3VR8A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
total genus 206
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr8A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr8A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr8A04
5J60A 2ZBWA 4X4JA 4K8DA 1YY5A 3ITJA 3VR8A 4Z44A 3KKJA 1YQ3A 5GSNA 4EM3A 3ALMA 1QO8A 1FL2A 1Q9IA 2WDVA 1H83A 3K7MX 2R0PA 3G5RA 5M0ZA 2VVMA 3OC4A 4EQXA 1AOGA 2XLUA 2GQFA 4H50A 2X8CA 1GRGA 3CPIG 3DJDA 5EB4A 4ZCCA 3UCLA 2GB0A 3IHGA 4K5RA 2WHDA 1KF6A 1LQTA 3NT6A 2CDUA 1D4EA 2XFOA 2PYXA 2XVHA 4U8LA 3KD9A 4OPGA 3VRBA 3AE8A 1L0VA 1CC6A 1ZOYA 3O0HA 4J31A 2GAHB 2OAMA 3NTAA 1NEKA 2AAQA 2O9ZA 1PXAA 1PJ7A 3BI2A 1E1NA 4TLZA 3NKSA 1LJ1A 2H89A 2JB2A 3QSEA 1ZK7A 3EANA 4K22A 1TDNA 1VQWA 2VRMA 3FG2P 4TLXA 3AEAA 3UP5A 4K7ZA 4GCMA 2XVJA 4IV9A 3NYEA 4UDQA 1JRZA 2XVFA 2XLSA 1CJCA 1Y56B 3GWFA 3C4NA 4EMIA 1RSGA 3GSIA 1PBDA 4CCQA 3RHAA 4YWOA 1VG9A 1FEAA 1IJHA 2R46A 3PO7A 2Y6QA 3I3LA 2XDOA 3NG7X 5KVIA 3AXBA 3BI5A 1GNDA 4C74A 4FX9A 4OCGA 4XXGA 1D4CA 4YT0A 3NTDA 3UP4A 1N4VA 4J56A 1NHSA 2CFYA 2YVFA 3AD7B 3ALJA 1GXFA 2XFQA 3V3OA 2YG6A 2A87A 2BC1A 3CGCA 3UTEA 3VQRA 4DSGA 1GRBA 4Z2UA 1NG3A 3KVEA 2YVGA 4CNKA 4A6NA 2V3BA 5EBKA 4J34A 3Q9TA 4BV6A 3P4RA 1BWCA 1OJCA 2FJAA 1E39A 3CTYA 1TYPA 3IC9A 2R4EA 1TRBA 4FK1A 2GRTA 2BCPA 2DKHA 4RSLA 2WP6A 3H8IA 3BNUA 3LXDA 4O5QA 3QSSA 2BCGG 3DH9A 4A9WA 1B8SA 4O5UA 1CL0A 1NAAA 2ZZCA 3GMCA 1CJ2A 2R45A 5LV9A 1LPFA 3AWIA 4YSYA 2WOVA 1CHUA 1KNPA 2BC0A 4C5OA 1FCDA 3B3RA 3ABVA 4A7AA 1QJDA 2GVCA 4USQA 2C65A 4YTNA 2FJDA 1H84A 3DA1A 4U8KA 3RP7A 4OPCA 2WDQA 2A8XA 2R9ZA 4RG4A 1GEUA 5JCKA 3H8LA 5KVHA 1N4WA 5IQ1A 4Z2TA 3VR9A 3AE5A 3DJGX 2C73A 1B37A 1E6EA 1NHQA 1W4XA 2BYBA 3EAOA 4BK1A 1KNRA 1OJ9A 1ZX9A 4GF7A 5J7XA 3NH3X 2GF3A 2OA1A 2NPXA 4EQSA 2YG7A 4YTMA 2AR8A 1JRYA 3CNDA 3NIXA 4H2NA 1O95A 5U25A 4MJWA 4NZHA 1EL8A 1H7WA 2WS3A 1ZKQA 4U8IA 4WX1A 3H4KA 3I6DA 1B4VA 2B7RA 2V5ZA 2X99A 3FMWA 4LU6A 5U1OA 2GR3A 3SFEA 3G5SA 4AP3A 4U8MA 5KOWA 3DK4A 1CBOA 3QSMA 1PBFA 1V59A 3IWAA 3RP6A 1DOBA 4RG3A 1D5TA 1LV0A 3M0OA 2JB3A 4IVMB 4D04A 3G5QA 3COXA 2YR4A 1LVLA 2BA9A 2QA2A 4YKFA 1IUUA 5JCNA 3EPTA 4C3XA 1H82A 3NHOX 2EQ9A 5EB5A 2JB1A 1O5WA 1KSUA 2XFUA 5GRTA 3P4SA 5JCMA 3IHMA 4LIIA 2WPCA 4B63A 2YM1A 4A99A 2APGA 3S5WA 1MO9A 2GQWA 2BXSA 3II4A 1IUSA 3JSKA 4Z43A 4B66A 1ONFA 4N9XA 1PS9A 3NLCA 3UKQA 1F3PA 3UOVA 3ATRA 2LFCA 2R0GA 1PXCA 2WETA 3GDNA 3WE0A 4EM4A 3GYXA 1ZDLA 4IA6A 4H4WA 1XHCA 1EBDA 2WOWA 1OJTA 1N1PA 4CRTA 4FDCB 3AE6A 3UKHA 1TYTA 5FS9A 3EF6A 4K2XA 1CC2A 5CKUA 3AEGA 4J36A 1PJ5A 2E5VA 3NK2X 2WQYA 3GD4A 4PABA 3SUCA 4AOXA 1MXTA 4GRTA 1K0IA 2IVDA 3M13A 2VQBA 3NYCA 4DGKA 2JAEA 4HB9A 4AT2A 1S3BA 1GRAA 2RGHA 1ZMDA 3LB8A 5HY5A 2TMDA 3K7TA 4PAAA 2BS4A 3AECA 3CPJG 3GDPA 4H4PA 4A6NB 4EQWA 3NK1X 4YSXA 2E1MA 5JCIA 2JKCA 3P9UA 1N4UA 4JN9A 1GREA 1YQZA 3C4AA 2CVJA 3AE1A 2W0HA 2X8HA 2X8GA 2YG3A 3DJEA 3GYIA 2XLTA 3D8XA 4NTDA 1P2EA 4AP1A 1D4DA 1CC4A 1EL9A 3CIRA 1JOAA 2XFNA 3Q6JA 5CQFA 1TDOA 3RNMA 5HHFA 1BGJA 1NDAA 2DKIA 5HXIA 1PBEA 1PJ6A 4LA1A 1FEBA 1VDCA 4A5LA 1S2YA 2XVEA 2BS3A 3L1RA 5FS6A 4Y4LA 2C3DA 1GRHA 2V3AA 4APNA 3QFAA 1PHHA 5JCLA 5BULA 2Z5XA 4U8JA 4Z24A 4BJYA 4UDPA 1DJQA 5EOWA 3SM8A 5TR3A 4UDRA 1TDFA 1NG4A 2R4JA 3F8PA 3CNSA 4H7UA 1CF3A 1EL5A 4TM4A 3IF9A 4B1BA 4B69A 4OPUA 4AOSA 4D03A 2B9XA 2TPRA 4OPTA 3URHA 2GR1A 3ICSA 3AD8B 2WBAA 3DK8A 1H7XA 2V61A 2IVEA 3AEBA 4OPIA 1ZP0A 4CNJA 3UKKA 2WP9A 2YLZA 2YQUA 3AYIA 2F5ZA 2JBVA 3PS9A 4ECHA 2ARDA 4H2RA 1SEZA 2YM2A 3CPHG 2WEUA 3R9UA 1HYUA 3NN6X 4J2WA 3AEFA 2OLNA 3ADAB 1Q1RA 2C64A 2Z5YA 1COYA 3T37A 2FBWA 2XLPA 1K4QA 4U2LA 4CBQA 3KLJA 4WCTA 1NHPA 3AD9B 3DMEA 2BK4A 1GRTA 2WU5A 3NNEA 2B9YA 2C66A 2WESA 1EL7A 3CNJA 4H4YA 5IQ4A 1IUVA 2RABA 4GDEA 2WDRA 4B65A 1YQ4A 4JNQA 2V6OA 5BVAA 2YR6A 1KSSA 3GRSA 3OZ2A 4E0VA 4JY3A 3GD3A 2EQ8A 1BZLA 2C7GA 3AEDA 1ZOVA 2C72A 2Q0KA 3FIMB 3ISHA 3PVCA 2GEWA 2GV8A 1P2HA 2Q7VA 3NRNA 4OPDA 2GR0A 4X9NA 1FOHA 3QVPA 1DOCA 3UKPA 4JY2A 3GYJA 4CY6A 3AYLA 1LQUA 2GMHA 1TDKA 1L9EA 1H81A 2VQ7A 2YAUA 1PBBA 3DK9A 3GQHA 3CGDA 3AB1A 4C3YA 1F8WA 2OALA 3LJPA 3LZWA 2E4GA 3V76A 3L8KA 4KX6A 2VZ2A 2X50A 3AYJA 1KFYA 4YTPA 2YLWA 2QA1A 3KU9A 4USRA 5HYMA 3VRDB 2YLXA 1GPEA 3FBSA 1BF3A 1JEHA 1GT8A 1GTHA 4ZCDA 1Q1WA 5C2TA 3UOYA 2XLRA 4K5SA 3AE2A 1GALA 1Y0PA 1CJ3A 3KPFA 4GUVA 4H4RA 4H4SA 4Y4NA 2HQMA 2B9WA 1XPQA 4FK1C 1GOSA 2ACZA 2RGJA 1JU2A 2C3CA 1E1KA 1E7PA 5KRQA 1F8SA 3QJ4A 4UP3A 1VRQB 2NVKX 5M10A 3HZLA 3ICRA 3GMBA 4BJZA 1NENA 4I59A 2Q0LA 3UKFA 1ZMCA 2OLOA 3UTGA 2R0CA 1RP0A 4YKGA 5U63A 5C3JA 1PXBA 2EQ7A 2YLSA 1S2QA 1REOA 4XWZA 3UKAA 4EQRA 3P1WA 2C75A 2VVLA 2WOIA 5KXJA 2BS2A 1IUWA 1F8RA 4CCRA 3AEEA 2GH5A 3GWDA 4A79A 4J33A 1GERA 2YG5A 4U2TA 2XFPA 3CGBA 3DGZA 1D7LA 2X3NA 3LZXA 3GRTA 4GR1A 2YLRA 4M52A 4EIQA 2B76A 1RYIA 2EQ6A 1NHRA 3NYFA 2ZZBA 3ICTA 4IVOB 3M12A 4H4QA 1NPXA 3SGLA 4H4UA 2V60A 2GMJA 5FS8A 2YVJA 3AE4A 2YG4A 3NN0X 4A65A 4YXDA 3E1TA 1M6IA 4Y4MA 1H86A 4B68A 5DBJA 3BI4A 2WPFA 2WPEA 4NTEA 4KPRA 3LADA 2YLTA 2UZZA 4H2QA 4JQ9A 3KA7A 4U8PA 1XANA 3DGHA 4H2PA 2IIDA 1PDHA 4P9SA 1VG0A 4IA5A 2XCGA 4EMJA 3CN8A 2BACA 5FMHA 4H4TA 3ZDNA 3CNPA 4B67A 1Y56A 2QAEA 2RGOA 5BRTA 3NK0X 1DODA 3CGEA 4CY8A 2VOUA 2VVLG 1GV4A 1JNZA 3ATQA 3CNTA 3DJJA 2BK5A 3K7QX 4H4XA 3VRAA 4X9MA 1LTXR 1PN0A 4JDRA 2FJEA 1M64A 4C77A 1YKJA 2ZZ0A 3K30A 3NGCX 3LOVA 2XYOA 3SQPA 4BK2A 1GETA 3C96A 3FPZA 1OJAA 4EIPA 4JNAA 4TM1A 1MOKA 4ICYA 2J3NA 4NTCA 3GQKA 1Z6LA 1UKVG 2C76A 2Y6RA 1QLBA 4I58A 1DXLA 5ER0A 3AE9A 3SFDA 3REDA 2GAGB 4GDPA 1DJNA 1E1LA 2GR2A 4ADWA 2YWLA 4U8NA 1GRFA 3V3NA 4BK3A 1KDGA 2H88A 1OJDA 2PHHA 3B6DA 3ZYXA 1D7YA 2CULA 4H4VA 3UOZA 3P4PA 1FECA 1ZY8A 3F8RA 3UTHA 1BGNA 4H4ZA 4YSHA 1IUTA 1H6VA 1L9DA 3BHKA 4OVIA 3S61A 1O94A 1JRXA 4DNAA 4DSHA 2C70A 1E1MA 4Z2RA 1IUXA 1S3EA 5IPYA 4HA6A 2I0ZA 4TM3A 4U8OA 4OPLA 3ALLA 2WU2A 3RP8A 3AE3A 4Z26A 2VRLA 1ELIA 4B64A 1JNRA 4ZN0A 1CJ4A 1TDEA 2C67A 1GESA 3UKLA 4EMWA 2B7SA 4YSZA 5L46A 3BNMA 3QFBA 3UTFA 1XDIA 3UOXA 3P4QA 5BUKA 5KOXA 1K0LA 2WP5A 1B5QA 2BXRA 1F6MA 2QCUA 3D1CA 2YR5A 4REKA 1X31B 1GSNA 2XVIA 2JK6A 2BK3A 2A89A 2Q6UA 4J57A 4NEWA 4XWRA 4AT0A 4NEVA 4BURA 5KWFA 1BKWA 2FJBA 1PBCA 2BABA 1GTEA 1DOEA 3BHFA 4U2SA 3AE7A 3F8DA 4TM0A 1K0JA 4Z25A 5FS7A 3QVRA 1L9CA 2AQJA 1DNCA
chains in the Genus database with same CATH superfamily
2ZBWA 4K8DA 1VBB4 4Z44A 1YQ3A 4ZEYA 1FL2A 1WYCA 2LKGA 3G5RA 1N33T 1ZEEA 4PFPA 1AOGA 2QYWA 2XLUA 4ZCCA 3MKDA 5A1LA 3CPIG 4O4IE 4ZXLA 2WHDA 3NT6A 2XFOA 4U8LA 5AQJB 5KX5E 4OPGA 2XASB 1ZOYA 4QX8B 3O1IA 1MNDA 3NTAA 1NEKA 2YKSA 5EK4A 2O9ZA 1PXAA 1PJ7A 4TLZA 1HNXT 3TLTA 3SWHA 4P0AA 1OOPD 3VKGA 2BG9C 2JB2A 2YINA 1TDNA 1VQWA 3FG2P 3ETVA 3UP5A 4GCMA 5HXRA 1JRZA 3P50A 2XLSA 2X9HA 5M4YA 1Y56B 5LG4A 1PBDA 1VG9A 3RPUA 3FZMB 1D1BA 3UQ7A 2XDOA 1DU2A 3AXBA 1GNDA 4XXGA 3N9LA 4YT0A 4KHPT 1XMQT 1NHSA 2CFYA 3AD7B 2V6YA 1GXFA 2XFQA 1IJ6A 1N32T 3VQRA 3UTEA 4DSGA 4YHHT 2QA7A 1GRBA 1UUSA 1XDPA 2V5DA 2UU9T 3ONLC 5EBKA 3Q9TA 2R044 3AA6B 3O1HA 3RIAA 5JH7E 4BV6A 5DQWA 3IC9A 1TYPA 1KK7A 4COFA 5L4EA 4FK1A 2N2NA 2BCPA 3LK2B 2DKHA 4EEBA 3QSSA 2VURA 4TV8E 2BCGG 4YHJA 2NTXA 4A9WA 2R074 4OX9T 4O5UA 1NAAA 4ISSA 1LPFA 1BR4A 1KNZA 2WOVA 1HX8A 2BC0A 1FCDA 4J2CA 3B3RA 5AQVB 3IEEA 1QJDA 4WYVA 1HX1B 5KVHA 3P8CD 2WCAA 4HFDA 1XWMA 5KMQA 2C73A 1E6EA 5HXEA 4BK1A 2I59A 3FXDB 5J7XA 5KMRA 2UXCT 2GF3A 2OA1A 2J1DG 4IE7A 4LF7T 1H7WA 3Q9DA 2BRAA 3I6DA 4LU6A 2CCQA 4E7SA 5U1OA 1WYBA 3ZMTB 2VB6A 3OKQA 4A98A 4AKGA 2VVSA 2WAUA 4OHFA 1DOBA 1R8IA 1LV0A 3M0OA 4IVMB 3GA8A 4O2BE 2W62A 2X51A 4XZCA 2YR4A 1LVLA 3EPTA 4C3XA 2EQ9A 4ZI3C 3IHMA 4HGAA 4B63A 1Z0PA 4AKRB 3EUHA 3SZCA 3N9QA 5LJNA 4JBWF 1Y64B 1OJTA 2Q9QA 3VHLA 2UXXB 3G06A 3AE6A 3FZHB 4Q4W4 4PJLA 1CC2A 3B5MA 2E5VA 1PJ5A 4PABA 2D0TA 3MXZA 4GYRA 4UR9A 4ADZA 2W00A 4DBQA 1MXTA 3T31A 5L3DB 2IVDA 5F3JA 4HB9A 4AT2A 5ABGA 5HY5A 2YEVC 4X20E 2KINB 3AVRA 4YJ3E 1FMVA 3UU3A 5JR9B 5LXTE 4H4PA 4DV5T 2E1MA 4JN9A 1VBE4 5LHHB 2X66A 5JVDE 2R064 2X8GA 3GYIA 1MIVA 3HA4A 1CC4A 4HWIB 2ODUA 3RNMA 4KP3C 3HKEE 3A7MA 5JR9A 5HHFA 3RYCE 4PJJA 3LK42 1S2YA 4H63V 3CVRA 2XAFB 2VVNA 2V3AA 5JCLA 2Z5XA 5LGTB 4BJYA 5HEOA 1NWMX 3SM8A 2D0UA 2HH7A 1NG4A 3CNSA 3NRXA 2D2SA 4GAVA 4AOSA 3SX6A 2B9XA 4OPTA 4K0UA 2WBAA 1HRI4 3AEBA 4OPIA 4CNJA 4JEHB 3AAEB 2YK0A 4M1PA 2YLZA 4ECHA 2BG9A 3JADA 1SHZC 4H2RA 1SEZA 2YM2A 4B6XA 3CPHG 3R9UA 1COV4 3NN6X 5FVLA 4J2WA 5AQKB 3C51A 2V7LA 1Q1RA 2CE7A 3NWIA 3FXEB 4U2LA 1NHPA 4H4YA 2E9XD 4B65A 2V6OA 4ANJA 1HTJF 5LGNB 1WR6A 4E0VA 3GD3A 2R7FA 4DUZT 2PYJA 1LVFA 3FIMB 2GEWA 2Q7VA 2UUCT 4OPDA 4ERRA 5AQSB 1LKXA 1DOCA 5LBMA 3AYLA 1LQUA 3AA0B 1TDKA 2PLV4 3HKDE 2YAUA 5AQUB 3CGDA 3AB1A 4C3YA 3LZWA 1OWAA 2X50A 3AYJA 1KFYA 2JJ9A 4X1IE 2QA1A 2YLXA 4KBMB 3PUQA 2LSIA 4RHV4 3N2KE 3SZFA 1Y0PA 3KPFA 4H4SA 5KMSA 3T1HT 3ANWA 2ACZA 3OPCA 1E1KA 2C3CA 3C4ZA 4UP3A 3QJ4A 4JI6T 5M10A 2LM9A 3HZLA 2CXDA 1NENA 5HEUA 2KT9A 2LRKA 3ZYMA 3UTGA 2HPLA 4QWNB 3PTRB 3C50A 3JBG4 2ZM8A 1REOA 3RC8A 4PK6A 2WOIA 1F8RA 4U7IA 2XQ9A 5L3EB 3AEEA 3KV5A 1IBLT 2GH5A 1GERA 2YG5A 4G73A 2XFPA 4YLHA 1D7LA 4EIQA 3GRTA 3VKHA 2YLRA 1RUE4 4E7ZA 2EQ6A 4AQGA 2BKPA 3NYFA 3ICTA 4H63H 4H4UA 2GMJA 3TLWA 3AE4A 3NN0X 4A65A 4Y4MA 2Y48B 2A72A 4ZI7E 3O9XA 3WAJA 2V6XA 2K5BB 2YLTA 4JQ9A 2OLTA 4JI7T 3GN5A 2W61A 5HEHA 1VCSA 2AXDS 4C91A 2KSRA 1PDHA 2IIDA 2VL0A 3ESLA 2EHOC 3R84B 4NUUA 2XCGA 2NR4A 5AQLB 3CN8A 3NZPA 4QXHB 5LMNT 5LMUT 3V5UA 2N1GA 2JMHA 1W09A 2RGOA 3CGEA 4CY8A 2VOUA 4DR3T 4H4XA 1J5WA 3VRAA 5FKYA 1V9DA 2RA1A 2Z6EA 5AQTB 4JI1T 2VWAA 4C77A 1YKJA 3ZT6A 4ZZBA 3J8F4 3FPZA 5LNKA 3LFMA 3UULA 4ICYA 1T7SA 4HWHA 4X66T 4AKIA 3PUXF 2Y6RA 4I58A 1DXLA 2WZHA 5ER0A 3ZJ1A 3ZC0A 3REDA 1DJNA 4ADWA 2YWLA 2IIUA 3ZYXA 2CPTA 3UOZA 3P4PA 4BAYB 1O94A 4Z2RA 4MFRA 4OPLA 4QKNA 1WR0A 5EK3A 4HFVA 2ZMAA 1HS7A 3F2EA 4DBRA 4HWFA 3UTFA 2CWYA 3UOXA 4MLKA 5BUKA 3E0ZA 2RR14 1F6MA 2ZM6T 2V7IA 4WW0A 1RUC4 5IUXA 2XVIA 1K5MD 2IC6A 4G63A 2VQET 5AQNB 2X68A 2BK3A 1YKHB 3P7IA 2BABA 1GTEA 1E2AA 4U2SA 3F8DA 3C98B 3RC3A 4EGWA 3PU8A 5J60A 4AQYT 3GWHA 1AR64 2HWB4 2G0UA 3KKJA 1RHI4 2UXDT 1H83A 5M0ZA 1Y01A 1XDOA 2CWOA 2VVMA 4EQXA 3RIUC 4H50A 2XQ6A 2X8CA 4UVCB 2GB0A 3IHGA 2JQ9A 4K5RA 3RI5A 3T8OA 2CEAA 2PYXA 1HFAA 2C0SA 3KPKA 3VRBA 2OAMA 4B3MT 2AAQA 2J47A 1LJ1A 2CA5A 3LK3B 4L9IA 1X79A 4I4TE 1HF8A 5GONE 5LCYA 4LFCT 3C4XA 3V5SA 2XVFA 3BQLA 4EMIA 1RSGA 3RRCA 4CCQA 3L3PA 4ILUA 4HFCA 1FEAA 1IJHA 3PO7A 3I3LA 1LRZA 4AQFC 3CX6B 3BI5A 4IE0A 4FX9A 3ZC1A 1J5ET 2E9XC 1D4CA 4LF9T 1N4VA 2IAKA 2A87A 3CGCA 3JAFA 5DJQC 3KVEA 1S35A 2CM0A 4WZXA 2NP9A 3H3AA 4J34A 2XAGB 4YY3T 3I0OA 3SZ0A 1E39A 2N9DA 4MALA 2GRTA 2WP6A 3SYIA 2NW9A 4F8HA 3LXDA 4UF0A 4H9SE 4U74A 3DH9A 3FZFB 4CZZB 2CHOA 2ZZCA 3K3QC 1CJ2A 2R45A 2IUBA 2C65A 1H84A 3JAEA 4CXYA 4U3CA 3HI2A 4RG4A 3KBUA 4ILCA 4Z2TA 3AE5A 3MJXA 3DJGX 2HWC4 4Z91A 5ABEA 1D4M4 4JYAT 2BYBA 1MIYA 3UFEA 1ZX9A 3TKLB 1OXZA 2NPXA 3DJBA 4IDPA 3LBXB 2LSYA 2WS3A 4WX1A 3PUGA 4DMWA 4JI8T 2B7RA 2X99A 3CQXC 4LF4T 4AP3A 4OYKA 2RPAA 4U8MA 1HG2A 4IHJE 3QSMA 1D0ZA 1VCTA 4CXXA 1D1CA 2WY2A 4FI5A 2BA9A 5JCNA 5JRCB 1H82A 3NHOX 5EB5A 1O5WA 5AFUL 4AKHA 2XFUA 5GRTA 2VKOA 3C4WA 3P4SA 1HNZT 2BKOA 4LIIA 2B1EA 2WPCA 2APGA 3II4A 4B66A 5LA6E 2C5JA 1ONFA 3UOVA 1HCIA 3MACA 5JRCA 1F3PA 2LFCA 2R0GA 1PXCA 3GDNA 3WE0A 4EM4A 3NRYA 1EBDA 5BR8T 5L3CB 1N1PA 3UKHA 5FS9A 2C4CA 4K2XA 5CKUA 1OEDC 4TUYE 1K0IA 3N9MA 5FVKA 3M13A 2M6IA 5JDLA 2VQBA 2JAEA 3NYCA 4DGKA 3T14A 2V6YB 4EIWA 1GRAA 3BQIA 4IE4A 5IHYA 3LB8A 4HEAA 2IMLA 2CLYB 2XM1A 2BS4A 2OV9A 2VQFT 3UUBA 4EQWA 4YSXA 1POV0 2PW9A 3P9UA 5J2TE 4KI0F 2C5IT 2CXLA 1W9RA 2W0HA 2X8HA 4X62T 3KBTA 1P2EA 1D4DA 3SRZA 3CIRA 4X1YE 5JDGA 1XMOT 4GK5E 2D9DA 1NDAA 5JDFA 4HFHA 1VDCA 4JI4T 2BS3A 3N9NA 2QVAA 5J2UE 4Y4LA 5ETWA 2C3DA 3IF8B 2KLQA 4DNDA 1NA1D 4U8JA 4Z24A 1DJQA 5EOWA 4HKAA 2MBGA 3H3MA 3F8PA 3RIUA 1CF3A 4DUYT 4TNWA 2TPRA 5FYMA 3URHA 1PIV4 3RGLA 2L9QA 3PUZF 4O4JE 4TWHA 1H7XA 5FXVA 2IVEA 5CJ5A 4B3RT 5HYAA 2IHR1 2IDOB 3UKKA 3JC6D 2YQUA 2DI4A 3PS9A 5ABFB 2ARDA 1SUMB 2LSJA 5JDNA 2LHNA 3ADAB 2C64A 1COYA 2H7OA 2XUEA 4IL4A 2E5LT 1K4QA 2X9WA 3KLJA 2AE9A 4WCTA 3AD9B 3DMEA 2EHOD 2B9YA 2C66A 2WESA 3CNJA 1NAFA 5IQ4A 2WDRA 3ZMZB 5BVAA 4G6GA 5ABFA 2YR6A 3N9OA 2E9XA 2JMKA 2EQ8A 1BZLA 2Q0KA 2GV8A 4DR6T 3UKPA 4JY2A 3N9PA 3OYZA 4G74A 1L9EA 5FXXA 3T1YT 1PBBA 3CPZA 4IE5A 3ZSTA 2Q9QB 2DWGA 1XHXA 3V76A 2X67A 4UELA 2LM2A 4YTPA 2YLWA 3KU9A 1GPEA 2CRBA 1BF3A 1JEHA 4ZCDA 3UOYA 1MQTD 2XLRA 1GALA 1U4QA 4LFAT 5HXHA 1CJ3A 3EHZA 4H9NC 4LF6T 1GOSA 2RGJA 3ZYLA 1JU2A 1F8SA 1EAH4 2NVKX 3GMBA 1VBD4 2Q0LA 1ZMCA 2VKDA 1RUF4 3MZKB 2WBLA 5C3JA 1PXBA 2EQ7A 5U63A 2VVLA 2BS2A 3CK6A 3HYWA 1N34T 3FZLB 4DR1T 3CGBA 2KWHA 3M65A 5AQQB 2HHHT 3LZXA 4M52A 4LMKA 2XQYA 1RYIA 3Q5XA 4EZ4A 2ZZBA 4IVOB 3Q5EA 4H4QA 3ZMSB 4II3A 5FS8A 3BK9A 3QUJA 1M6IA 1H86A 2BG9E 5DABA 1I6ZA 2ES0A 2UXNB 2I6HA 1XANA 4UXNB 4JI0T 4V1Av 2DHRA 3I9WA 1QSDA 5AQMB 5J0ZA 3ZDNA 4B67A 4EMJA 2XQ3A 4X1KE 4DR4T 5BRTA 3NK0X 1YD8G 1YKEB 2VVLG 1GV4A 1JNZA 4MHCA 3DJJA 2BG9B 3AAAB 1VBA4 1M64A 2ZZ0A 4ZI2C 1J1JA 3K8PC 3HYXA 1GETA 3L8RA 4I55E 4JLEA 4KMCA 2NOXA 4G2AA 2YN6A 1Z6LA 3GQKA 1N36T 3ZMUB 5L3FB 4JV5T 3CMMA 2L8KA 2YU2A 3AE9A 2XY8B 1OEDA 4GDPA 2HN1A 4ILBA 1AR84 5AQHB 1OJDA 3B6DA 1HG5A 1D7YA 2W67A 2CULA 4H4VA 4UEMA 5LB7B 1FECA 3FHNA 3ZPOA 1ZY8A 3F8RA 4YSHA 1VOMA 4H4ZA 4JI2T 1L9DA 4DSHA 5LYJE 2C70A 4AXPA 2Y8DA 2WWUA 4DMVA 4TM3A 3ALLA 2WU2A 1SE7A 3CWZB 4Z26A 2VRLA 1ELIA 3PJAJ 1JNRA 3ETUA 4B64A 4ZN0A 4G6HA 1VRH4 1CJ4A 2C67A 3UKLA 2P9BA 1GESA 1XI1A 2B7SA 4CI3B 3BNMA 3QFBA 4PJMA 1US7B 2WP5A 2QCUA 2XTLA 1M7KA 4TWDA 2K24A 1GSNA 2JK6A 2DWKA 4P09A 5AQIB 3ZT5A 2A3DA 3RF1A 2A89A 4NEWA 3ANWB 4XWRA 3PJAA 4BURA 2BKNA 1UCUA 5KWFA 2FJBA 3SS1A 1K0JA 4Z25A 1ZV4X 3QVRA 1L9CA 3E08A 2AQJA 2LT3A 3KV4A 3OJAA 4X4JA 1YY5A 3ITJA 4EM3A 2HPJA 2YDQA 5F8PA 2W66A 1H8TD 4U33A 3EDVA 3RLFF 3ZCIA 2GQFA 4UIGA 2RP4A 3UCLA 1LQTA 2CDUA 2XVHA 3AE8A 1L0VA 5FY7A 1CC6A 4L0RA 4J31A 1WFDA 4KHZF 3BI2A 1E1NA 3W15B 4OK0A 3GN5B 3QSEA 1ZK7A 3EANA 4K22A 2VRMA 3A8YC 3AEAA 2XVJA 2KWIB 4IV9A 4UDQA 3JC6C 4KUMB 1MMDA 4LF5T 1D0XA 2JPFA 3ZT7A 3PU3A 2V7JA 3LSVA 2UXBT 3HYVA 3UP4A 2BZBA 3NTDA 2XQ7A 4J56A 4CI1B 5AQFB 2DLRA 4O4HE 2LOPA 2YG6A 2BC1A 1YXRA 4IT4A 4U2YA 4CNKA 4A6NA 1EZ3A 4HN9A 2V3BA 3CX7B 3HL6A 2K9AA 1BWCA 1OJCA 2FJAA 3LDQB 4DV3T 4RSLA 2H3RA 4B3TT 4O5QA 5L4HA 2RS34 4XAXB 3CQCB 3O1JA 1B8SA 1CL0A 2A9UA 3GMCA 3AWIA 2WM9A 4YSYA 1KNPA 5IYZE 2A2FX 3ABVA 4USQA 3B57A 2FJDA 2XHEB 3DA1A 4U8KA 4OPCA 4C90A 2R9ZA 2XQ5A 5JCKA 3H8LA 2MAWA 1N4WA 3VR9A 3EAOA 1KNRA 5FXZA 1OJ9A 4EQSA 4A97A 3NH3X 3UFGA 2PTFA 2YG7A 4ASKA 3CNDA 1JRYA 2XQ8A 1O95A 4NZHA 4U8IA 3H4KA 1B4VA 4UDRA 4TV9E 3KFWX 2YDRA 2VKJA 3FMWA 4NNJA 4DV0T 4AI6A 2GR3A 3SFEA 3G5SA 5LBQB 1FIOA 3HKCE 2KMFA 5KOWA 3C64A 3DK4A 4JUYA 1CBOA 2VL8A 5HAXA 4GAPA 1V59A 3IWAA 2BDEA 4RG3A 1D5TA 2CMRA 2JB3A 3G5QA 4HWDA 2WMNA 2QA2A 4YKFA 3SY4A 4PAGA 2UUBT 1KSUA 4X65T 5JCMA 3AB3B 5JQGE 2BRYA 1H7CA 2X0YA 5L47A 3OBVE 1D0YA 1IAPA 3S5WA 1MO9A 2GQWA 2QGSA 2BBJA 2XAJB 4X5TA 2RMU4 3NLCA 5KMGP 3ATRA 3GYXA 3RKOA 3U3IA 1ZDLA 1X9BA 4H4WA 4IA6A 1SA0E 4QX7B 3RYIE 2V7MA 4WNKA 3EF6A 3K3NA 2ACXA 3NK2X 1T98A 2WQYA 3T2ZA 3KINB 4I43B 3SUCA 2VASA 4GRTA 5ADXL 1FEWA 1CUNA 3FI7A 3UQ4A 3MK7C 5FL0A 1ZMDA 2TMDA 3K7TA 3AECA 2MTQA 1IJ5A 2NW7A 2JKCA 3LG7A 2CXFA 1GREA 1YQZA 5JTGA 2YG3A 3DJEA 4NTDA 2XLTA 3D8XA 1AR94 4AP1A 3IA3A 3UU5A 4TZ4C 3TLUA 1EL9A 1JOAA 4UF0B 5CQFA 3I9YA 1BGJA 2DKIA 5HXIA 4HE8A 1PJ6A 1FEBA 2NW8A 3RRWA 2XVEA 3L1RA 2YDSA 3ZCJA 2Y6XA 3T0KA 4APNA 3OYXA 5BULA 4X64T 1W0BA 2L3LA 4UDPA 4K0KT 1HNWT 3ZN0B 5TR3A 2PJQA 3QB5A 4PK5A 1TDFA 1UX5A 4P0BA 5J1GA 4H7UA 4BJMA 1EL5A 5LG3A 4B1BA 4B69A 4OPUA 4D03A 4EEDA 3QNUA 3AXJB 2PG8A 3DK8A 3HKBE 3CQGB 1RMU4 5HWXA 3H37A 3T2YA 3ZEFB 4EB6E 5FNVE 2WP9A 4IE6A 3AYIA 5L2LA 2F5ZA 1W0AA 3RH3A 2WEUA 3AXJA 2FBWA 1VRBA 2BK4A 1GRTA 2WU5A 1PO24 1EL7A 4LMLA 3AVSA 3FZKB 1IUVA 3IHRA 2PZSA 3WI3A 4JNQA 5CA0E 5AQOB 3GRSA 3OZ2A 4DV4T 3K3OA 4DV1T 2EHOA 4GKJT 2LE8A 5LJMA 2C7GA 2C72A 3ISHA 2ODVA 1P2HA 4Q4X4 4ZI2D 2GR0A 1IBKT 4X9NA 3QVPA 4UVAB 4CY6A 4II2A 4A5XA 3DP7A 3D0TA 1MIWA 1H81A 3GQHA 4QXCB 3ZN1B 2OALA 4ZS2A 3R6NA 4IDNA 4KX6A 1FMWA 2MPKA 4I0UA 2PBIA 5JR9C 4I50E 3FBSA 2OA5A 1HR0T 1GT8A 5EK2A 2VK9A 2X9YA 4K5SA 4NWZA 3AE2A 1XNQT 4H9PC 1E7PA 3T2KA 2K3WA 1VRQB 4IL9A 3ICRA 4H9RC 3EDUA 2R0CA 3PUYF 2KNDA 2YOEA 4YKGA 2JQQA 2LLYA 5LOVE 4XWZA 4EQRA 5LGUB 2E2AA 3EAMA 1QUUA 4IDZA 2C75A 3OVUA 3P1WA 5TAOA 4O2AE 5KXJA 1IUWA 4Q4V4 4UVBB 4HTEA 3GWDA 4J33A 3KVAA 4U2TA 4JEUB 3DGZA 4GR1A 2X3NA 4XBFB 4F6RC 2B76A 4AISA 4NPPA 1NHRA 2W2UA 3PUSA 3N2GE 2RS14 2W4XA 2R6GF 3M12A 4U72A 3DTOA 1Z8UA 4YXDA 4B68A 2CBIA 5DBJA 3BI4A 2WPFA 4KPRA 4U8PA 1AR74 1WRDA 4A56A 3DGHA 4P1NA 4H2PA 3ONJA 4TWFA 2J4GA 3ZSSA 1VG0A 4QXBB 5FMHA 4H4TA 1ZHCA 3PUVF 1Y56A 2QAEA 5E0OA 3CNTA 4X9MA 3GMIA 1LTXR 2FJEA 3K30A 3NGCX 3LOVA 4EXTA 5F5WA 3NKZA 3C96A 2MYSA 4TM1A 1WCRA 3RQWA 2XSBA 1G8XA 2J3NA 4NTCA 3RYHE 3RHWA 3RQUA 4CN1A 4BA9A 1UKVG 4H9OC 1UX4A 2C76A 4EYUA 3SFDA 1BEV4 2GAGB 1E1LA 2E9XB 1GRFA 4BK3A 1KDGA 2PHHA 1PO14 2WMOA 3NVOA 2V26A 4IDOA 5FY1A 3UU6A 1BGNA 3UTHA 1IUTA 4OVIA 3BHKA 4HFIA 4EZHA 4AQFA 1S3EA 5IPYA 3J9X1 4GYSA 4U8OA 2J62A 3AE3A 2RM24 1TDEA 4EMWA 5FL1A 1XDIA 3QB5K 3Q5DA 3P4QA 4Z90A 3EI0A 1K0LA 2BXRA 1AJ3A 2V7KA 4REKA 4U31A 3KDSE 5HEJA 4J57A 2XQ4A 4AT0A 1BKWA 1PBCA 3BHFA 3VU7H 1DOEA 4TNVA 4TM0A 5FS7A 1PVC4 3ATQA 3PV0F 1CHUA 1DNCA 3UTKA 4L5GA 3FBLA 4PNIA 2CHNA 3VR8A 4MBQA 1MMNA 5GSNA 3ALMA 3FB2A 1QO8A 2NTYA 2H7VC 4GIWA 5ABHA 1Q9IA 2WDVA 3K7MX 2R0PA 1EV14 3OC4A 5KMPA 4HFBA 1GRGA 5EB4A 3DJDA 2CBJA 1KF6A 1D4EA 2LEHA 2M6BA 3KD9A 1MMGA 2JQHA 3O0HA 2GAHB 1R084 4AIUA 4GB34 3NKSA 1M62A 2H89A 3CKDA 3FBZA 2X5ID 4QH1A 2QRXA 4N78D 3U78A 4TLXA 4O8SA 4K7ZA 3N5LA 3NYEA 3TLSA 5AQPB 4DR7T 4TX5A 1CJCA 3GWFA 3C4NA 1NCQD 2UUAT 3GSIA 4EV6A 3RHAA 4YWOA 1OEDE 5IWAT 2D5UA 2R46A 5KVIA 2Y6QA 3NG7X 3SZWA 4IDQA 4C74A 4OCGA 3UUXB 5JDHA 2YVFA 3ALJA 2NWBA 5HXCA 3LJCA 3V3OA 2LJLA 4WBNE 4U2ZA 3P4WA 1U5PA 4Z2UA 1NG3A 2YVGA 3KV9A 1OEDB 3PDYA 2BVLA 3P4RA 5HCJA 3CTYA 4FJOA 2R4EA 1TRBA 2DNXA 3QC9A 1XNRT 3H8IA 3IBPA 3BNUA 4CN4A 1B7TA 2XM2A 5LV9A 3WAKA 4QH4A 4C5OA 4A7AA 2GVCA 2XPKA 4WBOA 4YTNA 3RP7A 1D1AA 1MMAA 2WDQA 5KDMC 2A8XA 2JIWA 1GEUA 5IQ1A 2MOZA 5CB4E 3UUNA 5JREA 1B37A 3ZMVB 1NHQA 1W4XA 4GF7A 4PDWD 2PFVA 2SPCA 4YTMA 3UUMA 2AR8A 3NIXA 4H2NA 5U25A 4MJWA 1EL8A 3OTOT 1ZKQA 1LVKA 1HRV4 2V5ZA 4OYJA 1UURA 1E1HB 1BR2A 4EOZB 3K1SA 1PBFA 1HXS4 4LFBT 3RP6A 2C5KT 2E8IA 3AA7B 4D04A 1VBC4 3COXA 1S94A 4PFOA 2WZIA 1IUUA 1AL24 2JB1A 4EYYR 3J7Yq 2FUPA 2YM1A 4A99A 4ZZCA 1YW0A 2DL1A 4NXMT 3KV6A 2BXSA 1IUSA 3JSKA 4Z43A 5HWYA 2LRLA 2Q9QD 4N9XA 1PS9A 3UKQA 2M67A 1R094 2WETA 1KEYA 4H9QC 1XHCA 2WOWA 2XZEA 4DO0A 2PY5A 4NXNT 4CRTA 4FDCB 1TYTA 4IGUA 3AEGA 4UV8B 4J36A 4ZHQE 3GD4A 4Q25A 4AOXA 2LSKA 3RX6A 3JD74 3E22E 4GKKT 1S3BA 4Q4Y4 2RGHA 5KNLA 3O4XE 3ZKRA 4PAAA 1RUG4 4O4LE 3CPJG 3ZYKA 3GDPA 4A6NB 5JCIA 3NK1X 3PE0A 4QHOA 1N4UA 2BBHA 5FY0A 3ONXA 2BVMA 2CVJA 4Z8XA 1MNEA 2F4VT 3C4AA 3AE1A 3BQKA 3L39A 3Q2MA 5LP6E 4NIQA 3F57A 2XFNA 3Q6JA 1TDOA 3I1AA 1WLXA 1T8BA 1PBEA 4LA1A 2W63A 5LHGB 4A5LA 1RUH4 2KXPB 2LSGA 4OFZA 2V8SV 2XJ7A 4GK0E 5FS6A 3X1DA 1GRHA 3KVBA 3QFAA 1PHHA 4DV6T 2KZ7B 2HN2A 3EVYA 2R4JA 4YFSA 1G73A 2DCFA 4TM4A 3UT5E 5HCMA 3IF9A 3RIFA 2GR1A 3ICSA 3AD8B 2PYLA 1UGOA 2V61A 3F31A 3CMLA 3SXIA 5JDMA 3SOLA 1ZP0A 4ISTA 4DIDB 2JBVA 4HFEA 1HYUA 4DV7T 3AEFA 2OLNA 4G9KA 2Z5YA 3T37A 2XLPA 4PW8A 3Q5WA 4CBQA 3NNEA 4CXWA 2RABA 4GDEA 1YQ4A 5C8YE 4CI2B 2LOSA 4YJ2E 4ILAA 1KSSA 5L3BB 4JY3A 3L09A 4PK4A 4CQIA 2XQAA 2JRKA 2GK9A 3AEDA 1ZOVA 3PVCA 1IZNB 3NRNA 3AAIA 2XSAA 1FOHA 2XAQB 1ZKEA 3GYJA 2RS54 3NBXX 2GMHA 4DR5T 2ZLYA 2VQ7A 1I94T 4IREA 3DK9A 1Z7S4 5HXSA 2EX3A 1F8WA 3LJPA 2WSSV 2E4GA 3QOFA 3L8KA 2VZ2A 4EAHA 2CLYC 3NZQA 3S4UA 1RVF4 4USRA 5HYMA 3VRDB 5CGMA 2ZM0A 4DV2T 1GTHA 1Q1WA 5C2TA 2I0MA 5LHIB 5CA1E 2ZM2A 4Y4NA 4GUVA 4H4RA 2HQMA 3I0QA 2B9WA 1XPQA 4FK1C 5KRQA 1T72A 2V1DB 3PUWF 4BJZA 2IW5B 4I59A 3UKFA 2OLOA 1RP0A 3UKAA 2YLSA 1S2QA 4ZS3A 1RUD4 1RUJ4 4JI3T 3M3ZB 4HWCA 1XHZA 2IC9A 2X0LB 4CCRA 4A79A 5DQVA 1UK5A 3EABA 4IIJE 4DVDA 2LKHA 3TLVA 4U7YA 1NPXA 1FJGT 3SGLA 4JI5T 2V60A 3MA9A 3ZJ2A 2YVJA 4UV9B 2YG4A 3E1TA 1ASJ4 4LMJA 2WPEA 2X9XA 4NTEA 4ZI3D 5HEGA 3LADA 2UZZA 3UU8A 4H2QA 3KA7A 2K48A 4P9SA 1RUI4 4IA5A 3A5XA 1XZYA 5FP3A 2BACA 3CNPA 2VKHA 3RYFE 1DODA 3RKGA 3K7QX 3B13A 2BK5A 1PN0A 2WWVA 5FMNA 4BJNA 4JDRA 2XAHB 4LF8T 5H6QB 2XYOA 3SQPA 4BK2A 1OJAA 4EIPA 4JNAA 1MOKA 3PUAA 3AA1B 3ZLIA 1O3XA 5CFBA 1QLBA 4QH5A 3N2OA 2EHOB 2GR2A 4U8NA 4B3ST 3V3NA 2H88A 2Q9QC 2W0GA 4AKLA 2WB5A 1IBMT 5H6RB 2LHRA 2V5CA 4DR2T 1H6VA 3S61A 4DNAA 1JRXA 1E1MA 1IUXA 3JCFA 3CX8B 2YU1A 4HA6A 2I0ZA 5AQRB 3QK6A 5L3GB 3RP8A 3UU4A 5AQGB 5EZYE 4ZOLE 1GQEA 4TN7B 4YSZA 5L46A 3PURA 2JQKA 1BR0A 5KOXA 1B5QA 4NUVA 3D1CA 5FXWA 2YR5A 1X31B 4GOUA 3HR0A 2X0HA 4CN6A 1BR1A 2Q6UA 4NEVA 4PJNA 5JDQA 3AE7A 5BMVE 3LBXA
chains in the Genus database with same CATH topology
5J60A 2ZBWA 4X4JA 4K8DA 1YY5A 3ITJA 3VR8A 4Z44A 3KKJA 1YQ3A 5GSNA 4EM3A 3ALMA 1QO8A 1FL2A 1Q9IA 2WDVA 1H83A 3K7MX 2R0PA 3G5RA 5M0ZA 2VVMA 3OC4A 4EQXA 5KMPA 1AOGA 2XLUA 2GQFA 4H50A 2X8CA 1GRGA 3CPIG 3DJDA 5EB4A 4ZCCA 3UCLA 2GB0A 3IHGA 4K5RA 2WHDA 1KF6A 1LQTA 3NT6A 2CDUA 1D4EA 2XFOA 2PYXA 2XVHA 4U8LA 3KD9A 3KPKA 3VRBA 3AE8A 1L0VA 1CC6A 4OPGA 1ZOYA 3O0HA 4J31A 2GAHB 2OAMA 3NTAA 1NEKA 2AAQA 2O9ZA 1PXAA 1PJ7A 3BI2A 1E1NA 4TLZA 3NKSA 1LJ1A 2H89A 2JB2A 3QSEA 1ZK7A 3EANA 4K22A 1TDNA 1VQWA 2VRMA 3FG2P 4TLXA 3AEAA 3UP5A 4K7ZA 4GCMA 2XVJA 4IV9A 3NYEA 4UDQA 1JRZA 2XVFA 2XLSA 1CJCA 1Y56B 3GWFA 3C4NA 4EMIA 1RSGA 3GSIA 1PBDA 4CCQA 3RHAA 4YWOA 1VG9A 1FEAA 1IJHA 2R46A 3PO7A 2Y6QA 3I3LA 2XDOA 3NG7X 5KVIA 3AXBA 3SZWA 3BI5A 1GNDA 4C74A 4FX9A 4OCGA 4XXGA 1D4CA 3HYVA 4YT0A 3NTDA 3UP4A 1N4VA 4J56A 1NHSA 2CFYA 2YVFA 3AD7B 3ALJA 1GXFA 2XFQA 3V3OA 2YG6A 2A87A 2BC1A 3CGCA 3UTEA 3VQRA 4DSGA 1GRBA 4Z2UA 1NG3A 3KVEA 2YVGA 4CNKA 4A6NA 2V3BA 5EBKA 4J34A 3Q9TA 4BV6A 3P4RA 1BWCA 1OJCA 3SZ0A 2FJAA 1E39A 3CTYA 1TYPA 3IC9A 2R4EA 1TRBA 4FK1A 2GRTA 2BCPA 2DKHA 4RSLA 2WP6A 3SYIA 3H8IA 3BNUA 3LXDA 4O5QA 3QSSA 2BCGG 3DH9A 4A9WA 1B8SA 4O5UA 1CL0A 1NAAA 2ZZCA 3GMCA 1CJ2A 2R45A 5LV9A 1LPFA 3AWIA 4YSYA 2WOVA 1CHUA 1KNPA 2BC0A 4C5OA 1FCDA 3B3RA 3ABVA 4A7AA 1QJDA 2GVCA 4USQA 2C65A 4YTNA 2FJDA 1H84A 3DA1A 4U8KA 3RP7A 4OPCA 2WDQA 2A8XA 2R9ZA 4RG4A 1GEUA 5JCKA 3H8LA 5KVHA 1N4WA 5IQ1A 4Z2TA 3VR9A 3AE5A 3DJGX 5KMQA 2C73A 1B37A 1E6EA 1NHQA 1W4XA 2BYBA 3EAOA 4BK1A 1KNRA 1OJ9A 1ZX9A 4GF7A 5J7XA 3NH3X 2GF3A 2OA1A 2NPXA 4EQSA 2YG7A 4YTMA 2AR8A 1JRYA 3CNDA 3NIXA 4H2NA 1O95A 5U25A 4MJWA 4NZHA 1EL8A 1H7WA 2WS3A 1ZKQA 4U8IA 4WX1A 3H4KA 2BRAA 3I6DA 1B4VA 2B7RA 2V5ZA 2X99A 3FMWA 4LU6A 4NNJA 5U1OA 2GR3A 3SFEA 3G5SA 4AP3A 4U8MA 5KOWA 3DK4A 1CBOA 3QSMA 4GAPA 1PBFA 1V59A 3IWAA 3RP6A 1DOBA 4RG3A 1D5TA 1LV0A 3M0OA 2JB3A 4IVMB 4D04A 3G5QA 3COXA 2YR4A 1LVLA 2BA9A 2QA2A 4YKFA 1IUUA 5JCNA 3EPTA 4C3XA 1H82A 3NHOX 3SY4A 2EQ9A 5EB5A 2JB1A 1O5WA 1KSUA 2XFUA 5GRTA 3P4SA 5JCMA 3IHMA 4LIIA 2WPCA 2BRYA 4B63A 2YM1A 4A99A 2APGA 3S5WA 1MO9A 2GQWA 2BXSA 3II4A 1IUSA 3JSKA 4Z43A 4B66A 1ONFA 4N9XA 3SZCA 1PS9A 3NLCA 3UKQA 1F3PA 3UOVA 3ATRA 2LFCA 2R0GA 1PXCA 2WETA 3GDNA 3GYXA 3WE0A 4EM4A 1ZDLA 4IA6A 4H4WA 1XHCA 1EBDA 2WOWA 1OJTA 1N1PA 4CRTA 4FDCB 3AE6A 3UKHA 1TYTA 5FS9A 3EF6A 2C4CA 1CC2A 4K2XA 5CKUA 3AEGA 4J36A 1PJ5A 2E5VA 3NK2X 2WQYA 3GD4A 3T2ZA 4PABA 3SUCA 4AOXA 1MXTA 4GRTA 1K0IA 2IVDA 3T31A 3M13A 2VQBA 3NYCA 4DGKA 2JAEA 4HB9A 4AT2A 5KMRA 3T14A 1S3BA 1GRAA 2RGHA 5KNLA 1ZMDA 3LB8A 5HY5A 2TMDA 3K7TA 4PAAA 2BS4A 3AECA 3CPJG 3GDPA 4H4PA 4A6NB 4EQWA 3NK1X 4YSXA 2E1MA 5JCIA 2JKCA 3P9UA 1N4UA 4JN9A 1GREA 1YQZA 3C4AA 2CVJA 3AE1A 2W0HA 2X8HA 2X8GA 2YG3A 3DJEA 3GYIA 2XLTA 3D8XA 4NTDA 1P2EA 4AP1A 1D4DA 1CC4A 1EL9A 3CIRA 1JOAA 2XFNA 3Q6JA 5CQFA 1TDOA 3RNMA 5HHFA 1BGJA 1NDAA 2DKIA 5HXIA 1PBEA 1PJ6A 4LA1A 1FEBA 1VDCA 4A5LA 1S2YA 2XVEA 2BS3A 3L1RA 5FS6A 4Y4LA 2C3DA 1GRHA 3T0KA 2V3AA 4APNA 3QFAA 1PHHA 5JCLA 5BULA 2Z5XA 4U8JA 4Z24A 4BJYA 4UDPA 1DJQA 5EOWA 3SM8A 5TR3A 4UDRA 1TDFA 1NG4A 2R4JA 3F8PA 3CNSA 4H7UA 1CF3A 1EL5A 4TM4A 3IF9A 4B1BA 4GAVA 4B69A 4OPUA 4AOSA 4D03A 3SX6A 2B9XA 2TPRA 4OPTA 3URHA 2GR1A 3ICSA 3AD8B 2WBAA 3DK8A 1H7XA 2V61A 2IVEA 3AEBA 3SXIA 4OPIA 1ZP0A 3T2YA 4CNJA 3UKKA 2WP9A 2YLZA 2YQUA 3AYIA 2F5ZA 2JBVA 3PS9A 4ECHA 2ARDA 4H2RA 1SEZA 2YM2A 3CPHG 2WEUA 3R9UA 1HYUA 3NN6X 4J2WA 3AEFA 2OLNA 3ADAB 1Q1RA 2C64A 4G9KA 2Z5YA 1COYA 3T37A 2FBWA 2XLPA 1K4QA 4U2LA 4CBQA 3KLJA 4WCTA 1NHPA 3AD9B 3DMEA 2BK4A 1GRTA 2WU5A 3NNEA 2B9YA 2C66A 2WESA 1EL7A 3CNJA 4H4YA 5IQ4A 1IUVA 2RABA 4GDEA 2WDRA 4B65A 1YQ4A 4JNQA 2V6OA 5BVAA 4G6GA 2YR6A 1KSSA 3GRSA 3OZ2A 4E0VA 4JY3A 3GD3A 2EQ8A 1BZLA 2C7GA 3AEDA 1ZOVA 2C72A 2Q0KA 3FIMB 3ISHA 3PVCA 2GEWA 2GV8A 1P2HA 2Q7VA 3NRNA 4OPDA 2GR0A 4X9NA 1FOHA 3QVPA 1DOCA 3UKPA 4JY2A 3GYJA 4CY6A 3AYLA 4II2A 4G74A 1LQUA 2GMHA 1TDKA 1L9EA 1H81A 2VQ7A 2YAUA 1PBBA 3DK9A 3GQHA 3CGDA 3AB1A 4C3YA 1F8WA 2OALA 3LJPA 3LZWA 2E4GA 3V76A 3L8KA 4KX6A 2VZ2A 2X50A 3AYJA 1KFYA 4YTPA 2YLWA 2QA1A 3KU9A 4USRA 5HYMA 3VRDB 2YLXA 1GPEA 3FBSA 1BF3A 1JEHA 1GT8A 1GTHA 4ZCDA 1Q1WA 5C2TA 3UOYA 2XLRA 4K5SA 4NWZA 3SZFA 3AE2A 1GALA 1Y0PA 1CJ3A 3KPFA 4GUVA 4H4RA 4H4SA 4Y4NA 2HQMA 5KMSA 2B9WA 1XPQA 4FK1C 1GOSA 2ACZA 2RGJA 1JU2A 2C3CA 1E1KA 1E7PA 3T2KA 5KRQA 1F8SA 3QJ4A 4UP3A 1VRQB 2NVKX 5M10A 3HZLA 3ICRA 3GMBA 4BJZA 1NENA 4I59A 2Q0LA 3UKFA 1ZMCA 2OLOA 3UTGA 2R0CA 1RP0A 4YKGA 5U63A 5C3JA 1PXBA 2EQ7A 2YLSA 1S2QA 1REOA 4XWZA 3UKAA 4EQRA 3P1WA 2C75A 2VVLA 2WOIA 5KXJA 2BS2A 1IUWA 1F8RA 3HYWA 4CCRA 3AEEA 2GH5A 3GWDA 4A79A 4J33A 1GERA 2YG5A 4U2TA 4G73A 2XFPA 3CGBA 3DGZA 1D7LA 2X3NA 3LZXA 3GRTA 4GR1A 2YLRA 4M52A 4EIQA 2B76A 1RYIA 2EQ6A 1NHRA 3NYFA 2ZZBA 3ICTA 4IVOB 3M12A 4H4QA 1NPXA 3SGLA 4H4UA 2V60A 4II3A 2GMJA 5FS8A 2YVJA 3AE4A 2YG4A 3NN0X 4A65A 4YXDA 3E1TA 1M6IA 4Y4MA 1H86A 4B68A 5DBJA 3BI4A 2WPFA 2WPEA 4NTEA 4KPRA 3LADA 2YLTA 2UZZA 4H2QA 4JQ9A 3KA7A 4U8PA 1XANA 3DGHA 4H2PA 2IIDA 1PDHA 4P9SA 1VG0A 4IA5A 2XCGA 4EMJA 3CN8A 2BACA 5FMHA 4H4TA 3ZDNA 3CNPA 4B67A 1Y56A 2QAEA 2RGOA 5BRTA 3NK0X 1DODA 3CGEA 4CY8A 2VOUA 2VVLG 1GV4A 1JNZA 3ATQA 3CNTA 3DJJA 2BK5A 3K7QX 4H4XA 3VRAA 4X9MA 1LTXR 1PN0A 4JDRA 2FJEA 1M64A 4C77A 1YKJA 2ZZ0A 3K30A 3NGCX 3LOVA 2XYOA 3SQPA 3HYXA 1GETA 3C96A 3FPZA 1OJAA 4BK2A 4EIPA 4JNAA 4TM1A 1MOKA 4ICYA 2J3NA 4NTCA 3GQKA 1Z6LA 1UKVG 3CMMA 2C76A 2Y6RA 1QLBA 4I58A 1DXLA 5ER0A 3AE9A 3SFDA 3REDA 2GAGB 4GDPA 1DJNA 1E1LA 2GR2A 4ADWA 2YWLA 4U8NA 1GRFA 3V3NA 4BK3A 1KDGA 2H88A 1OJDA 2PHHA 3B6DA 3ZYXA 1D7YA 2CULA 4H4VA 3UOZA 3P4PA 1FECA 1ZY8A 3F8RA 3UTHA 1BGNA 4H4ZA 4YSHA 1IUTA 1H6VA 1L9DA 3BHKA 4OVIA 3S61A 1O94A 1JRXA 4DNAA 4DSHA 2C70A 1E1MA 4Z2RA 1IUXA 1S3EA 5IPYA 4HA6A 2I0ZA 4TM3A 4U8OA 4OPLA 3ALLA 2WU2A 3RP8A 3AE3A 4Z26A 2VRLA 1ELIA 4B64A 1JNRA 4ZN0A 4G6HA 1CJ4A 1TDEA 2C67A 1GESA 3UKLA 4EMWA 2B7SA 4YSZA 5L46A 3BNMA 3QFBA 3UTFA 1XDIA 3UOXA 3P4QA 5BUKA 5KOXA 1K0LA 2WP5A 1B5QA 2BXRA 1F6MA 2QCUA 3D1CA 2YR5A 4REKA 1X31B 1GSNA 2XVIA 2JK6A 2BK3A 2A89A 2Q6UA 4J57A 4NEWA 4XWRA 4AT0A 4NEVA 4BURA 5KWFA 1BKWA 2FJBA 1PBCA 2BABA 1GTEA 1DOEA 3BHFA 4U2SA 3AE7A 3F8DA 4TM0A 1K0JA 4Z25A 5FS7A 3QVRA 1L9CA 2AQJA 1DNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J60 A;  2ZBW A;  4X4J A;  4K8D A;  1YY5 A;  3ITJ A;  3VR8 A;  4Z44 A;  3KKJ A;  1YQ3 A;  5GSN A;  4EM3 A;  3ALM A;  1QO8 A;  1FL2 A;  1Q9I A;  2WDV A;  1H83 A;  3K7M X;  2R0P A;  3G5R A;  5M0Z A;  2VVM A;  3OC4 A;  4EQX A;  1AOG A;  2XLU A;  2GQF A;  4H50 A;  2X8C A;  1GRG A;  3CPI G;  3DJD A;  5EB4 A;  4ZCC A;  3UCL A;  2GB0 A;  3IHG A;  4K5R A;  2WHD A;  1KF6 A;  1LQT A;  3NT6 A;  2CDU A;  1D4E A;  2XFO A;  2PYX A;  2XVH A;  4U8L A;  3KD9 A;  4OPG A;  3VRB A;  3AE8 A;  1L0V A;  1CC6 A;  1ZOY A;  3O0H A;  4J31 A;  2GAH B;  2OAM A;  3NTA A;  1NEK A;  2AAQ A;  2O9Z A;  1PXA A;  1PJ7 A;  3BI2 A;  1E1N A;  4TLZ A;  3NKS A;  1LJ1 A;  2H89 A;  2JB2 A;  3QSE A;  1ZK7 A;  3EAN A;  4K22 A;  1TDN A;  1VQW A;  2VRM A;  3FG2 P;  4TLX A;  3AEA A;  3UP5 A;  4K7Z A;  4GCM A;  2XVJ A;  4IV9 A;  3NYE A;  4UDQ A;  1JRZ A;  2XVF A;  2XLS A;  1CJC A;  1Y56 B;  3GWF A;  3C4N A;  4EMI A;  1RSG A;  3GSI A;  1PBD A;  4CCQ A;  3RHA A;  4YWO A;  1VG9 A;  1FEA A;  1IJH A;  2R46 A;  3PO7 A;  2Y6Q A;  3I3L A;  2XDO A;  3NG7 X;  5KVI A;  3AXB A;  3BI5 A;  1GND A;  4C74 A;  4FX9 A;  4OCG A;  4XXG A;  1D4C A;  4YT0 A;  3NTD A;  3UP4 A;  1N4V A;  4J56 A;  1NHS A;  2CFY A;  2YVF A;  3AD7 B;  3ALJ A;  1GXF A;  2XFQ A;  3V3O A;  2YG6 A;  2A87 A;  2BC1 A;  3CGC A;  3UTE A;  3VQR A;  4DSG A;  1GRB A;  4Z2U A;  1NG3 A;  3KVE A;  2YVG A;  4CNK A;  4A6N A;  2V3B A;  5EBK A;  4J34 A;  3Q9T A;  4BV6 A;  3P4R A;  1BWC A;  1OJC A;  2FJA A;  1E39 A;  3CTY A;  1TYP A;  3IC9 A;  2R4E A;  1TRB A;  4FK1 A;  2GRT A;  2BCP A;  2DKH A;  4RSL A;  2WP6 A;  3H8I A;  3BNU A;  3LXD A;  4O5Q A;  3QSS A;  2BCG G;  3DH9 A;  4A9W A;  1B8S A;  4O5U A;  1CL0 A;  1NAA A;  2ZZC A;  3GMC A;  1CJ2 A;  2R45 A;  5LV9 A;  1LPF A;  3AWI A;  4YSY A;  2WOV A;  1CHU A;  1KNP A;  2BC0 A;  4C5O A;  1FCD A;  3B3R A;  3ABV A;  4A7A A;  1QJD A;  2GVC A;  4USQ A;  2C65 A;  4YTN A;  2FJD A;  1H84 A;  3DA1 A;  4U8K A;  3RP7 A;  4OPC A;  2WDQ A;  2A8X A;  2R9Z A;  4RG4 A;  1GEU A;  5JCK A;  3H8L A;  5KVH A;  1N4W A;  5IQ1 A;  4Z2T A;  3VR9 A;  3AE5 A;  3DJG X;  2C73 A;  1B37 A;  1E6E A;  1NHQ A;  1W4X A;  2BYB A;  3EAO A;  4BK1 A;  1KNR A;  1OJ9 A;  1ZX9 A;  4GF7 A;  5J7X A;  3NH3 X;  2GF3 A;  2OA1 A;  2NPX A;  4EQS A;  2YG7 A;  4YTM A;  2AR8 A;  1JRY A;  3CND A;  3NIX A;  4H2N A;  1O95 A;  5U25 A;  4MJW A;  4NZH A;  1EL8 A;  1H7W A;  2WS3 A;  1ZKQ A;  4U8I A;  4WX1 A;  3H4K A;  3I6D A;  1B4V A;  2B7R A;  2V5Z A;  2X99 A;  3FMW A;  4LU6 A;  5U1O A;  2GR3 A;  3SFE A;  3G5S A;  4AP3 A;  4U8M A;  5KOW A;  3DK4 A;  1CBO A;  3QSM A;  1PBF A;  1V59 A;  3IWA A;  3RP6 A;  1DOB A;  4RG3 A;  1D5T A;  1LV0 A;  3M0O A;  2JB3 A;  4IVM B;  4D04 A;  3G5Q A;  3COX A;  2YR4 A;  1LVL A;  2BA9 A;  2QA2 A;  4YKF A;  1IUU A;  5JCN A;  3EPT A;  4C3X A;  1H82 A;  3NHO X;  2EQ9 A;  5EB5 A;  2JB1 A;  1O5W A;  1KSU A;  2XFU A;  5GRT A;  3P4S A;  5JCM A;  3IHM A;  4LII A;  2WPC A;  4B63 A;  2YM1 A;  4A99 A;  2APG A;  3S5W A;  1MO9 A;  2GQW A;  2BXS A;  3II4 A;  1IUS A;  3JSK A;  4Z43 A;  4B66 A;  1ONF A;  4N9X A;  1PS9 A;  3NLC A;  3UKQ A;  1F3P A;  3UOV A;  3ATR A;  2LFC A;  2R0G A;  1PXC A;  2WET A;  3GDN A;  3WE0 A;  4EM4 A;  3GYX A;  1ZDL A;  4IA6 A;  4H4W A;  1XHC A;  1EBD A;  2WOW A;  1OJT A;  1N1P A;  4CRT A;  4FDC B;  3AE6 A;  3UKH A;  1TYT A;  5FS9 A;  3EF6 A;  4K2X A;  1CC2 A;  5CKU A;  3AEG A;  4J36 A;  1PJ5 A;  2E5V A;  3NK2 X;  2WQY A;  3GD4 A;  4PAB A;  3SUC A;  4AOX A;  1MXT A;  4GRT A;  1K0I A;  2IVD A;  3M13 A;  2VQB A;  3NYC A;  4DGK A;  2JAE A;  4HB9 A;  4AT2 A;  1S3B A;  1GRA A;  2RGH A;  1ZMD A;  3LB8 A;  5HY5 A;  2TMD A;  3K7T A;  4PAA A;  2BS4 A;  3AEC A;  3CPJ G;  3GDP A;  4H4P A;  4A6N B;  4EQW A;  3NK1 X;  4YSX A;  2E1M A;  5JCI A;  2JKC A;  3P9U A;  1N4U A;  4JN9 A;  1GRE A;  1YQZ A;  3C4A A;  2CVJ A;  3AE1 A;  2W0H A;  2X8H A;  2X8G A;  2YG3 A;  3DJE A;  3GYI A;  2XLT A;  3D8X A;  4NTD A;  1P2E A;  4AP1 A;  1D4D A;  1CC4 A;  1EL9 A;  3CIR A;  1JOA A;  2XFN A;  3Q6J A;  5CQF A;  1TDO A;  3RNM A;  5HHF A;  1BGJ A;  1NDA A;  2DKI A;  5HXI A;  1PBE A;  1PJ6 A;  4LA1 A;  1FEB A;  1VDC A;  4A5L A;  1S2Y A;  2XVE A;  2BS3 A;  3L1R A;  5FS6 A;  4Y4L A;  2C3D A;  1GRH A;  2V3A A;  4APN A;  3QFA A;  1PHH A;  5JCL A;  5BUL A;  2Z5X A;  4U8J A;  4Z24 A;  4BJY A;  4UDP A;  1DJQ A;  5EOW A;  3SM8 A;  5TR3 A;  4UDR A;  1TDF A;  1NG4 A;  2R4J A;  3F8P A;  3CNS A;  4H7U A;  1CF3 A;  1EL5 A;  4TM4 A;  3IF9 A;  4B1B A;  4B69 A;  4OPU A;  4AOS A;  4D03 A;  2B9X A;  2TPR A;  4OPT A;  3URH A;  2GR1 A;  3ICS A;  3AD8 B;  2WBA A;  3DK8 A;  1H7X A;  2V61 A;  2IVE A;  3AEB A;  4OPI A;  1ZP0 A;  4CNJ A;  3UKK A;  2WP9 A;  2YLZ A;  2YQU A;  3AYI A;  2F5Z A;  2JBV A;  3PS9 A;  4ECH A;  2ARD A;  4H2R A;  1SEZ A;  2YM2 A;  3CPH G;  2WEU A;  3R9U A;  1HYU A;  3NN6 X;  4J2W A;  3AEF A;  2OLN A;  3ADA B;  1Q1R A;  2C64 A;  2Z5Y A;  1COY A;  3T37 A;  2FBW A;  2XLP A;  1K4Q A;  4U2L A;  4CBQ A;  3KLJ A;  4WCT A;  1NHP A;  3AD9 B;  3DME A;  2BK4 A;  1GRT A;  2WU5 A;  3NNE A;  2B9Y A;  2C66 A;  2WES A;  1EL7 A;  3CNJ A;  4H4Y A;  5IQ4 A;  1IUV A;  2RAB A;  4GDE A;  2WDR A;  4B65 A;  1YQ4 A;  4JNQ A;  2V6O A;  5BVA A;  2YR6 A;  1KSS A;  3GRS A;  3OZ2 A;  4E0V A;  4JY3 A;  3GD3 A;  2EQ8 A;  1BZL A;  2C7G A;  3AED A;  1ZOV A;  2C72 A;  2Q0K A;  3FIM B;  3ISH A;  3PVC A;  2GEW A;  2GV8 A;  1P2H A;  2Q7V A;  3NRN A;  4OPD A;  2GR0 A;  4X9N A;  1FOH A;  3QVP A;  1DOC A;  3UKP A;  4JY2 A;  3GYJ A;  4CY6 A;  3AYL A;  1LQU A;  2GMH A;  1TDK A;  1L9E A;  1H81 A;  2VQ7 A;  2YAU A;  1PBB A;  3DK9 A;  3GQH A;  3CGD A;  3AB1 A;  4C3Y A;  1F8W A;  2OAL A;  3LJP A;  3LZW A;  2E4G A;  3V76 A;  3L8K A;  4KX6 A;  2VZ2 A;  2X50 A;  3AYJ A;  1KFY A;  4YTP A;  2YLW A;  2QA1 A;  3KU9 A;  4USR A;  5HYM A;  3VRD B;  2YLX A;  1GPE A;  3FBS A;  1BF3 A;  1JEH A;  1GT8 A;  1GTH A;  4ZCD A;  1Q1W A;  5C2T A;  3UOY A;  2XLR A;  4K5S A;  3AE2 A;  1GAL A;  1Y0P A;  1CJ3 A;  3KPF A;  4GUV A;  4H4R A;  4H4S A;  4Y4N A;  2HQM A;  2B9W A;  1XPQ A;  4FK1 C;  1GOS A;  2ACZ A;  2RGJ A;  1JU2 A;  2C3C A;  1E1K A;  1E7P A;  5KRQ A;  1F8S A;  3QJ4 A;  4UP3 A;  1VRQ B;  2NVK X;  5M10 A;  3HZL A;  3ICR A;  3GMB A;  4BJZ A;  1NEN A;  4I59 A;  2Q0L A;  3UKF A;  1ZMC A;  2OLO A;  3UTG A;  2R0C A;  1RP0 A;  4YKG A;  5U63 A;  5C3J A;  1PXB A;  2EQ7 A;  2YLS A;  1S2Q A;  1REO A;  4XWZ A;  3UKA A;  4EQR A;  3P1W A;  2C75 A;  2VVL A;  2WOI A;  5KXJ A;  2BS2 A;  1IUW A;  1F8R A;  4CCR A;  3AEE A;  2GH5 A;  3GWD A;  4A79 A;  4J33 A;  1GER A;  2YG5 A;  4U2T A;  2XFP A;  3CGB A;  3DGZ A;  1D7L A;  2X3N A;  3LZX A;  3GRT A;  4GR1 A;  2YLR A;  4M52 A;  4EIQ A;  2B76 A;  1RYI A;  2EQ6 A;  1NHR A;  3NYF A;  2ZZB A;  3ICT A;  4IVO B;  3M12 A;  4H4Q A;  1NPX A;  3SGL A;  4H4U A;  2V60 A;  2GMJ A;  5FS8 A;  2YVJ A;  3AE4 A;  2YG4 A;  3NN0 X;  4A65 A;  4YXD A;  3E1T A;  1M6I A;  4Y4M A;  1H86 A;  4B68 A;  5DBJ A;  3BI4 A;  2WPF A;  2WPE A;  4NTE A;  4KPR A;  3LAD A;  2YLT A;  2UZZ A;  4H2Q A;  4JQ9 A;  3KA7 A;  4U8P A;  1XAN A;  3DGH A;  4H2P A;  2IID A;  1PDH A;  4P9S A;  1VG0 A;  4IA5 A;  2XCG A;  4EMJ A;  3CN8 A;  2BAC A;  5FMH A;  4H4T A;  3ZDN A;  3CNP A;  4B67 A;  1Y56 A;  2QAE A;  2RGO A;  5BRT A;  3NK0 X;  1DOD A;  3CGE A;  4CY8 A;  2VOU A;  2VVL G;  1GV4 A;  1JNZ A;  3ATQ A;  3CNT A;  3DJJ A;  2BK5 A;  3K7Q X;  4H4X A;  3VRA A;  4X9M A;  1LTX R;  1PN0 A;  4JDR A;  2FJE A;  1M64 A;  4C77 A;  1YKJ A;  2ZZ0 A;  3K30 A;  3NGC X;  3LOV A;  2XYO A;  3SQP A;  4BK2 A;  1GET A;  3C96 A;  3FPZ A;  1OJA A;  4EIP A;  4JNA A;  4TM1 A;  1MOK A;  4ICY A;  2J3N A;  4NTC A;  3GQK A;  1Z6L A;  1UKV G;  2C76 A;  2Y6R A;  1QLB A;  4I58 A;  1DXL A;  5ER0 A;  3AE9 A;  3SFD A;  3RED A;  2GAG B;  4GDP A;  1DJN A;  1E1L A;  2GR2 A;  4ADW A;  2YWL A;  4U8N A;  1GRF A;  3V3N A;  4BK3 A;  1KDG A;  2H88 A;  1OJD A;  2PHH A;  3B6D A;  3ZYX A;  1D7Y A;  2CUL A;  4H4V A;  3UOZ A;  3P4P A;  1FEC A;  1ZY8 A;  3F8R A;  3UTH A;  1BGN A;  4H4Z A;  4YSH A;  1IUT A;  1H6V A;  1L9D A;  3BHK A;  4OVI A;  3S61 A;  1O94 A;  1JRX A;  4DNA A;  4DSH A;  2C70 A;  1E1M A;  4Z2R A;  1IUX A;  1S3E A;  5IPY A;  4HA6 A;  2I0Z A;  4TM3 A;  4U8O A;  4OPL A;  3ALL A;  2WU2 A;  3RP8 A;  3AE3 A;  4Z26 A;  2VRL A;  1ELI A;  4B64 A;  1JNR A;  4ZN0 A;  1CJ4 A;  1TDE A;  2C67 A;  1GES A;  3UKL A;  4EMW A;  2B7S A;  4YSZ A;  5L46 A;  3BNM A;  3QFB A;  3UTF A;  1XDI A;  3UOX A;  3P4Q A;  5BUK A;  5KOX A;  1K0L A;  2WP5 A;  1B5Q A;  2BXR A;  1F6M A;  2QCU A;  3D1C A;  2YR5 A;  4REK A;  1X31 B;  1GSN A;  2XVI A;  2JK6 A;  2BK3 A;  2A89 A;  2Q6U A;  4J57 A;  4NEW A;  4XWR A;  4AT0 A;  4NEV A;  4BUR A;  5KWF A;  1BKW A;  2FJB A;  1PBC A;  2BAB A;  1GTE A;  1DOE A;  3BHF A;  4U2S A;  3AE7 A;  3F8D A;  4TM0 A;  1K0J A;  4Z25 A;  5FS7 A;  3QVR A;  1L9C A;  2AQJ A;  1DNC A; 
#chains in the Genus database with same CATH topology
 2ZBW A;  4K8D A;  1VBB 4;  4Z44 A;  1YQ3 A;  4ZEY A;  1FL2 A;  1WYC A;  2LKG A;  3G5R A;  1N33 T;  1ZEE A;  4PFP A;  1AOG A;  2QYW A;  2XLU A;  4ZCC A;  3MKD A;  5A1L A;  3CPI G;  4O4I E;  4ZXL A;  2WHD A;  3NT6 A;  2XFO A;  4U8L A;  5AQJ B;  5KX5 E;  4OPG A;  2XAS B;  1ZOY A;  4QX8 B;  3O1I A;  1MND A;  3NTA A;  1NEK A;  2YKS A;  5EK4 A;  2O9Z A;  1PXA A;  1PJ7 A;  4TLZ A;  1HNX T;  3TLT A;  3SWH A;  4P0A A;  1OOP D;  3VKG A;  2BG9 C;  2JB2 A;  2YIN A;  1TDN A;  1VQW A;  3FG2 P;  3ETV A;  3UP5 A;  4GCM A;  5HXR A;  1JRZ A;  3P50 A;  2XLS A;  2X9H A;  5M4Y A;  1Y56 B;  5LG4 A;  1PBD A;  1VG9 A;  3RPU A;  3FZM B;  1D1B A;  3UQ7 A;  2XDO A;  1DU2 A;  3AXB A;  1GND A;  4XXG A;  3N9L A;  4YT0 A;  4KHP T;  1XMQ T;  1NHS A;  2CFY A;  3AD7 B;  2V6Y A;  1GXF A;  2XFQ A;  1IJ6 A;  1N32 T;  3VQR A;  3UTE A;  4DSG A;  4YHH T;  2QA7 A;  1GRB A;  1UUS A;  1XDP A;  2V5D A;  2UU9 T;  3ONL C;  5EBK A;  3Q9T A;  2R04 4;  3AA6 B;  3O1H A;  3RIA A;  5JH7 E;  4BV6 A;  5DQW A;  3IC9 A;  1TYP A;  1KK7 A;  4COF A;  5L4E A;  4FK1 A;  2N2N A;  2BCP A;  3LK2 B;  2DKH A;  4EEB A;  3QSS A;  2VUR A;  4TV8 E;  2BCG G;  4YHJ A;  2NTX A;  4A9W A;  2R07 4;  4OX9 T;  4O5U A;  1NAA A;  4ISS A;  1LPF A;  1BR4 A;  1KNZ A;  2WOV A;  1HX8 A;  2BC0 A;  1FCD A;  4J2C A;  3B3R A;  5AQV B;  3IEE A;  1QJD A;  4WYV A;  1HX1 B;  5KVH A;  3P8C D;  2WCA A;  4HFD A;  1XWM A;  5KMQ A;  2C73 A;  1E6E A;  5HXE A;  4BK1 A;  2I59 A;  3FXD B;  5J7X A;  5KMR A;  2UXC T;  2GF3 A;  2OA1 A;  2J1D G;  4IE7 A;  4LF7 T;  1H7W A;  3Q9D A;  2BRA A;  3I6D A;  4LU6 A;  2CCQ A;  4E7S A;  5U1O A;  1WYB A;  3ZMT B;  2VB6 A;  3OKQ A;  4A98 A;  4AKG A;  2VVS A;  2WAU A;  4OHF A;  1DOB A;  1R8I A;  1LV0 A;  3M0O A;  4IVM B;  3GA8 A;  4O2B E;  2W62 A;  2X51 A;  4XZC A;  2YR4 A;  1LVL A;  3EPT A;  4C3X A;  2EQ9 A;  4ZI3 C;  3IHM A;  4HGA A;  4B63 A;  1Z0P A;  4AKR B;  3EUH A;  3SZC A;  3N9Q A;  5LJN A;  4JBW F;  1Y64 B;  1OJT A;  2Q9Q A;  3VHL A;  2UXX B;  3G06 A;  3AE6 A;  3FZH B;  4Q4W 4;  4PJL A;  1CC2 A;  3B5M A;  2E5V A;  1PJ5 A;  4PAB A;  2D0T A;  3MXZ A;  4GYR A;  4UR9 A;  4ADZ A;  2W00 A;  4DBQ A;  1MXT A;  3T31 A;  5L3D B;  2IVD A;  5F3J A;  4HB9 A;  4AT2 A;  5ABG A;  5HY5 A;  2YEV C;  4X20 E;  2KIN B;  3AVR A;  4YJ3 E;  1FMV A;  3UU3 A;  5JR9 B;  5LXT E;  4H4P A;  4DV5 T;  2E1M A;  4JN9 A;  1VBE 4;  5LHH B;  2X66 A;  5JVD E;  2R06 4;  2X8G A;  3GYI A;  1MIV A;  3HA4 A;  1CC4 A;  4HWI B;  2ODU A;  3RNM A;  4KP3 C;  3HKE E;  3A7M A;  5JR9 A;  5HHF A;  3RYC E;  4PJJ A;  3LK4 2;  1S2Y A;  4H63 V;  3CVR A;  2XAF B;  2VVN A;  2V3A A;  5JCL A;  2Z5X A;  5LGT B;  4BJY A;  5HEO A;  1NWM X;  3SM8 A;  2D0U A;  2HH7 A;  1NG4 A;  3CNS A;  3NRX A;  2D2S A;  4GAV A;  4AOS A;  3SX6 A;  2B9X A;  4OPT A;  4K0U A;  2WBA A;  1HRI 4;  3AEB A;  4OPI A;  4CNJ A;  4JEH B;  3AAE B;  2YK0 A;  4M1P A;  2YLZ A;  4ECH A;  2BG9 A;  3JAD A;  1SHZ C;  4H2R A;  1SEZ A;  2YM2 A;  4B6X A;  3CPH G;  3R9U A;  1COV 4;  3NN6 X;  5FVL A;  4J2W A;  5AQK B;  3C51 A;  2V7L A;  1Q1R A;  2CE7 A;  3NWI A;  3FXE B;  4U2L A;  1NHP A;  4H4Y A;  2E9X D;  4B65 A;  2V6O A;  4ANJ A;  1HTJ F;  5LGN B;  1WR6 A;  4E0V A;  3GD3 A;  2R7F A;  4DUZ T;  2PYJ A;  1LVF A;  3FIM B;  2GEW A;  2Q7V A;  2UUC T;  4OPD A;  4ERR A;  5AQS B;  1LKX A;  1DOC A;  5LBM A;  3AYL A;  1LQU A;  3AA0 B;  1TDK A;  2PLV 4;  3HKD E;  2YAU A;  5AQU B;  3CGD A;  3AB1 A;  4C3Y A;  3LZW A;  1OWA A;  2X50 A;  3AYJ A;  1KFY A;  2JJ9 A;  4X1I E;  2QA1 A;  2YLX A;  4KBM B;  3PUQ A;  2LSI A;  4RHV 4;  3N2K E;  3SZF A;  1Y0P A;  3KPF A;  4H4S A;  5KMS A;  3T1H T;  3ANW A;  2ACZ A;  3OPC A;  1E1K A;  2C3C A;  3C4Z A;  4UP3 A;  3QJ4 A;  4JI6 T;  5M10 A;  2LM9 A;  3HZL A;  2CXD A;  1NEN A;  5HEU A;  2KT9 A;  2LRK A;  3ZYM A;  3UTG A;  2HPL A;  4QWN B;  3PTR B;  3C50 A;  3JBG 4;  2ZM8 A;  1REO A;  3RC8 A;  4PK6 A;  2WOI A;  1F8R A;  4U7I A;  2XQ9 A;  5L3E B;  3AEE A;  3KV5 A;  1IBL T;  2GH5 A;  1GER A;  2YG5 A;  4G73 A;  2XFP A;  4YLH A;  1D7L A;  4EIQ A;  3GRT A;  3VKH A;  2YLR A;  1RUE 4;  4E7Z A;  2EQ6 A;  4AQG A;  2BKP A;  3NYF A;  3ICT A;  4H63 H;  4H4U A;  2GMJ A;  3TLW A;  3AE4 A;  3NN0 X;  4A65 A;  4Y4M A;  2Y48 B;  2A72 A;  4ZI7 E;  3O9X A;  3WAJ A;  2V6X A;  2K5B B;  2YLT A;  4JQ9 A;  2OLT A;  4JI7 T;  3GN5 A;  2W61 A;  5HEH A;  1VCS A;  2AXD S;  4C91 A;  2KSR A;  1PDH A;  2IID A;  2VL0 A;  3ESL A;  2EHO C;  3R84 B;  4NUU A;  2XCG A;  2NR4 A;  5AQL B;  3CN8 A;  3NZP A;  4QXH B;  5LMN T;  5LMU T;  3V5U A;  2N1G A;  2JMH A;  1W09 A;  2RGO A;  3CGE A;  4CY8 A;  2VOU A;  4DR3 T;  4H4X A;  1J5W A;  3VRA A;  5FKY A;  1V9D A;  2RA1 A;  2Z6E A;  5AQT B;  4JI1 T;  2VWA A;  4C77 A;  1YKJ A;  3ZT6 A;  4ZZB A;  3J8F 4;  3FPZ A;  5LNK A;  3LFM A;  3UUL A;  4ICY A;  1T7S A;  4HWH A;  4X66 T;  4AKI A;  3PUX F;  2Y6R A;  4I58 A;  1DXL A;  2WZH A;  5ER0 A;  3ZJ1 A;  3ZC0 A;  3RED A;  1DJN A;  4ADW A;  2YWL A;  2IIU A;  3ZYX A;  2CPT A;  3UOZ A;  3P4P A;  4BAY B;  1O94 A;  4Z2R A;  4MFR A;  4OPL A;  4QKN A;  1WR0 A;  5EK3 A;  4HFV A;  2ZMA A;  1HS7 A;  3F2E A;  4DBR A;  4HWF A;  3UTF A;  2CWY A;  3UOX A;  4MLK A;  5BUK A;  3E0Z A;  2RR1 4;  1F6M A;  2ZM6 T;  2V7I A;  4WW0 A;  1RUC 4;  5IUX A;  2XVI A;  1K5M D;  2IC6 A;  4G63 A;  2VQE T;  5AQN B;  2X68 A;  2BK3 A;  1YKH B;  3P7I A;  2BAB A;  1GTE A;  1E2A A;  4U2S A;  3F8D A;  3C98 B;  3RC3 A;  4EGW A;  3PU8 A;  5J60 A;  4AQY T;  3GWH A;  1AR6 4;  2HWB 4;  2G0U A;  3KKJ A;  1RHI 4;  2UXD T;  1H83 A;  5M0Z A;  1Y01 A;  1XDO A;  2CWO A;  2VVM A;  4EQX A;  3RIU C;  4H50 A;  2XQ6 A;  2X8C A;  4UVC B;  2GB0 A;  3IHG A;  2JQ9 A;  4K5R A;  3RI5 A;  3T8O A;  2CEA A;  2PYX A;  1HFA A;  2C0S A;  3KPK A;  3VRB A;  2OAM A;  4B3M T;  2AAQ A;  2J47 A;  1LJ1 A;  2CA5 A;  3LK3 B;  4L9I A;  1X79 A;  4I4T E;  1HF8 A;  5GON E;  5LCY A;  4LFC T;  3C4X A;  3V5S A;  2XVF A;  3BQL A;  4EMI A;  1RSG A;  3RRC A;  4CCQ A;  3L3P A;  4ILU A;  4HFC A;  1FEA A;  1IJH A;  3PO7 A;  3I3L A;  1LRZ A;  4AQF C;  3CX6 B;  3BI5 A;  4IE0 A;  4FX9 A;  3ZC1 A;  1J5E T;  2E9X C;  1D4C A;  4LF9 T;  1N4V A;  2IAK A;  2A87 A;  3CGC A;  3JAF A;  5DJQ C;  3KVE A;  1S35 A;  2CM0 A;  4WZX A;  2NP9 A;  3H3A A;  4J34 A;  2XAG B;  4YY3 T;  3I0O A;  3SZ0 A;  1E39 A;  2N9D A;  4MAL A;  2GRT A;  2WP6 A;  3SYI A;  2NW9 A;  4F8H A;  3LXD A;  4UF0 A;  4H9S E;  4U74 A;  3DH9 A;  3FZF B;  4CZZ B;  2CHO A;  2ZZC A;  3K3Q C;  1CJ2 A;  2R45 A;  2IUB A;  2C65 A;  1H84 A;  3JAE A;  4CXY A;  4U3C A;  3HI2 A;  4RG4 A;  3KBU A;  4ILC A;  4Z2T A;  3AE5 A;  3MJX A;  3DJG X;  2HWC 4;  4Z91 A;  5ABE A;  1D4M 4;  4JYA T;  2BYB A;  1MIY A;  3UFE A;  1ZX9 A;  3TKL B;  1OXZ A;  2NPX A;  3DJB A;  4IDP A;  3LBX B;  2LSY A;  2WS3 A;  4WX1 A;  3PUG A;  4DMW A;  4JI8 T;  2B7R A;  2X99 A;  3CQX C;  4LF4 T;  4AP3 A;  4OYK A;  2RPA A;  4U8M A;  1HG2 A;  4IHJ E;  3QSM A;  1D0Z A;  1VCT A;  4CXX A;  1D1C A;  2WY2 A;  4FI5 A;  2BA9 A;  5JCN A;  5JRC B;  1H82 A;  3NHO X;  5EB5 A;  1O5W A;  5AFU L;  4AKH A;  2XFU A;  5GRT A;  2VKO A;  3C4W A;  3P4S A;  1HNZ T;  2BKO A;  4LII A;  2B1E A;  2WPC A;  2APG A;  3II4 A;  4B66 A;  5LA6 E;  2C5J A;  1ONF A;  3UOV A;  1HCI A;  3MAC A;  5JRC A;  1F3P A;  2LFC A;  2R0G A;  1PXC A;  3GDN A;  3WE0 A;  4EM4 A;  3NRY A;  1EBD A;  5BR8 T;  5L3C B;  1N1P A;  3UKH A;  5FS9 A;  2C4C A;  4K2X A;  5CKU A;  1OED C;  4TUY E;  1K0I A;  3N9M A;  5FVK A;  3M13 A;  2M6I A;  5JDL A;  2VQB A;  2JAE A;  3NYC A;  4DGK A;  3T14 A;  2V6Y B;  4EIW A;  1GRA A;  3BQI A;  4IE4 A;  5IHY A;  3LB8 A;  4HEA A;  2IML A;  2CLY B;  2XM1 A;  2BS4 A;  2OV9 A;  2VQF T;  3UUB A;  4EQW A;  4YSX A;  1POV 0;  2PW9 A;  3P9U A;  5J2T E;  4KI0 F;  2C5I T;  2CXL A;  1W9R A;  2W0H A;  2X8H A;  4X62 T;  3KBT A;  1P2E A;  1D4D A;  3SRZ A;  3CIR A;  4X1Y E;  5JDG A;  1XMO T;  4GK5 E;  2D9D A;  1NDA A;  5JDF A;  4HFH A;  1VDC A;  4JI4 T;  2BS3 A;  3N9N A;  2QVA A;  5J2U E;  4Y4L A;  5ETW A;  2C3D A;  3IF8 B;  2KLQ A;  4DND A;  1NA1 D;  4U8J A;  4Z24 A;  1DJQ A;  5EOW A;  4HKA A;  2MBG A;  3H3M A;  3F8P A;  3RIU A;  1CF3 A;  4DUY T;  4TNW A;  2TPR A;  5FYM A;  3URH A;  1PIV 4;  3RGL A;  2L9Q A;  3PUZ F;  4O4J E;  4TWH A;  1H7X A;  5FXV A;  2IVE A;  5CJ5 A;  4B3R T;  5HYA A;  2IHR 1;  2IDO B;  3UKK A;  3JC6 D;  2YQU A;  2DI4 A;  3PS9 A;  5ABF B;  2ARD A;  1SUM B;  2LSJ A;  5JDN A;  2LHN A;  3ADA B;  2C64 A;  1COY A;  2H7O A;  2XUE A;  4IL4 A;  2E5L T;  1K4Q A;  2X9W A;  3KLJ A;  2AE9 A;  4WCT A;  3AD9 B;  3DME A;  2EHO D;  2B9Y A;  2C66 A;  2WES A;  3CNJ A;  1NAF A;  5IQ4 A;  2WDR A;  3ZMZ B;  5BVA A;  4G6G A;  5ABF A;  2YR6 A;  3N9O A;  2E9X A;  2JMK A;  2EQ8 A;  1BZL A;  2Q0K A;  2GV8 A;  4DR6 T;  3UKP A;  4JY2 A;  3N9P A;  3OYZ A;  4G74 A;  1L9E A;  5FXX A;  3T1Y T;  1PBB A;  3CPZ A;  4IE5 A;  3ZST A;  2Q9Q B;  2DWG A;  1XHX A;  3V76 A;  2X67 A;  4UEL A;  2LM2 A;  4YTP A;  2YLW A;  3KU9 A;  1GPE A;  2CRB A;  1BF3 A;  1JEH A;  4ZCD A;  3UOY A;  1MQT D;  2XLR A;  1GAL A;  1U4Q A;  4LFA T;  5HXH A;  1CJ3 A;  3EHZ A;  4H9N C;  4LF6 T;  1GOS A;  2RGJ A;  3ZYL A;  1JU2 A;  1F8S A;  1EAH 4;  2NVK X;  3GMB A;  1VBD 4;  2Q0L A;  1ZMC A;  2VKD A;  1RUF 4;  3MZK B;  2WBL A;  5C3J A;  1PXB A;  2EQ7 A;  5U63 A;  2VVL A;  2BS2 A;  3CK6 A;  3HYW A;  1N34 T;  3FZL B;  4DR1 T;  3CGB A;  2KWH A;  3M65 A;  5AQQ B;  2HHH T;  3LZX A;  4M52 A;  4LMK A;  2XQY A;  1RYI A;  3Q5X A;  4EZ4 A;  2ZZB A;  4IVO B;  3Q5E A;  4H4Q A;  3ZMS B;  4II3 A;  5FS8 A;  3BK9 A;  3QUJ A;  1M6I A;  1H86 A;  2BG9 E;  5DAB A;  1I6Z A;  2ES0 A;  2UXN B;  2I6H A;  1XAN A;  4UXN B;  4JI0 T;  4V1A v;  2DHR A;  3I9W A;  1QSD A;  5AQM B;  5J0Z A;  3ZDN A;  4B67 A;  4EMJ A;  2XQ3 A;  4X1K E;  4DR4 T;  5BRT A;  3NK0 X;  1YD8 G;  1YKE B;  2VVL G;  1GV4 A;  1JNZ A;  4MHC A;  3DJJ A;  2BG9 B;  3AAA B;  1VBA 4;  1M64 A;  2ZZ0 A;  4ZI2 C;  1J1J A;  3K8P C;  3HYX A;  1GET A;  3L8R A;  4I55 E;  4JLE A;  4KMC A;  2NOX A;  4G2A A;  2YN6 A;  1Z6L A;  3GQK A;  1N36 T;  3ZMU B;  5L3F B;  4JV5 T;  3CMM A;  2L8K A;  2YU2 A;  3AE9 A;  2XY8 B;  1OED A;  4GDP A;  2HN1 A;  4ILB A;  1AR8 4;  5AQH B;  1OJD A;  3B6D A;  1HG5 A;  1D7Y A;  2W67 A;  2CUL A;  4H4V A;  4UEM A;  5LB7 B;  1FEC A;  3FHN A;  3ZPO A;  1ZY8 A;  3F8R A;  4YSH A;  1VOM A;  4H4Z A;  4JI2 T;  1L9D A;  4DSH A;  5LYJ E;  2C70 A;  4AXP A;  2Y8D A;  2WWU A;  4DMV A;  4TM3 A;  3ALL A;  2WU2 A;  1SE7 A;  3CWZ B;  4Z26 A;  2VRL A;  1ELI A;  3PJA J;  1JNR A;  3ETU A;  4B64 A;  4ZN0 A;  4G6H A;  1VRH 4;  1CJ4 A;  2C67 A;  3UKL A;  2P9B A;  1GES A;  1XI1 A;  2B7S A;  4CI3 B;  3BNM A;  3QFB A;  4PJM A;  1US7 B;  2WP5 A;  2QCU A;  2XTL A;  1M7K A;  4TWD A;  2K24 A;  1GSN A;  2JK6 A;  2DWK A;  4P09 A;  5AQI B;  3ZT5 A;  2A3D A;  3RF1 A;  2A89 A;  4NEW A;  3ANW B;  4XWR A;  3PJA A;  4BUR A;  2BKN A;  1UCU A;  5KWF A;  2FJB A;  3SS1 A;  1K0J A;  4Z25 A;  1ZV4 X;  3QVR A;  1L9C A;  3E08 A;  2AQJ A;  2LT3 A;  3KV4 A;  3OJA A;  4X4J A;  1YY5 A;  3ITJ A;  4EM3 A;  2HPJ A;  2YDQ A;  5F8P A;  2W66 A;  1H8T D;  4U33 A;  3EDV A;  3RLF F;  3ZCI A;  2GQF A;  4UIG A;  2RP4 A;  3UCL A;  1LQT A;  2CDU A;  2XVH A;  3AE8 A;  1L0V A;  5FY7 A;  1CC6 A;  4L0R A;  4J31 A;  1WFD A;  4KHZ F;  3BI2 A;  1E1N A;  3W15 B;  4OK0 A;  3GN5 B;  3QSE A;  1ZK7 A;  3EAN A;  4K22 A;  2VRM A;  3A8Y C;  3AEA A;  2XVJ A;  2KWI B;  4IV9 A;  4UDQ A;  3JC6 C;  4KUM B;  1MMD A;  4LF5 T;  1D0X A;  2JPF A;  3ZT7 A;  3PU3 A;  2V7J A;  3LSV A;  2UXB T;  3HYV A;  3UP4 A;  2BZB A;  3NTD A;  2XQ7 A;  4J56 A;  4CI1 B;  5AQF B;  2DLR A;  4O4H E;  2LOP A;  2YG6 A;  2BC1 A;  1YXR A;  4IT4 A;  4U2Y A;  4CNK A;  4A6N A;  1EZ3 A;  4HN9 A;  2V3B A;  3CX7 B;  3HL6 A;  2K9A A;  1BWC A;  1OJC A;  2FJA A;  3LDQ B;  4DV3 T;  4RSL A;  2H3R A;  4B3T T;  4O5Q A;  5L4H A;  2RS3 4;  4XAX B;  3CQC B;  3O1J A;  1B8S A;  1CL0 A;  2A9U A;  3GMC A;  3AWI A;  2WM9 A;  4YSY A;  1KNP A;  5IYZ E;  2A2F X;  3ABV A;  4USQ A;  3B57 A;  2FJD A;  2XHE B;  3DA1 A;  4U8K A;  4OPC A;  4C90 A;  2R9Z A;  2XQ5 A;  5JCK A;  3H8L A;  2MAW A;  1N4W A;  3VR9 A;  3EAO A;  1KNR A;  5FXZ A;  1OJ9 A;  4EQS A;  4A97 A;  3NH3 X;  3UFG A;  2PTF A;  2YG7 A;  4ASK A;  3CND A;  1JRY A;  2XQ8 A;  1O95 A;  4NZH A;  4U8I A;  3H4K A;  1B4V A;  4UDR A;  4TV9 E;  3KFW X;  2YDR A;  2VKJ A;  3FMW A;  4NNJ A;  4DV0 T;  4AI6 A;  2GR3 A;  3SFE A;  3G5S A;  5LBQ B;  1FIO A;  3HKC E;  2KMF A;  5KOW A;  3C64 A;  3DK4 A;  4JUY A;  1CBO A;  2VL8 A;  5HAX A;  4GAP A;  1V59 A;  3IWA A;  2BDE A;  4RG3 A;  1D5T A;  2CMR A;  2JB3 A;  3G5Q A;  4HWD A;  2WMN A;  2QA2 A;  4YKF A;  3SY4 A;  4PAG A;  2UUB T;  1KSU A;  4X65 T;  5JCM A;  3AB3 B;  5JQG E;  2BRY A;  1H7C A;  2X0Y A;  5L47 A;  3OBV E;  1D0Y A;  1IAP A;  3S5W A;  1MO9 A;  2GQW A;  2QGS A;  2BBJ A;  2XAJ B;  4X5T A;  2RMU 4;  3NLC A;  5KMG P;  3ATR A;  3GYX A;  3RKO A;  3U3I A;  1ZDL A;  1X9B A;  4H4W A;  4IA6 A;  1SA0 E;  4QX7 B;  3RYI E;  2V7M A;  4WNK A;  3EF6 A;  3K3N A;  2ACX A;  3NK2 X;  1T98 A;  2WQY A;  3T2Z A;  3KIN B;  4I43 B;  3SUC A;  2VAS A;  4GRT A;  5ADX L;  1FEW A;  1CUN A;  3FI7 A;  3UQ4 A;  3MK7 C;  5FL0 A;  1ZMD A;  2TMD A;  3K7T A;  3AEC A;  2MTQ A;  1IJ5 A;  2NW7 A;  2JKC A;  3LG7 A;  2CXF A;  1GRE A;  1YQZ A;  5JTG A;  2YG3 A;  3DJE A;  4NTD A;  2XLT A;  3D8X A;  1AR9 4;  4AP1 A;  3IA3 A;  3UU5 A;  4TZ4 C;  3TLU A;  1EL9 A;  1JOA A;  4UF0 B;  5CQF A;  3I9Y A;  1BGJ A;  2DKI A;  5HXI A;  4HE8 A;  1PJ6 A;  1FEB A;  2NW8 A;  3RRW A;  2XVE A;  3L1R A;  2YDS A;  3ZCJ A;  2Y6X A;  3T0K A;  4APN A;  3OYX A;  5BUL A;  4X64 T;  1W0B A;  2L3L A;  4UDP A;  4K0K T;  1HNW T;  3ZN0 B;  5TR3 A;  2PJQ A;  3QB5 A;  4PK5 A;  1TDF A;  1UX5 A;  4P0B A;  5J1G A;  4H7U A;  4BJM A;  1EL5 A;  5LG3 A;  4B1B A;  4B69 A;  4OPU A;  4D03 A;  4EED A;  3QNU A;  3AXJ B;  2PG8 A;  3DK8 A;  3HKB E;  3CQG B;  1RMU 4;  5HWX A;  3H37 A;  3T2Y A;  3ZEF B;  4EB6 E;  5FNV E;  2WP9 A;  4IE6 A;  3AYI A;  5L2L A;  2F5Z A;  1W0A A;  3RH3 A;  2WEU A;  3AXJ A;  2FBW A;  1VRB A;  2BK4 A;  1GRT A;  2WU5 A;  1PO2 4;  1EL7 A;  4LML A;  3AVS A;  3FZK B;  1IUV A;  3IHR A;  2PZS A;  3WI3 A;  4JNQ A;  5CA0 E;  5AQO B;  3GRS A;  3OZ2 A;  4DV4 T;  3K3O A;  4DV1 T;  2EHO A;  4GKJ T;  2LE8 A;  5LJM A;  2C7G A;  2C72 A;  3ISH A;  2ODV A;  1P2H A;  4Q4X 4;  4ZI2 D;  2GR0 A;  1IBK T;  4X9N A;  3QVP A;  4UVA B;  4CY6 A;  4II2 A;  4A5X A;  3DP7 A;  3D0T A;  1MIW A;  1H81 A;  3GQH A;  4QXC B;  3ZN1 B;  2OAL A;  4ZS2 A;  3R6N A;  4IDN A;  4KX6 A;  1FMW A;  2MPK A;  4I0U A;  2PBI A;  5JR9 C;  4I50 E;  3FBS A;  2OA5 A;  1HR0 T;  1GT8 A;  5EK2 A;  2VK9 A;  2X9Y A;  4K5S A;  4NWZ A;  3AE2 A;  1XNQ T;  4H9P C;  1E7P A;  3T2K A;  2K3W A;  1VRQ B;  4IL9 A;  3ICR A;  4H9R C;  3EDU A;  2R0C A;  3PUY F;  2KND A;  2YOE A;  4YKG A;  2JQQ A;  2LLY A;  5LOV E;  4XWZ A;  4EQR A;  5LGU B;  2E2A A;  3EAM A;  1QUU A;  4IDZ A;  2C75 A;  3OVU A;  3P1W A;  5TAO A;  4O2A E;  5KXJ A;  1IUW A;  4Q4V 4;  4UVB B;  4HTE A;  3GWD A;  4J33 A;  3KVA A;  4U2T A;  4JEU B;  3DGZ A;  4GR1 A;  2X3N A;  4XBF B;  4F6R C;  2B76 A;  4AIS A;  4NPP A;  1NHR A;  2W2U A;  3PUS A;  3N2G E;  2RS1 4;  2W4X A;  2R6G F;  3M12 A;  4U72 A;  3DTO A;  1Z8U A;  4YXD A;  4B68 A;  2CBI A;  5DBJ A;  3BI4 A;  2WPF A;  4KPR A;  4U8P A;  1AR7 4;  1WRD A;  4A56 A;  3DGH A;  4P1N A;  4H2P A;  3ONJ A;  4TWF A;  2J4G A;  3ZSS A;  1VG0 A;  4QXB B;  5FMH A;  4H4T A;  1ZHC A;  3PUV F;  1Y56 A;  2QAE A;  5E0O A;  3CNT A;  4X9M A;  3GMI A;  1LTX R;  2FJE A;  3K30 A;  3NGC X;  3LOV A;  4EXT A;  5F5W A;  3NKZ A;  3C96 A;  2MYS A;  4TM1 A;  1WCR A;  3RQW A;  2XSB A;  1G8X A;  2J3N A;  4NTC A;  3RYH E;  3RHW A;  3RQU A;  4CN1 A;  4BA9 A;  1UKV G;  4H9O C;  1UX4 A;  2C76 A;  4EYU A;  3SFD A;  1BEV 4;  2GAG B;  1E1L A;  2E9X B;  1GRF A;  4BK3 A;  1KDG A;  2PHH A;  1PO1 4;  2WMO A;  3NVO A;  2V26 A;  4IDO A;  5FY1 A;  3UU6 A;  1BGN A;  3UTH A;  1IUT A;  4OVI A;  3BHK A;  4HFI A;  4EZH A;  4AQF A;  1S3E A;  5IPY A;  3J9X 1;  4GYS A;  4U8O A;  2J62 A;  3AE3 A;  2RM2 4;  1TDE A;  4EMW A;  5FL1 A;  1XDI A;  3QB5 K;  3Q5D A;  3P4Q A;  4Z90 A;  3EI0 A;  1K0L A;  2BXR A;  1AJ3 A;  2V7K A;  4REK A;  4U31 A;  3KDS E;  5HEJ A;  4J57 A;  2XQ4 A;  4AT0 A;  1BKW A;  1PBC A;  3BHF A;  3VU7 H;  1DOE A;  4TNV A;  4TM0 A;  5FS7 A;  1PVC 4;  3ATQ A;  3PV0 F;  1CHU A;  1DNC A;  3UTK A;  4L5G A;  3FBL A;  4PNI A;  2CHN A;  3VR8 A;  4MBQ A;  1MMN A;  5GSN A;  3ALM A;  3FB2 A;  1QO8 A;  2NTY A;  2H7V C;  4GIW A;  5ABH A;  1Q9I A;  2WDV A;  3K7M X;  2R0P A;  1EV1 4;  3OC4 A;  5KMP A;  4HFB A;  1GRG A;  5EB4 A;  3DJD A;  2CBJ A;  1KF6 A;  1D4E A;  2LEH A;  2M6B A;  3KD9 A;  1MMG A;  2JQH A;  3O0H A;  2GAH B;  1R08 4;  4AIU A;  4GB3 4;  3NKS A;  1M62 A;  2H89 A;  3CKD A;  3FBZ A;  2X5I D;  4QH1 A;  2QRX A;  4N78 D;  3U78 A;  4TLX A;  4O8S A;  4K7Z A;  3N5L A;  3NYE A;  3TLS A;  5AQP B;  4DR7 T;  4TX5 A;  1CJC A;  3GWF A;  3C4N A;  1NCQ D;  2UUA T;  3GSI A;  4EV6 A;  3RHA A;  4YWO A;  1OED E;  5IWA T;  2D5U A;  2R46 A;  5KVI A;  2Y6Q A;  3NG7 X;  3SZW A;  4IDQ A;  4C74 A;  4OCG A;  3UUX B;  5JDH A;  2YVF A;  3ALJ A;  2NWB A;  5HXC A;  3LJC A;  3V3O A;  2LJL A;  4WBN E;  4U2Z A;  3P4W A;  1U5P A;  4Z2U A;  1NG3 A;  2YVG A;  3KV9 A;  1OED B;  3PDY A;  2BVL A;  3P4R A;  5HCJ A;  3CTY A;  4FJO A;  2R4E A;  1TRB A;  2DNX A;  3QC9 A;  1XNR T;  3H8I A;  3IBP A;  3BNU A;  4CN4 A;  1B7T A;  2XM2 A;  5LV9 A;  3WAK A;  4QH4 A;  4C5O A;  4A7A A;  2GVC A;  2XPK A;  4WBO A;  4YTN A;  3RP7 A;  1D1A A;  1MMA A;  2WDQ A;  5KDM C;  2A8X A;  2JIW A;  1GEU A;  5IQ1 A;  2MOZ A;  5CB4 E;  3UUN A;  5JRE A;  1B37 A;  3ZMV B;  1NHQ A;  1W4X A;  4GF7 A;  4PDW D;  2PFV A;  2SPC A;  4YTM A;  3UUM A;  2AR8 A;  3NIX A;  4H2N A;  5U25 A;  4MJW A;  1EL8 A;  3OTO T;  1ZKQ A;  1LVK A;  1HRV 4;  2V5Z A;  4OYJ A;  1UUR A;  1E1H B;  1BR2 A;  4EOZ B;  3K1S A;  1PBF A;  1HXS 4;  4LFB T;  3RP6 A;  2C5K T;  2E8I A;  3AA7 B;  4D04 A;  1VBC 4;  3COX A;  1S94 A;  4PFO A;  2WZI A;  1IUU A;  1AL2 4;  2JB1 A;  4EYY R;  3J7Y q;  2FUP A;  2YM1 A;  4A99 A;  4ZZC A;  1YW0 A;  2DL1 A;  4NXM T;  3KV6 A;  2BXS A;  1IUS A;  3JSK A;  4Z43 A;  5HWY A;  2LRL A;  2Q9Q D;  4N9X A;  1PS9 A;  3UKQ A;  2M67 A;  1R09 4;  2WET A;  1KEY A;  4H9Q C;  1XHC A;  2WOW A;  2XZE A;  4DO0 A;  2PY5 A;  4NXN T;  4CRT A;  4FDC B;  1TYT A;  4IGU A;  3AEG A;  4UV8 B;  4J36 A;  4ZHQ E;  3GD4 A;  4Q25 A;  4AOX A;  2LSK A;  3RX6 A;  3JD7 4;  3E22 E;  4GKK T;  1S3B A;  4Q4Y 4;  2RGH A;  5KNL A;  3O4X E;  3ZKR A;  4PAA A;  1RUG 4;  4O4L E;  3CPJ G;  3ZYK A;  3GDP A;  4A6N B;  5JCI A;  3NK1 X;  3PE0 A;  4QHO A;  1N4U A;  2BBH A;  5FY0 A;  3ONX A;  2BVM A;  2CVJ A;  4Z8X A;  1MNE A;  2F4V T;  3C4A A;  3AE1 A;  3BQK A;  3L39 A;  3Q2M A;  5LP6 E;  4NIQ A;  3F57 A;  2XFN A;  3Q6J A;  1TDO A;  3I1A A;  1WLX A;  1T8B A;  1PBE A;  4LA1 A;  2W63 A;  5LHG B;  4A5L A;  1RUH 4;  2KXP B;  2LSG A;  4OFZ A;  2V8S V;  2XJ7 A;  4GK0 E;  5FS6 A;  3X1D A;  1GRH A;  3KVB A;  3QFA A;  1PHH A;  4DV6 T;  2KZ7 B;  2HN2 A;  3EVY A;  2R4J A;  4YFS A;  1G73 A;  2DCF A;  4TM4 A;  3UT5 E;  5HCM A;  3IF9 A;  3RIF A;  2GR1 A;  3ICS A;  3AD8 B;  2PYL A;  1UGO A;  2V61 A;  3F31 A;  3CML A;  3SXI A;  5JDM A;  3SOL A;  1ZP0 A;  4IST A;  4DID B;  2JBV A;  4HFE A;  1HYU A;  4DV7 T;  3AEF A;  2OLN A;  4G9K A;  2Z5Y A;  3T37 A;  2XLP A;  4PW8 A;  3Q5W A;  4CBQ A;  3NNE A;  4CXW A;  2RAB A;  4GDE A;  1YQ4 A;  5C8Y E;  4CI2 B;  2LOS A;  4YJ2 E;  4ILA A;  1KSS A;  5L3B B;  4JY3 A;  3L09 A;  4PK4 A;  4CQI A;  2XQA A;  2JRK A;  2GK9 A;  3AED A;  1ZOV A;  3PVC A;  1IZN B;  3NRN A;  3AAI A;  2XSA A;  1FOH A;  2XAQ B;  1ZKE A;  3GYJ A;  2RS5 4;  3NBX X;  2GMH A;  4DR5 T;  2ZLY A;  2VQ7 A;  1I94 T;  4IRE A;  3DK9 A;  1Z7S 4;  5HXS A;  2EX3 A;  1F8W A;  3LJP A;  2WSS V;  2E4G A;  3QOF A;  3L8K A;  2VZ2 A;  4EAH A;  2CLY C;  3NZQ A;  3S4U A;  1RVF 4;  4USR A;  5HYM A;  3VRD B;  5CGM A;  2ZM0 A;  4DV2 T;  1GTH A;  1Q1W A;  5C2T A;  2I0M A;  5LHI B;  5CA1 E;  2ZM2 A;  4Y4N A;  4GUV A;  4H4R A;  2HQM A;  3I0Q A;  2B9W A;  1XPQ A;  4FK1 C;  5KRQ A;  1T72 A;  2V1D B;  3PUW F;  4BJZ A;  2IW5 B;  4I59 A;  3UKF A;  2OLO A;  1RP0 A;  3UKA A;  2YLS A;  1S2Q A;  4ZS3 A;  1RUD 4;  1RUJ 4;  4JI3 T;  3M3Z B;  4HWC A;  1XHZ A;  2IC9 A;  2X0L B;  4CCR A;  4A79 A;  5DQV A;  1UK5 A;  3EAB A;  4IIJ E;  4DVD A;  2LKH A;  3TLV A;  4U7Y A;  1NPX A;  1FJG T;  3SGL A;  4JI5 T;  2V60 A;  3MA9 A;  3ZJ2 A;  2YVJ A;  4UV9 B;  2YG4 A;  3E1T A;  1ASJ 4;  4LMJ A;  2WPE A;  2X9X A;  4NTE A;  4ZI3 D;  5HEG A;  3LAD A;  2UZZ A;  3UU8 A;  4H2Q A;  3KA7 A;  2K48 A;  4P9S A;  1RUI 4;  4IA5 A;  3A5X A;  1XZY A;  5FP3 A;  2BAC A;  3CNP A;  2VKH A;  3RYF E;  1DOD A;  3RKG A;  3K7Q X;  3B13 A;  2BK5 A;  1PN0 A;  2WWV A;  5FMN A;  4BJN A;  4JDR A;  2XAH B;  4LF8 T;  5H6Q B;  2XYO A;  3SQP A;  4BK2 A;  1OJA A;  4EIP A;  4JNA A;  1MOK A;  3PUA A;  3AA1 B;  3ZLI A;  1O3X A;  5CFB A;  1QLB A;  4QH5 A;  3N2O A;  2EHO B;  2GR2 A;  4U8N A;  4B3S T;  3V3N A;  2H88 A;  2Q9Q C;  2W0G A;  4AKL A;  2WB5 A;  1IBM T;  5H6R B;  2LHR A;  2V5C A;  4DR2 T;  1H6V A;  3S61 A;  4DNA A;  1JRX A;  1E1M A;  1IUX A;  3JCF A;  3CX8 B;  2YU1 A;  4HA6 A;  2I0Z A;  5AQR B;  3QK6 A;  5L3G B;  3RP8 A;  3UU4 A;  5AQG B;  5EZY E;  4ZOL E;  1GQE A;  4TN7 B;  4YSZ A;  5L46 A;  3PUR A;  2JQK A;  1BR0 A;  5KOX A;  1B5Q A;  4NUV A;  3D1C A;  5FXW A;  2YR5 A;  1X31 B;  4GOU A;  3HR0 A;  2X0H A;  4CN6 A;  1BR1 A;  2Q6U A;  4NEV A;  4PJN A;  5JDQ A;  3AE7 A;  5BMV E;  3LBX A; 
#chains in the Genus database with same CATH homology
 5J60 A;  2ZBW A;  4X4J A;  4K8D A;  1YY5 A;  3ITJ A;  3VR8 A;  4Z44 A;  3KKJ A;  1YQ3 A;  5GSN A;  4EM3 A;  3ALM A;  1QO8 A;  1FL2 A;  1Q9I A;  2WDV A;  1H83 A;  3K7M X;  2R0P A;  3G5R A;  5M0Z A;  2VVM A;  3OC4 A;  4EQX A;  5KMP A;  1AOG A;  2XLU A;  2GQF A;  4H50 A;  2X8C A;  1GRG A;  3CPI G;  3DJD A;  5EB4 A;  4ZCC A;  3UCL A;  2GB0 A;  3IHG A;  4K5R A;  2WHD A;  1KF6 A;  1LQT A;  3NT6 A;  2CDU A;  1D4E A;  2XFO A;  2PYX A;  2XVH A;  4U8L A;  3KD9 A;  3KPK A;  3VRB A;  3AE8 A;  1L0V A;  1CC6 A;  4OPG A;  1ZOY A;  3O0H A;  4J31 A;  2GAH B;  2OAM A;  3NTA A;  1NEK A;  2AAQ A;  2O9Z A;  1PXA A;  1PJ7 A;  3BI2 A;  1E1N A;  4TLZ A;  3NKS A;  1LJ1 A;  2H89 A;  2JB2 A;  3QSE A;  1ZK7 A;  3EAN A;  4K22 A;  1TDN A;  1VQW A;  2VRM A;  3FG2 P;  4TLX A;  3AEA A;  3UP5 A;  4K7Z A;  4GCM A;  2XVJ A;  4IV9 A;  3NYE A;  4UDQ A;  1JRZ A;  2XVF A;  2XLS A;  1CJC A;  1Y56 B;  3GWF A;  3C4N A;  4EMI A;  1RSG A;  3GSI A;  1PBD A;  4CCQ A;  3RHA A;  4YWO A;  1VG9 A;  1FEA A;  1IJH A;  2R46 A;  3PO7 A;  2Y6Q A;  3I3L A;  2XDO A;  3NG7 X;  5KVI A;  3AXB A;  3SZW A;  3BI5 A;  1GND A;  4C74 A;  4FX9 A;  4OCG A;  4XXG A;  1D4C A;  3HYV A;  4YT0 A;  3NTD A;  3UP4 A;  1N4V A;  4J56 A;  1NHS A;  2CFY A;  2YVF A;  3AD7 B;  3ALJ A;  1GXF A;  2XFQ A;  3V3O A;  2YG6 A;  2A87 A;  2BC1 A;  3CGC A;  3UTE A;  3VQR A;  4DSG A;  1GRB A;  4Z2U A;  1NG3 A;  3KVE A;  2YVG A;  4CNK A;  4A6N A;  2V3B A;  5EBK A;  4J34 A;  3Q9T A;  4BV6 A;  3P4R A;  1BWC A;  1OJC A;  3SZ0 A;  2FJA A;  1E39 A;  3CTY A;  1TYP A;  3IC9 A;  2R4E A;  1TRB A;  4FK1 A;  2GRT A;  2BCP A;  2DKH A;  4RSL A;  2WP6 A;  3SYI A;  3H8I A;  3BNU A;  3LXD A;  4O5Q A;  3QSS A;  2BCG G;  3DH9 A;  4A9W A;  1B8S A;  4O5U A;  1CL0 A;  1NAA A;  2ZZC A;  3GMC A;  1CJ2 A;  2R45 A;  5LV9 A;  1LPF A;  3AWI A;  4YSY A;  2WOV A;  1CHU A;  1KNP A;  2BC0 A;  4C5O A;  1FCD A;  3B3R A;  3ABV A;  4A7A A;  1QJD A;  2GVC A;  4USQ A;  2C65 A;  4YTN A;  2FJD A;  1H84 A;  3DA1 A;  4U8K A;  3RP7 A;  4OPC A;  2WDQ A;  2A8X A;  2R9Z A;  4RG4 A;  1GEU A;  5JCK A;  3H8L A;  5KVH A;  1N4W A;  5IQ1 A;  4Z2T A;  3VR9 A;  3AE5 A;  3DJG X;  5KMQ A;  2C73 A;  1B37 A;  1E6E A;  1NHQ A;  1W4X A;  2BYB A;  3EAO A;  4BK1 A;  1KNR A;  1OJ9 A;  1ZX9 A;  4GF7 A;  5J7X A;  3NH3 X;  2GF3 A;  2OA1 A;  2NPX A;  4EQS A;  2YG7 A;  4YTM A;  2AR8 A;  1JRY A;  3CND A;  3NIX A;  4H2N A;  1O95 A;  5U25 A;  4MJW A;  4NZH A;  1EL8 A;  1H7W A;  2WS3 A;  1ZKQ A;  4U8I A;  4WX1 A;  3H4K A;  2BRA A;  3I6D A;  1B4V A;  2B7R A;  2V5Z A;  2X99 A;  3FMW A;  4LU6 A;  4NNJ A;  5U1O A;  2GR3 A;  3SFE A;  3G5S A;  4AP3 A;  4U8M A;  5KOW A;  3DK4 A;  1CBO A;  3QSM A;  4GAP A;  1PBF A;  1V59 A;  3IWA A;  3RP6 A;  1DOB A;  4RG3 A;  1D5T A;  1LV0 A;  3M0O A;  2JB3 A;  4IVM B;  4D04 A;  3G5Q A;  3COX A;  2YR4 A;  1LVL A;  2BA9 A;  2QA2 A;  4YKF A;  1IUU A;  5JCN A;  3EPT A;  4C3X A;  1H82 A;  3NHO X;  3SY4 A;  2EQ9 A;  5EB5 A;  2JB1 A;  1O5W A;  1KSU A;  2XFU A;  5GRT A;  3P4S A;  5JCM A;  3IHM A;  4LII A;  2WPC A;  2BRY A;  4B63 A;  2YM1 A;  4A99 A;  2APG A;  3S5W A;  1MO9 A;  2GQW A;  2BXS A;  3II4 A;  1IUS A;  3JSK A;  4Z43 A;  4B66 A;  1ONF A;  4N9X A;  3SZC A;  1PS9 A;  3NLC A;  3UKQ A;  1F3P A;  3UOV A;  3ATR A;  2LFC A;  2R0G A;  1PXC A;  2WET A;  3GDN A;  3GYX A;  3WE0 A;  4EM4 A;  1ZDL A;  4IA6 A;  4H4W A;  1XHC A;  1EBD A;  2WOW A;  1OJT A;  1N1P A;  4CRT A;  4FDC B;  3AE6 A;  3UKH A;  1TYT A;  5FS9 A;  3EF6 A;  2C4C A;  1CC2 A;  4K2X A;  5CKU A;  3AEG A;  4J36 A;  1PJ5 A;  2E5V A;  3NK2 X;  2WQY A;  3GD4 A;  3T2Z A;  4PAB A;  3SUC A;  4AOX A;  1MXT A;  4GRT A;  1K0I A;  2IVD A;  3T31 A;  3M13 A;  2VQB A;  3NYC A;  4DGK A;  2JAE A;  4HB9 A;  4AT2 A;  5KMR A;  3T14 A;  1S3B A;  1GRA A;  2RGH A;  5KNL A;  1ZMD A;  3LB8 A;  5HY5 A;  2TMD A;  3K7T A;  4PAA A;  2BS4 A;  3AEC A;  3CPJ G;  3GDP A;  4H4P A;  4A6N B;  4EQW A;  3NK1 X;  4YSX A;  2E1M A;  5JCI A;  2JKC A;  3P9U A;  1N4U A;  4JN9 A;  1GRE A;  1YQZ A;  3C4A A;  2CVJ A;  3AE1 A;  2W0H A;  2X8H A;  2X8G A;  2YG3 A;  3DJE A;  3GYI A;  2XLT A;  3D8X A;  4NTD A;  1P2E A;  4AP1 A;  1D4D A;  1CC4 A;  1EL9 A;  3CIR A;  1JOA A;  2XFN A;  3Q6J A;  5CQF A;  1TDO A;  3RNM A;  5HHF A;  1BGJ A;  1NDA A;  2DKI A;  5HXI A;  1PBE A;  1PJ6 A;  4LA1 A;  1FEB A;  1VDC A;  4A5L A;  1S2Y A;  2XVE A;  2BS3 A;  3L1R A;  5FS6 A;  4Y4L A;  2C3D A;  1GRH A;  3T0K A;  2V3A A;  4APN A;  3QFA A;  1PHH A;  5JCL A;  5BUL A;  2Z5X A;  4U8J A;  4Z24 A;  4BJY A;  4UDP A;  1DJQ A;  5EOW A;  3SM8 A;  5TR3 A;  4UDR A;  1TDF A;  1NG4 A;  2R4J A;  3F8P A;  3CNS A;  4H7U A;  1CF3 A;  1EL5 A;  4TM4 A;  3IF9 A;  4B1B A;  4GAV A;  4B69 A;  4OPU A;  4AOS A;  4D03 A;  3SX6 A;  2B9X A;  2TPR A;  4OPT A;  3URH A;  2GR1 A;  3ICS A;  3AD8 B;  2WBA A;  3DK8 A;  1H7X A;  2V61 A;  2IVE A;  3AEB A;  3SXI A;  4OPI A;  1ZP0 A;  3T2Y A;  4CNJ A;  3UKK A;  2WP9 A;  2YLZ A;  2YQU A;  3AYI A;  2F5Z A;  2JBV A;  3PS9 A;  4ECH A;  2ARD A;  4H2R A;  1SEZ A;  2YM2 A;  3CPH G;  2WEU A;  3R9U A;  1HYU A;  3NN6 X;  4J2W A;  3AEF A;  2OLN A;  3ADA B;  1Q1R A;  2C64 A;  4G9K A;  2Z5Y A;  1COY A;  3T37 A;  2FBW A;  2XLP A;  1K4Q A;  4U2L A;  4CBQ A;  3KLJ A;  4WCT A;  1NHP A;  3AD9 B;  3DME A;  2BK4 A;  1GRT A;  2WU5 A;  3NNE A;  2B9Y A;  2C66 A;  2WES A;  1EL7 A;  3CNJ A;  4H4Y A;  5IQ4 A;  1IUV A;  2RAB A;  4GDE A;  2WDR A;  4B65 A;  1YQ4 A;  4JNQ A;  2V6O A;  5BVA A;  4G6G A;  2YR6 A;  1KSS A;  3GRS A;  3OZ2 A;  4E0V A;  4JY3 A;  3GD3 A;  2EQ8 A;  1BZL A;  2C7G A;  3AED A;  1ZOV A;  2C72 A;  2Q0K A;  3FIM B;  3ISH A;  3PVC A;  2GEW A;  2GV8 A;  1P2H A;  2Q7V A;  3NRN A;  4OPD A;  2GR0 A;  4X9N A;  1FOH A;  3QVP A;  1DOC A;  3UKP A;  4JY2 A;  3GYJ A;  4CY6 A;  3AYL A;  4II2 A;  4G74 A;  1LQU A;  2GMH A;  1TDK A;  1L9E A;  1H81 A;  2VQ7 A;  2YAU A;  1PBB A;  3DK9 A;  3GQH A;  3CGD A;  3AB1 A;  4C3Y A;  1F8W A;  2OAL A;  3LJP A;  3LZW A;  2E4G A;  3V76 A;  3L8K A;  4KX6 A;  2VZ2 A;  2X50 A;  3AYJ A;  1KFY A;  4YTP A;  2YLW A;  2QA1 A;  3KU9 A;  4USR A;  5HYM A;  3VRD B;  2YLX A;  1GPE A;  3FBS A;  1BF3 A;  1JEH A;  1GT8 A;  1GTH A;  4ZCD A;  1Q1W A;  5C2T A;  3UOY A;  2XLR A;  4K5S A;  4NWZ A;  3SZF A;  3AE2 A;  1GAL A;  1Y0P A;  1CJ3 A;  3KPF A;  4GUV A;  4H4R A;  4H4S A;  4Y4N A;  2HQM A;  5KMS A;  2B9W A;  1XPQ A;  4FK1 C;  1GOS A;  2ACZ A;  2RGJ A;  1JU2 A;  2C3C A;  1E1K A;  1E7P A;  3T2K A;  5KRQ A;  1F8S A;  3QJ4 A;  4UP3 A;  1VRQ B;  2NVK X;  5M10 A;  3HZL A;  3ICR A;  3GMB A;  4BJZ A;  1NEN A;  4I59 A;  2Q0L A;  3UKF A;  1ZMC A;  2OLO A;  3UTG A;  2R0C A;  1RP0 A;  4YKG A;  5U63 A;  5C3J A;  1PXB A;  2EQ7 A;  2YLS A;  1S2Q A;  1REO A;  4XWZ A;  3UKA A;  4EQR A;  3P1W A;  2C75 A;  2VVL A;  2WOI A;  5KXJ A;  2BS2 A;  1IUW A;  1F8R A;  3HYW A;  4CCR A;  3AEE A;  2GH5 A;  3GWD A;  4A79 A;  4J33 A;  1GER A;  2YG5 A;  4U2T A;  4G73 A;  2XFP A;  3CGB A;  3DGZ A;  1D7L A;  2X3N A;  3LZX A;  3GRT A;  4GR1 A;  2YLR A;  4M52 A;  4EIQ A;  2B76 A;  1RYI A;  2EQ6 A;  1NHR A;  3NYF A;  2ZZB A;  3ICT A;  4IVO B;  3M12 A;  4H4Q A;  1NPX A;  3SGL A;  4H4U A;  2V60 A;  4II3 A;  2GMJ A;  5FS8 A;  2YVJ A;  3AE4 A;  2YG4 A;  3NN0 X;  4A65 A;  4YXD A;  3E1T A;  1M6I A;  4Y4M A;  1H86 A;  4B68 A;  5DBJ A;  3BI4 A;  2WPF A;  2WPE A;  4NTE A;  4KPR A;  3LAD A;  2YLT A;  2UZZ A;  4H2Q A;  4JQ9 A;  3KA7 A;  4U8P A;  1XAN A;  3DGH A;  4H2P A;  2IID A;  1PDH A;  4P9S A;  1VG0 A;  4IA5 A;  2XCG A;  4EMJ A;  3CN8 A;  2BAC A;  5FMH A;  4H4T A;  3ZDN A;  3CNP A;  4B67 A;  1Y56 A;  2QAE A;  2RGO A;  5BRT A;  3NK0 X;  1DOD A;  3CGE A;  4CY8 A;  2VOU A;  2VVL G;  1GV4 A;  1JNZ A;  3ATQ A;  3CNT A;  3DJJ A;  2BK5 A;  3K7Q X;  4H4X A;  3VRA A;  4X9M A;  1LTX R;  1PN0 A;  4JDR A;  2FJE A;  1M64 A;  4C77 A;  1YKJ A;  2ZZ0 A;  3K30 A;  3NGC X;  3LOV A;  2XYO A;  3SQP A;  3HYX A;  1GET A;  3C96 A;  3FPZ A;  1OJA A;  4BK2 A;  4EIP A;  4JNA A;  4TM1 A;  1MOK A;  4ICY A;  2J3N A;  4NTC A;  3GQK A;  1Z6L A;  1UKV G;  3CMM A;  2C76 A;  2Y6R A;  1QLB A;  4I58 A;  1DXL A;  5ER0 A;  3AE9 A;  3SFD A;  3RED A;  2GAG B;  4GDP A;  1DJN A;  1E1L A;  2GR2 A;  4ADW A;  2YWL A;  4U8N A;  1GRF A;  3V3N A;  4BK3 A;  1KDG A;  2H88 A;  1OJD A;  2PHH A;  3B6D A;  3ZYX A;  1D7Y A;  2CUL A;  4H4V A;  3UOZ A;  3P4P A;  1FEC A;  1ZY8 A;  3F8R A;  3UTH A;  1BGN A;  4H4Z A;  4YSH A;  1IUT A;  1H6V A;  1L9D A;  3BHK A;  4OVI A;  3S61 A;  1O94 A;  1JRX A;  4DNA A;  4DSH A;  2C70 A;  1E1M A;  4Z2R A;  1IUX A;  1S3E A;  5IPY A;  4HA6 A;  2I0Z A;  4TM3 A;  4U8O A;  4OPL A;  3ALL A;  2WU2 A;  3RP8 A;  3AE3 A;  4Z26 A;  2VRL A;  1ELI A;  4B64 A;  1JNR A;  4ZN0 A;  4G6H A;  1CJ4 A;  1TDE A;  2C67 A;  1GES A;  3UKL A;  4EMW A;  2B7S A;  4YSZ A;  5L46 A;  3BNM A;  3QFB A;  3UTF A;  1XDI A;  3UOX A;  3P4Q A;  5BUK A;  5KOX A;  1K0L A;  2WP5 A;  1B5Q A;  2BXR A;  1F6M A;  2QCU A;  3D1C A;  2YR5 A;  4REK A;  1X31 B;  1GSN A;  2XVI A;  2JK6 A;  2BK3 A;  2A89 A;  2Q6U A;  4J57 A;  4NEW A;  4XWR A;  4AT0 A;  4NEV A;  4BUR A;  5KWF A;  1BKW A;  2FJB A;  1PBC A;  2BAB A;  1GTE A;  1DOE A;  3BHF A;  4U2S A;  3AE7 A;  3F8D A;  4TM0 A;  1K0J A;  4Z25 A;  5FS7 A;  3QVR A;  1L9C A;  2AQJ A;  1DNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...