3SS1A 1RUC4 2CWOA 4G6HA 1PDHA 4CY6A 4ZI7E 3KFWX 3CN8A 1D4M4 1AR94 1N1PA 3F8PA 3A8YC 3U78A 5JH7E 3ATQA 2PYXA 4QXCB 4HTEA 1NA1D 1S35A 3JBG4 2BBJA 2DKIA 4CNJA 4GR1A 1CJ3A 3KPFA 4CN4A 1MMAA 5KVIA 3JAEA 3QB5K 2EQ7A 5HHFA 3RC3A 3DK9A 3NIXA 3UQ7A 1VRBA 3AECA 2C7GA 4X20E 4O4IE 2JIWA 3JSKA 2VL8A 2BK5A 1X79A 5HEUA 3PURA 1HYUA 3PV0F 4ZI3C 1TDFA 2V1DB 1XDPA 2R4EA 1BR0A 3SZCA 1GREA 4A65A 3FG2P 5L4EA 3EI0A 3NRNA 2QCUA 5HEHA 2K24A 5L3CB 5KXJA 1O5WA 1LJ1A 2VQET 5F8PA 1F6MA 5AQJB 4NIQA 3CPJG 4ADWA 5J2UE 5M10A 4YSHA 3IA3A 4UVCB 5M4YA 3LOVA 5J7XA 2BG9B 4BURA 2XTLA 5AQTB 4Q4X4 2CRBA 1KDGA 1ZKQA 3ISHA 4Y4MA 1BGNA 3B6DA 3ALLA 3P4QA 3PVCA 4USQA 1RMU4 2V3AA 5CQFA 4LFAT 4AISA 3UOVA 1EL7A 4ECHA 1Z0PA 4DNDA 2ACXA 5LJMA 3ZMTB 2C66A 3NRXA 4IDOA 1BKWA 2XQ3A 2RA1A 1F3PA 3UTGA 3COXA 1VG9A 2WU5A 3CGBA 2WMOA 3NYCA 1OJAA 1XI1A 1D4CA 2YEVC 3KD9A 4YWOA 5C3JA 4QHOA 1NENA 3GRSA 4HB9A 4ILBA 2W0GA 2WZIA 3A5XA 5KWFA 4AIUA 3AB1A 5LCYA 2OLNA 2NPXA 4JUYA 1FMWA 2KZ7B 2V60A 5EK2A 2R46A 4U2YA 3PUXF 3K3OA 4A79A 3LG7A 1OWAA 1FEWA 3V5UA 2CXDA 1KEYA 3P4PA 2CPTA 2X66A 3D0TA 2A8XA 2WDQA 3NK2X 1MMDA 2E5VA 4GDPA 3KV5A 2ZMAA 2CLYC 2V8SV 1VBE4 4X9MA 4HGAA 2C67A 2NTXA 1US7B 5LXTE 3MK7C 4Z44A 4A9WA 2X9WA 5KDMC 3ALJA 4E0VA 4NEWA 4QH1A 4LMKA 4AKGA 2E9XD 5HEJA 1D4DA 2CBJA 1N4UA 3H8IA 4ZOLE 1DODA 3RGLA 5IQ4A 1GTHA 1OEDC 1PO24 4IHJE 3GDNA 2W63A 3ZCJA 2IUBA 2X8HA 4CXXA 4UDRA 2YK0A 1UUSA 5ABEA 4H9RC 2XVHA 5KMQA 5BRTA 4H63H 3GMIA 5LV9A 2A87A 4ISTA 4UR9A 1FMVA 1RHI4 1JNZA 2WAUA 3R6NA 2OLTA 1GRAA 2A72A 1D4EA 2R7FA 2VL0A 3EAOA 1S2QA 1I6ZA 3Q5XA 4B69A 2IC9A 2L8KA 3BI4A 2B9YA 3AAEB 3FXDB 1FIOA 3RIFA 2IVEA 2XM2A 2UU9T 4ILCA 5JDQA 4N78D
chains in the Genus database with same CATH topology
1KFYA 4K22A 3T0KA 4K7ZA 1GRTA 1LPFA 3Q9TA 3RP7A 3V76A 3M0OA 2Z5XA 3LJPA 4TM0A 2GB0A 1BF3A 2HQMA 1CHUA 3P4SA 2QA2A 5KMPA 1K0JA 1COYA 4OCGA 2R0PA 2ZZ0A 2XYOA 5J60A 1M64A 1VDCA 1CC2A 1O95A 3GSIA 2C3CA 3CIRA 1NHRA 2OA1A 3KU9A 2VZ2A 4C74A 4AT2A 1PJ5A 1L9DA 3GWFA 1JRZA 1XANA 4XWRA 1D7LA 4CNKA 5BULA 3NYEA 2R4JA 2WQYA 1NHPA 4YKFA 4G74A 1X31B 3D8XA 2C70A 2YG7A 5KMRA 1PN0A 5BUKA 4GCMA 2C3DA 4LU6A 4ZN0A 2C76A 2OLOA 4K8DA 4BK2A 3AEEA 3ICTA 4U8IA 1FCDA 1Q1RA 2WEUA 2YLZA 1Y56B 4C3XA 2BRAA 4XXGA 1CC6A 2BACA 1PBEA 1TDEA 3HZLA 2O9ZA 3KVEA 2WPCA 4GDEA 1VRQB 2XLRA 3IC9A 3SYIA 1B5QA 4A6NB 4H4RA 1PBCA 4PAAA 3QFAA 5GSNA 1GSNA 5L46A 2XFNA 4H4YA 4U2SA 2X3NA 3NN6X 1XPQA 4B63A 2BA9A 3DGZA 4IV9A 2Q7VA 4GF7A 3HYXA 4BV6A 3ZYXA 3G5RA 3GWDA 2WOVA 1JOAA 4U8NA 1DXLA 2XFUA 4YTPA 2J3NA 4TLZA 3LZWA 1M6IA 2FJEA 2EQ8A 4FDCB 3NK0X 4I59A 2OAMA 2YLTA 3T2ZA 2Q0KA 2XDOA 4M52A 1DOBA 2GAHB 3M12A 1CC4A 4TM3A 2E1MA 3ADAB 2FBWA 5FS9A 3UOZA 2Y6RA 1NHQA 4NEVA 4C5OA 1K0LA 4U8KA 1NAAA 2BK4A 3CNDA 4PABA 4BJYA 2YG4A 3UP5A 1FL2A 2ZBWA 1OJCA 1VG0A 1B4VA 3KKJA 3AE4A 2AQJA 4TM1A 1GRHA 2I0ZA 2BS3A 3B3RA 2CDUA 1DOCA 1PJ7A 2H88A 1LQUA 2RGOA 4ZCDA 4H4SA 1GRBA 5IQ1A 3S5WA 4AOXA 1NEKA 1CJCA 4H4WA 3CNTA 3KA7A 4H2PA 1Y56A 3L8KA 3C4NA 1L9CA 3UOXA 2WP5A 3UKAA 5EB5A 1ZDLA 1MOKA 1GALA 1PBDA 5KOXA 2R0CA 3FBSA 1YQ3A 3I3LA 1GOSA 3FPZA 1H6VA 1F8WA 3SFEA 2GRTA 1UKVG 4Z25A 1DOEA 3LB8A 5IPYA 3AEAA 3GRTA 2YAUA 4H2NA 3NNEA 3SGLA 1KNRA 3SZFA 3T37A 4Z26A 4U8MA 1E1KA 4XWZA 1H82A 3S61A 4YTNA 2GR3A 5CKUA 1LV0A 4NTCA 3T2KA 4JY2A 2JB3A 2YQUA 3KLJA 5KOWA 4JY3A 3UTEA 1EL9A 1GETA 3AE9A 2AR8A 3NTDA 4RSLA 5ER0A 3WE0A 4YTMA 2GR1A 2XLUA 4B66A 4KX6A 4IA6A 3T14A 2WP9A 1F8SA 2BCPA 4LA1A 4P9SA 3DMEA 4Y4LA 1NDAA 2GVCA 4I58A 3K7TA 4IA5A 4J36A 4RG3A 5JCNA 3AE7A 3H4KA 2WS3A 1DJNA 2B9XA 2BYBA 3UKLA 1RYIA 5HY5A 3NH3X 3CGEA 4OPDA 3BI5A 1RSGA 4J31A 4A99A 1IUVA 1NG3A 2VRMA 1YQ4A 1ZOYA 1EL8A 1OJDA 3EPTA 4IVOB 4FK1C 1GNDA 2R9ZA 5KVHA 3FIMB 4D04A 2WPEA 1FEBA 4Z2UA 2WU2A 2YR4A 1YY5A 1YKJA 2YG3A 1ONFA 1P2HA 4GAVA 3GQKA 1CJ4A 4JNAA 4DNAA 3ALMA 4J2WA 4CCRA 4TLXA 1SEZA 1GERA 3SX6A 1QJDA 2GF3A 3AYJA 2VVMA 2C4CA 1H83A 3BNMA 3GMCA 1OJTA 2NVKX 4EM4A 3DA1A 1GXFA 2XFQA 3CPHG 4J56A 2DKHA 5FS6A 4EQXA 1L9EA 2FJBA 2JK6A 2YM2A 1L0VA 3GYXA 4G6GA 3KPKA 3SUCA 1IUSA 1K4QA 2VOUA 4B68A 1B8SA 4H2QA 1E6EA 3QSEA 1S3BA 3NLCA 1DNCA 1ZY8A 4EMJA 2H89A 1GPEA 4UDQA 3GYIA 4WX1A 4KPRA 4USRA 1RP0A 2YLXA 4B64A 3DJGX 1PS9A 2C73A 3V3OA 3CNPA 5DBJA 4GAPA 3BHFA 2GQFA 4OPCA 5BVAA 2R0GA 3P1WA 3P9UA 3SZWA 2GEWA 1E1NA 1E1LA 3GDPA 3UCLA 2GR0A 4H4UA 4H4QA 4U8OA 2XLPA 3EANA 1IUXA 2JB2A 3C96A 2XFOA 3QJ4A 5FS8A 4OPGA 3CTYA 4Z43A 3G5SA 2V6OA 3VQRA 1IUWA 2C72A 1ZP0A 1FOHA 2F5ZA 4JDRA 4X4JA 2PHHA 1REOA 3LXDA 3AYIA 3UKHA 1BZLA 1DJQA 3AEBA 2TPRA 4H2RA 1TRBA 2Y6QA 4LIIA 1JRXA 2QAEA 4GUVA 3SQPA 4A5LA 3K7MX 4BJZA 2YLWA 3AXBA 3UKFA 3K7QX 4YSXA 4IVMB 1H7XA 1E39A 4EQSA 4DSGA 4K5RA 2GMHA 4N9XA 3AEGA 1N4VA 2XVFA 3LZXA 4U2TA 4B67A 4G6HA 1O94A 1PDHA 4CY6A 1TDKA 5C2TA 3CN8A 1CJ2A 2CULA 3PO7A 4JQ9A 4II2A 3SY4A 1N1PA 4H4XA 2VRLA 3F8PA 1MXTA 1ZMCA 3ATQA 4G73A 1Q9IA 1JNRA 3II4A 2PYXA 3AE1A 1KSUA 5U25A 5FS7A 2WOIA 2B9WA 1KF6A 2XLSA 3IWAA 2BABA 2B7SA 3OZ2A 4UDPA 2GR2A 1P2EA 2GH5A 4JNQA 2DKIA 4YSZA 3VRAA 4CNJA 2UZZA 2OALA 4GR1A 1CJ3A 1S2YA 1D5TA 3V3NA 1ZMDA 3QVPA 3KPFA 2LFCA 2E4GA 3DGHA 3DH9A 4EM3A 2YLSA 4K2XA 3CGCA 5KVIA 2BRYA 5KNLA 2A89A 4Z24A 1MO9A 5HHFA 2EQ7A 3NT6A 3DK9A 3NIXA 4H4ZA 2IVDA 2B76A 3AECA 1PXCA 2WESA 2C7GA 2C75A 3E1TA 2EQ9A 5KMSA 2WDVA 4OPLA 3JSKA 3AD9B 2BK5A 4U8LA 4EQWA 1PXBA 2QA1A 1HYUA 3SFDA 1GT8A 2YVFA 3AWIA 2BC1A 1TDFA 1W4XA 3QFBA 2R4EA 1KSSA 2RGJA 3IF9A 1TDNA 4J34A 3SZCA 1FEAA 1GREA 1ZOVA 4K5SA 3UKQA 3FG2P 4A65A 3NRNA 1PBBA 3EF6A 2QCUA 2W0HA 2BK3A 4U8PA 3D1CA 5KXJA 1O5WA 1LJ1A 1IUTA 3CNJA 4FX9A 4H4PA 3VRBA 1F6MA 3CPJG 3REDA 4ADWA 4DSHA 5M10A 1N4WA 2YVJA 4YSHA 2ACZA 3R9UA 3AE8A 3LOVA 3I6DA 4NZHA 4X9NA 5J7XA 4AP1A 1PJ6A 3H8LA 4BURA 2YWLA 4J57A 3Q6JA 1JEHA 1GRGA 5JCLA 3RHAA 3SXIA 1GTEA 1KDGA 5HYMA 1ZKQA 1CF3A 2Q6UA 3ISHA 3IHMA 2CFYA 2XLTA 4NTEA 4Y4MA 3VR9A 1IUUA 1H7WA 3ZDNA 1BGNA 2V5ZA 3ALLA 3B6DA 3BNUA 3F8DA 3AYLA 3CGDA 3VR8A 2ZZCA 3P4QA 3PVCA 4USQA 4WCTA 2V3AA 5CQFA 5M0ZA 3RP8A 3DK4A 4C3YA 4REKA 3UOVA 2V3BA 2CVJA 4NWZA 2VQBA 4Z2TA 2XFPA 1EL7A 3QVRA 3BHKA 1BWCA 4ECHA 2WOWA 3BI2A 1QLBA 1LVLA 2BS4A 5FMHA 2WP6A 4BK1A 4GRTA 2C66A 2X8GA 4RG4A 3UKPA 5KRQA 1BKWA 3AEDA 2RABA 2VVLG 1ZX9A 1ELIA 2BXRA 1H81A 1H86A 3DJDA 5EB4A 4FK1A 2C65A 3CPIG 1F3PA 1Z6LA 2YG5A 3NN0X 3UTGA 3T2YA 4CY8A 3COXA 1VG9A 3CMMA 2BXSA 2WU5A 4YSYA 3CGBA 4UP3A 4DGKA 2R45A 3VRDB 1B37A 2XVJA 4O5UA 3L1RA 4EMWA 3NYCA 4II3A 5JCIA 1OJAA 1H84A 1D4CA 3FMWA 3KD9A 4YWOA 5C3JA 1NENA 4U8JA 3DJEA 4H4TA 2GQWA 1IJHA 2X8CA 4MJWA 3GRSA 4HB9A 2Q0LA 3UP4A 2EQ6A 2V61A 2BS2A 5KWFA 3O0HA 1GEUA 3NG7X 3URHA 3AB1A 2OLNA 2NPXA 4OVIA 4B65A 2WHDA 2X99A 2YG6A 5EOWA 4YXDA 3DK8A 4ZCCA 2YR6A 1BGJA 2V60A 2AAQA 2IIDA 3AE6A 1JRYA 4B1BA 2ARDA 2R46A 3RP6A 2WPFA 2YLRA 2WETA 4A7AA 1NG4A 2B7RA 1PHHA 2YM1A 3QSSA 4A79A 4AOSA 1XHCA 2C64A 1F8RA 5TR3A 1E7PA 4AP3A 4YKGA 3IHGA 2FJAA 3RNMA 4CRTA 2GMJA 3P4PA 3GYJA 3NYFA 4OPUA 4Z2RA 2YR5A 3DJJA 2A8XA 4G9KA 2WDQA 1CL0A 2XVIA 4H7UA 3AE2A 2JBVA 3M13A 3NK1X 3CNSA 3T31A 3NK2X 3NKSA 2E5VA 4GDPA 3UKKA 4X9MA 4TM4A 2C67A 2ZZBA 1VQWA 5EBKA 4D03A 5HXIA 1Q1WA 1TYPA 2GAGB 1V59A 4HA6A 4H4VA 3HYVA 4O5QA 1XDIA 4Z44A 4A9WA 3G5QA 3UTFA 2TMDA 3ALJA 3NTAA 4NEWA 4Y4NA 2VVLA 1CBOA 4C77A 4E0VA 3AE5A 2JAEA 4EIPA 3ABVA 1D4DA 1OJ9A 1Y0PA 1PXAA 3F8RA 2BC0A 4EQRA 1N4UA 3H8IA 3AE3A 1EBDA 3C4AA 4A6NA 4YT0A 3K30A 3P4RA 1DODA 1JU2A 3GD4A 5IQ4A 1GTHA 2GV8A 4H50A 4OPIA 4EIQA 3AD8B 3GMBA 1QO8A 5U63A 1PBFA 3OC4A 1E1MA 3GDNA 4OPTA 3AD7B 3HYWA 2YVGA 4CBQA 4CCQA 4NNJA 2X8HA 1GESA 3ITJA 4UDRA 1TYTA 2RGHA 2Z5YA 4U2LA 1TDOA 3ATRA 2XVHA 4J33A 5KMQA 3NGCX 1K0IA 3ICSA 5BRTA 3SZ0A 2JKCA 2FJDA 3ICRA 5LV9A 2A87A 2JB1A 2X50A 2XCGA 3GD3A 3NHOX 1NHSA 1YQZA 1LQTA 1JNZA 1GRFA 2XVEA 3UOYA 3GQHA 4ICYA 4BK3A 3SM8A 1S3EA 3QSMA 1GRAA 2WDRA 1D4EA 2VQ7A 3EAOA 1KNPA 1S2QA 1D7YA 2BCGG 2WBAA 3PS9A 1EL5A 4B69A 1GV4A 2APGA 5JCKA 3BI4A 1NPXA 2B9YA 5JCMA 1LTXR 3LADA 4NTDA 2IVEA 3UTHA 4APNA 1AOGA 4AT0A 3AEFA 4EMIA 1FECA 5U1OA 4JN9A 5GRTA 1ZK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFY A;  4K22 A;  4K7Z A;  1GRT A;  1LPF A;  3Q9T A;  3RP7 A;  3V76 A;  3M0O A;  2Z5X A;  3LJP A;  4TM0 A;  2GB0 A;  1BF3 A;  2HQM A;  1CHU A;  3P4S A;  2QA2 A;  1K0J A;  1COY A;  4OCG A;  2R0P A;  2ZZ0 A;  2XYO A;  5J60 A;  1M64 A;  1VDC A;  1CC2 A;  1O95 A;  3GSI A;  2C3C A;  3CIR A;  1NHR A;  2OA1 A;  3KU9 A;  2VZ2 A;  4C74 A;  4AT2 A;  1PJ5 A;  1L9D A;  3GWF A;  1JRZ A;  1XAN A;  4XWR A;  1D7L A;  4CNK A;  5BUL A;  3NYE A;  2R4J A;  2WQY A;  1NHP A;  4YKF A;  1X31 B;  3D8X A;  2C70 A;  2YG7 A;  1PN0 A;  5BUK A;  4GCM A;  2C3D A;  4LU6 A;  4ZN0 A;  2C76 A;  2OLO A;  4K8D A;  4BK2 A;  3AEE A;  3ICT A;  4U8I A;  1FCD A;  1Q1R A;  2WEU A;  2YLZ A;  1Y56 B;  4C3X A;  4XXG A;  1CC6 A;  2BAC A;  1PBE A;  1TDE A;  3HZL A;  2O9Z A;  3KVE A;  2WPC A;  4GDE A;  1VRQ B;  2XLR A;  3IC9 A;  1B5Q A;  4A6N B;  4H4R A;  1PBC A;  4PAA A;  3QFA A;  5GSN A;  1GSN A;  5L46 A;  2XFN A;  4H4Y A;  4U2S A;  2X3N A;  3NN6 X;  1XPQ A;  4B63 A;  2BA9 A;  3DGZ A;  4IV9 A;  2Q7V A;  4GF7 A;  4BV6 A;  3ZYX A;  3G5R A;  3GWD A;  2WOV A;  1JOA A;  4U8N A;  1DXL A;  2XFU A;  4YTP A;  2J3N A;  4TLZ A;  3LZW A;  1M6I A;  2FJE A;  2EQ8 A;  4FDC B;  3NK0 X;  4I59 A;  2OAM A;  2YLT A;  2Q0K A;  2XDO A;  4M52 A;  1DOB A;  2GAH B;  3M12 A;  1CC4 A;  4TM3 A;  2E1M A;  3ADA B;  2FBW A;  5FS9 A;  3UOZ A;  2Y6R A;  1NHQ A;  4NEV A;  4C5O A;  1K0L A;  4U8K A;  1NAA A;  2BK4 A;  3CND A;  4PAB A;  4BJY A;  2YG4 A;  3UP5 A;  1FL2 A;  2ZBW A;  1OJC A;  1VG0 A;  1B4V A;  3KKJ A;  3AE4 A;  2AQJ A;  4TM1 A;  1GRH A;  2I0Z A;  2BS3 A;  3B3R A;  2CDU A;  1DOC A;  1PJ7 A;  2H88 A;  1LQU A;  2RGO A;  4ZCD A;  4H4S A;  1GRB A;  5IQ1 A;  3S5W A;  4AOX A;  1NEK A;  1CJC A;  4H4W A;  3CNT A;  3KA7 A;  4H2P A;  1Y56 A;  3L8K A;  3C4N A;  1L9C A;  3UOX A;  2WP5 A;  3UKA A;  5EB5 A;  1ZDL A;  1MOK A;  1GAL A;  1PBD A;  5KOX A;  2R0C A;  3FBS A;  1YQ3 A;  3I3L A;  1GOS A;  3FPZ A;  1H6V A;  1F8W A;  3SFE A;  2GRT A;  1UKV G;  4Z25 A;  1DOE A;  3LB8 A;  5IPY A;  3AEA A;  3GRT A;  2YAU A;  4H2N A;  3NNE A;  3SGL A;  1KNR A;  3T37 A;  4Z26 A;  4U8M A;  1E1K A;  4XWZ A;  1H82 A;  3S61 A;  4YTN A;  2GR3 A;  5CKU A;  1LV0 A;  4NTC A;  4JY2 A;  2JB3 A;  2YQU A;  3KLJ A;  5KOW A;  4JY3 A;  3UTE A;  1EL9 A;  1GET A;  3AE9 A;  2AR8 A;  3NTD A;  4RSL A;  5ER0 A;  3WE0 A;  4YTM A;  2GR1 A;  2XLU A;  4B66 A;  4KX6 A;  4IA6 A;  2WP9 A;  1F8S A;  2BCP A;  4LA1 A;  4P9S A;  3DME A;  4Y4L A;  1NDA A;  2GVC A;  4I58 A;  3K7T A;  4IA5 A;  4J36 A;  4RG3 A;  5JCN A;  3AE7 A;  3H4K A;  2WS3 A;  1DJN A;  2B9X A;  2BYB A;  3UKL A;  1RYI A;  5HY5 A;  3NH3 X;  3CGE A;  4OPD A;  3BI5 A;  1RSG A;  4J31 A;  4A99 A;  1IUV A;  1NG3 A;  2VRM A;  1YQ4 A;  1ZOY A;  1EL8 A;  1OJD A;  3EPT A;  4IVO B;  4FK1 C;  1GND A;  2R9Z A;  5KVH A;  3FIM B;  4D04 A;  2WPE A;  1FEB A;  4Z2U A;  2WU2 A;  2YR4 A;  1YY5 A;  1YKJ A;  2YG3 A;  1ONF A;  1P2H A;  3GQK A;  1CJ4 A;  4JNA A;  4DNA A;  3ALM A;  4J2W A;  4CCR A;  4TLX A;  1SEZ A;  1GER A;  1QJD A;  2GF3 A;  3AYJ A;  2VVM A;  3BNM A;  1H83 A;  3GMC A;  1OJT A;  2NVK X;  4EM4 A;  3DA1 A;  1GXF A;  2XFQ A;  3CPH G;  4J56 A;  2DKH A;  5FS6 A;  4EQX A;  1L9E A;  2FJB A;  2JK6 A;  2YM2 A;  1L0V A;  3GYX A;  3SUC A;  1IUS A;  1K4Q A;  2VOU A;  4B68 A;  1B8S A;  4H2Q A;  1E6E A;  3QSE A;  1S3B A;  3NLC A;  1DNC A;  1ZY8 A;  4EMJ A;  2H89 A;  1GPE A;  4UDQ A;  3GYI A;  4WX1 A;  4KPR A;  4USR A;  1RP0 A;  2YLX A;  4B64 A;  3DJG X;  1PS9 A;  2C73 A;  3V3O A;  3CNP A;  5DBJ A;  3BHF A;  2GQF A;  4OPC A;  5BVA A;  2R0G A;  3P1W A;  3P9U A;  2GEW A;  1E1N A;  1E1L A;  3GDP A;  3UCL A;  2GR0 A;  4H4U A;  4H4Q A;  4U8O A;  2XLP A;  3EAN A;  1IUX A;  2JB2 A;  3C96 A;  2XFO A;  3QJ4 A;  5FS8 A;  4OPG A;  3CTY A;  4Z43 A;  3G5S A;  2V6O A;  3VQR A;  1IUW A;  2C72 A;  1ZP0 A;  1FOH A;  2F5Z A;  4JDR A;  4X4J A;  2PHH A;  1REO A;  3LXD A;  3AYI A;  3UKH A;  1BZL A;  1DJQ A;  3AEB A;  2TPR A;  4H2R A;  1TRB A;  2Y6Q A;  4LII A;  1JRX A;  2QAE A;  4GUV A;  3SQP A;  4A5L A;  3K7M X;  4BJZ A;  2YLW A;  3AXB A;  3UKF A;  3K7Q X;  4YSX A;  4IVM B;  1H7X A;  1E39 A;  4EQS A;  4DSG A;  4K5R A;  2GMH A;  4N9X A;  3AEG A;  1N4V A;  2XVF A;  3LZX A;  4U2T A;  4B67 A;  1O94 A;  1PDH A;  4CY6 A;  1TDK A;  5C2T A;  3CN8 A;  1CJ2 A;  2CUL A;  3PO7 A;  4JQ9 A;  1N1P A;  4H4X A;  2VRL A;  3F8P A;  1MXT A;  1ZMC A;  3ATQ A;  1Q9I A;  1JNR A;  3II4 A;  2PYX A;  3AE1 A;  1KSU A;  5U25 A;  5FS7 A;  2WOI A;  2B9W A;  1KF6 A;  2XLS A;  3IWA A;  2BAB A;  2B7S A;  3OZ2 A;  4UDP A;  2GR2 A;  1P2E A;  2GH5 A;  4JNQ A;  2DKI A;  4YSZ A;  3VRA A;  4CNJ A;  2UZZ A;  2OAL A;  4GR1 A;  1CJ3 A;  1S2Y A;  1D5T A;  3V3N A;  1ZMD A;  3QVP A;  3KPF A;  2LFC A;  2E4G A;  3DGH A;  3DH9 A;  4EM3 A;  2YLS A;  4K2X A;  3CGC A;  5KVI A;  2A89 A;  4Z24 A;  1MO9 A;  5HHF A;  2EQ7 A;  3NT6 A;  3DK9 A;  3NIX A;  4H4Z A;  2IVD A;  2B76 A;  3AEC A;  1PXC A;  2WES A;  2C7G A;  2C75 A;  3E1T A;  2EQ9 A;  2WDV A;  4OPL A;  3JSK A;  3AD9 B;  2BK5 A;  4U8L A;  4EQW A;  1PXB A;  2QA1 A;  1HYU A;  3SFD A;  1GT8 A;  2YVF A;  3AWI A;  2BC1 A;  1TDF A;  1W4X A;  3QFB A;  2R4E A;  1KSS A;  2RGJ A;  3IF9 A;  1TDN A;  4J34 A;  1FEA A;  1GRE A;  1ZOV A;  4K5S A;  3UKQ A;  3FG2 P;  4A65 A;  3NRN A;  1PBB A;  3EF6 A;  2QCU A;  2W0H A;  2BK3 A;  4U8P A;  3D1C A;  5KXJ A;  1O5W A;  1LJ1 A;  1IUT A;  3CNJ A;  4FX9 A;  4H4P A;  3VRB A;  1F6M A;  3CPJ G;  3RED A;  4ADW A;  4DSH A;  5M10 A;  1N4W A;  2YVJ A;  4YSH A;  2ACZ A;  3R9U A;  3AE8 A;  3LOV A;  3I6D A;  4NZH A;  4X9N A;  5J7X A;  4AP1 A;  1PJ6 A;  3H8L A;  4BUR A;  2YWL A;  4J57 A;  3Q6J A;  1JEH A;  1GRG A;  5JCL A;  3RHA A;  1GTE A;  1KDG A;  5HYM A;  1ZKQ A;  1CF3 A;  2Q6U A;  3ISH A;  3IHM A;  2CFY A;  2XLT A;  4NTE A;  4Y4M A;  3VR9 A;  1IUU A;  1H7W A;  3ZDN A;  1BGN A;  2V5Z A;  3ALL A;  3B6D A;  3BNU A;  3F8D A;  3AYL A;  3CGD A;  3VR8 A;  2ZZC A;  3P4Q A;  3PVC A;  4USQ A;  4WCT A;  2V3A A;  5CQF A;  5M0Z A;  3RP8 A;  3DK4 A;  4C3Y A;  4REK A;  3UOV A;  2V3B A;  2CVJ A;  2VQB A;  4Z2T A;  2XFP A;  1EL7 A;  3QVR A;  3BHK A;  1BWC A;  4ECH A;  2WOW A;  3BI2 A;  1QLB A;  1LVL A;  2BS4 A;  5FMH A;  2WP6 A;  4BK1 A;  4GRT A;  2C66 A;  2X8G A;  4RG4 A;  3UKP A;  5KRQ A;  1BKW A;  3AED A;  2RAB A;  2VVL G;  1ZX9 A;  1ELI A;  2BXR A;  1H81 A;  1H86 A;  3DJD A;  5EB4 A;  4FK1 A;  2C65 A;  3CPI G;  1F3P A;  1Z6L A;  2YG5 A;  3NN0 X;  3UTG A;  4CY8 A;  3COX A;  1VG9 A;  2BXS A;  2WU5 A;  4YSY A;  3CGB A;  4UP3 A;  4DGK A;  2R45 A;  3VRD B;  1B37 A;  2XVJ A;  4O5U A;  3L1R A;  4EMW A;  3NYC A;  5JCI A;  1OJA A;  1H84 A;  1D4C A;  3FMW A;  3KD9 A;  4YWO A;  5C3J A;  1NEN A;  4U8J A;  3DJE A;  4H4T A;  2GQW A;  1IJH A;  2X8C A;  4MJW A;  3GRS A;  4HB9 A;  2Q0L A;  3UP4 A;  2EQ6 A;  2V61 A;  2BS2 A;  5KWF A;  3O0H A;  1GEU A;  3NG7 X;  3URH A;  3AB1 A;  2OLN A;  2NPX A;  4OVI A;  4B65 A;  2WHD A;  2X99 A;  2YG6 A;  5EOW A;  4YXD A;  3DK8 A;  4ZCC A;  2YR6 A;  1BGJ A;  2V60 A;  2AAQ A;  2IID A;  3AE6 A;  1JRY A;  4B1B A;  2ARD A;  2R46 A;  3RP6 A;  2WPF A;  2YLR A;  2WET A;  4A7A A;  1NG4 A;  2B7R A;  1PHH A;  2YM1 A;  3QSS A;  4A79 A;  4AOS A;  1XHC A;  2C64 A;  1F8R A;  5TR3 A;  1E7P A;  4AP3 A;  4YKG A;  3IHG A;  2FJA A;  3RNM A;  4CRT A;  2GMJ A;  3P4P A;  3GYJ A;  3NYF A;  4OPU A;  4Z2R A;  2YR5 A;  3DJJ A;  2A8X A;  2WDQ A;  1CL0 A;  2XVI A;  4H7U A;  3AE2 A;  2JBV A;  3M13 A;  3NK1 X;  3CNS A;  3NK2 X;  3NKS A;  2E5V A;  4GDP A;  3UKK A;  4X9M A;  4TM4 A;  2C67 A;  2ZZB A;  1VQW A;  5EBK A;  4D03 A;  5HXI A;  1Q1W A;  1TYP A;  2GAG B;  1V59 A;  4HA6 A;  4H4V A;  4O5Q A;  1XDI A;  4Z44 A;  4A9W A;  3G5Q A;  3UTF A;  2TMD A;  3ALJ A;  3NTA A;  4NEW A;  4Y4N A;  2VVL A;  1CBO A;  4C77 A;  4E0V A;  3AE5 A;  2JAE A;  4EIP A;  3ABV A;  1D4D A;  1OJ9 A;  1Y0P A;  1PXA A;  3F8R A;  2BC0 A;  4EQR A;  1N4U A;  3H8I A;  3AE3 A;  1EBD A;  3C4A A;  4A6N A;  4YT0 A;  3K30 A;  3P4R A;  1DOD A;  1JU2 A;  3GD4 A;  5IQ4 A;  1GTH A;  2GV8 A;  4H50 A;  4OPI A;  4EIQ A;  3AD8 B;  3GMB A;  1QO8 A;  5U63 A;  1PBF A;  3OC4 A;  1E1M A;  3GDN A;  4OPT A;  3AD7 B;  4CBQ A;  2YVG A;  4CCQ A;  2X8H A;  1GES A;  3ITJ A;  4UDR A;  1TYT A;  2RGH A;  2Z5Y A;  4U2L A;  1TDO A;  3ATR A;  2XVH A;  4J33 A;  3NGC X;  1K0I A;  3ICS A;  5BRT A;  2JKC A;  2FJD A;  3ICR A;  5LV9 A;  2A87 A;  2JB1 A;  2X50 A;  2XCG A;  3GD3 A;  3NHO X;  1NHS A;  1YQZ A;  1LQT A;  1JNZ A;  1GRF A;  2XVE A;  3UOY A;  3GQH A;  4ICY A;  4BK3 A;  3SM8 A;  1S3E A;  3QSM A;  1GRA A;  2WDR A;  1D4E A;  2VQ7 A;  3EAO A;  1KNP A;  1S2Q A;  1D7Y A;  2BCG G;  2WBA A;  3PS9 A;  1EL5 A;  4B69 A;  1GV4 A;  2APG A;  5JCK A;  3BI4 A;  1NPX A;  2B9Y A;  5JCM A;  1LTX R;  3LAD A;  4NTD A;  2IVE A;  3UTH A;  4APN A;  1AOG A;  4AT0 A;  3AEF A;  4EMI A;  1FEC A;  5U1O A;  4JN9 A;  5GRT A;  1ZK7 A; 
#chains in the Genus database with same CATH topology
 4K22 A;  1NCQ D;  3O1H A;  3V76 A;  5L3D B;  4TM0 A;  1VBA 4;  4HFH A;  1VBB 4;  2A2F X;  3GN5 B;  1CHU A;  2Z6E A;  2QA2 A;  4EXT A;  1K0J A;  3PUQ A;  3AAI A;  1M64 A;  1O95 A;  3GSI A;  4DR1 T;  2CMR A;  4TN7 B;  1L9D A;  2WCA A;  3BQL A;  1YXR A;  5BUL A;  3L39 A;  1NHP A;  2YIN A;  2EHO A;  4GIW A;  3ZT7 A;  3OTO T;  4PK4 A;  4H63 V;  2RMU 4;  2C76 A;  2OLO A;  2W00 A;  4WBO A;  2W2U A;  4U8I A;  4IIJ E;  3CKD A;  1ASJ 4;  1FJG T;  1PBE A;  2NW7 A;  2XQY A;  1VRQ B;  4QXH B;  5GON E;  2NOX A;  4XBF B;  3LJC A;  1Y64 B;  2X9Y A;  3QFA A;  1GSN A;  4DUZ T;  3NN6 X;  4B63 A;  2CWY A;  2BKN A;  3HL6 A;  2C5I T;  2BVL A;  2J3N A;  4O2B E;  2LRL A;  4HEA A;  2Q0K A;  5LYJ E;  5AQV B;  4UF0 A;  3M12 A;  3JAD A;  1CC4 A;  2MBG A;  3UOZ A;  5BR8 T;  1NHQ A;  3LK3 B;  4NEV A;  5L3G B;  1K0L A;  3TLT A;  1OED E;  2X68 A;  2M6I A;  2YG4 A;  1FL2 A;  4JI7 T;  3RF1 A;  3UU4 A;  2LRK A;  1B4V A;  2JPF A;  3KKJ A;  4JI2 T;  3B3R A;  1PJ7 A;  5IQ1 A;  5JDL A;  3T1H T;  1CJC A;  3CNT A;  4JI6 T;  4H2P A;  4ZZB A;  3L8K A;  3C4N A;  2LT3 A;  4UXN B;  1GAL A;  5KOX A;  3I3L A;  3AA1 B;  1GOS A;  2WWU A;  3W15 B;  4AI6 A;  4Z25 A;  4PFP A;  3LK2 B;  3SZF A;  4H2N A;  1KNR A;  5LGN B;  3QC9 A;  1PVC 4;  4XWZ A;  3S61 A;  4YTN A;  3O4X E;  4DV7 T;  3AA0 B;  2XQ4 A;  3AA6 B;  2YQU A;  2XSA A;  3LBX A;  3C51 A;  3PUS A;  4QKN A;  1EL9 A;  1GET A;  3WE0 A;  2XLU A;  4IA6 A;  4Y4L A;  1NDA A;  2JQK A;  3K7T A;  2HH7 A;  5JCN A;  1M7K A;  3ZJ2 A;  3H4K A;  2WS3 A;  1DJN A;  5HY5 A;  3WAK A;  5BMV E;  3BI5 A;  4J31 A;  5LHH B;  1IUV A;  1NG3 A;  1ZV4 X;  3MKD A;  3PUW F;  3UFE A;  1YQ4 A;  4EB6 E;  1GND A;  3FIM B;  3RQU A;  4ERR A;  2WU2 A;  4ZI2 C;  3RIA A;  1ONF A;  1P2H A;  4JNA A;  3ALM A;  5JDF A;  1SEZ A;  1QJD A;  4K0U A;  1UGO A;  2GF3 A;  4QXB B;  1H83 A;  4CI3 B;  3L09 A;  3PUZ F;  3CK6 A;  3VKH A;  2XPK A;  2DKH A;  4EQX A;  3SUC A;  1K4Q A;  4UVA B;  2VQF T;  1B8S A;  2VK9 A;  4OFZ A;  5AQU B;  4AKH A;  3K8P C;  1ZY8 A;  2H89 A;  1PO1 4;  1GPE A;  5HWX A;  4KPR A;  2F4V T;  1XMO T;  3DJG X;  2L3L A;  3FBL A;  4Z91 A;  4IDZ A;  5DBJ A;  4GAP A;  3RPU A;  3N2K E;  5HEG A;  3LFM A;  1EAH 4;  1KNZ A;  4ZEY A;  5FL0 A;  1E1L A;  2LM9 A;  2X9H A;  3C96 A;  3QJ4 A;  4OPG A;  3CTY A;  4Z43 A;  1W0B A;  2LJL A;  1EZ3 A;  1IUW A;  2C72 A;  3VU7 H;  4UEL A;  4G63 A;  4TUY E;  4UV9 B;  5HXH A;  3RKG A;  2BG9 A;  1SHZ C;  4LII A;  2XZE A;  1JRX A;  4A5L A;  3K7M X;  1M62 A;  3K7Q X;  3LK4 2;  5FL1 A;  1H7X A;  4AKI A;  2NW9 A;  4GYR A;  2VWA A;  4EV6 A;  2E8I A;  3LZX A;  4B67 A;  4GB3 4;  3OPC A;  4EEB A;  5FXW A;  1TDK A;  1NAF A;  1AR8 4;  3FZL B;  3PO7 A;  2CUL A;  2P9B A;  1WLX A;  1MXT A;  5JTG A;  1VRH 4;  3II4 A;  1JNR A;  3HI2 A;  3AE1 A;  1KF6 A;  2BKP A;  3NBX X;  1D0Z A;  2LKH A;  4GOU A;  3IWA A;  3OZ2 A;  3RI5 A;  4PNI A;  2E2A A;  3ZEF B;  4YSZ A;  3J9X 1;  4P0A A;  3DGH A;  1XHZ A;  4NXM T;  2BRY A;  5KNL A;  3NT6 A;  4P1N A;  1HS7 A;  4DO0 A;  5J1G A;  1PXC A;  2C75 A;  3E1T A;  3AD9 B;  3I9Y A;  4U8L A;  4EQW A;  2QA1 A;  1RUD 4;  5JR9 B;  3IF9 A;  5AQS B;  3RQW A;  3UKQ A;  3EF6 A;  2W0H A;  4FX9 A;  4H4P A;  1IUT A;  1T7S A;  3VRB A;  4DSH A;  2ACZ A;  3R9U A;  3AE8 A;  2XAQ B;  4GYS A;  4I43 B;  2CM0 A;  4NZH A;  1N36 T;  3Q5D A;  3JC6 C;  3MXZ A;  1WCR A;  4J57 A;  5JDH A;  1UX5 A;  1CF3 A;  5AQO B;  1UUR A;  2KXP B;  3IHM A;  1IAP A;  2XLT A;  1U4Q A;  3ZDN A;  2Y48 B;  3F8D A;  3AYL A;  3CGD A;  5M0Z A;  3RP8 A;  4AXP A;  4REK A;  5LHI B;  2VQB A;  4DR5 T;  4Z2T A;  4H9P C;  3BHK A;  2H7V C;  4QX8 B;  3BI2 A;  1QLB A;  2BS4 A;  2X5I D;  4BK1 A;  5AFU L;  4RG4 A;  4F6R C;  5KRQ A;  4ILU A;  2LSY A;  2RAB A;  5ETW A;  1ELI A;  2BXR A;  1H81 A;  3DJD A;  2JMH A;  4FK1 A;  5EB4 A;  5C8Y E;  3OYX A;  1N33 T;  2BXS A;  3ZMU B;  4YSY A;  4UP3 A;  4DGK A;  2R45 A;  4O5U A;  4II3 A;  5JCI A;  5JVD E;  1H84 A;  2LSI A;  2UXD T;  3BQI A;  2V7M A;  2ZM8 A;  2X8C A;  4MJW A;  2VAS A;  2Q0L A;  5L3B B;  2BS2 A;  1GEU A;  3NG7 X;  2KT9 A;  3R84 B;  1D1C A;  4OVI A;  4ZI3 D;  3HKD E;  3DK8 A;  1BGJ A;  2Y6X A;  2J1D G;  5HXS A;  1XDO A;  3RP6 A;  1U5P A;  2WPF A;  2YLR A;  4A7A A;  2B7R A;  4AOS A;  4CZZ B;  4FI5 A;  1XHC A;  1F8R A;  5TR3 A;  2V6X A;  4AP3 A;  4YKG A;  2D2S A;  2FJA A;  3RNM A;  3GN5 A;  2YKS A;  2GMJ A;  3GYJ A;  3NYF A;  4TWD A;  5JDM A;  3DJJ A;  4G9K A;  1CL0 A;  2XVI A;  2UUB T;  3AE2 A;  3M13 A;  3NKS A;  4YHH T;  4DV1 T;  4JYA T;  4TM4 A;  1VQW A;  1MQT D;  3P7I A;  1SA0 E;  1TYP A;  3I1A A;  2GAG B;  1XDI A;  3NRY A;  5DJQ C;  4AQG A;  3G5Q A;  4AKL A;  3KVB A;  3NTA A;  4Y4N A;  5KX5 E;  2KND A;  3AE5 A;  2UXB T;  3L3P A;  1Y0P A;  3F8R A;  4IDQ A;  4MBQ A;  3RYH E;  4LMJ A;  1POV 0;  3AE3 A;  4OYJ A;  1JU2 A;  3RHW A;  5ABF B;  4H50 A;  3N2G E;  1BEV 4;  2JRK A;  1J1J A;  3VHL A;  1S94 A;  5CA1 E;  1PBF A;  1E1M A;  4TV9 E;  3OC4 A;  2R06 4;  1VCS A;  4PJJ A;  2Z5Y A;  2BDE A;  2WB5 A;  2RR1 4;  4J33 A;  3SRZ A;  3CVR A;  5FP3 A;  2JQH A;  3NHO X;  1YQZ A;  4O2A E;  1GRF A;  5FVK A;  4LF4 T;  2XVE A;  2VKJ A;  5AQF B;  4MAL A;  2DL1 A;  2J62 A;  3SM8 A;  3PU8 A;  3ETV A;  3C50 A;  3Q5W A;  2JQQ A;  2XQ5 A;  2JJ9 A;  3IBP A;  3C4X A;  3PU3 A;  4Z90 A;  3UTH A;  3AEF A;  4O4L E;  2BZB A;  1FEC A;  4JN9 A;  1KFY A;  4H9S E;  4X5T A;  1GRT A;  3Q9T A;  1EV1 4;  3LJP A;  4HWI B;  4U74 A;  3P4S A;  3PUA A;  3RYF E;  4G2A A;  5KMP A;  2PYL A;  1WRD A;  4X64 T;  2R0P A;  5J60 A;  1NHR A;  1B7T A;  2VKO A;  3RKO A;  3IF8 B;  1UX4 A;  5A1L A;  1PJ5 A;  3UUL A;  3RIU A;  3KV9 A;  1I94 T;  4JBW F;  3CX7 B;  4CXW A;  4E7Z A;  4G74 A;  2C70 A;  3PE0 A;  5KMR A;  4ZN0 A;  1RUF 4;  3QOF A;  4BK2 A;  3AEE A;  3ZN0 B;  4HFE A;  1FCD A;  2XAF B;  5TAO A;  1Y56 B;  4XXG A;  4HWH A;  2BAC A;  2YN6 A;  5DQV A;  2V5C A;  2HPL A;  2WPC A;  2PY5 A;  4ZXL A;  1PBC A;  3CX6 B;  5GSN A;  2QVA A;  3DGZ A;  2WSS V;  4IV9 A;  1WR0 A;  2XY8 B;  3TLS A;  3ZYX A;  1HG2 A;  4TNW A;  5AQL B;  3G5R A;  3GWD A;  2WOV A;  2Q9Q B;  3ANW B;  1JOA A;  3BK9 A;  2XFU A;  2FJE A;  4FDC B;  3NK0 X;  4IDP A;  4ZS3 A;  4I59 A;  3AXJ B;  2LSG A;  4KP3 C;  3QK6 A;  1DOB A;  2GAH B;  4E7S A;  4J2C A;  4L0R A;  5LGT B;  4U8K A;  1NAA A;  2MAW A;  2BK4 A;  3CND A;  4PAB A;  4BJY A;  2CHN A;  2CDU A;  4UEM A;  1LQU A;  4ZCD A;  4H4S A;  1GRB A;  1NEK A;  5F3J A;  2PFV A;  3PUG A;  3AAA B;  5LOV E;  1ZDL A;  1MOK A;  2R0C A;  3FPZ A;  1H6V A;  2KLQ A;  5IPY A;  2X67 A;  1DOE A;  3AEA A;  5EK3 A;  1HX1 B;  3ETU A;  5FKY A;  1T72 A;  4NUU A;  2H3R A;  3T8O A;  3T2K A;  4JY2 A;  3M65 A;  4ADZ A;  3UTE A;  2V7J A;  3C4W A;  3B57 A;  3AE9 A;  2AR8 A;  3NTD A;  4RSL A;  2DNX A;  2WP9 A;  1F8S A;  5AQH B;  3DME A;  3K3N A;  1BR4 A;  2I59 A;  3AE7 A;  2BYB A;  3EHZ A;  3CGE A;  3F57 A;  5CFB A;  1EL8 A;  2XJ7 A;  3RIU C;  2R9Z A;  3ZYM A;  4D04 A;  2DLR A;  2B1E A;  2I0M A;  1YY5 A;  1G73 A;  1WFD A;  3FB2 A;  4GAV A;  3EVY A;  4U2Z A;  4CCR A;  3JCF A;  1GER A;  4XZC A;  1SE7 A;  3AYJ A;  5JQG E;  2C4C A;  2OA5 A;  1XNR T;  4DV6 T;  2NVK X;  3KIN B;  3DA1 A;  4J56 A;  4TV8 E;  2PW9 A;  5FS6 A;  4G6G A;  2YM2 A;  4C91 A;  3OKQ A;  3KPK A;  1QUU A;  4B68 A;  1E6E A;  3FZF B;  1S3B A;  3N2O A;  5U1O A;  1DNC A;  4EMJ A;  4LF9 T;  3N5L A;  3GYI A;  2QGS A;  3Q2M A;  2N1G A;  1IJ6 A;  2CXF A;  5FMN A;  4HWD A;  5IUX A;  1PS9 A;  3CML A;  2C73 A;  3V3O A;  3CNP A;  1ZHC A;  4U31 A;  5BVA A;  2XQ9 A;  4OPC A;  3PTR B;  5JR9 A;  2MOZ A;  1E1N A;  3GDP A;  2XLP A;  3EAN A;  1IUX A;  5LMN T;  3G5S A;  3ONL C;  3T1Y T;  4MFR A;  3VQR A;  2K48 A;  2F5Z A;  2PHH A;  3A7M A;  5ADX L;  4IL4 A;  3AYI A;  5AQG B;  1BZL A;  1ZKE A;  1WYC A;  2G0U A;  2PTF A;  2QAE A;  2X51 A;  5ABG A;  3SQP A;  4COF A;  3IHR A;  2UXC T;  2UXX B;  4WZX A;  3CQX C;  2K9A A;  4BAY B;  2HN1 A;  2CLY B;  2IHR 1;  4EOZ B;  2MTQ A;  1O94 A;  3RX6 A;  2EHO D;  4ZI2 D;  1IBM T;  4BJN A;  4II2 A;  3ZKR A;  4JEH B;  4I50 E;  2V7K A;  4DV0 T;  2VRL A;  1ZMC A;  4G73 A;  1Q9I A;  5LB7 B;  4DBR A;  4Q4Y 4;  2E5L T;  5U25 A;  1T98 A;  2BAB A;  4UDP A;  2GR2 A;  2GH5 A;  5DQW A;  3VRA A;  2UZZ A;  1OED B;  3GWH A;  1S2Y A;  3V3N A;  1ZMD A;  1E2A A;  2E4G A;  4DR4 T;  3CGC A;  4K2X A;  2LSJ A;  2A89 A;  4Z24 A;  4YJ2 E;  3KBT A;  2B76 A;  2IVD A;  2BKO A;  3CX8 B;  1H7C A;  4HWC A;  3AA7 B;  2EQ9 A;  5KMS A;  5HXC A;  2V6Y A;  4OPL A;  2PG8 A;  4JI4 T;  1PXB A;  3SFD A;  4LF8 T;  2L9Q A;  2YVF A;  2K3W A;  2BC1 A;  1W4X A;  3UUM A;  3QFB A;  3O1I A;  3PJA A;  1TDN A;  4AKR B;  1FEA A;  4K5S A;  2EHO C;  2W66 A;  1SUM B;  4Q25 A;  2BBH A;  3RC8 A;  4JEU B;  4JI1 T;  4U8P A;  2V26 A;  2YVJ A;  4EZH A;  3I6D A;  4X9N A;  4AP1 A;  3H8L A;  2E9X B;  5JR9 C;  1XHX A;  2RS5 4;  4CI1 B;  1GRG A;  3DJB A;  3SOL A;  4KBM B;  2ZM0 A;  4EYU A;  3RHA A;  3SXI A;  5HYM A;  3UFG A;  3E22 E;  5HXR A;  2Q6U A;  3K1S A;  1HNX T;  1H7W A;  1YD8 G;  3VR8 A;  4WCT A;  5DAB A;  4DV4 T;  3DK4 A;  1D0X A;  3KV4 A;  4C3Y A;  3FHN A;  3F31 A;  2V3B A;  3NKZ A;  5ABF A;  2VKH A;  1BWC A;  4ISS A;  4BA9 A;  1LVL A;  1RUG 4;  4YY3 T;  2X8G A;  2AE9 A;  2ES0 A;  3UKP A;  3TKL B;  2VVS A;  1ZX9 A;  2VVL G;  3TLU A;  5H6Q B;  3CPI G;  1Z6L A;  1XNQ T;  3T2Y A;  1MMG A;  2ZLY A;  4CY8 A;  4L5G A;  4NXN T;  1B37 A;  3O9X A;  3J8F 4;  3FMW A;  3QNU A;  1HXS 4;  4DBQ A;  4U8J A;  3DJE A;  2KWH A;  4CN6 A;  4IL9 A;  3UP4 A;  3FXE B;  3RRW A;  5JRC B;  3H37 A;  4B65 A;  1HFA A;  2IIU A;  2YG6 A;  5EOW A;  4DV2 T;  4B3T T;  4B1B A;  2RP4 A;  1NG4 A;  4MLK A;  2YM1 A;  2HPJ A;  3QSS A;  4DV5 T;  5ABH A;  3IHG A;  4CRT A;  5H6R B;  2KSR A;  3EDV A;  3E08 A;  4H7U A;  1W09 A;  2JBV A;  3JC6 D;  3UKK A;  1J5W A;  2ZZB A;  4QH4 A;  1Q1W A;  4B3M T;  3OVU A;  4TWH A;  3HYV A;  3UTF A;  2VVL A;  2C0S A;  3ZMZ B;  1E1H B;  3UU5 A;  4A98 A;  4ZZC A;  4EIP A;  3HR0 A;  4IE5 A;  1IBL T;  4IDN A;  3ABV A;  3N9L A;  4ASK A;  1OJ9 A;  2BC0 A;  1EBD A;  3C4A A;  4YT0 A;  2LE8 A;  2WZH A;  4O4H E;  2RM2 4;  3GD4 A;  2GV8 A;  4OPI A;  3AD8 B;  5U63 A;  3PUY F;  2M6B A;  1RUH 4;  2EX3 A;  5L3F B;  2Q9Q A;  3ANW A;  5L3E B;  2YVG A;  3HYW A;  4CBQ A;  4BJM A;  4NNJ A;  1HR0 T;  1GES A;  2RGH A;  4GK0 E;  1MNE A;  5LHG B;  4DV3 T;  2JMK A;  4I55 E;  3NGC X;  3ICS A;  2FJD A;  1LRZ A;  2JB1 A;  2D0T A;  4EED A;  4H9N C;  2I6H A;  5IWA T;  3TLW A;  3ZC0 A;  1MMN A;  3CPZ A;  3UOY A;  3GQH A;  4ICY A;  1COV 4;  2X0L B;  3FI7 A;  1S3E A;  2WDR A;  2W67 A;  2VQ7 A;  4DR7 T;  2BCG G;  3PS9 A;  5JCK A;  2A9U A;  2VKD A;  5JCM A;  2VUR A;  4IE4 A;  4UIG A;  4H9O C;  1XWM A;  4APN A;  1AOG A;  4AT0 A;  5GRT A;  2BG9 C;  1ZK7 A;  4K7Z A;  3MAC A;  2YDR A;  3LDQ B;  4CQI A;  5HCJ A;  1KK7 A;  3M0O A;  2Z5X A;  2GB0 A;  3N9O A;  2ZZ0 A;  2CA5 A;  3ESL A;  3P50 A;  4WYV A;  1YKE B;  2C3C A;  3CIR A;  3ZST A;  3KU9 A;  2VZ2 A;  4C74 A;  2C5K T;  1D7L A;  1MIW A;  4CNK A;  3RH3 A;  3NYE A;  2R4J A;  1W9R A;  4P0B A;  3RYC E;  2CBI A;  2WMN A;  3B5M A;  1X31 B;  1HF8 A;  1PN0 A;  5BUK A;  4GCM A;  4OHF A;  1LKX A;  2C3D A;  4LU6 A;  2LSK A;  3Q9D A;  4F8H A;  2YLZ A;  1BR2 A;  2BRA A;  1DU2 A;  3HZL A;  1RUJ 4;  3KVE A;  1VCT A;  2J47 A;  1B5Q A;  4A6N B;  5FXV A;  2PYJ A;  4ANJ A;  5L46 A;  2CE7 A;  2CEA A;  4H4Y A;  2X3N A;  2CCQ A;  2BA9 A;  2M67 A;  4Z8X A;  3UU8 A;  2Q7V A;  4PAG A;  2UXN B;  2PBI A;  3ZLI A;  4U8N A;  4YTP A;  1NWM X;  3LZW A;  3N9N A;  2YLT A;  1Y01 A;  5FY1 A;  4M1P A;  4TM3 A;  2E1M A;  4C5O A;  4HN9 A;  3AB3 B;  2Q9Q C;  3UP5 A;  2XQ7 A;  1VG0 A;  3AE4 A;  4TM1 A;  1VBD 4;  2BS3 A;  4KI0 F;  2RS3 4;  2QA7 A;  4GK5 E;  3KBU A;  3KV6 A;  2WP5 A;  3UKA A;  5JRE A;  5HAX A;  3FBS A;  3HKC E;  1AR6 4;  2GRT A;  2YAU A;  3PJA J;  3SWH A;  3NNE A;  1MIV A;  2Y8D A;  4U8M A;  1E1K A;  3OJA A;  5AQR B;  4GKK T;  1H82 A;  2SPC A;  5LG4 A;  2GR3 A;  5CKU A;  1LV0 A;  4LML A;  2JB3 A;  5JDN A;  2R6G F;  5ER0 A;  5AQM B;  3S4U A;  2V7I A;  4YTM A;  1R08 4;  2BG9 E;  1UCU A;  4KX6 A;  3I9W A;  4LA1 A;  4P9S A;  2GVC A;  3UU3 A;  4I58 A;  4J36 A;  4RG3 A;  3NVO A;  2B9X A;  1CUN A;  1RYI A;  2GK9 A;  3NH3 X;  5FXX A;  1ZOY A;  3EPT A;  4FK1 C;  1MIY A;  5KVH A;  1HRV 4;  2WPE A;  1FEB A;  4Z2U A;  4K0K T;  1YKJ A;  2YG3 A;  1HNW T;  4DNA A;  2A3D A;  4J2W A;  2NP9 A;  3ZCI A;  3N9Q A;  3VKG A;  3HKE E;  3BNM A;  2VVM A;  3ZN1 B;  4AQF A;  1GXF A;  1L9E A;  1OED A;  2FJB A;  2NWB A;  2JK6 A;  4LF6 T;  3GYX A;  5CJ5 A;  3TLV A;  3J7Y q;  2VOU A;  4H2Q A;  4Q4V 4;  3NLC A;  4HFB A;  4YHJ A;  4UDQ A;  4USR A;  1RP0 A;  4HFI A;  3ZYK A;  3BHF A;  4JI5 T;  2GQF A;  2R0G A;  3SZW A;  2ODU A;  2QRX A;  5E0O A;  2NTY A;  5HXE A;  4EAH A;  2ZM6 T;  4LF7 T;  4U8O A;  4H4Q A;  4EMW A;  4HWF A;  2V6O A;  3MA9 A;  4PW8 A;  1ZP0 A;  1FOH A;  4JDR A;  3F2E A;  2FUP A;  5HEO A;  2R04 4;  5LP6 E;  4DR3 T;  3I0O A;  3LXD A;  3UKH A;  1D1B A;  3AEB A;  4OYK A;  2E9X A;  1RUI 4;  2Y6Q A;  3ONX A;  3OYZ A;  2YLW A;  2YOE A;  4H9Q C;  2CHO A;  4YSX A;  4IVM B;  1E39 A;  4DSG A;  2GMH A;  1YW0 A;  2QYW A;  2XVF A;  2XHE B;  5IHY A;  2BVM A;  5FXZ A;  1Z7S 4;  5C2T A;  3NZP A;  5CGM A;  1CJ2 A;  4JQ9 A;  2DI4 A;  4O8S A;  3JD7 4;  3SY4 A;  3MZK B;  2KIN B;  4IE7 A;  5LGU B;  4H4X A;  3ONJ A;  1KSU A;  5FS7 A;  1ZEE A;  2B9W A;  2WOI A;  5HWY A;  2XLS A;  2B7S A;  2IC6 A;  4JNQ A;  3UUX B;  1P2E A;  1WYB A;  2XQ8 A;  3NWI A;  2OAL A;  1D5T A;  3QVP A;  2LFC A;  4EM3 A;  3DH9 A;  2YLS A;  1IZN B;  1AJ3 A;  3UUB A;  3ZJ1 A;  1MO9 A;  2DHR A;  2W61 A;  4LF5 T;  4H4Z A;  2KWI B;  1W0A A;  4PK5 A;  4IRE A;  4UVB B;  2WES A;  4AQF C;  2W4X A;  4KHP T;  2WDV A;  5JRC A;  1LVF A;  5L4H A;  4DVD A;  4TX5 A;  1V9D A;  3M3Z B;  2NR4 A;  1GT8 A;  3AWI A;  5J2T E;  2UUC T;  2LOS A;  1KSS A;  2RGJ A;  4J34 A;  3H3M A;  3CQC B;  5L2L A;  2LHR A;  1XMQ T;  1ZOV A;  3UTK A;  2UUA T;  3PUV F;  5LBQ B;  1PBB A;  4JI8 T;  2BK3 A;  3D1C A;  1N32 T;  5F5W A;  3CNJ A;  2HHH T;  3RED A;  3UQ4 A;  1N4W A;  2ODV A;  5LJN A;  1PJ6 A;  3P4W A;  4CXY A;  2NW8 A;  2YWL A;  5LMU T;  3Q6J A;  1JEH A;  3IEE A;  2D5U A;  5JCL A;  1N34 T;  1GTE A;  3C64 A;  2XAJ B;  3C98 B;  4TWF A;  2CFY A;  4NTE A;  3O1J A;  3VR9 A;  1IUU A;  2X0H A;  2N9D A;  2V5Z A;  2X0Y A;  3BNU A;  5FY0 A;  5HCM A;  2ZZC A;  2R07 4;  2E9X C;  4KUM B;  4HFC A;  4NWZ A;  2CVJ A;  3HKB E;  4JLE A;  2IW5 B;  2XFP A;  5CB4 E;  3QVR A;  2LEH A;  2WOW A;  5FMH A;  2WP6 A;  4GRT A;  1OXZ A;  2V7L A;  3AED A;  4P09 A;  1H86 A;  4JI0 T;  2K5B B;  2C65 A;  2YG5 A;  3NN0 X;  4X65 T;  3CMM A;  3L8R A;  2MPK A;  3VRD B;  2XVJ A;  4U3C A;  2C5J A;  3L1R A;  4B6X A;  2RPA A;  3FBZ A;  5CA0 E;  3FZK B;  4H4T A;  5KMG P;  2GQW A;  1IJH A;  2HWC 4;  4DID B;  5LNK A;  2EQ6 A;  2V61 A;  3O0H A;  3URH A;  3GA8 A;  1D1A A;  3UUN A;  4HKA A;  2WHD A;  4U7Y A;  4HFD A;  2X99 A;  2VB6 A;  4YXD A;  4ZCC A;  2YR6 A;  2WY2 A;  2AAQ A;  2IID A;  3AE6 A;  2J4G A;  3ZC1 A;  1JRY A;  2ARD A;  4IE6 A;  2WET A;  1PHH A;  3Q5E A;  2C64 A;  4HFV A;  2YU2 A;  3KDS E;  1E7P A;  2IAK A;  4OPU A;  3PDY A;  4Z2R A;  2YR5 A;  2AXD S;  3NK1 X;  3CNS A;  3T31 A;  4WW0 A;  4O4J E;  2XM1 A;  4C90 A;  4D03 A;  5EBK A;  5HXI A;  4DMW A;  1V59 A;  4HA6 A;  4H4V A;  3ZT5 A;  3N9M A;  3G06 A;  4O5Q A;  4NUV A;  4TZ4 C;  2TMD A;  1H8T D;  1CBO A;  4C77 A;  3QB5 A;  2JAE A;  1HTJ F;  4UV8 B;  1PXA A;  1HX8 A;  4EQR A;  3NZQ A;  4A56 A;  4PJL A;  3K3Q C;  4PJN A;  4A6N A;  3K30 A;  3P4R A;  5JDG A;  4V1A v;  4CN1 A;  4KHZ F;  4EIQ A;  1R09 4;  3I0Q A;  3GMB A;  1QO8 A;  2HN2 A;  4OPT A;  4PDW D;  3AD7 B;  4EGW A;  4CCQ A;  3WI3 A;  1XZY A;  2D0U A;  3ITJ A;  3UU6 A;  1TYT A;  1VOM A;  4U2L A;  1TDO A;  3ATR A;  4I0U A;  1K0I A;  3SZ0 A;  2XQA A;  4DMV A;  2JKC A;  3ICR A;  4AQY T;  2X50 A;  2XCG A;  3GD3 A;  1NHS A;  5FYM A;  1LQT A;  4MHC A;  1OOP D;  3WAJ A;  3EUH A;  4BK3 A;  4GKJ T;  3QSM A;  1KNP A;  2WBA A;  1D7Y A;  4CI2 B;  1EL5 A;  4U7I A;  4X1K E;  4ILA A;  1GV4 A;  2APG A;  4A97 A;  1NPX A;  2PLV 4;  1LTX R;  3LAD A;  4NTD A;  4EMI A;  4L9I A;  3T0K A;  3EAB A;  5EZY E;  4IT4 A;  1LPF A;  3RP7 A;  4IE0 A;  4HE8 A;  1BF3 A;  4JI3 T;  1T8B A;  2HQM A;  3FZM B;  3BQK A;  1COY A;  4OCG A;  2KMF A;  2XYO A;  1AR7 4;  1VDC A;  1CC2 A;  4LFC T;  4DR6 T;  2OA1 A;  5LG3 A;  4AT2 A;  3GWF A;  1JRZ A;  2DCF A;  2YDQ A;  2LHN A;  1XAN A;  3U3I A;  4XWR A;  5L47 A;  3EDU A;  2WQY A;  3ZMV B;  4YKF A;  4PFO A;  4YLH A;  4JV5 T;  3D8X A;  2YG7 A;  5AQI B;  1D0Y A;  4K8D A;  4Q4W 4;  3P8C D;  3ICT A;  4XAX B;  1Q1R A;  2WEU A;  2CXL A;  3RLF F;  4C3X A;  1CC6 A;  1TDE A;  2O9Z A;  3ZT6 A;  4WNK A;  4GDE A;  2XLR A;  3IC9 A;  3SYI A;  4H4R A;  5IYZ E;  1G8X A;  4PAA A;  3B13 A;  1K5M D;  2WBL A;  2XFN A;  4U2S A;  1XPQ A;  1HCI A;  4YJ3 E;  4GF7 A;  3ZYL A;  3HYX A;  4BV6 A;  2LKG A;  3DTO A;  2OV9 A;  2LM2 A;  5LA6 E;  1DXL A;  4B3S T;  1WR6 A;  3FZH B;  2IML A;  4TLZ A;  1M6I A;  2EQ8 A;  1AL2 4;  2OAM A;  3T2Z A;  5EK4 A;  2XQ6 A;  2XDO A;  4M52 A;  4PJM A;  4QWN B;  2XUE A;  2FBW A;  3ADA B;  5FS9 A;  2Y6R A;  3RRC A;  5LBM A;  4X1Y E;  2DWG A;  3ZMS B;  2ZBW A;  1OJC A;  3LSV A;  2AQJ A;  1GRH A;  2I0Z A;  4X1I E;  1DOC A;  2H88 A;  2RGO A;  3S5W A;  4FJO A;  4AOX A;  4H4W A;  3KA7 A;  1Y56 A;  3UOX A;  1L9C A;  5EB5 A;  3C4Z A;  3H3A A;  4RHV 4;  1PBD A;  1HNZ T;  1HG5 A;  1YQ3 A;  5AQP B;  1F8W A;  3SFE A;  1UKV G;  4TNV A;  3LB8 A;  4QH5 A;  5FNV E;  3GRT A;  2PJQ A;  2XAG B;  1LVK A;  3SGL A;  4Z26 A;  3T37 A;  3CWZ B;  3RYI E;  3V5S A;  1UK5 A;  4NTC A;  5KOW A;  3E0Z A;  3KLJ A;  1IBK T;  1Z8U A;  4JY3 A;  4LFB T;  1RUE 4;  1YKH B;  4U72 A;  3UT5 E;  5J0Z A;  3AXJ A;  1RVF 4;  2GR1 A;  4B3R T;  2EHO B;  2MYS A;  4B66 A;  3T14 A;  2BCP A;  5AQK B;  4IA5 A;  4OK0 A;  3UKL A;  4DUY T;  4OPD A;  1VBC 4;  1RSG A;  4A99 A;  2VRM A;  4IVO B;  4I4T E;  2XSB A;  1OJD A;  2YR4 A;  5FY7 A;  2D9D A;  3GQK A;  1CJ4 A;  3ZPO A;  4TLX A;  3SX6 A;  2LOP A;  3GMC A;  3JAF A;  1GQE A;  1OJT A;  3DP7 A;  4EM4 A;  2XFQ A;  2ZM2 A;  3CPH G;  2YDS A;  5AQQ B;  4UF0 B;  4WBN E;  4EZ4 A;  4X66 T;  4EIW A;  1IJ5 A;  1L0V A;  3AVS A;  2XAH B;  4YFS A;  1IUS A;  3CQG B;  5HYA A;  2Q9Q D;  4A5X A;  5FVL A;  2JQ9 A;  3QSE A;  1PIV 4;  2RS1 4;  2XAS B;  3N9P A;  1X9B A;  4WX1 A;  4KMC A;  2YLX A;  4B64 A;  3MJX A;  2N2N A;  4PK6 A;  1O3X A;  2W62 A;  3AVR A;  4DR2 T;  3P1W A;  3P9U A;  3EAM A;  2GEW A;  4QX7 B;  3X1D A;  1BR1 A;  3UCL A;  2GR0 A;  2LLY A;  4H4U A;  4ZS2 A;  2JB2 A;  5FS8 A;  2XFO A;  3HA4 A;  2YU1 A;  2IDO B;  4X4J A;  1REO A;  2PZS A;  2VVN A;  2V5D A;  2H7O A;  3LBX B;  1MND A;  4X62 T;  1DJQ A;  2X9X A;  4OX9 T;  4NPP A;  2TPR A;  4H2R A;  1TRB A;  4EYY R;  1R8I A;  3OBV E;  3KVA A;  4U33 A;  1J5E T;  4GUV A;  4BJZ A;  3ZSS A;  4ZHQ E;  3AXB A;  3UKF A;  1HRI 4;  2V6Y B;  4IGU A;  2WWV A;  2HWB 4;  2DWK A;  4EQS A;  1QSD A;  4K5R A;  4N9X A;  2WM9 A;  5AQN B;  3AEG A;  3QUJ A;  1N4V A;  4U2T A;  3SS1 A;  1RUC 4;  2CWO A;  4G6H A;  1PDH A;  4CY6 A;  4ZI7 E;  3KFW X;  3CN8 A;  1D4M 4;  1AR9 4;  1N1P A;  3F8P A;  3A8Y C;  3U78 A;  5JH7 E;  3ATQ A;  2PYX A;  4QXC B;  4HTE A;  1NA1 D;  1S35 A;  3JBG 4;  2BBJ A;  2DKI A;  4CNJ A;  4GR1 A;  1CJ3 A;  3KPF A;  4CN4 A;  1MMA A;  5KVI A;  3JAE A;  3QB5 K;  2EQ7 A;  5HHF A;  3RC3 A;  3DK9 A;  3NIX A;  3UQ7 A;  1VRB A;  3AEC A;  2C7G A;  4X20 E;  4O4I E;  2JIW A;  3JSK A;  2VL8 A;  2BK5 A;  1X79 A;  5HEU A;  3PUR A;  1HYU A;  3PV0 F;  4ZI3 C;  1TDF A;  2V1D B;  1XDP A;  2R4E A;  1BR0 A;  3SZC A;  1GRE A;  4A65 A;  3FG2 P;  5L4E A;  3EI0 A;  3NRN A;  2QCU A;  5HEH A;  2K24 A;  5L3C B;  5KXJ A;  1O5W A;  1LJ1 A;  2VQE T;  5F8P A;  1F6M A;  5AQJ B;  4NIQ A;  3CPJ G;  4ADW A;  5J2U E;  5M10 A;  4YSH A;  3IA3 A;  4UVC B;  5M4Y A;  3LOV A;  5J7X A;  2BG9 B;  4BUR A;  2XTL A;  5AQT B;  4Q4X 4;  2CRB A;  1KDG A;  1ZKQ A;  3ISH A;  4Y4M A;  1BGN A;  3B6D A;  3ALL A;  3P4Q A;  3PVC A;  4USQ A;  1RMU 4;  2V3A A;  5CQF A;  4LFA T;  4AIS A;  3UOV A;  1EL7 A;  4ECH A;  1Z0P A;  4DND A;  2ACX A;  5LJM A;  3ZMT B;  2C66 A;  3NRX A;  4IDO A;  1BKW A;  2XQ3 A;  2RA1 A;  1F3P A;  3UTG A;  3COX A;  1VG9 A;  2WU5 A;  3CGB A;  2WMO A;  3NYC A;  1OJA A;  1XI1 A;  1D4C A;  2YEV C;  3KD9 A;  4YWO A;  5C3J A;  4QHO A;  1NEN A;  3GRS A;  4HB9 A;  4ILB A;  2W0G A;  2WZI A;  3A5X A;  5KWF A;  4AIU A;  3AB1 A;  5LCY A;  2OLN A;  2NPX A;  4JUY A;  1FMW A;  2KZ7 B;  2V60 A;  5EK2 A;  2R46 A;  4U2Y A;  3PUX F;  3K3O A;  4A79 A;  3LG7 A;  1OWA A;  1FEW A;  3V5U A;  2CXD A;  1KEY A;  3P4P A;  2CPT A;  2X66 A;  3D0T A;  2A8X A;  2WDQ A;  3NK2 X;  1MMD A;  2E5V A;  4GDP A;  3KV5 A;  2ZMA A;  2CLY C;  2V8S V;  1VBE 4;  4X9M A;  4HGA A;  2C67 A;  2NTX A;  1US7 B;  5LXT E;  3MK7 C;  4Z44 A;  4A9W A;  2X9W A;  5KDM C;  3ALJ A;  4E0V A;  4NEW A;  4QH1 A;  4LMK A;  4AKG A;  2E9X D;  5HEJ A;  1D4D A;  2CBJ A;  1N4U A;  3H8I A;  4ZOL E;  1DOD A;  3RGL A;  5IQ4 A;  1GTH A;  1OED C;  1PO2 4;  4IHJ E;  3GDN A;  2W63 A;  3ZCJ A;  2IUB A;  2X8H A;  4CXX A;  4UDR A;  2YK0 A;  1UUS A;  5ABE A;  4H9R C;  2XVH A;  5KMQ A;  5BRT A;  4H63 H;  3GMI A;  5LV9 A;  2A87 A;  4IST A;  4UR9 A;  1FMV A;  1RHI 4;  1JNZ A;  2WAU A;  3R6N A;  2OLT A;  1GRA A;  2A72 A;  1D4E A;  2R7F A;  2VL0 A;  3EAO A;  1S2Q A;  1I6Z A;  3Q5X A;  4B69 A;  2IC9 A;  2L8K A;  3BI4 A;  2B9Y A;  3AAE B;  3FXD B;  1FIO A;  3RIF A;  2IVE A;  2XM2 A;  2UU9 T;  4ILC A;  5JDQ A;  4N78 D; 
#chains in the Genus database with same CATH homology
 1KFY A;  4K22 A;  3T0K A;  4K7Z A;  1GRT A;  1LPF A;  3Q9T A;  3RP7 A;  3V76 A;  3M0O A;  2Z5X A;  3LJP A;  4TM0 A;  2GB0 A;  1BF3 A;  2HQM A;  1CHU A;  3P4S A;  2QA2 A;  5KMP A;  1K0J A;  1COY A;  4OCG A;  2R0P A;  2ZZ0 A;  2XYO A;  5J60 A;  1M64 A;  1VDC A;  1CC2 A;  1O95 A;  3GSI A;  2C3C A;  3CIR A;  1NHR A;  2OA1 A;  3KU9 A;  2VZ2 A;  4C74 A;  4AT2 A;  1PJ5 A;  1L9D A;  3GWF A;  1JRZ A;  1XAN A;  4XWR A;  1D7L A;  4CNK A;  5BUL A;  3NYE A;  2R4J A;  2WQY A;  1NHP A;  4YKF A;  4G74 A;  1X31 B;  3D8X A;  2C70 A;  2YG7 A;  5KMR A;  1PN0 A;  5BUK A;  4GCM A;  2C3D A;  4LU6 A;  4ZN0 A;  2C76 A;  2OLO A;  4K8D A;  4BK2 A;  3AEE A;  3ICT A;  4U8I A;  1FCD A;  1Q1R A;  2WEU A;  2YLZ A;  1Y56 B;  4C3X A;  2BRA A;  4XXG A;  1CC6 A;  2BAC A;  1PBE A;  1TDE A;  3HZL A;  2O9Z A;  3KVE A;  2WPC A;  4GDE A;  1VRQ B;  2XLR A;  3IC9 A;  3SYI A;  1B5Q A;  4A6N B;  4H4R A;  1PBC A;  4PAA A;  3QFA A;  5GSN A;  1GSN A;  5L46 A;  2XFN A;  4H4Y A;  4U2S A;  2X3N A;  3NN6 X;  1XPQ A;  4B63 A;  2BA9 A;  3DGZ A;  4IV9 A;  2Q7V A;  4GF7 A;  3HYX A;  4BV6 A;  3ZYX A;  3G5R A;  3GWD A;  2WOV A;  1JOA A;  4U8N A;  1DXL A;  2XFU A;  4YTP A;  2J3N A;  4TLZ A;  3LZW A;  1M6I A;  2FJE A;  2EQ8 A;  4FDC B;  3NK0 X;  4I59 A;  2OAM A;  2YLT A;  3T2Z A;  2Q0K A;  2XDO A;  4M52 A;  1DOB A;  2GAH B;  3M12 A;  1CC4 A;  4TM3 A;  2E1M A;  3ADA B;  2FBW A;  5FS9 A;  3UOZ A;  2Y6R A;  1NHQ A;  4NEV A;  4C5O A;  1K0L A;  4U8K A;  1NAA A;  2BK4 A;  3CND A;  4PAB A;  4BJY A;  2YG4 A;  3UP5 A;  1FL2 A;  2ZBW A;  1OJC A;  1VG0 A;  1B4V A;  3KKJ A;  3AE4 A;  2AQJ A;  4TM1 A;  1GRH A;  2I0Z A;  2BS3 A;  3B3R A;  2CDU A;  1DOC A;  1PJ7 A;  2H88 A;  1LQU A;  2RGO A;  4ZCD A;  4H4S A;  1GRB A;  5IQ1 A;  3S5W A;  4AOX A;  1NEK A;  1CJC A;  4H4W A;  3CNT A;  3KA7 A;  4H2P A;  1Y56 A;  3L8K A;  3C4N A;  1L9C A;  3UOX A;  2WP5 A;  3UKA A;  5EB5 A;  1ZDL A;  1MOK A;  1GAL A;  1PBD A;  5KOX A;  2R0C A;  3FBS A;  1YQ3 A;  3I3L A;  1GOS A;  3FPZ A;  1H6V A;  1F8W A;  3SFE A;  2GRT A;  1UKV G;  4Z25 A;  1DOE A;  3LB8 A;  5IPY A;  3AEA A;  3GRT A;  2YAU A;  4H2N A;  3NNE A;  3SGL A;  1KNR A;  3SZF A;  3T37 A;  4Z26 A;  4U8M A;  1E1K A;  4XWZ A;  1H82 A;  3S61 A;  4YTN A;  2GR3 A;  5CKU A;  1LV0 A;  4NTC A;  3T2K A;  4JY2 A;  2JB3 A;  2YQU A;  3KLJ A;  5KOW A;  4JY3 A;  3UTE A;  1EL9 A;  1GET A;  3AE9 A;  2AR8 A;  3NTD A;  4RSL A;  5ER0 A;  3WE0 A;  4YTM A;  2GR1 A;  2XLU A;  4B66 A;  4KX6 A;  4IA6 A;  3T14 A;  2WP9 A;  1F8S A;  2BCP A;  4LA1 A;  4P9S A;  3DME A;  4Y4L A;  1NDA A;  2GVC A;  4I58 A;  3K7T A;  4IA5 A;  4J36 A;  4RG3 A;  5JCN A;  3AE7 A;  3H4K A;  2WS3 A;  1DJN A;  2B9X A;  2BYB A;  3UKL A;  1RYI A;  5HY5 A;  3NH3 X;  3CGE A;  4OPD A;  3BI5 A;  1RSG A;  4J31 A;  4A99 A;  1IUV A;  1NG3 A;  2VRM A;  1YQ4 A;  1ZOY A;  1EL8 A;  1OJD A;  3EPT A;  4IVO B;  4FK1 C;  1GND A;  2R9Z A;  5KVH A;  3FIM B;  4D04 A;  2WPE A;  1FEB A;  4Z2U A;  2WU2 A;  2YR4 A;  1YY5 A;  1YKJ A;  2YG3 A;  1ONF A;  1P2H A;  4GAV A;  3GQK A;  1CJ4 A;  4JNA A;  4DNA A;  3ALM A;  4J2W A;  4CCR A;  4TLX A;  1SEZ A;  1GER A;  3SX6 A;  1QJD A;  2GF3 A;  3AYJ A;  2VVM A;  2C4C A;  1H83 A;  3BNM A;  3GMC A;  1OJT A;  2NVK X;  4EM4 A;  3DA1 A;  1GXF A;  2XFQ A;  3CPH G;  4J56 A;  2DKH A;  5FS6 A;  4EQX A;  1L9E A;  2FJB A;  2JK6 A;  2YM2 A;  1L0V A;  3GYX A;  4G6G A;  3KPK A;  3SUC A;  1IUS A;  1K4Q A;  2VOU A;  4B68 A;  1B8S A;  4H2Q A;  1E6E A;  3QSE A;  1S3B A;  3NLC A;  1DNC A;  1ZY8 A;  4EMJ A;  2H89 A;  1GPE A;  4UDQ A;  3GYI A;  4WX1 A;  4KPR A;  4USR A;  1RP0 A;  2YLX A;  4B64 A;  3DJG X;  1PS9 A;  2C73 A;  3V3O A;  3CNP A;  5DBJ A;  4GAP A;  3BHF A;  2GQF A;  4OPC A;  5BVA A;  2R0G A;  3P1W A;  3P9U A;  3SZW A;  2GEW A;  1E1N A;  1E1L A;  3GDP A;  3UCL A;  2GR0 A;  4H4U A;  4H4Q A;  4U8O A;  2XLP A;  3EAN A;  1IUX A;  2JB2 A;  3C96 A;  2XFO A;  3QJ4 A;  5FS8 A;  4OPG A;  3CTY A;  4Z43 A;  3G5S A;  2V6O A;  3VQR A;  1IUW A;  2C72 A;  1ZP0 A;  1FOH A;  2F5Z A;  4JDR A;  4X4J A;  2PHH A;  1REO A;  3LXD A;  3AYI A;  3UKH A;  1BZL A;  1DJQ A;  3AEB A;  2TPR A;  4H2R A;  1TRB A;  2Y6Q A;  4LII A;  1JRX A;  2QAE A;  4GUV A;  3SQP A;  4A5L A;  3K7M X;  4BJZ A;  2YLW A;  3AXB A;  3UKF A;  3K7Q X;  4YSX A;  4IVM B;  1H7X A;  1E39 A;  4EQS A;  4DSG A;  4K5R A;  2GMH A;  4N9X A;  3AEG A;  1N4V A;  2XVF A;  3LZX A;  4U2T A;  4B67 A;  4G6H A;  1O94 A;  1PDH A;  4CY6 A;  1TDK A;  5C2T A;  3CN8 A;  1CJ2 A;  2CUL A;  3PO7 A;  4JQ9 A;  4II2 A;  3SY4 A;  1N1P A;  4H4X A;  2VRL A;  3F8P A;  1MXT A;  1ZMC A;  3ATQ A;  4G73 A;  1Q9I A;  1JNR A;  3II4 A;  2PYX A;  3AE1 A;  1KSU A;  5U25 A;  5FS7 A;  2WOI A;  2B9W A;  1KF6 A;  2XLS A;  3IWA A;  2BAB A;  2B7S A;  3OZ2 A;  4UDP A;  2GR2 A;  1P2E A;  2GH5 A;  4JNQ A;  2DKI A;  4YSZ A;  3VRA A;  4CNJ A;  2UZZ A;  2OAL A;  4GR1 A;  1CJ3 A;  1S2Y A;  1D5T A;  3V3N A;  1ZMD A;  3QVP A;  3KPF A;  2LFC A;  2E4G A;  3DGH A;  3DH9 A;  4EM3 A;  2YLS A;  4K2X A;  3CGC A;  5KVI A;  2BRY A;  5KNL A;  2A89 A;  4Z24 A;  1MO9 A;  5HHF A;  2EQ7 A;  3NT6 A;  3DK9 A;  3NIX A;  4H4Z A;  2IVD A;  2B76 A;  3AEC A;  1PXC A;  2WES A;  2C7G A;  2C75 A;  3E1T A;  2EQ9 A;  5KMS A;  2WDV A;  4OPL A;  3JSK A;  3AD9 B;  2BK5 A;  4U8L A;  4EQW A;  1PXB A;  2QA1 A;  1HYU A;  3SFD A;  1GT8 A;  2YVF A;  3AWI A;  2BC1 A;  1TDF A;  1W4X A;  3QFB A;  2R4E A;  1KSS A;  2RGJ A;  3IF9 A;  1TDN A;  4J34 A;  3SZC A;  1FEA A;  1GRE A;  1ZOV A;  4K5S A;  3UKQ A;  3FG2 P;  4A65 A;  3NRN A;  1PBB A;  3EF6 A;  2QCU A;  2W0H A;  2BK3 A;  4U8P A;  3D1C A;  5KXJ A;  1O5W A;  1LJ1 A;  1IUT A;  3CNJ A;  4FX9 A;  4H4P A;  3VRB A;  1F6M A;  3CPJ G;  3RED A;  4ADW A;  4DSH A;  5M10 A;  1N4W A;  2YVJ A;  4YSH A;  2ACZ A;  3R9U A;  3AE8 A;  3LOV A;  3I6D A;  4NZH A;  4X9N A;  5J7X A;  4AP1 A;  1PJ6 A;  3H8L A;  4BUR A;  2YWL A;  4J57 A;  3Q6J A;  1JEH A;  1GRG A;  5JCL A;  3RHA A;  3SXI A;  1GTE A;  1KDG A;  5HYM A;  1ZKQ A;  1CF3 A;  2Q6U A;  3ISH A;  3IHM A;  2CFY A;  2XLT A;  4NTE A;  4Y4M A;  3VR9 A;  1IUU A;  1H7W A;  3ZDN A;  1BGN A;  2V5Z A;  3ALL A;  3B6D A;  3BNU A;  3F8D A;  3AYL A;  3CGD A;  3VR8 A;  2ZZC A;  3P4Q A;  3PVC A;  4USQ A;  4WCT A;  2V3A A;  5CQF A;  5M0Z A;  3RP8 A;  3DK4 A;  4C3Y A;  4REK A;  3UOV A;  2V3B A;  2CVJ A;  4NWZ A;  2VQB A;  4Z2T A;  2XFP A;  1EL7 A;  3QVR A;  3BHK A;  1BWC A;  4ECH A;  2WOW A;  3BI2 A;  1QLB A;  1LVL A;  2BS4 A;  5FMH A;  2WP6 A;  4BK1 A;  4GRT A;  2C66 A;  2X8G A;  4RG4 A;  3UKP A;  5KRQ A;  1BKW A;  3AED A;  2RAB A;  2VVL G;  1ZX9 A;  1ELI A;  2BXR A;  1H81 A;  1H86 A;  3DJD A;  5EB4 A;  4FK1 A;  2C65 A;  3CPI G;  1F3P A;  1Z6L A;  2YG5 A;  3NN0 X;  3UTG A;  3T2Y A;  4CY8 A;  3COX A;  1VG9 A;  3CMM A;  2BXS A;  2WU5 A;  4YSY A;  3CGB A;  4UP3 A;  4DGK A;  2R45 A;  3VRD B;  1B37 A;  2XVJ A;  4O5U A;  3L1R A;  4EMW A;  3NYC A;  4II3 A;  5JCI A;  1OJA A;  1H84 A;  1D4C A;  3FMW A;  3KD9 A;  4YWO A;  5C3J A;  1NEN A;  4U8J A;  3DJE A;  4H4T A;  2GQW A;  1IJH A;  2X8C A;  4MJW A;  3GRS A;  4HB9 A;  2Q0L A;  3UP4 A;  2EQ6 A;  2V61 A;  2BS2 A;  5KWF A;  3O0H A;  1GEU A;  3NG7 X;  3URH A;  3AB1 A;  2OLN A;  2NPX A;  4OVI A;  4B65 A;  2WHD A;  2X99 A;  2YG6 A;  5EOW A;  4YXD A;  3DK8 A;  4ZCC A;  2YR6 A;  1BGJ A;  2V60 A;  2AAQ A;  2IID A;  3AE6 A;  1JRY A;  4B1B A;  2ARD A;  2R46 A;  3RP6 A;  2WPF A;  2YLR A;  2WET A;  4A7A A;  1NG4 A;  2B7R A;  1PHH A;  2YM1 A;  3QSS A;  4A79 A;  4AOS A;  1XHC A;  2C64 A;  1F8R A;  5TR3 A;  1E7P A;  4AP3 A;  4YKG A;  3IHG A;  2FJA A;  3RNM A;  4CRT A;  2GMJ A;  3P4P A;  3GYJ A;  3NYF A;  4OPU A;  4Z2R A;  2YR5 A;  3DJJ A;  2A8X A;  4G9K A;  2WDQ A;  1CL0 A;  2XVI A;  4H7U A;  3AE2 A;  2JBV A;  3M13 A;  3NK1 X;  3CNS A;  3T31 A;  3NK2 X;  3NKS A;  2E5V A;  4GDP A;  3UKK A;  4X9M A;  4TM4 A;  2C67 A;  2ZZB A;  1VQW A;  5EBK A;  4D03 A;  5HXI A;  1Q1W A;  1TYP A;  2GAG B;  1V59 A;  4HA6 A;  4H4V A;  3HYV A;  4O5Q A;  1XDI A;  4Z44 A;  4A9W A;  3G5Q A;  3UTF A;  2TMD A;  3ALJ A;  3NTA A;  4NEW A;  4Y4N A;  2VVL A;  1CBO A;  4C77 A;  4E0V A;  3AE5 A;  2JAE A;  4EIP A;  3ABV A;  1D4D A;  1OJ9 A;  1Y0P A;  1PXA A;  3F8R A;  2BC0 A;  4EQR A;  1N4U A;  3H8I A;  3AE3 A;  1EBD A;  3C4A A;  4A6N A;  4YT0 A;  3K30 A;  3P4R A;  1DOD A;  1JU2 A;  3GD4 A;  5IQ4 A;  1GTH A;  2GV8 A;  4H50 A;  4OPI A;  4EIQ A;  3AD8 B;  3GMB A;  1QO8 A;  5U63 A;  1PBF A;  3OC4 A;  1E1M A;  3GDN A;  4OPT A;  3AD7 B;  3HYW A;  2YVG A;  4CBQ A;  4CCQ A;  4NNJ A;  2X8H A;  1GES A;  3ITJ A;  4UDR A;  1TYT A;  2RGH A;  2Z5Y A;  4U2L A;  1TDO A;  3ATR A;  2XVH A;  4J33 A;  5KMQ A;  3NGC X;  1K0I A;  3ICS A;  5BRT A;  3SZ0 A;  2JKC A;  2FJD A;  3ICR A;  5LV9 A;  2A87 A;  2JB1 A;  2X50 A;  2XCG A;  3GD3 A;  3NHO X;  1NHS A;  1YQZ A;  1LQT A;  1JNZ A;  1GRF A;  2XVE A;  3UOY A;  3GQH A;  4ICY A;  4BK3 A;  3SM8 A;  1S3E A;  3QSM A;  1GRA A;  2WDR A;  1D4E A;  2VQ7 A;  3EAO A;  1KNP A;  1S2Q A;  1D7Y A;  2BCG G;  2WBA A;  3PS9 A;  1EL5 A;  4B69 A;  1GV4 A;  2APG A;  5JCK A;  3BI4 A;  1NPX A;  2B9Y A;  5JCM A;  1LTX R;  3LAD A;  4NTD A;  2IVE A;  3UTH A;  4APN A;  1AOG A;  4AT0 A;  3AEF A;  4EMI A;  1FEC A;  5U1O A;  4JN9 A;  5GRT A;  1ZK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...