3VR8A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Flavoprotein subunit of complex II
total genus 206
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr8A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr8A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr8A04
1GPEA 3KA7A 1VDCA 3AE6A 4U2LA 4Z24A 1TDNA 3SFEA 3FIMB 4U8JA 2C3DA 4FX9A 4XWRA 3RP8A 1DOCA 1DNCA 1LJ1A 1FEAA 1H7WA 2QCUA 1E39A 3H8LA 3VQRA 4AOSA 5JCLA 2R45A 4Y4MA 3AWIA 5KVHA 1RYIA 3GD4A 1LPFA 3S5WA 2R0CA 1VQWA 2YLSA 3NYFA 4AOXA 1NENA 4B66A 1L9EA 4K2XA 3GRSA 2BABA 1CJ2A 1GERA 3RNMA 4YSYA 1M64A 3B6DA 4CY8A 1V59A 3AEFA 1E7PA 1S3BA 2VQBA 3NRNA 4CCRA 2YVGA 2A89A 2HQMA 1DJNA 2ZZ0A 1OJDA 4AT2A 4EQRA 1MO9A 2EQ7A 3F8DA 1NHSA 3GYIA 4YXDA 2R0GA 4FK1A 3AE8A 2OA1A 2RGJA 3QVRA 1LVLA 2ACZA 3DJEA 2B7SA 2Z5YA 4H4ZA 1PBFA 1QO8A 1N4VA 3L8KA 1GRAA 3AB1A 4EQSA 4Z26A 1JEHA 3K7TA 2LFCA 2DKIA 3CNJA 4CY6A 2WEUA 3SGLA 1H83A 2YLZA 2OLOA 3LADA 5IPYA 4M52A 4Z2TA 4OPLA 1JRZA 4O5QA 3IHGA 4N9XA 5IQ1A 2VVLG 1CJCA 2E1MA 3DJGX 1O5WA 1YY5A 3NNEA 1GRBA 4UP3A 4ZN0A 5JCIA 5HY5A 2BCGG 1BF3A 4XXGA 1GETA 1AOGA 4BK3A 2BS4A 2XVHA 2WPFA 3CPJG 5CKUA 3ALMA 3DH9A 1KDGA 4GRTA 4UDRA 4YKFA 3AEAA 3ADAB 4JNQA 4PAAA 1PBDA 2H88A 4YSZA 2BS3A 3BHFA 3FPZA 2V6OA 4K22A 3AE2A 2WOWA 4ZCCA 4CCQA 3ABVA 1YQZA 4OPGA 1L9CA 2RGOA 2ZBWA 3NK2X 4H4PA 2CULA 3AE4A 1YQ4A 4EM3A 5BUKA 3AEGA 3RP7A 3VR9A 2VOUA 4YWOA 3BNUA 3K30A 2IIDA 3BNMA 3OC4A 4IA5A 2GMHA 1ELIA 1ONFA 3GQHA 5HHFA 3M12A 2PYXA 2XLUA 3CNPA 3AE9A 2O9ZA 4U2SA 2WBAA 4GDPA 3O0HA 1FEBA 4J56A 1BGJA 5HYMA 1Z6LA 2YG4A 2IVEA 2XYOA 4P9SA 1F6MA 1NPXA 4EMWA 3KKJA 3AD9B 4H4SA 4O5UA 3NT6A 4IVMB 3CN8A 3NH3X 3AD8B 3KVEA 1F3PA 1D4DA 4U8MA 3G5QA 3BI5A 1N1PA 3DGHA 3V3OA 3UKHA 4YTMA 2R46A 1NHRA 2ZZBA 3AEBA 5U63A 3DK9A 5FS9A 3P4QA 2XLPA 2YG7A 3ZYXA 2VVLA 2E5VA 2YVFA 2X50A 4EMIA 1OJAA 1EL5A 1EL8A 1GRTA 1E1NA 2XFUA 2XFOA 3AECA 3PO7A 1B37A 2WESA 4YSXA 1S3EA 2VRLA 2ARDA 2YR5A 5FS8A 4X4JA 2VZ2A 3SQPA 3UKPA 3CPIG 4JQ9A 1ZX9A 1N4WA 2QA1A 3IC9A 3KD9A 2XFPA 3QSSA 1NHQA 1E1LA 2EQ9A 1IUSA 5JCNA 3QJ4A 3CGCA 3P1WA 1IUUA 1GOSA 1PXBA 3QSMA 2R4EA 4ICYA 3CNSA 2YM1A 2WOVA 3QSEA 2JB1A 4AP1A 3B3RA 2XVFA 2Z5XA 1IUVA 1NG3A 3CTYA 3LXDA 4U8IA 4WX1A 3V3NA 4H4XA 4Z25A 2WOIA 3IHMA 3KPFA 3CGEA 5C3JA 1Y56B 5KOXA 4FDCB 5GRTA 4TLXA 3LZWA 1PXCA 2B7RA 2YQUA 1EBDA 1H7XA 4J57A 1KSUA 3GSIA 1Q1WA 4J2WA 5JCKA 1PBCA 4IA6A 1DOBA 1O94A 3I6DA 5KWFA 3LOVA 4YT0A 1KFYA 3KLJA 3QFAA 4EQWA 2BA9A 3UP5A 3IWAA 1PS9A 4GUVA 2AQJA 3P9UA 1K0IA 2B76A 4FK1C 5U25A 1L9DA 1P2EA 2GRTA 4B1BA 4USRA 3UKQA 3UTGA 3ICRA 2WQYA 3FMWA 1K4QA 2GAGB 5C2TA 4IVOB 2XVJA 5DBJA 3F8PA 3Q9TA 2Q6UA 3GDPA 3URHA 4NEWA 4RG3A 4B64A 1KSSA 5JCMA 1NHPA 3LZXA 3GQKA 2BC1A 1E1KA 4GCMA 4AT0A 1QJDA 4B69A 1DODA 2OAMA 3II4A 1XHCA 3AYJA 2GF3A 4KPRA 2XCGA 2V3BA 2V61A 1K0LA 3NKSA 2YLTA 2JK6A 2GEWA 3GMBA 1GALA 3R9UA 3LB8A 1GRFA 1X31B 1ZK7A 1ZDLA 4H50A 5EB5A 1OJTA 1GV4A 5EB4A 4TLZA 4AP3A 2R9ZA 1D4EA 1PBEA 3AD7B 3GYJA 4HB9A 4OPTA 4A7AA 2NPXA 1CBOA 5FS6A 2GB0A 3UOZA 2RGHA 1DJQA 4CNJA 1BKWA 4Z44A 1ZY8A 3NK1X 4B67A 3VRAA 2YG6A 1M6IA 5BULA 1QLBA 3UKAA 3BI2A 1ZOYA 5FS7A 2C67A 2XVIA 2X8HA 4EM4A 2C76A 1VG0A 4OVIA 2YAUA 1PJ5A 4B68A 4Z43A 4HA6A 1Y56A 2AR8A 2YR4A 3KU9A 4H7UA 4A6NA 4Z2UA 2Q7VA 1D7LA 1D4CA 1XDIA 4OCGA 1CC6A 3EPTA 4E0VA 1CL0A 1E6EA 1DOEA 5IQ4A 1ZOVA 4YTPA 4A6NB 4C5OA 2WHDA 2E4GA 3COXA 4DNAA 2JB3A 4DSGA 1OJ9A 4GF7A 3NIXA 3UTHA 1YKJA 3UKKA 2CFYA 4C74A 3NN6X 1RSGA 1IUXA 2GR1A 4U8NA 1KNPA 4JN9A 4K8DA 1GNDA 1F8WA 2A87A 4U8PA 1P2HA 2GH5A 4X9MA 3F8RA 3DJJA 4I58A 3SM8A 5M10A 1VRQB 4A5LA 3ATQA 3CGBA 4IV9A 3AXBA 4CBQA 1SEZA 4J36A 1W4XA 3RP6A 2BS2A 3UCLA 4TM4A 2BC0A 2FJAA 4U8KA 1TDFA 1JU2A 2VQ7A 1UKVG 3ISHA 1NDAA 1CJ4A 2B9XA 1JRYA 1GSNA 2EQ6A 2WP6A 2YM2A 4JY2A 4EMJA 1LTXR 2WS3A 1ZKQA 3UKFA 3H4KA 1RP0A 2V60A 3DK8A 4C3YA 1IJHA 2AAQA 2WP5A 5KXJA 1ZMCA 3C4AA 1CJ3A 1F8SA 3GRTA 2C72A 3GYXA 2UZZA 2H89A 3NG7X 2GQFA 5KVIA 2BXRA 3I3LA 2IVDA 1OJCA 2RABA 1PJ6A 3LJPA 3M13A 3GWDA 3P4PA 1BZLA 3FG2P 4JY3A 4LU6A 2FJBA 4YTNA 2I0ZA 3NLCA 4MJWA 2Y6QA 3P4RA 4B63A 1Y0PA 3OZ2A 3REDA 2R4JA 3UP4A 4TM0A 3H8IA 3C4NA 1BWCA 1H82A 1GTHA 2XVEA 3V76A 2WDRA 4NZHA 3ZDNA 5LV9A 3NHOX 4TM3A 2C64A 1GREA 3G5RA 4A65A 3WE0A 2XLRA 3NYEA 3AEDA 2XLSA 4RG4A 5EBKA 4OPDA 4H4YA 4H2RA 4H4UA 3E1TA 1TRBA 1NEKA 4BV6A 2V3AA 5L46A 1EL9A 1Q9IA 4D03A 3UTEA 1EL7A 4H4QA 4JDRA 1JNRA 4NTDA 1TYPA 3AE7A 1ZMDA 4C3XA 2YG3A 1TDEA 1VG9A 3S61A 3CGDA 3DGZA 4NTEA 2YWLA 4WCTA 2XDOA 3QVPA 1H81A 4H4TA 5J7XA 2YR6A 1FCDA 1K0JA 3PVCA 1GESA 3DMEA 3NTDA 2J3NA 4CRTA 2YG5A 3ALJA 3ITJA 1JRXA 4YKGA 1D5TA 3AEEA 1PHHA 4U8OA 2BXSA 2V5ZA 2YLRA 4J31A 4Y4LA 4ZCDA 2WP9A 2VVMA 3GMCA 2Y6RA 2GR0A 1TDKA 4K5SA 2YVJA 4J34A 2BYBA 3VRDB 1FL2A 5KOWA 4TM1A 4UDQA 1JOAA 4GDEA 2C75A 3HZLA 3M0OA 4RSLA 4CNKA 5CQFA 3JSKA 1PXAA 3D1CA 4H4RA 3CIRA 4Y4NA 3BHKA 1IUWA 3UTFA 2JB2A 2X8GA 1GT8A 1REOA 3IF9A 4PABA 4USQA 1GTEA 3ICSA 2ZZCA 1GRHA 2WETA 5KRQA 4U2TA 2OLNA 3NK0X 2PHHA 5GSNA 1XANA 2QA2A 2BACA 1FOHA 4EQXA 3EF6A 4KX6A 3Q6JA 2F5ZA 3BI4A 4ECHA 4A9WA 2EQ8A 1B5QA 1CF3A 4JNAA 2XFQA 2GVCA 1H84A 2JKCA 3NYCA 2WDVA 1LQTA 3SUCA 2TPRA 2Q0LA 2WPCA 2C7GA 2FBWA 1FECA 4I59A 4H4VA 3EANA 3RHAA 2BK5A 2X3NA 4OPCA 1D7YA 5HXIA 1CC4A 2WPEA 2WDQA 1MOKA 4J33A 4APNA 1MXTA 3QFBA 3PS9A 1PJ7A 3GDNA 1S2YA 3NTAA 5M0ZA 3ICTA 2BCPA 2GAHB 3AE3A 3UKLA 1YQ3A 2X8CA 2WU5A 1COYA 2C3CA 3NGCX 2Q0KA 3CPHG 5EOWA 4ADWA 4Z2RA 2BK4A 1JNZA 3FBSA 3GD3A 4D04A 3AE1A 4XWZA 1NAAA 1PBBA 3D8XA 2JBVA 2JAEA 3VR8A 2GMJA 3AYLA 3EAOA 2OALA 2X99A 1F8RA 4OPUA 2GR2A 2GV8A 2VRMA 3CNDA 4BK1A 2WU2A 1CHUA 1KNRA 5ER0A 1Q1RA 4YSHA 1PDHA 1BGNA 3UOVA 4BJZA 3CNTA 1GEUA 2TMDA 3DJDA 4H2NA 1E1MA 1LV0A 4K7ZA 4A99A 1N4UA 2DKHA 1CC2A 5FMHA 3AE5A 3VRBA 1XPQA 2B9YA 3NN0X 4OPIA 1B4VA 1H86A 3P4SA 3K7QX 2C73A 2BK3A 4H4WA 5J60A 1HYUA 4GR1A 2GR3A 4DGKA 4BK2A 4C77A 2XLTA 1ZP0A 3ALLA 2W0HA 2NVKX 2C70A 5BVAA 2CDUA 4H2PA 1O95A 3SFDA 2R0PA 1LQUA 3UOXA 4X9NA 3L1RA 1IUTA 1TYTA 3K7MX 4LIIA 4B65A 2XFNA 4LA1A 4H2QA 3G5SA 4EIPA 2A8XA 2C66A 2QAEA 1TDOA 2C65A 1PN0A 3C96A 4DSHA 5BRTA 2GQWA 2CVJA 3T37A 4BURA 2YLXA 3ATRA 4A79A 2FJEA 4EIQA 4BJYA 1B8SA 1S2QA 4NTCA 1GXFA 1H6VA 3UOYA 2APGA 5TR3A 3GWFA 2B9WA 1KF6A 4K5RA 5U1OA 3AYIA 4NEVA 3DA1A 4U8LA 2FJDA 4UDPA 4REKA 2YLWA 3DK4A 1DXLA 1GRGA 1L0VA 1NG4A
chains in the Genus database with same CATH superfamily
3ZYMA 3ESLA 1U5PA 4O2AE 1VDCA 3AE6A 4U2LA 3OPCA 4ERRA 1R084 3FHNA 4U8JA 2C3DA 2P9BA 1DOCA 2QCUA 3H8LA 2V6XA 1FEAA 4AOSA 5KVHA 2R45A 4Y4MA 3JAFA 1LPFA 3S5WA 4O4LE 3PTRB 4AOXA 1NENA 4AQYT 4K2XA 2BABA 1CJ2A 3IEEA 3RH3A 5JH7E 1V59A 1E7PA 2VQBA 2YVGA 3AXJB 2R064 2EHOA 3ZMZB 1MO9A 2EQ7A 4EB6E 3ETVA 3AE8A 3SWHA 3A7MA 3DJEA 2B7SA 2CEAA 4H4ZA 1RUF4 5KDMC 3DTOA 3ZN1B 5HEUA 3AB1A 2BG9E 2LFCA 4CY6A 4AKHA 2OLOA 2BZBA 5AQIB 3TKLB 4N9XA 1WLXA 1M7KA 2E1MA 3KFWX 1O5WA 4LMLA 1AOGA 2BKOA 1NCQD 4DV2T 2WPFA 3CPJG 3N9PA 4UDRA 2H88A 2LKHA 4UF0A 4K22A 5M4YA 4ZCCA 2V6YA 3ABVA 4AKRB 4OPGA 1L9CA 3NK2X 4LFCT 5CFBA 4CN1A 4B3RT 3AEGA 4TZ4C 2PYLA 3BNUA 1Z7S4 3HYXA 3OC4A 4HE8A 1ELIA 1WYCA 3CNPA 3AE9A 4U2YA 2O9ZA 4DV0T 4YLHA 2YG4A 3SZFA 2UUBT 4H4SA 4IVMB 2DLRA 3AD8B 3KBUA 3O4XE 4YFSA 3RLFF 4K0KT 3DGHA 1N1PA 4ILCA 2XQ4A 2JIWA 2JQQA 3TLVA 2R46A 4UVAB 4JI6T 3P4QA 3IA3A 3ZYXA 4U72A 4EMIA 4AQFA 5FS8A 2NTXA 4ZS2A 5J2UE 4X4JA 4JQ9A 4DR1T 3KD9A 2YDQA 4GK0E 2EQ9A 3SOLA 2H3RA 2ZM8A 1N36T 2HHHT 3V5UA 1GOSA 2X9YA 5F8PA 4AP1A 3OBVE 1GQEA 1XDPA 3LXDA 4QH5A 1IBLT 4JI8T 3QUJA 1VBE4 3SRZA 2X9WA 3KPFA 1Y56B 2BVMA 3LZWA 1VBB4 1H7XA 2X68A 1Q1WA 3N2OA 4AXPA 4IDOA 4J2WA 3AA0B 5JRCA 1HF8A 5JCKA 5IWAT 1D1CA 1KFYA 3KLJA 3QFAA 3IWAA 5LHIB 2YU1A 3P9UA 2B76A 5HWYA 3N9LA 5U25A 1P2EA 4B1BA 2CA5A 2L3LA 2V6YB 3ICRA 1UX5A 2MAWA 2WZIA 3MZKB 3F8PA 3Q9TA 1OOPD 3GDPA 5AQOB 4ZXLA 2YN6A 5CGMA 3LJCA 5AQNB 3LZXA 4H63V 2BC1A 3KBTA 1QJDA 2XSBA 1BEV4 4B69A 3II4A 4HWDA 1XHCA 3MA9A 4KPRA 2W63A 2Y48B 1X9BA 1N33T 1K0LA 1HRV4 2JK6A 1HXS4 2ZMAA 3LB8A 1GRFA 2E9XB 4ZEYA 1OJTA 3N9QA 1AJ3A 5HEJA 2BRYA 3KV5A 4TWHA 2RA1A 4IHJE 1ZY8A 3UT5E 3PV0F 4LFAT 3JCFA 4Z43A 4HA6A 5EK3A 1Y56A 2YR4A 1S35A 4FI5A 4YJ3E 2JQHA 4ILBA 1XDIA 3JC6D 3NKZA 2LOPA 5FY0A 1HS7A 4PDWD 4EEDA 4ZS3A 1LRZA 2NTYA 4A6NB 3T31A 3HL6A 2PZSA 2VKOA 4PFOA 3PUQA 5L3EB 3NIXA 3UTHA 4MBQA 5L4HA 3UKKA 5AQMB 3NN6X 1IUXA 2GR1A 3ZT6A 5JDNA 5L4EA 5ABEA 2A87A 2E9XD 4L0RA 2GH5A 3UQ7A 3AVRA 4I58A 5J0ZA 3CKDA 5EK2A 5M10A 5AQFB 2N1GA 3CGBA 3E22E 3AXBA 4XZCA 4CBQA 4J36A 3RP6A 2E2AA 4JI1T 4TM4A 2BC0A 4U8KA 1TDFA 2Y6XA 4BJNA 2DNXA 5FXZA 2YK0A 4JV5T 1JRYA 4JI2T 2ACXA 2IHR1 4DV1T 2WS3A 1FEWA 3N9OA 4ZZBA 4UR9A 3H4KA 4C3YA 4IE0A 2V7IA 1AR74 2YKSA 1ZMCA 1CJ3A 3QOFA 3GYXA 2H89A 3RYFE 3I3LA 3AAEB 2RABA 4LU6A 1AR84 3P4PA 1BZLA 1W09A 3AA6B 4MJWA 3P4RA 4B63A 3KVAA 2VVNA 5CB4E 5FNVE 2R4JA 5LG3A 3DJBA 1RUG4 1BWCA 5LV9A 4TM3A 2C64A 3G5RA 3WE0A 2IAKA 5HCJA 3AA1B 3LK3B 4H4UA 4BV6A 4TNWA 2OLTA 1EL7A 4H4QA 4UXNB 4NTDA 4QXBB 1TYPA 2X0LB 3AE7A 4C3XA 4QHOA 1TDEA 1VG9A 1ZKEA 3CGDA 4WCTA 3N9MA 4AISA 4BAYB 2UXCT 2MBGA 2AE9A 3HI2A 3NTDA 2C5JA 1HX8A 5AQRB 1QUUA 1JRXA 3L8RA 2HPJA 3AEEA 1PHHA 4Y4LA 4X62T 2WP9A 1Z8UA 4LF9T 4EXTA 5DABA 2BYBA 3AB3B 5KOWA 4PJMA 1WR6A 1UUSA 4H4RA 3AXJA 3CIRA 4Y4NA 2JB2A 2X8GA 1GT8A 1LVFA 1GTEA 4IDQA 2WETA 4OX9T 2PHHA 3N2GE 5L47A 4ECHA 5ABFA 5HXEA 2NWBA 1VCSA 4JNAA 3ZYKA 2WPCA 2FBWA 2Q9QA 4X65T 4H4VA 3RHAA 2BK5A 2X3NA 5HXIA 1CC4A 2BG9C 2DCFA 3I9YA 2WWVA 2XAQB 5H6RB 4APNA 4DIDB 3GDNA 1S2YA 4IE4A 5M0ZA 3ICTA 3I9WA 2X8CA 2CCQA 3ONJA 3OKQA 4MALA 2LM2A 4Z2RA 2KXPB 3FBSA 4NUUA 2CM0A 5HEOA 3VR8A 1H7CA 5LCYA 4NNJA 1SE7A 4IE5A 3HKDE 2YINA 2VRMA 3CNDA 3CX7B 2XQ8A 2XQ3A 5ER0A 2V5CA 1PDHA 5A1LA 3NRXA 1GEUA 1VBD4 4H2NA 3PDYA 1N4UA 4M1PA 3VRBA 4Q25A 1US7B 1PVC4 3D0TA 4H63H 2BK3A 2XM1A 1XNQT 1HYUA 2GR3A 4X1IE 4BK2A 4C77A 2XLTA 1ZP0A 5BVAA 2NVKX 5FY7A 4H2PA 5HCMA 2R0PA 1LQUA 1IUTA 1TYTA 4B65A 4EIPA 3SS1A 2KLQA 2CE7A 2QAEA 2C65A 1PN0A 3RKGA 4HWIB 3TLSA 2J1DG 2CBJA 3CQCB 2BBJA 4EIQA 4Q4W4 4BJYA 3IHRA 3RRWA 4WW0A 1KF6A 4K5RA 1HNZT 3DA1A 4JUYA 4DR7T 1DXLA 1L0VA 1NG4A 4GYRA 5LP6E 3SFEA 4Q4V4 4FX9A 1LJ1A 3VQRA 1E39A 5HYAA 5JCLA 2R0CA 4G6GA 3EABA 2YLSA 1PIV4 3GRSA 4KHZF 4YSYA 3B6DA 4CY8A 5HEHA 3SYIA 3RIUC 4NXMT 4CCRA 2MOZA 2A89A 3FB2A 4U33A 4AT2A 4EQRA 1NHSA 3GYIA 4I50E 2OA1A 3WAJA 5FKYA 3QVRA 2ACZA 2XQ6A 4ILAA 2Z5YA 3CMMA 1WRDA 1QO8A 2CHNA 4PJNA 4TV8E 3L8KA 3K7TA 3K3OA 4DR2T 4IDZA 5KX5E 3LADA 4U3CA 4Z2TA 4OPLA 2WBLA 1SUMB 4IT4A 3DJGX 1Y64B 3O9XA 3RHWA 2JQKA 5FP3A 1OEDE 5CA1E 5CKUA 3UU3A 4JNQA 4YSZA 2BS3A 2V6OA 2WOWA 2YU2A 4PNIA 1YQZA 2UUCT 4ANJA 2IW5B 5IUXA 2CULA 4H9NC 1YQ4A 3F2EA 5BUKA 1HTJF 3RP7A 2WSSV 2VOUA 3TLTA 3J9X1 3K30A 2WMNA 4GB34 2GMHA 1ONFA 4KP3C 2XLUA 2XZEA 3ZSTA 4N78D 2VK9A 3CQGB 3WAKA 3BQKA 2WBAA 2BRAA 3O0HA 4J56A 5HYMA 2PTFA 1BGJA 1POV0 1UCUA 1F6MA 2LLYA 4EMWA 4BA9A 4O5UA 3NT6A 3NH3X 5DQWA 3KVEA 1D0XA 1D4DA 4DR4T 3UU5A 4U8MA 3G5QA 3UKHA 2MYSA 1XZYA 4DR6T 2A2FX 1NHRA 5U63A 2VVLA 2E5VA 2YVFA 3FZKB 2X50A 2X67A 1EL5A 1GRTA 1B37A 2VRLA 2ARDA 3UKPA 3PUYF 2RS54 2LEHA 3QSSA 5HXCA 5JREA 2VWAA 3CGCA 4ILUA 3P1WA 3QSMA 1OEDB 2R4EA 4ICYA 3EDVA 5LBMA 2YM1A 3BQLA 3QSEA 5KNLA 3B3RA 1UK5A 2Z5XA 3CTYA 5AQKB 2X51A 2XQ7A 5LGUB 3E0ZA 4WX1A 1HFAA 3Q5DA 2WOIA 4DR3T 3C4XA 5L2LA 4TLXA 2B7RA 2XQYA 2EX3A 4ISSA 3K1SA 3GSIA 3L3PA 2L9QA 2I0MA 3I6DA 3W15B 5KWFA 3LOVA 4YT0A 2OV9A 3UP5A 3NZQA 1PS9A 2AQJA 4FK1C 1K0IA 2LT3A 5HXSA 2GRTA 3UKQA 2IC6A 3FMWA 2CLYC 3EVYA 1K4QA 4G73A 2MTQA 4GOUA 4F8HA 3P50A 2VL8A 2BKNA 5DBJA 1UX4A 3SX6A 4B64A 4JI5T 3UTKA 4WBOA 4AT0A 1XHXA 3ZMTB 2UUAT 4CN4A 2EHOD 2V3BA 2V61A 3MKDA 3GMBA 3CX6B 3H37A 2XPKA 4DBRA 5EB5A 4H50A 1D4EA 1PBEA 3AD7B 4HB9A 4OPTA 1FMVA 2OA5A 2NPXA 4A7AA 1YD8G 1DJQA 1HNWT 2ZM2A 3L39A 1BKWA 4Z44A 5BULA 5JR9A 2YG6A 1M6IA 1M62A 2XVIA 3C4ZA 4B68A 4LF5T 3CWZB 1VBA4 3ZT5A 2Q7VA 1D4CA 2RS34 3EPTA 4PK4A 1CL0A 4KMCA 4J2CA 1ZOVA 4YTPA 3NBXX 2WHDA 3COXA 3PE0A 4DNAA 1W9RA 1OJ9A 2M6IA 1RUH4 5LMUT 4NPPA 3V5SA 1S94A 3LG7A 5ADXL 1KEYA 2CFYA 4ZZCA 1I94T 2HPLA 2UXNB 4PW8A 4GKJT 5HAXA 5LJNA 2SPCA 4HFDA 3UUMA 4H9RC 3ATQA 2BKPA 1O3XA 4EAHA 2BS2A 3UCLA 1QSDA 2H7OA 4EV6A 3ZMUB 4X1KE 3ISHA 3T14A 1CJ4A 4EIWA 4LF8T 4PFPA 4DO0A 4II3A 2YM2A 1MNEA 4NWZA 3TLUA 2LKGA 3RIAA 2V1DB 2WP5A 5LMNT 3GWDA 3NLCA 1T98A 3U3IA 2CXLA 4H9SE 3ZLIA 4NUVA 1J5WA 2XVEA 3V76A 2WDRA 4EEBA 3NHOX 4P0AA 4A65A 1XWMA 3C4WA 3AEDA 2XLSA 2AXDS 4RG4A 3QB5K 2J4GA 3PJAJ 2D0TA 2I6HA 3AA7B 2V3AA 5L46A 1EL9A 4X66T 3UTEA 4JDRA 3GN5B 2YG3A 5JDHA 5EK4A 3S61A 3ANWA 1N34T 1AR94 2YWLA 3ONLC 3ZC0A 2XDOA 1H81A 1SHZC 4H4TA 5J7XA 4I43B 3FZMB 4QXCB 3DMEA 4UVCB 4CRTA 3ALJA 4YKGA 2ODUA 1RVF4 3UU6A 2V5ZA 4HEAA 4TUYE 3GMCA 2Y6RA 2GR0A 3ZPOA 5HWXA 2CLYB 3K3NA 3VRDB 1T72A 3CQXC 5FL1A 2UXBT 3SZ0A 4UDQA 4GDEA 3M0OA 4CQIA 3UULA 3O1HA 4DMVA 2NW9A 3UUXB 3UTFA 4QX7B 2XAHB 3BK9A 1Y01A 2ZZCA 1GRHA 5KRQA 4U2TA 3NK0X 1T8BA 2QA2A 4A97A 5ETWA 3Q6JA 5LXTE 1V9DA 3KPKA 3RRCA 1YKEB 1B5QA 3UQ4A 2JKCA 1WR0A 2LSYA 2X9HA 3I0QA 4O4IE 5CJ5A 1AL24 1FECA 4I59A 3EANA 5FXVA 4UF0B 2WPEA 2WDQA 3B57A 3T2ZA 2Q9QD 1ASJ4 1PJ7A 2BCPA 4BJMA 3Q5EA 2D0UA 2WU5A 3LK42 2YEVC 4X20E 5EOWA 3CPHG 1JNZA 2PY5A 2LSIA 1D1BA 2JAEA 2CHOA 2CXDA 1E1HB 3RI5A 2GV8A 2WU2A 2ZM6T 2KNDA 4YSHA 1RUD4 3VHLA 3CNTA 3DJDA 5AQQB 1E1MA 4K7ZA 1OWAA 5L3FB 3AE5A 1XPQA 5AQGB 3KDSE 3NN0X 5J60A 3QC9A 3ALLA 2W0HA 2C70A 3OVUA 4X9NA 5JDQA 4LA1A 4HWFA 2LHRA 4H2QA 4DR5T 2C66A 3ZKRA 1D4M4 2CVJA 2CXFA 2RM24 2Q9QC 2J47A 3ATRA 2G0UA 3T2YA 1GXFA 1H6VA 3PJAA 4E7ZA 2HH7A 5TR3A 5IHYA 2B9WA 3EI0A 1E2AA 1KK7A 5L3BB 4U2ZA 2VQET 3DK4A 3AE4A 1TDNA 4DNDA 2CPTA 1DNCA 4MHCA 1H7WA 1XMQT 2YDSA 2DHRA 3AWIA 3GD4A 3QNUA 3NYFA 1L9EA 1GERA 2A72A 4HFBA 3AEFA 2XJ7A 3NRNA 5ABGA 3T1YT 4KHPT 2HQMA 2ZZ0A 1OJDA 2PJQA 3F8DA 4YXDA 3NWIA 4JEHB 1HG2A 2RGJA 2M67A 3HKBE 3T2KA 1LVLA 2VQFT 1EV14 4IIJE 3SZCA 5F3JA 1D0YA 4Z26A 1NWMX 3MXZA 1FIOA 1B7TA 1JEHA 3N5LA 2DKIA 3CNJA 2WEUA 3SGLA 1H83A 2YLZA 5IPYA 3TLWA 1JRZA 3UFGA 4O5QA 5JDGA 1G73A 2W00A 5IQ1A 2UU9T 4LMJA 3NNEA 4ZN0A 1BF3A 1RUI4 2BS4A 3ALMA 3UU4A 3AEAA 1PBDA 3FPZA 2KINB 3BQIA 3AE2A 3PU8A 1WCRA 3ZN0B 5AQHB 2ZBWA 5JVDE 3A5XA 3KV4A 4UVBB 2LHNA 2IIDA 4II2A 4IA5A 3KINB 5HHFA 4H9PC 3M12A 4B3TT 4U2SA 2ES0A 4HWHA 2IIUA 2XAGB 1Z6LA 2IVEA 3KVBA 5FYMA 1NPXA 1MIWA 3AD9B 1RUJ4 2M6BA 2HN1A 2KMFA 3M3ZB 4YTMA 2LSKA 2ZZBA 1FJGT 3DK9A 5FS9A 4P09A 2W4XA 3JC6C 2XFUA 2XFOA 4HFVA 4YSXA 1S3EA 2YR5A 2WZHA 3GQKA 3CPIG 3PUVF 4C91A 5H6QB 2W67A 4TNVA 1E1LA 1IUSA 2WB5A 3RF1A 5JCNA 3PUAA 2EHOC 4LMKA 2Y8DA 3CNSA 2XUEA 5LB7B 3Q2MA 2RS14 3SXIA 2XVFA 5JDLA 1NG3A 1OEDC 2UXXB 1ZHCA 4HFCA 4H4XA 3IHMA 2F4VT 3CGEA 5C3JA 4P0BA 3LFMA 3F31A 3ZYLA 4EGWA 5HXHA 4J57A 4UV9B 3ZEFB 3P4WA 1PBCA 4IA6A 1DOBA 4EQWA 2IMLA 3ZMSB 4GUVA 3LBXB 3J7Yq 1XDOA 2NW8A 4U7IA 3ONXA 3FZLB 3T0KA 2WQYA 2GAGB 2QRXA 2XY8B 4QXHB 2W0GA 4DVDA 5C2TA 2VKHA 2PLV4 5JTGA 2Q6UA 4HN9A 5LNKA 4YJ2E 4GCMA 2LJLA 2GF3A 4ZI2D 1RUC4 3RGLA 1GALA 1X31B 1IBKT 1ZDLA 5EB4A 4AP3A 4K0UA 3N2KE 4TLZA 2R9ZA 1CBOA 1Z0PA 3UOZA 2RGHA 2BDEA 4CNJA 1IAPA 1UURA 4B67A 3NK1X 3VRAA 1QLBA 5J1GA 3BI2A 1ZOYA 3UKAA 2C67A 4EM4A 4AI6A 2C76A 4OVIA 2W61A 1PJ5A 3AVSA 5JDFA 2VL0A 3Q5XA 1IBMT 4Z2UA 4A6NA 1ZEEA 4HKAA 3I1AA 2XHEB 4OCGA 1CC6A 4E0VA 3LDQB 2C4CA 4C5OA 5BR8T 1G8XA 2HN2A 4DSGA 4O4HE 4JI0T 1YKJA 3T1HT 1RSGA 1KNPA 4QH1A 4PK6A 3OYXA 3A8YC 4OFZA 4U8PA 1F8WA 5KMPA 4Z90A 1NAFA 4X9MA 4ZI7E 2VKDA 3F8RA 1VRQB 4ADZA 2E9XA 4IV9A 1SEZA 1W4XA 1DU2A 2FJAA 4WNKA 1LVKA 2V7LA 1UKVG 2B9XA 2EQ6A 2BG9A 2LSJA 4EMJA 5KMGP 1ZKQA 5EZYE 3VKHA 3Q9DA 2BG9B 1RP0A 2CRBA 1IJHA 3S4UA 3C4AA 2BBHA 5AQUB 5KVIA 2GQFA 4ZOLE 3FG2P 3ZC1A 1AR64 2FJBA 4YTNA 2I0ZA 1BR2A 2Y6QA 1Y0PA 2KWHA 4Q4X4 2KT9A 2R044 1H82A 1GTHA 1J1JA 4NZHA 2JRKA 2YOEA 5JRCB 1MNDA 2LRLA 1COV4 2XLRA 1VBC4 3MJXA 3LK2B 4NXNT 4TWDA 5KMRA 3E1TA 4GAPA 3CX8B 3OYZA 1MMGA 1Q9IA 5LJMA 1JNRA 3B13A 1K5MD 4AKGA 4HGAA 2V7MA 4F6RC 1VRH4 1UGOA 4G63A 5LYJE 2YR6A 1FCDA 1MMNA 2IC9A 4ISTA 1K0JA 3PVCA 2D9DA 2J3NA 2YG5A 3ITJA 2XAFB 2BXSA 2YLRA 4J31A 4ZCDA 4IDPA 2WCAA 3WI3A 2C5KT 3PUSA 3PUGA 2YVJA 4J34A 1R8IA 1YKHB 1FL2A 2A3DA 3HZLA 4CNKA 1RUE4 5LGNB 1PXAA 2WY2A 4JLEA 4EOZB 3BHKA 3IF9A 4HTEA 4B3ST 4XAXB 4USQA 2WWUA 3J8F4 4LFBT 2OLNA 5AQLB 5GSNA 3CVRA 3H3MA 3UU8A 3JD74 4KX6A 5FMNA 3BI4A 4A9WA 2CWYA 2XQ9A 3RC8A 2MPKA 1CF3A 2GVCA 3NYCA 3SUCA 2WDVA 2TPRA 2Q0LA 5LGTB 4V1Av 1D1AA 2XASB 4OPCA 1D7YA 4O4JE 1MOKA 4J33A 1LKXA 4RHV4 3QK6A 1MXTA 1RMU4 4ASKA 3IBPA 2N2NA 2QYWA 2C0SA 3O1JA 2C3CA 3NGCX 4ADWA 3GD3A 4JBWF 5F5WA 3ZJ2A 3FBZA 3AE1A 1D0ZA 1NAAA 3ZMVB 1PBBA 3QB5A 2GMJA 2E5LT 3AYLA 3KV6A 3RC3A 2OALA 4L5GA 4OPUA 2GR2A 3CK6A 4BK1A 1CHUA 1KNRA 2X0YA 4HWCA 1Q1RA 2YDRA 4QX8B 1BGNA 2KWIB 1LV0A 3ZCIA 1FMWA 3F57A 1CC2A 1PO24 5FMHA 1MIVA 4DV6T 1H86A 2ZLYA 3CPZA 3PUXF 4IL4A 2C73A 4GK5E 2W66A 2X5ID 4U74A 4A98A 1IZNB 3G06A 1X79A 1O95A 3L1RA 4LIIA 2XM2A 3G5SA 2JQ9A 4TX5A 2A8XA 1NA1D 1TDOA 3HYWA 4L9IA 4DSHA 5BRTA 3T37A 4UELA 2FJEA 3C98B 1B8SA 4NTCA 3UOYA 4TV9E 3GWFA 2QGSA 2PG8A 2WM9A 5U1OA 3AYIA 4NEVA 3P8CD 5BMVE 2FJDA 5AQVB 2YLWA 3V3NA 4X5TA 4MLKA 4GDPA 3ETUA 3SY4A 1YQ3A 1GPEA 3UUNA 3KA7A 4Z24A 2LOSA 3FIMB 2RPAA 3VU7H 4XWRA 3RP8A 2JMKA 1RYIA 3MK7C 4COFA 1VQWA 4H9OC 4B66A 5TAOA 4GKKT 3RNMA 1M64A 1S3BA 4WZXA 3E08A 1DJNA 3MACA 2QVAA 4EZ4A 2R0GA 4FK1A 3NZPA 4QH4A 4UIGA 4IGUA 1PBFA 3FXEB 1HNXT 4B3MT 1N4VA 4FJOA 1GRAA 4EQSA 1CUNA 4E7SA 1VOMA 4IE6A 4CI1B 4M52A 3IHGA 1XI1A 2VVLG 1CJCA 3HKCE 3JADA 1R094 4G74A 1YY5A 3AAIA 1GRBA 4UP3A 5JCIA 3ANWB 3M65A 3FZHB 2ZM0A 2BCGG 4XXGA 5HY5A 1GETA 4BK3A 2XVHA 4EZHA 3DH9A 4Z8XA 1KDGA 4GRTA 5IYZE 4YKFA 3ADAB 4PAAA 3DP7A 3BHFA 4HFEA 3RIFA 4CCQA 2RGOA 2ODVA 5HEGA 4H4PA 2Z6EA 1MMAA 4A56A 3PUZF 4CI3B 4EM3A 4Z91A 3VR9A 4YWOA 4IDNA 3HA4A 3BNMA 4U31A 3GQHA 3HR0A 2PYXA 2V5DA 4KI0F 3GWHA 3OTOT 1FEBA 4CXXA 2K3WA 2HWC4 2XYOA 4P9SA 3KKJA 4CXYA 4ZI3C 3CN8A 1F3PA 3C51A 2JPFA 3R84B 3FZFB 1OEDA 2XQ5A 4TN7B 4XBFB 4PJJA 3ZJ1A 3BI5A 3V3OA 3AEBA 5ABHA 2XLPA 2YG7A 1RHI4 1ZV4X 5E0OA 1OJAA 1EL8A 1H8TD 2DWKA 3RKOA 1E1NA 3PO7A 3AECA 1HR0T 2WESA 4A5LA 1PO14 3SQPA 4HFHA 2VZ2A 1ZX9A 1N4WA 2QA1A 3IC9A 4JI4T 2XFPA 4EYUA 1NHQA 3FI7A 3RPUA 3QJ4A 4X64T 1IUUA 2CMRA 4EYYR 1PXBA 4DV7T 5JDMA 3RQUA 2WOVA 2VB6A 2JB1A 3NVOA 2W62A 1IUVA 4KBMB 2FUPA 4U8IA 3PU3A 2RMU4 2EHOB 2D5UA 5AQPB 4Z25A 4B6XA 5KOXA 4FDCB 1YW0A 3PURA 5GRTA 1PXCA 2YQUA 1EBDA 5AQSB 1KSUA 2Q9QB 4H9QC 1O94A 4Q4Y4 2BA9A 2R074 5ABFB 4DV3T 1L9DA 4MFRA 4USRA 3UTGA 2NW7A 4DUZT 4DV5T 4IVOB 2XVJA 2PYJA 2LM9A 1MMDA 3URHA 5JR9C 4NEWA 4RG3A 1HCIA 1KSSA 5JCMA 1NHPA 2K24A 1E1KA 1KNZA 5KMQA 1DODA 4AQFC 2OAMA 2KZ7B 2XQAA 3AYJA 2QA7A 2XCGA 3NKSA 2YLTA 2GEWA 5DJQC 3R9UA 3JBG4 1ZK7A 1GV4A 1VRBA 2KSRA 3ZCJA 3GYJA 4YY3T 4AQGA 5FS6A 3X1DA 2GB0A 5FVKA 2RP4A 5HXRA 2DL1A 4CN6A 2I59A 2J62A 2NR4A 5C8YE 5FS7A 2X8HA 1VG0A 4QWNB 2YAUA 2XTLA 4UEMA 2N9DA 2AR8A 3KU9A 4PK5A 3HYVA 4H7UA 2VURA 1D7LA 1OXZA 4DMWA 2CBIA 3GN5A 4PAGA 1E6EA 1DOEA 5IQ4A 4CZZB 2E4GA 2PFVA 2JB3A 2HWB4 2H7VC 4GF7A 3SZWA 1EZ3A 4C74A 4WYVA 4U8NA 4JN9A 4K8DA 1GNDA 1P2HA 3DJJA 3SM8A 3H3AA 3I0OA 5KMSA 2RR14 3UUBA 1WFDA 4WBNE 1JU2A 2VQ7A 3C64A 1NDAA 1BR0A 1GSNA 3ZSSA 2V7KA 3EAMA 2WP6A 4JY2A 1LTXR 2UXDT 3UKFA 1WYBA 1HX1B 4OHFA 3LBXA 2V60A 3DK8A 2K5BB 1VCTA 3JAEA 2B1EA 2AAQA 2PW9A 4OK0A 5KXJA 1F8SA 3FXDB 3GRTA 2IUBA 5FXXA 4DV4T 2C72A 2UZZA 2IVDA 1U4QA 3NG7X 2A9UA 2BXRA 1OJCA 1YXRA 1PJ6A 3C50A 1XNRT 3O1IA 4YHJA 3LJPA 3M13A 4JY3A 2JMHA 3VKGA 4UV8B 5J2TE 3KV9A 3PUWF 4C90A 1EAH4 3OZ2A 3RYCE 2W2UA 4IE7A 3REDA 3UP4A 4QKNA 4TM0A 3H8IA 3N9NA 3C4NA 3ZDNA 4LF4T 5L3CB 1GREA 4YHHT 3NYEA 3RIUA 1W0AA 4DUYT 5EBKA 5LA6E 2X9XA 4H4YA 3GA8A 4OPDA 3EUHA 4HFIA 4H2RA 2LSGA 3RQWA 3AAAB 1TRBA 1NEKA 4LF6T 1IJ6A 4D03A 4P1NA 5AFUL 1MQTD 3Q5WA 1ZMDA 4X1YE 1T7SA 3DGZA 4NTEA 3QVPA 4PJLA 1GESA 3CMLA 5LHGB 3RYIE 1D5TA 5JR9B 2JJ9A 4U8OA 2VVSA 2WAUA 4KUMB 4GYSA 2DI4A 2VVMA 4I0UA 1TDKA 4K5SA 5FXWA 3HKEE 5FVLA 2VASA 2XSAA 4G2AA 4TM1A 1JOAA 2CWOA 2C75A 4RSLA 4GAVA 3K8PC 3OJAA 3JSKA 5CQFA 2K48A 3B5MA 3D1CA 4JEUB 4OYJA 4O2BE 5L3DB 1IUWA 1REOA 4PABA 3ICSA 2NOXA 4I4TE 1BR4A 1XANA 2BACA 1FOHA 2E9XC 3P7IA 4EQXA 5AQTB 3EF6A 4ZHQE 3EHZA 2F5ZA 1HG5A 4I55E 4CXWA 2EQ8A 5FL0A 3RX6A 2LRKA 2C5IT 1HRI4 5AQJB 2XFQA 1H84A 4JYAT 4AIUA 1LQTA 2BVLA 4JI7T 2E8IA 2C7GA 3ZT7A 3LSVA 2GK9A 3UFEA 2R6GF 3QFBA 3PS9A 4AKLA 3NTAA 5DQVA 4G6HA 3IF8B 1XHZA 2GAHB 4GIWA 3AE3A 4CI2B 3UKLA 1COYA 2X0HA 2D2SA 3T8OA 2Q0KA 4OYKA 5L3GB 2BK4A 4D04A 5LHHB 1XMOT 3GMIA 4XWZA 3L09A 3D8XA 4ZI2C 4LF7T 4G9KA 2JBVA 1BR1A 3EAOA 1I6ZA 2X99A 1W0BA 1F8RA 3FBLA 2V8SV 1N32T 2V7JA 3EDUA 5JQGE 3UOVA 4AKIA 4BJZA 2TMDA 1MIYA 4A99A 4ZI3D 5CA0E 5GONE 2DKHA 1SA0E 2B9YA 4OPIA 1B4VA 1IJ5A 3P4SA 3R6NA 3U78A 3K7QX 4DBQA 2DWGA 4H4WA 4GR1A 4DGKA 2LE8A 5LOVE 2K9AA 2CDUA 4NIQA 3SFDA 2R7FA 3UOXA 5FY1A 4TWFA 4IREA 3K7MX 2VKJA 5LBQB 4O8SA 2XFNA 3C96A 2X66A 2GQWA 2WMOA 5LG4A 4BURA 2V26A 2YLXA 1J5ET 4A79A 2L8KA 4JI3T 2NP9A 4IL9A 1S2QA 4A5XA 2APGA 2IDOB 3NRYA 3RYHE 4U7YA 4U8LA 4UDPA 2XAJB 4REKA 1GRGA 3K3QC 2PBIA
chains in the Genus database with same CATH topology
1GPEA 3KA7A 1VDCA 3AE6A 4U2LA 4Z24A 1TDNA 3SFEA 3FIMB 4U8JA 2C3DA 4FX9A 4XWRA 3RP8A 1DOCA 1DNCA 1LJ1A 1FEAA 1H7WA 2QCUA 1E39A 3H8LA 3VQRA 4AOSA 5JCLA 2R45A 4Y4MA 3AWIA 5KVHA 1RYIA 3GD4A 1LPFA 3S5WA 2R0CA 1VQWA 2YLSA 3NYFA 4G6GA 4AOXA 1NENA 4B66A 1L9EA 4K2XA 3GRSA 2BABA 1CJ2A 1GERA 3RNMA 4YSYA 1M64A 3B6DA 4CY8A 1V59A 3AEFA 1E7PA 1S3BA 2VQBA 3NRNA 3SYIA 2YVGA 4CCRA 2A89A 2HQMA 1DJNA 2ZZ0A 1OJDA 4AT2A 4EQRA 1MO9A 2EQ7A 3F8DA 1NHSA 3GYIA 4YXDA 2R0GA 4FK1A 3AE8A 2OA1A 2RGJA 3QVRA 1LVLA 2ACZA 3DJEA 3T2KA 2B7SA 2Z5YA 3CMMA 4H4ZA 1PBFA 1QO8A 1N4VA 3SZCA 3L8KA 1GRAA 3AB1A 4EQSA 4Z26A 1JEHA 3K7TA 2LFCA 2DKIA 3CNJA 4CY6A 2WEUA 3SGLA 1H83A 2YLZA 2OLOA 3LADA 5IPYA 4M52A 4Z2TA 4OPLA 1JRZA 4O5QA 3IHGA 4N9XA 5IQ1A 2VVLG 1CJCA 2E1MA 3DJGX 4G74A 1O5WA 1YY5A 3NNEA 1GRBA 4UP3A 4ZN0A 5JCIA 5HY5A 2BCGG 1BF3A 4XXGA 1GETA 1AOGA 4BK3A 2BS4A 2XVHA 2WPFA 3CPJG 5CKUA 3ALMA 3DH9A 1KDGA 4GRTA 4UDRA 4YKFA 3AEAA 3ADAB 4JNQA 4PAAA 1PBDA 2H88A 4YSZA 2BS3A 3BHFA 3FPZA 2V6OA 4K22A 3AE2A 2WOWA 4ZCCA 4CCQA 3ABVA 1YQZA 4OPGA 1L9CA 2RGOA 2ZBWA 3NK2X 4H4PA 2CULA 3AE4A 1YQ4A 4EM3A 5BUKA 3AEGA 3RP7A 3VR9A 2VOUA 4YWOA 3BNUA 3K30A 2IIDA 3BNMA 3HYXA 3OC4A 4IA5A 2GMHA 4II2A 1ELIA 1ONFA 3GQHA 5HHFA 3M12A 2PYXA 2XLUA 3CNPA 3AE9A 2O9ZA 4U2SA 2WBAA 2BRAA 3O0HA 1FEBA 4GDPA 1BGJA 4J56A 5HYMA 1Z6LA 2YG4A 2IVEA 2XYOA 4P9SA 1F6MA 1NPXA 3SZFA 4EMWA 3KKJA 3AD9B 4H4SA 4O5UA 3NT6A 4IVMB 3CN8A 3NH3X 3AD8B 3KVEA 1F3PA 1D4DA 4U8MA 3G5QA 3BI5A 1N1PA 3DGHA 3V3OA 3UKHA 4YTMA 2R46A 1NHRA 2ZZBA 3AEBA 5U63A 3DK9A 5FS9A 3P4QA 2XLPA 2YG7A 3ZYXA 2VVLA 2E5VA 2YVFA 2X50A 4EMIA 1OJAA 1EL5A 1EL8A 1GRTA 1E1NA 2XFUA 2XFOA 3AECA 3PO7A 1B37A 2WESA 4YSXA 1S3EA 2VRLA 2ARDA 2YR5A 5FS8A 4X4JA 2VZ2A 3SQPA 3UKPA 3CPIG 4JQ9A 1ZX9A 1N4WA 2QA1A 3IC9A 3KD9A 2XFPA 3QSSA 1NHQA 1E1LA 2EQ9A 1IUSA 5JCNA 3QJ4A 3CGCA 3P1WA 1IUUA 1GOSA 1PXBA 3QSMA 2R4EA 4ICYA 3CNSA 2YM1A 2WOVA 3QSEA 5KNLA 2JB1A 3SXIA 4AP1A 3B3RA 2XVFA 2Z5XA 1IUVA 1NG3A 3CTYA 3LXDA 4U8IA 4WX1A 3V3NA 4H4XA 4Z25A 2WOIA 3IHMA 3KPFA 3CGEA 5C3JA 1Y56B 5KOXA 4FDCB 5GRTA 4TLXA 3LZWA 1PXCA 2B7RA 2YQUA 1EBDA 1H7XA 4J57A 1KSUA 3GSIA 1Q1WA 4J2WA 5JCKA 1PBCA 4IA6A 1DOBA 1O94A 3I6DA 5KWFA 3LOVA 4YT0A 1KFYA 3KLJA 3QFAA 4EQWA 2BA9A 3UP5A 3IWAA 1PS9A 4GUVA 2AQJA 3P9UA 1K0IA 2B76A 4FK1C 5U25A 1L9DA 1P2EA 2GRTA 4B1BA 4USRA 3UKQA 3T0KA 3ICRA 2WQYA 3FMWA 4G73A 3UTGA 1K4QA 2GAGB 5C2TA 4IVOB 2XVJA 5DBJA 3F8PA 3Q9TA 3SX6A 2Q6UA 3GDPA 3URHA 4NEWA 4RG3A 4B64A 1KSSA 5JCMA 1NHPA 3LZXA 3GQKA 2BC1A 1E1KA 4GCMA 4AT0A 1QJDA 5KMQA 4B69A 1DODA 2OAMA 3II4A 1XHCA 3AYJA 2GF3A 4KPRA 2XCGA 2V3BA 2V61A 1K0LA 3NKSA 2YLTA 2JK6A 2GEWA 3GMBA 1GALA 3R9UA 3LB8A 1GRFA 1X31B 1ZK7A 1ZDLA 4H50A 5EB5A 1OJTA 1GV4A 5EB4A 4TLZA 4AP3A 2R9ZA 1D4EA 1PBEA 3AD7B 3GYJA 4HB9A 4OPTA 4A7AA 2NPXA 1CBOA 5FS6A 2GB0A 3UOZA 2RGHA 2BRYA 1DJQA 4CNJA 1BKWA 4Z44A 1ZY8A 3NK1X 4B67A 3VRAA 2YG6A 1M6IA 5BULA 1QLBA 3UKAA 3BI2A 1ZOYA 5FS7A 2C67A 2XVIA 2X8HA 4EM4A 2C76A 1VG0A 4OVIA 2YAUA 1PJ5A 4B68A 4Z43A 4HA6A 1Y56A 2AR8A 2YR4A 3KU9A 3HYVA 4H7UA 4A6NA 4Z2UA 2Q7VA 1D7LA 1D4CA 1XDIA 4OCGA 1CC6A 3EPTA 4E0VA 1CL0A 1E6EA 2C4CA 1DOEA 5IQ4A 1ZOVA 4YTPA 4A6NB 4C5OA 2WHDA 2E4GA 3COXA 4DNAA 2JB3A 3T31A 1OJ9A 4DSGA 4GF7A 3NIXA 3UTHA 3SZWA 1YKJA 3UKKA 2CFYA 4C74A 3NN6X 1RSGA 1IUXA 2GR1A 4U8NA 1KNPA 4JN9A 4K8DA 1GNDA 1F8WA 2A87A 4U8PA 1P2HA 5KMPA 2GH5A 4X9MA 3F8RA 3DJJA 4I58A 3SM8A 5M10A 1VRQB 4A5LA 3ATQA 3CGBA 4IV9A 3AXBA 5KMSA 4CBQA 1SEZA 4J36A 1W4XA 3RP6A 2BS2A 3UCLA 4TM4A 2BC0A 2FJAA 4U8KA 1TDFA 1JU2A 2VQ7A 1UKVG 3ISHA 3T14A 1NDAA 1CJ4A 2B9XA 1JRYA 1GSNA 2EQ6A 2WP6A 4II3A 2YM2A 4JY2A 4EMJA 1LTXR 2WS3A 1ZKQA 4NWZA 3UKFA 3H4KA 1RP0A 2V60A 3DK8A 4C3YA 1IJHA 2AAQA 2WP5A 5KXJA 1ZMCA 3C4AA 1CJ3A 1F8SA 3GRTA 2C72A 3GYXA 2UZZA 2H89A 3NG7X 2GQFA 5KVIA 2BXRA 3I3LA 2IVDA 1OJCA 2RABA 1PJ6A 3LJPA 3M13A 3GWDA 3P4PA 1BZLA 3FG2P 4JY3A 4LU6A 2FJBA 4YTNA 2I0ZA 3NLCA 4MJWA 2Y6QA 3P4RA 4B63A 1Y0PA 3OZ2A 3REDA 2R4JA 3UP4A 4TM0A 3H8IA 3C4NA 1BWCA 1H82A 1GTHA 2XVEA 3V76A 2WDRA 4NZHA 3ZDNA 5LV9A 3NHOX 4TM3A 2C64A 1GREA 3G5RA 4A65A 3WE0A 2XLRA 3NYEA 3AEDA 2XLSA 4RG4A 5EBKA 4OPDA 4H4YA 5KMRA 4H2RA 4H4UA 3E1TA 1TRBA 1NEKA 4BV6A 4GAPA 2V3AA 5L46A 1EL9A 1Q9IA 4D03A 3UTEA 1EL7A 4H4QA 4JDRA 1JNRA 4NTDA 1TYPA 3AE7A 1ZMDA 4C3XA 2YG3A 1TDEA 1VG9A 3S61A 3CGDA 3DGZA 4NTEA 2YWLA 4WCTA 2XDOA 3QVPA 1H81A 4H4TA 5J7XA 2YR6A 1FCDA 1K0JA 3PVCA 1GESA 3DMEA 3NTDA 2J3NA 4CRTA 2YG5A 3ALJA 3ITJA 1JRXA 4YKGA 1D5TA 3AEEA 1PHHA 4U8OA 2BXSA 2V5ZA 2YLRA 4J31A 4Y4LA 4ZCDA 2WP9A 2VVMA 3GMCA 2Y6RA 2GR0A 1TDKA 4K5SA 2YVJA 4J34A 2BYBA 3VRDB 1FL2A 5KOWA 3SZ0A 4TM1A 4UDQA 1JOAA 4GDEA 2C75A 3HZLA 3M0OA 4GAVA 4RSLA 4CNKA 5CQFA 3JSKA 1PXAA 3D1CA 4H4RA 3CIRA 4Y4NA 3BHKA 1IUWA 3UTFA 2JB2A 2X8GA 1GT8A 1REOA 3IF9A 4PABA 4USQA 1GTEA 3ICSA 2ZZCA 1GRHA 2WETA 5KRQA 4U2TA 2OLNA 3NK0X 2PHHA 5GSNA 1XANA 2QA2A 2BACA 1FOHA 4EQXA 3EF6A 4KX6A 3Q6JA 2F5ZA 3BI4A 4ECHA 4A9WA 2EQ8A 3KPKA 1B5QA 1CF3A 4JNAA 2XFQA 2GVCA 1H84A 2JKCA 3NYCA 2WDVA 1LQTA 3SUCA 2TPRA 2Q0LA 2WPCA 2C7GA 2FBWA 1FECA 4I59A 4H4VA 3EANA 3RHAA 2BK5A 2X3NA 4OPCA 1D7YA 5HXIA 1CC4A 2WPEA 2WDQA 1MOKA 4J33A 3T2ZA 4APNA 1MXTA 3QFBA 3PS9A 1PJ7A 3GDNA 1S2YA 3NTAA 4G6HA 5M0ZA 3ICTA 2BCPA 2GAHB 3AE3A 3UKLA 1YQ3A 2X8CA 2WU5A 1COYA 2C3CA 3NGCX 2Q0KA 3CPHG 5EOWA 4ADWA 4Z2RA 2BK4A 1JNZA 3FBSA 3GD3A 4D04A 3AE1A 4XWZA 1NAAA 1PBBA 3D8XA 4G9KA 2JBVA 2JAEA 3VR8A 4NNJA 2GMJA 3AYLA 3EAOA 2OALA 2X99A 1F8RA 4OPUA 2GR2A 2GV8A 2VRMA 3CNDA 4BK1A 2WU2A 1CHUA 1KNRA 5ER0A 1Q1RA 4YSHA 1PDHA 1BGNA 3UOVA 4BJZA 3CNTA 1GEUA 2TMDA 3DJDA 4H2NA 1E1MA 1LV0A 4K7ZA 4A99A 1N4UA 2DKHA 1CC2A 5FMHA 3AE5A 3VRBA 1XPQA 2B9YA 3NN0X 4OPIA 1B4VA 1H86A 3P4SA 3K7QX 2C73A 2BK3A 4H4WA 5J60A 1HYUA 4GR1A 2GR3A 4DGKA 4BK2A 4C77A 2XLTA 1ZP0A 3ALLA 2W0HA 2NVKX 2C70A 5BVAA 2CDUA 4H2PA 1O95A 3SFDA 2R0PA 1LQUA 3UOXA 4X9NA 3L1RA 1IUTA 1TYTA 3K7MX 4LIIA 4B65A 2XFNA 4LA1A 4H2QA 3G5SA 4EIPA 2A8XA 2C66A 2QAEA 1TDOA 2C65A 1PN0A 3C96A 3HYWA 4DSHA 5BRTA 2GQWA 2CVJA 3T37A 4BURA 2YLXA 3ATRA 4A79A 2FJEA 4EIQA 4BJYA 1B8SA 3T2YA 1S2QA 4NTCA 1GXFA 1H6VA 3UOYA 2APGA 5TR3A 3GWFA 2B9WA 1KF6A 4K5RA 5U1OA 3AYIA 4NEVA 3DA1A 4U8LA 2FJDA 4UDPA 4REKA 2YLWA 3DK4A 1DXLA 1GRGA 1L0VA 3SY4A 1NG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPE A;  3KA7 A;  1VDC A;  3AE6 A;  4U2L A;  4Z24 A;  1TDN A;  3SFE A;  3FIM B;  4U8J A;  2C3D A;  4FX9 A;  4XWR A;  3RP8 A;  1DOC A;  1DNC A;  1LJ1 A;  1FEA A;  1H7W A;  2QCU A;  1E39 A;  3H8L A;  3VQR A;  4AOS A;  5JCL A;  2R45 A;  4Y4M A;  3AWI A;  5KVH A;  1RYI A;  3GD4 A;  1LPF A;  3S5W A;  2R0C A;  1VQW A;  2YLS A;  3NYF A;  4AOX A;  1NEN A;  4B66 A;  1L9E A;  4K2X A;  3GRS A;  2BAB A;  1CJ2 A;  1GER A;  3RNM A;  4YSY A;  1M64 A;  3B6D A;  4CY8 A;  1V59 A;  3AEF A;  1E7P A;  1S3B A;  2VQB A;  3NRN A;  4CCR A;  2YVG A;  2A89 A;  2HQM A;  1DJN A;  2ZZ0 A;  1OJD A;  4AT2 A;  4EQR A;  1MO9 A;  2EQ7 A;  3F8D A;  1NHS A;  3GYI A;  4YXD A;  2R0G A;  4FK1 A;  3AE8 A;  2OA1 A;  2RGJ A;  3QVR A;  1LVL A;  2ACZ A;  3DJE A;  2B7S A;  2Z5Y A;  4H4Z A;  1PBF A;  1QO8 A;  1N4V A;  3L8K A;  1GRA A;  3AB1 A;  4EQS A;  4Z26 A;  1JEH A;  3K7T A;  2LFC A;  2DKI A;  3CNJ A;  4CY6 A;  2WEU A;  3SGL A;  1H83 A;  2YLZ A;  2OLO A;  3LAD A;  5IPY A;  4M52 A;  4Z2T A;  4OPL A;  1JRZ A;  4O5Q A;  3IHG A;  4N9X A;  5IQ1 A;  2VVL G;  1CJC A;  2E1M A;  3DJG X;  1O5W A;  1YY5 A;  3NNE A;  1GRB A;  4UP3 A;  4ZN0 A;  5JCI A;  5HY5 A;  2BCG G;  1BF3 A;  4XXG A;  1GET A;  1AOG A;  4BK3 A;  2BS4 A;  2XVH A;  2WPF A;  3CPJ G;  5CKU A;  3ALM A;  3DH9 A;  1KDG A;  4GRT A;  4UDR A;  4YKF A;  3AEA A;  3ADA B;  4JNQ A;  4PAA A;  1PBD A;  2H88 A;  4YSZ A;  2BS3 A;  3BHF A;  3FPZ A;  2V6O A;  4K22 A;  3AE2 A;  2WOW A;  4ZCC A;  4CCQ A;  3ABV A;  1YQZ A;  4OPG A;  1L9C A;  2RGO A;  2ZBW A;  3NK2 X;  4H4P A;  2CUL A;  3AE4 A;  1YQ4 A;  4EM3 A;  5BUK A;  3AEG A;  3RP7 A;  3VR9 A;  2VOU A;  4YWO A;  3BNU A;  3K30 A;  2IID A;  3BNM A;  3OC4 A;  4IA5 A;  2GMH A;  1ELI A;  1ONF A;  3GQH A;  5HHF A;  3M12 A;  2PYX A;  2XLU A;  3CNP A;  3AE9 A;  2O9Z A;  4U2S A;  2WBA A;  4GDP A;  3O0H A;  1FEB A;  4J56 A;  1BGJ A;  5HYM A;  1Z6L A;  2YG4 A;  2IVE A;  2XYO A;  4P9S A;  1F6M A;  1NPX A;  4EMW A;  3KKJ A;  3AD9 B;  4H4S A;  4O5U A;  3NT6 A;  4IVM B;  3CN8 A;  3NH3 X;  3AD8 B;  3KVE A;  1F3P A;  1D4D A;  4U8M A;  3G5Q A;  3BI5 A;  1N1P A;  3DGH A;  3V3O A;  3UKH A;  4YTM A;  2R46 A;  1NHR A;  2ZZB A;  3AEB A;  5U63 A;  3DK9 A;  5FS9 A;  3P4Q A;  2XLP A;  2YG7 A;  3ZYX A;  2VVL A;  2E5V A;  2YVF A;  2X50 A;  4EMI A;  1OJA A;  1EL5 A;  1EL8 A;  1GRT A;  1E1N A;  2XFU A;  2XFO A;  3AEC A;  3PO7 A;  1B37 A;  2WES A;  4YSX A;  1S3E A;  2VRL A;  2ARD A;  2YR5 A;  5FS8 A;  4X4J A;  2VZ2 A;  3SQP A;  3UKP A;  3CPI G;  4JQ9 A;  1ZX9 A;  1N4W A;  2QA1 A;  3IC9 A;  3KD9 A;  2XFP A;  3QSS A;  1NHQ A;  1E1L A;  2EQ9 A;  1IUS A;  5JCN A;  3QJ4 A;  3CGC A;  3P1W A;  1IUU A;  1GOS A;  1PXB A;  3QSM A;  2R4E A;  4ICY A;  3CNS A;  2YM1 A;  2WOV A;  3QSE A;  2JB1 A;  4AP1 A;  3B3R A;  2XVF A;  2Z5X A;  1IUV A;  1NG3 A;  3CTY A;  3LXD A;  4U8I A;  4WX1 A;  3V3N A;  4H4X A;  4Z25 A;  2WOI A;  3IHM A;  3KPF A;  3CGE A;  5C3J A;  1Y56 B;  5KOX A;  4FDC B;  5GRT A;  4TLX A;  3LZW A;  1PXC A;  2B7R A;  2YQU A;  1EBD A;  1H7X A;  4J57 A;  1KSU A;  3GSI A;  1Q1W A;  4J2W A;  5JCK A;  1PBC A;  4IA6 A;  1DOB A;  1O94 A;  3I6D A;  5KWF A;  3LOV A;  4YT0 A;  1KFY A;  3KLJ A;  3QFA A;  4EQW A;  2BA9 A;  3UP5 A;  3IWA A;  1PS9 A;  4GUV A;  2AQJ A;  3P9U A;  1K0I A;  2B76 A;  4FK1 C;  5U25 A;  1L9D A;  1P2E A;  2GRT A;  4B1B A;  4USR A;  3UKQ A;  3UTG A;  3ICR A;  2WQY A;  3FMW A;  1K4Q A;  2GAG B;  5C2T A;  4IVO B;  2XVJ A;  5DBJ A;  3F8P A;  3Q9T A;  2Q6U A;  3GDP A;  3URH A;  4NEW A;  4RG3 A;  4B64 A;  1KSS A;  5JCM A;  1NHP A;  3LZX A;  3GQK A;  2BC1 A;  1E1K A;  4GCM A;  4AT0 A;  1QJD A;  4B69 A;  1DOD A;  2OAM A;  3II4 A;  1XHC A;  3AYJ A;  2GF3 A;  4KPR A;  2XCG A;  2V3B A;  2V61 A;  1K0L A;  3NKS A;  2YLT A;  2JK6 A;  2GEW A;  3GMB A;  1GAL A;  3R9U A;  3LB8 A;  1GRF A;  1X31 B;  1ZK7 A;  1ZDL A;  4H50 A;  5EB5 A;  1OJT A;  1GV4 A;  5EB4 A;  4TLZ A;  4AP3 A;  2R9Z A;  1D4E A;  1PBE A;  3AD7 B;  3GYJ A;  4HB9 A;  4OPT A;  4A7A A;  2NPX A;  1CBO A;  5FS6 A;  2GB0 A;  3UOZ A;  2RGH A;  1DJQ A;  4CNJ A;  1BKW A;  4Z44 A;  1ZY8 A;  3NK1 X;  4B67 A;  3VRA A;  2YG6 A;  1M6I A;  5BUL A;  1QLB A;  3UKA A;  3BI2 A;  1ZOY A;  5FS7 A;  2C67 A;  2XVI A;  2X8H A;  4EM4 A;  2C76 A;  1VG0 A;  4OVI A;  2YAU A;  1PJ5 A;  4B68 A;  4Z43 A;  4HA6 A;  1Y56 A;  2AR8 A;  2YR4 A;  3KU9 A;  4H7U A;  4A6N A;  4Z2U A;  2Q7V A;  1D7L A;  1D4C A;  1XDI A;  4OCG A;  1CC6 A;  3EPT A;  4E0V A;  1CL0 A;  1E6E A;  1DOE A;  5IQ4 A;  1ZOV A;  4YTP A;  4A6N B;  4C5O A;  2WHD A;  2E4G A;  3COX A;  4DNA A;  2JB3 A;  4DSG A;  1OJ9 A;  4GF7 A;  3NIX A;  3UTH A;  1YKJ A;  3UKK A;  2CFY A;  4C74 A;  3NN6 X;  1RSG A;  1IUX A;  2GR1 A;  4U8N A;  1KNP A;  4JN9 A;  4K8D A;  1GND A;  1F8W A;  2A87 A;  4U8P A;  1P2H A;  2GH5 A;  4X9M A;  3F8R A;  3DJJ A;  4I58 A;  3SM8 A;  5M10 A;  1VRQ B;  4A5L A;  3ATQ A;  3CGB A;  4IV9 A;  3AXB A;  4CBQ A;  1SEZ A;  4J36 A;  1W4X A;  3RP6 A;  2BS2 A;  3UCL A;  4TM4 A;  2BC0 A;  2FJA A;  4U8K A;  1TDF A;  1JU2 A;  2VQ7 A;  1UKV G;  3ISH A;  1NDA A;  1CJ4 A;  2B9X A;  1JRY A;  1GSN A;  2EQ6 A;  2WP6 A;  2YM2 A;  4JY2 A;  4EMJ A;  1LTX R;  2WS3 A;  1ZKQ A;  3UKF A;  3H4K A;  1RP0 A;  2V60 A;  3DK8 A;  4C3Y A;  1IJH A;  2AAQ A;  2WP5 A;  5KXJ A;  1ZMC A;  3C4A A;  1CJ3 A;  1F8S A;  3GRT A;  2C72 A;  3GYX A;  2UZZ A;  2H89 A;  3NG7 X;  2GQF A;  5KVI A;  2BXR A;  3I3L A;  2IVD A;  1OJC A;  2RAB A;  1PJ6 A;  3LJP A;  3M13 A;  3GWD A;  3P4P A;  1BZL A;  3FG2 P;  4JY3 A;  4LU6 A;  2FJB A;  4YTN A;  2I0Z A;  3NLC A;  4MJW A;  2Y6Q A;  3P4R A;  4B63 A;  1Y0P A;  3OZ2 A;  3RED A;  2R4J A;  3UP4 A;  4TM0 A;  3H8I A;  3C4N A;  1BWC A;  1H82 A;  1GTH A;  2XVE A;  3V76 A;  2WDR A;  4NZH A;  3ZDN A;  5LV9 A;  3NHO X;  4TM3 A;  2C64 A;  1GRE A;  3G5R A;  4A65 A;  3WE0 A;  2XLR A;  3NYE A;  3AED A;  2XLS A;  4RG4 A;  5EBK A;  4OPD A;  4H4Y A;  4H2R A;  4H4U A;  3E1T A;  1TRB A;  1NEK A;  4BV6 A;  2V3A A;  5L46 A;  1EL9 A;  1Q9I A;  4D03 A;  3UTE A;  1EL7 A;  4H4Q A;  4JDR A;  1JNR A;  4NTD A;  1TYP A;  3AE7 A;  1ZMD A;  4C3X A;  2YG3 A;  1TDE A;  1VG9 A;  3S61 A;  3CGD A;  3DGZ A;  4NTE A;  2YWL A;  4WCT A;  2XDO A;  3QVP A;  1H81 A;  4H4T A;  5J7X A;  2YR6 A;  1FCD A;  1K0J A;  3PVC A;  1GES A;  3DME A;  3NTD A;  2J3N A;  4CRT A;  2YG5 A;  3ALJ A;  3ITJ A;  1JRX A;  4YKG A;  1D5T A;  3AEE A;  1PHH A;  4U8O A;  2BXS A;  2V5Z A;  2YLR A;  4J31 A;  4Y4L A;  4ZCD A;  2WP9 A;  2VVM A;  3GMC A;  2Y6R A;  2GR0 A;  1TDK A;  4K5S A;  2YVJ A;  4J34 A;  2BYB A;  3VRD B;  1FL2 A;  5KOW A;  4TM1 A;  4UDQ A;  1JOA A;  4GDE A;  2C75 A;  3HZL A;  3M0O A;  4RSL A;  4CNK A;  5CQF A;  3JSK A;  1PXA A;  3D1C A;  4H4R A;  3CIR A;  4Y4N A;  3BHK A;  1IUW A;  3UTF A;  2JB2 A;  2X8G A;  1GT8 A;  1REO A;  3IF9 A;  4PAB A;  4USQ A;  1GTE A;  3ICS A;  2ZZC A;  1GRH A;  2WET A;  5KRQ A;  4U2T A;  2OLN A;  3NK0 X;  2PHH A;  5GSN A;  1XAN A;  2QA2 A;  2BAC A;  1FOH A;  4EQX A;  3EF6 A;  4KX6 A;  3Q6J A;  2F5Z A;  3BI4 A;  4ECH A;  4A9W A;  2EQ8 A;  1B5Q A;  1CF3 A;  4JNA A;  2XFQ A;  2GVC A;  1H84 A;  2JKC A;  3NYC A;  2WDV A;  1LQT A;  3SUC A;  2TPR A;  2Q0L A;  2WPC A;  2C7G A;  2FBW A;  1FEC A;  4I59 A;  4H4V A;  3EAN A;  3RHA A;  2BK5 A;  2X3N A;  4OPC A;  1D7Y A;  5HXI A;  1CC4 A;  2WPE A;  2WDQ A;  1MOK A;  4J33 A;  4APN A;  1MXT A;  3QFB A;  3PS9 A;  1PJ7 A;  3GDN A;  1S2Y A;  3NTA A;  5M0Z A;  3ICT A;  2BCP A;  2GAH B;  3AE3 A;  3UKL A;  1YQ3 A;  2X8C A;  2WU5 A;  1COY A;  2C3C A;  3NGC X;  2Q0K A;  3CPH G;  5EOW A;  4ADW A;  4Z2R A;  2BK4 A;  1JNZ A;  3FBS A;  3GD3 A;  4D04 A;  3AE1 A;  4XWZ A;  1NAA A;  1PBB A;  3D8X A;  2JBV A;  2JAE A;  3VR8 A;  2GMJ A;  3AYL A;  3EAO A;  2OAL A;  2X99 A;  1F8R A;  4OPU A;  2GR2 A;  2GV8 A;  2VRM A;  3CND A;  4BK1 A;  2WU2 A;  1CHU A;  1KNR A;  5ER0 A;  1Q1R A;  4YSH A;  1PDH A;  1BGN A;  3UOV A;  4BJZ A;  3CNT A;  1GEU A;  2TMD A;  3DJD A;  4H2N A;  1E1M A;  1LV0 A;  4K7Z A;  4A99 A;  1N4U A;  2DKH A;  1CC2 A;  5FMH A;  3AE5 A;  3VRB A;  1XPQ A;  2B9Y A;  3NN0 X;  4OPI A;  1B4V A;  1H86 A;  3P4S A;  3K7Q X;  2C73 A;  2BK3 A;  4H4W A;  5J60 A;  1HYU A;  4GR1 A;  2GR3 A;  4DGK A;  4BK2 A;  4C77 A;  2XLT A;  1ZP0 A;  3ALL A;  2W0H A;  2NVK X;  2C70 A;  5BVA A;  2CDU A;  4H2P A;  1O95 A;  3SFD A;  2R0P A;  1LQU A;  3UOX A;  4X9N A;  3L1R A;  1IUT A;  1TYT A;  3K7M X;  4LII A;  4B65 A;  2XFN A;  4LA1 A;  4H2Q A;  3G5S A;  4EIP A;  2A8X A;  2C66 A;  2QAE A;  1TDO A;  2C65 A;  1PN0 A;  3C96 A;  4DSH A;  5BRT A;  2GQW A;  2CVJ A;  3T37 A;  4BUR A;  2YLX A;  3ATR A;  4A79 A;  2FJE A;  4EIQ A;  4BJY A;  1B8S A;  1S2Q A;  4NTC A;  1GXF A;  1H6V A;  3UOY A;  2APG A;  5TR3 A;  3GWF A;  2B9W A;  1KF6 A;  4K5R A;  5U1O A;  3AYI A;  4NEV A;  3DA1 A;  4U8L A;  2FJD A;  4UDP A;  4REK A;  2YLW A;  3DK4 A;  1DXL A;  1GRG A;  1L0V A;  1NG4 A; 
#chains in the Genus database with same CATH topology
 3ZYM A;  3ESL A;  1U5P A;  4O2A E;  1VDC A;  3AE6 A;  4U2L A;  3OPC A;  4ERR A;  1R08 4;  3FHN A;  4U8J A;  2C3D A;  2P9B A;  1DOC A;  2QCU A;  3H8L A;  2V6X A;  1FEA A;  4AOS A;  5KVH A;  2R45 A;  4Y4M A;  3JAF A;  1LPF A;  3S5W A;  4O4L E;  3PTR B;  4AOX A;  1NEN A;  4AQY T;  4K2X A;  2BAB A;  1CJ2 A;  3IEE A;  3RH3 A;  5JH7 E;  1V59 A;  1E7P A;  2VQB A;  2YVG A;  3AXJ B;  2R06 4;  2EHO A;  3ZMZ B;  1MO9 A;  2EQ7 A;  4EB6 E;  3ETV A;  3AE8 A;  3SWH A;  3A7M A;  3DJE A;  2B7S A;  2CEA A;  4H4Z A;  1RUF 4;  5KDM C;  3DTO A;  3ZN1 B;  5HEU A;  3AB1 A;  2BG9 E;  2LFC A;  4CY6 A;  4AKH A;  2OLO A;  2BZB A;  5AQI B;  3TKL B;  4N9X A;  1WLX A;  1M7K A;  2E1M A;  3KFW X;  1O5W A;  4LML A;  1AOG A;  2BKO A;  1NCQ D;  4DV2 T;  2WPF A;  3CPJ G;  3N9P A;  4UDR A;  2H88 A;  2LKH A;  4UF0 A;  4K22 A;  5M4Y A;  4ZCC A;  2V6Y A;  3ABV A;  4AKR B;  4OPG A;  1L9C A;  3NK2 X;  4LFC T;  5CFB A;  4CN1 A;  4B3R T;  3AEG A;  4TZ4 C;  2PYL A;  3BNU A;  1Z7S 4;  3HYX A;  3OC4 A;  4HE8 A;  1ELI A;  1WYC A;  3CNP A;  3AE9 A;  4U2Y A;  2O9Z A;  4DV0 T;  4YLH A;  2YG4 A;  3SZF A;  2UUB T;  4H4S A;  4IVM B;  2DLR A;  3AD8 B;  3KBU A;  3O4X E;  4YFS A;  3RLF F;  4K0K T;  3DGH A;  1N1P A;  4ILC A;  2XQ4 A;  2JIW A;  2JQQ A;  3TLV A;  2R46 A;  4UVA B;  4JI6 T;  3P4Q A;  3IA3 A;  3ZYX A;  4U72 A;  4EMI A;  4AQF A;  5FS8 A;  2NTX A;  4ZS2 A;  5J2U E;  4X4J A;  4JQ9 A;  4DR1 T;  3KD9 A;  2YDQ A;  4GK0 E;  2EQ9 A;  3SOL A;  2H3R A;  2ZM8 A;  1N36 T;  2HHH T;  3V5U A;  1GOS A;  2X9Y A;  5F8P A;  4AP1 A;  3OBV E;  1GQE A;  1XDP A;  3LXD A;  4QH5 A;  1IBL T;  4JI8 T;  3QUJ A;  1VBE 4;  3SRZ A;  2X9W A;  3KPF A;  1Y56 B;  2BVM A;  3LZW A;  1VBB 4;  1H7X A;  2X68 A;  1Q1W A;  3N2O A;  4AXP A;  4IDO A;  4J2W A;  3AA0 B;  5JRC A;  1HF8 A;  5JCK A;  5IWA T;  1D1C A;  1KFY A;  3KLJ A;  3QFA A;  3IWA A;  5LHI B;  2YU1 A;  3P9U A;  2B76 A;  5HWY A;  3N9L A;  5U25 A;  1P2E A;  4B1B A;  2CA5 A;  2L3L A;  2V6Y B;  3ICR A;  1UX5 A;  2MAW A;  2WZI A;  3MZK B;  3F8P A;  3Q9T A;  1OOP D;  3GDP A;  5AQO B;  4ZXL A;  2YN6 A;  5CGM A;  3LJC A;  5AQN B;  3LZX A;  4H63 V;  2BC1 A;  3KBT A;  1QJD A;  2XSB A;  1BEV 4;  4B69 A;  3II4 A;  4HWD A;  1XHC A;  3MA9 A;  4KPR A;  2W63 A;  2Y48 B;  1X9B A;  1N33 T;  1K0L A;  1HRV 4;  2JK6 A;  1HXS 4;  2ZMA A;  3LB8 A;  1GRF A;  2E9X B;  4ZEY A;  1OJT A;  3N9Q A;  1AJ3 A;  5HEJ A;  2BRY A;  3KV5 A;  4TWH A;  2RA1 A;  4IHJ E;  1ZY8 A;  3UT5 E;  3PV0 F;  4LFA T;  3JCF A;  4Z43 A;  4HA6 A;  5EK3 A;  1Y56 A;  2YR4 A;  1S35 A;  4FI5 A;  4YJ3 E;  2JQH A;  4ILB A;  1XDI A;  3JC6 D;  3NKZ A;  2LOP A;  5FY0 A;  1HS7 A;  4PDW D;  4EED A;  4ZS3 A;  1LRZ A;  2NTY A;  4A6N B;  3T31 A;  3HL6 A;  2PZS A;  2VKO A;  4PFO A;  3PUQ A;  5L3E B;  3NIX A;  3UTH A;  4MBQ A;  5L4H A;  3UKK A;  5AQM B;  3NN6 X;  1IUX A;  2GR1 A;  3ZT6 A;  5JDN A;  5L4E A;  5ABE A;  2A87 A;  2E9X D;  4L0R A;  2GH5 A;  3UQ7 A;  3AVR A;  4I58 A;  5J0Z A;  3CKD A;  5EK2 A;  5M10 A;  5AQF B;  2N1G A;  3CGB A;  3E22 E;  3AXB A;  4XZC A;  4CBQ A;  4J36 A;  3RP6 A;  2E2A A;  4JI1 T;  4TM4 A;  2BC0 A;  4U8K A;  1TDF A;  2Y6X A;  4BJN A;  2DNX A;  5FXZ A;  2YK0 A;  4JV5 T;  1JRY A;  4JI2 T;  2ACX A;  2IHR 1;  4DV1 T;  2WS3 A;  1FEW A;  3N9O A;  4ZZB A;  4UR9 A;  3H4K A;  4C3Y A;  4IE0 A;  2V7I A;  1AR7 4;  2YKS A;  1ZMC A;  1CJ3 A;  3QOF A;  3GYX A;  2H89 A;  3RYF E;  3I3L A;  3AAE B;  2RAB A;  4LU6 A;  1AR8 4;  3P4P A;  1BZL A;  1W09 A;  3AA6 B;  4MJW A;  3P4R A;  4B63 A;  3KVA A;  2VVN A;  5CB4 E;  5FNV E;  2R4J A;  5LG3 A;  3DJB A;  1RUG 4;  1BWC A;  5LV9 A;  4TM3 A;  2C64 A;  3G5R A;  3WE0 A;  2IAK A;  5HCJ A;  3AA1 B;  3LK3 B;  4H4U A;  4BV6 A;  4TNW A;  2OLT A;  1EL7 A;  4H4Q A;  4UXN B;  4NTD A;  4QXB B;  1TYP A;  2X0L B;  3AE7 A;  4C3X A;  4QHO A;  1TDE A;  1VG9 A;  1ZKE A;  3CGD A;  4WCT A;  3N9M A;  4AIS A;  4BAY B;  2UXC T;  2MBG A;  2AE9 A;  3HI2 A;  3NTD A;  2C5J A;  1HX8 A;  5AQR B;  1QUU A;  1JRX A;  3L8R A;  2HPJ A;  3AEE A;  1PHH A;  4Y4L A;  4X62 T;  2WP9 A;  1Z8U A;  4LF9 T;  4EXT A;  5DAB A;  2BYB A;  3AB3 B;  5KOW A;  4PJM A;  1WR6 A;  1UUS A;  4H4R A;  3AXJ A;  3CIR A;  4Y4N A;  2JB2 A;  2X8G A;  1GT8 A;  1LVF A;  1GTE A;  4IDQ A;  2WET A;  4OX9 T;  2PHH A;  3N2G E;  5L47 A;  4ECH A;  5ABF A;  5HXE A;  2NWB A;  1VCS A;  4JNA A;  3ZYK A;  2WPC A;  2FBW A;  2Q9Q A;  4X65 T;  4H4V A;  3RHA A;  2BK5 A;  2X3N A;  5HXI A;  1CC4 A;  2BG9 C;  2DCF A;  3I9Y A;  2WWV A;  2XAQ B;  5H6R B;  4APN A;  4DID B;  3GDN A;  1S2Y A;  4IE4 A;  5M0Z A;  3ICT A;  3I9W A;  2X8C A;  2CCQ A;  3ONJ A;  3OKQ A;  4MAL A;  2LM2 A;  4Z2R A;  2KXP B;  3FBS A;  4NUU A;  2CM0 A;  5HEO A;  3VR8 A;  1H7C A;  5LCY A;  4NNJ A;  1SE7 A;  4IE5 A;  3HKD E;  2YIN A;  2VRM A;  3CND A;  3CX7 B;  2XQ8 A;  2XQ3 A;  5ER0 A;  2V5C A;  1PDH A;  5A1L A;  3NRX A;  1GEU A;  1VBD 4;  4H2N A;  3PDY A;  1N4U A;  4M1P A;  3VRB A;  4Q25 A;  1US7 B;  1PVC 4;  3D0T A;  4H63 H;  2BK3 A;  2XM1 A;  1XNQ T;  1HYU A;  2GR3 A;  4X1I E;  4BK2 A;  4C77 A;  2XLT A;  1ZP0 A;  5BVA A;  2NVK X;  5FY7 A;  4H2P A;  5HCM A;  2R0P A;  1LQU A;  1IUT A;  1TYT A;  4B65 A;  4EIP A;  3SS1 A;  2KLQ A;  2CE7 A;  2QAE A;  2C65 A;  1PN0 A;  3RKG A;  4HWI B;  3TLS A;  2J1D G;  2CBJ A;  3CQC B;  2BBJ A;  4EIQ A;  4Q4W 4;  4BJY A;  3IHR A;  3RRW A;  4WW0 A;  1KF6 A;  4K5R A;  1HNZ T;  3DA1 A;  4JUY A;  4DR7 T;  1DXL A;  1L0V A;  1NG4 A;  4GYR A;  5LP6 E;  3SFE A;  4Q4V 4;  4FX9 A;  1LJ1 A;  3VQR A;  1E39 A;  5HYA A;  5JCL A;  2R0C A;  4G6G A;  3EAB A;  2YLS A;  1PIV 4;  3GRS A;  4KHZ F;  4YSY A;  3B6D A;  4CY8 A;  5HEH A;  3SYI A;  3RIU C;  4NXM T;  4CCR A;  2MOZ A;  2A89 A;  3FB2 A;  4U33 A;  4AT2 A;  4EQR A;  1NHS A;  3GYI A;  4I50 E;  2OA1 A;  3WAJ A;  5FKY A;  3QVR A;  2ACZ A;  2XQ6 A;  4ILA A;  2Z5Y A;  3CMM A;  1WRD A;  1QO8 A;  2CHN A;  4PJN A;  4TV8 E;  3L8K A;  3K7T A;  3K3O A;  4DR2 T;  4IDZ A;  5KX5 E;  3LAD A;  4U3C A;  4Z2T A;  4OPL A;  2WBL A;  1SUM B;  4IT4 A;  3DJG X;  1Y64 B;  3O9X A;  3RHW A;  2JQK A;  5FP3 A;  1OED E;  5CA1 E;  5CKU A;  3UU3 A;  4JNQ A;  4YSZ A;  2BS3 A;  2V6O A;  2WOW A;  2YU2 A;  4PNI A;  1YQZ A;  2UUC T;  4ANJ A;  2IW5 B;  5IUX A;  2CUL A;  4H9N C;  1YQ4 A;  3F2E A;  5BUK A;  1HTJ F;  3RP7 A;  2WSS V;  2VOU A;  3TLT A;  3J9X 1;  3K30 A;  2WMN A;  4GB3 4;  2GMH A;  1ONF A;  4KP3 C;  2XLU A;  2XZE A;  3ZST A;  4N78 D;  2VK9 A;  3CQG B;  3WAK A;  3BQK A;  2WBA A;  2BRA A;  3O0H A;  4J56 A;  5HYM A;  2PTF A;  1BGJ A;  1POV 0;  1UCU A;  1F6M A;  2LLY A;  4EMW A;  4BA9 A;  4O5U A;  3NT6 A;  3NH3 X;  5DQW A;  3KVE A;  1D0X A;  1D4D A;  4DR4 T;  3UU5 A;  4U8M A;  3G5Q A;  3UKH A;  2MYS A;  1XZY A;  4DR6 T;  2A2F X;  1NHR A;  5U63 A;  2VVL A;  2E5V A;  2YVF A;  3FZK B;  2X50 A;  2X67 A;  1EL5 A;  1GRT A;  1B37 A;  2VRL A;  2ARD A;  3UKP A;  3PUY F;  2RS5 4;  2LEH A;  3QSS A;  5HXC A;  5JRE A;  2VWA A;  3CGC A;  4ILU A;  3P1W A;  3QSM A;  1OED B;  2R4E A;  4ICY A;  3EDV A;  5LBM A;  2YM1 A;  3BQL A;  3QSE A;  5KNL A;  3B3R A;  1UK5 A;  2Z5X A;  3CTY A;  5AQK B;  2X51 A;  2XQ7 A;  5LGU B;  3E0Z A;  4WX1 A;  1HFA A;  3Q5D A;  2WOI A;  4DR3 T;  3C4X A;  5L2L A;  4TLX A;  2B7R A;  2XQY A;  2EX3 A;  4ISS A;  3K1S A;  3GSI A;  3L3P A;  2L9Q A;  2I0M A;  3I6D A;  3W15 B;  5KWF A;  3LOV A;  4YT0 A;  2OV9 A;  3UP5 A;  3NZQ A;  1PS9 A;  2AQJ A;  4FK1 C;  1K0I A;  2LT3 A;  5HXS A;  2GRT A;  3UKQ A;  2IC6 A;  3FMW A;  2CLY C;  3EVY A;  1K4Q A;  4G73 A;  2MTQ A;  4GOU A;  4F8H A;  3P50 A;  2VL8 A;  2BKN A;  5DBJ A;  1UX4 A;  3SX6 A;  4B64 A;  4JI5 T;  3UTK A;  4WBO A;  4AT0 A;  1XHX A;  3ZMT B;  2UUA T;  4CN4 A;  2EHO D;  2V3B A;  2V61 A;  3MKD A;  3GMB A;  3CX6 B;  3H37 A;  2XPK A;  4DBR A;  5EB5 A;  4H50 A;  1D4E A;  1PBE A;  3AD7 B;  4HB9 A;  4OPT A;  1FMV A;  2OA5 A;  2NPX A;  4A7A A;  1YD8 G;  1DJQ A;  1HNW T;  2ZM2 A;  3L39 A;  1BKW A;  4Z44 A;  5BUL A;  5JR9 A;  2YG6 A;  1M6I A;  1M62 A;  2XVI A;  3C4Z A;  4B68 A;  4LF5 T;  3CWZ B;  1VBA 4;  3ZT5 A;  2Q7V A;  1D4C A;  2RS3 4;  3EPT A;  4PK4 A;  1CL0 A;  4KMC A;  4J2C A;  1ZOV A;  4YTP A;  3NBX X;  2WHD A;  3COX A;  3PE0 A;  4DNA A;  1W9R A;  1OJ9 A;  2M6I A;  1RUH 4;  5LMU T;  4NPP A;  3V5S A;  1S94 A;  3LG7 A;  5ADX L;  1KEY A;  2CFY A;  4ZZC A;  1I94 T;  2HPL A;  2UXN B;  4PW8 A;  4GKJ T;  5HAX A;  5LJN A;  2SPC A;  4HFD A;  3UUM A;  4H9R C;  3ATQ A;  2BKP A;  1O3X A;  4EAH A;  2BS2 A;  3UCL A;  1QSD A;  2H7O A;  4EV6 A;  3ZMU B;  4X1K E;  3ISH A;  3T14 A;  1CJ4 A;  4EIW A;  4LF8 T;  4PFP A;  4DO0 A;  4II3 A;  2YM2 A;  1MNE A;  4NWZ A;  3TLU A;  2LKG A;  3RIA A;  2V1D B;  2WP5 A;  5LMN T;  3GWD A;  3NLC A;  1T98 A;  3U3I A;  2CXL A;  4H9S E;  3ZLI A;  4NUV A;  1J5W A;  2XVE A;  3V76 A;  2WDR A;  4EEB A;  3NHO X;  4P0A A;  4A65 A;  1XWM A;  3C4W A;  3AED A;  2XLS A;  2AXD S;  4RG4 A;  3QB5 K;  2J4G A;  3PJA J;  2D0T A;  2I6H A;  3AA7 B;  2V3A A;  5L46 A;  1EL9 A;  4X66 T;  3UTE A;  4JDR A;  3GN5 B;  2YG3 A;  5JDH A;  5EK4 A;  3S61 A;  3ANW A;  1N34 T;  1AR9 4;  2YWL A;  3ONL C;  3ZC0 A;  2XDO A;  1H81 A;  1SHZ C;  4H4T A;  5J7X A;  4I43 B;  3FZM B;  4QXC B;  3DME A;  4UVC B;  4CRT A;  3ALJ A;  4YKG A;  2ODU A;  1RVF 4;  3UU6 A;  2V5Z A;  4HEA A;  4TUY E;  3GMC A;  2Y6R A;  2GR0 A;  3ZPO A;  5HWX A;  2CLY B;  3K3N A;  3VRD B;  1T72 A;  3CQX C;  5FL1 A;  2UXB T;  3SZ0 A;  4UDQ A;  4GDE A;  3M0O A;  4CQI A;  3UUL A;  3O1H A;  4DMV A;  2NW9 A;  3UUX B;  3UTF A;  4QX7 B;  2XAH B;  3BK9 A;  1Y01 A;  2ZZC A;  1GRH A;  5KRQ A;  4U2T A;  3NK0 X;  1T8B A;  2QA2 A;  4A97 A;  5ETW A;  3Q6J A;  5LXT E;  1V9D A;  3KPK A;  3RRC A;  1YKE B;  1B5Q A;  3UQ4 A;  2JKC A;  1WR0 A;  2LSY A;  2X9H A;  3I0Q A;  4O4I E;  5CJ5 A;  1AL2 4;  1FEC A;  4I59 A;  3EAN A;  5FXV A;  4UF0 B;  2WPE A;  2WDQ A;  3B57 A;  3T2Z A;  2Q9Q D;  1ASJ 4;  1PJ7 A;  2BCP A;  4BJM A;  3Q5E A;  2D0U A;  2WU5 A;  3LK4 2;  2YEV C;  4X20 E;  5EOW A;  3CPH G;  1JNZ A;  2PY5 A;  2LSI A;  1D1B A;  2JAE A;  2CHO A;  2CXD A;  1E1H B;  3RI5 A;  2GV8 A;  2WU2 A;  2ZM6 T;  2KND A;  4YSH A;  1RUD 4;  3VHL A;  3CNT A;  3DJD A;  5AQQ B;  1E1M A;  4K7Z A;  1OWA A;  5L3F B;  3AE5 A;  1XPQ A;  5AQG B;  3KDS E;  3NN0 X;  5J60 A;  3QC9 A;  3ALL A;  2W0H A;  2C70 A;  3OVU A;  4X9N A;  5JDQ A;  4LA1 A;  4HWF A;  2LHR A;  4H2Q A;  4DR5 T;  2C66 A;  3ZKR A;  1D4M 4;  2CVJ A;  2CXF A;  2RM2 4;  2Q9Q C;  2J47 A;  3ATR A;  2G0U A;  3T2Y A;  1GXF A;  1H6V A;  3PJA A;  4E7Z A;  2HH7 A;  5TR3 A;  5IHY A;  2B9W A;  3EI0 A;  1E2A A;  1KK7 A;  5L3B B;  4U2Z A;  2VQE T;  3DK4 A;  3AE4 A;  1TDN A;  4DND A;  2CPT A;  1DNC A;  4MHC A;  1H7W A;  1XMQ T;  2YDS A;  2DHR A;  3AWI A;  3GD4 A;  3QNU A;  3NYF A;  1L9E A;  1GER A;  2A72 A;  4HFB A;  3AEF A;  2XJ7 A;  3NRN A;  5ABG A;  3T1Y T;  4KHP T;  2HQM A;  2ZZ0 A;  1OJD A;  2PJQ A;  3F8D A;  4YXD A;  3NWI A;  4JEH B;  1HG2 A;  2RGJ A;  2M67 A;  3HKB E;  3T2K A;  1LVL A;  2VQF T;  1EV1 4;  4IIJ E;  3SZC A;  5F3J A;  1D0Y A;  4Z26 A;  1NWM X;  3MXZ A;  1FIO A;  1B7T A;  1JEH A;  3N5L A;  2DKI A;  3CNJ A;  2WEU A;  3SGL A;  1H83 A;  2YLZ A;  5IPY A;  3TLW A;  1JRZ A;  3UFG A;  4O5Q A;  5JDG A;  1G73 A;  2W00 A;  5IQ1 A;  2UU9 T;  4LMJ A;  3NNE A;  4ZN0 A;  1BF3 A;  1RUI 4;  2BS4 A;  3ALM A;  3UU4 A;  3AEA A;  1PBD A;  3FPZ A;  2KIN B;  3BQI A;  3AE2 A;  3PU8 A;  1WCR A;  3ZN0 B;  5AQH B;  2ZBW A;  5JVD E;  3A5X A;  3KV4 A;  4UVB B;  2LHN A;  2IID A;  4II2 A;  4IA5 A;  3KIN B;  5HHF A;  4H9P C;  3M12 A;  4B3T T;  4U2S A;  2ES0 A;  4HWH A;  2IIU A;  2XAG B;  1Z6L A;  2IVE A;  3KVB A;  5FYM A;  1NPX A;  1MIW A;  3AD9 B;  1RUJ 4;  2M6B A;  2HN1 A;  2KMF A;  3M3Z B;  4YTM A;  2LSK A;  2ZZB A;  1FJG T;  3DK9 A;  5FS9 A;  4P09 A;  2W4X A;  3JC6 C;  2XFU A;  2XFO A;  4HFV A;  4YSX A;  1S3E A;  2YR5 A;  2WZH A;  3GQK A;  3CPI G;  3PUV F;  4C91 A;  5H6Q B;  2W67 A;  4TNV A;  1E1L A;  1IUS A;  2WB5 A;  3RF1 A;  5JCN A;  3PUA A;  2EHO C;  4LMK A;  2Y8D A;  3CNS A;  2XUE A;  5LB7 B;  3Q2M A;  2RS1 4;  3SXI A;  2XVF A;  5JDL A;  1NG3 A;  1OED C;  2UXX B;  1ZHC A;  4HFC A;  4H4X A;  3IHM A;  2F4V T;  3CGE A;  5C3J A;  4P0B A;  3LFM A;  3F31 A;  3ZYL A;  4EGW A;  5HXH A;  4J57 A;  4UV9 B;  3ZEF B;  3P4W A;  1PBC A;  4IA6 A;  1DOB A;  4EQW A;  2IML A;  3ZMS B;  4GUV A;  3LBX B;  3J7Y q;  1XDO A;  2NW8 A;  4U7I A;  3ONX A;  3FZL B;  3T0K A;  2WQY A;  2GAG B;  2QRX A;  2XY8 B;  4QXH B;  2W0G A;  4DVD A;  5C2T A;  2VKH A;  2PLV 4;  5JTG A;  2Q6U A;  4HN9 A;  5LNK A;  4YJ2 E;  4GCM A;  2LJL A;  2GF3 A;  4ZI2 D;  1RUC 4;  3RGL A;  1GAL A;  1X31 B;  1IBK T;  1ZDL A;  5EB4 A;  4AP3 A;  4K0U A;  3N2K E;  4TLZ A;  2R9Z A;  1CBO A;  1Z0P A;  3UOZ A;  2RGH A;  2BDE A;  4CNJ A;  1IAP A;  1UUR A;  4B67 A;  3NK1 X;  3VRA A;  1QLB A;  5J1G A;  3BI2 A;  1ZOY A;  3UKA A;  2C67 A;  4EM4 A;  4AI6 A;  2C76 A;  4OVI A;  2W61 A;  1PJ5 A;  3AVS A;  5JDF A;  2VL0 A;  3Q5X A;  1IBM T;  4Z2U A;  4A6N A;  1ZEE A;  4HKA A;  3I1A A;  2XHE B;  4OCG A;  1CC6 A;  4E0V A;  3LDQ B;  2C4C A;  4C5O A;  5BR8 T;  1G8X A;  2HN2 A;  4DSG A;  4O4H E;  4JI0 T;  1YKJ A;  3T1H T;  1RSG A;  1KNP A;  4QH1 A;  4PK6 A;  3OYX A;  3A8Y C;  4OFZ A;  4U8P A;  1F8W A;  5KMP A;  4Z90 A;  1NAF A;  4X9M A;  4ZI7 E;  2VKD A;  3F8R A;  1VRQ B;  4ADZ A;  2E9X A;  4IV9 A;  1SEZ A;  1W4X A;  1DU2 A;  2FJA A;  4WNK A;  1LVK A;  2V7L A;  1UKV G;  2B9X A;  2EQ6 A;  2BG9 A;  2LSJ A;  4EMJ A;  5KMG P;  1ZKQ A;  5EZY E;  3VKH A;  3Q9D A;  2BG9 B;  1RP0 A;  2CRB A;  1IJH A;  3S4U A;  3C4A A;  2BBH A;  5AQU B;  5KVI A;  2GQF A;  4ZOL E;  3FG2 P;  3ZC1 A;  1AR6 4;  2FJB A;  4YTN A;  2I0Z A;  1BR2 A;  2Y6Q A;  1Y0P A;  2KWH A;  4Q4X 4;  2KT9 A;  2R04 4;  1H82 A;  1GTH A;  1J1J A;  4NZH A;  2JRK A;  2YOE A;  5JRC B;  1MND A;  2LRL A;  1COV 4;  2XLR A;  1VBC 4;  3MJX A;  3LK2 B;  4NXN T;  4TWD A;  5KMR A;  3E1T A;  4GAP A;  3CX8 B;  3OYZ A;  1MMG A;  1Q9I A;  5LJM A;  1JNR A;  3B13 A;  1K5M D;  4AKG A;  4HGA A;  2V7M A;  4F6R C;  1VRH 4;  1UGO A;  4G63 A;  5LYJ E;  2YR6 A;  1FCD A;  1MMN A;  2IC9 A;  4IST A;  1K0J A;  3PVC A;  2D9D A;  2J3N A;  2YG5 A;  3ITJ A;  2XAF B;  2BXS A;  2YLR A;  4J31 A;  4ZCD A;  4IDP A;  2WCA A;  3WI3 A;  2C5K T;  3PUS A;  3PUG A;  2YVJ A;  4J34 A;  1R8I A;  1YKH B;  1FL2 A;  2A3D A;  3HZL A;  4CNK A;  1RUE 4;  5LGN B;  1PXA A;  2WY2 A;  4JLE A;  4EOZ B;  3BHK A;  3IF9 A;  4HTE A;  4B3S T;  4XAX B;  4USQ A;  2WWU A;  3J8F 4;  4LFB T;  2OLN A;  5AQL B;  5GSN A;  3CVR A;  3H3M A;  3UU8 A;  3JD7 4;  4KX6 A;  5FMN A;  3BI4 A;  4A9W A;  2CWY A;  2XQ9 A;  3RC8 A;  2MPK A;  1CF3 A;  2GVC A;  3NYC A;  3SUC A;  2WDV A;  2TPR A;  2Q0L A;  5LGT B;  4V1A v;  1D1A A;  2XAS B;  4OPC A;  1D7Y A;  4O4J E;  1MOK A;  4J33 A;  1LKX A;  4RHV 4;  3QK6 A;  1MXT A;  1RMU 4;  4ASK A;  3IBP A;  2N2N A;  2QYW A;  2C0S A;  3O1J A;  2C3C A;  3NGC X;  4ADW A;  3GD3 A;  4JBW F;  5F5W A;  3ZJ2 A;  3FBZ A;  3AE1 A;  1D0Z A;  1NAA A;  3ZMV B;  1PBB A;  3QB5 A;  2GMJ A;  2E5L T;  3AYL A;  3KV6 A;  3RC3 A;  2OAL A;  4L5G A;  4OPU A;  2GR2 A;  3CK6 A;  4BK1 A;  1CHU A;  1KNR A;  2X0Y A;  4HWC A;  1Q1R A;  2YDR A;  4QX8 B;  1BGN A;  2KWI B;  1LV0 A;  3ZCI A;  1FMW A;  3F57 A;  1CC2 A;  1PO2 4;  5FMH A;  1MIV A;  4DV6 T;  1H86 A;  2ZLY A;  3CPZ A;  3PUX F;  4IL4 A;  2C73 A;  4GK5 E;  2W66 A;  2X5I D;  4U74 A;  4A98 A;  1IZN B;  3G06 A;  1X79 A;  1O95 A;  3L1R A;  4LII A;  2XM2 A;  3G5S A;  2JQ9 A;  4TX5 A;  2A8X A;  1NA1 D;  1TDO A;  3HYW A;  4L9I A;  4DSH A;  5BRT A;  3T37 A;  4UEL A;  2FJE A;  3C98 B;  1B8S A;  4NTC A;  3UOY A;  4TV9 E;  3GWF A;  2QGS A;  2PG8 A;  2WM9 A;  5U1O A;  3AYI A;  4NEV A;  3P8C D;  5BMV E;  2FJD A;  5AQV B;  2YLW A;  3V3N A;  4X5T A;  4MLK A;  4GDP A;  3ETU A;  3SY4 A;  1YQ3 A;  1GPE A;  3UUN A;  3KA7 A;  4Z24 A;  2LOS A;  3FIM B;  2RPA A;  3VU7 H;  4XWR A;  3RP8 A;  2JMK A;  1RYI A;  3MK7 C;  4COF A;  1VQW A;  4H9O C;  4B66 A;  5TAO A;  4GKK T;  3RNM A;  1M64 A;  1S3B A;  4WZX A;  3E08 A;  1DJN A;  3MAC A;  2QVA A;  4EZ4 A;  2R0G A;  4FK1 A;  3NZP A;  4QH4 A;  4UIG A;  4IGU A;  1PBF A;  3FXE B;  1HNX T;  4B3M T;  1N4V A;  4FJO A;  1GRA A;  4EQS A;  1CUN A;  4E7S A;  1VOM A;  4IE6 A;  4CI1 B;  4M52 A;  3IHG A;  1XI1 A;  2VVL G;  1CJC A;  3HKC E;  3JAD A;  1R09 4;  4G74 A;  1YY5 A;  3AAI A;  1GRB A;  4UP3 A;  5JCI A;  3ANW B;  3M65 A;  3FZH B;  2ZM0 A;  2BCG G;  4XXG A;  5HY5 A;  1GET A;  4BK3 A;  2XVH A;  4EZH A;  3DH9 A;  4Z8X A;  1KDG A;  4GRT A;  5IYZ E;  4YKF A;  3ADA B;  4PAA A;  3DP7 A;  3BHF A;  4HFE A;  3RIF A;  4CCQ A;  2RGO A;  2ODV A;  5HEG A;  4H4P A;  2Z6E A;  1MMA A;  4A56 A;  3PUZ F;  4CI3 B;  4EM3 A;  4Z91 A;  3VR9 A;  4YWO A;  4IDN A;  3HA4 A;  3BNM A;  4U31 A;  3GQH A;  3HR0 A;  2PYX A;  2V5D A;  4KI0 F;  3GWH A;  3OTO T;  1FEB A;  4CXX A;  2K3W A;  2HWC 4;  2XYO A;  4P9S A;  3KKJ A;  4CXY A;  4ZI3 C;  3CN8 A;  1F3P A;  3C51 A;  2JPF A;  3R84 B;  3FZF B;  1OED A;  2XQ5 A;  4TN7 B;  4XBF B;  4PJJ A;  3ZJ1 A;  3BI5 A;  3V3O A;  3AEB A;  5ABH A;  2XLP A;  2YG7 A;  1RHI 4;  1ZV4 X;  5E0O A;  1OJA A;  1EL8 A;  1H8T D;  2DWK A;  3RKO A;  1E1N A;  3PO7 A;  3AEC A;  1HR0 T;  2WES A;  4A5L A;  1PO1 4;  3SQP A;  4HFH A;  2VZ2 A;  1ZX9 A;  1N4W A;  2QA1 A;  3IC9 A;  4JI4 T;  2XFP A;  4EYU A;  1NHQ A;  3FI7 A;  3RPU A;  3QJ4 A;  4X64 T;  1IUU A;  2CMR A;  4EYY R;  1PXB A;  4DV7 T;  5JDM A;  3RQU A;  2WOV A;  2VB6 A;  2JB1 A;  3NVO A;  2W62 A;  1IUV A;  4KBM B;  2FUP A;  4U8I A;  3PU3 A;  2RMU 4;  2EHO B;  2D5U A;  5AQP B;  4Z25 A;  4B6X A;  5KOX A;  4FDC B;  1YW0 A;  3PUR A;  5GRT A;  1PXC A;  2YQU A;  1EBD A;  5AQS B;  1KSU A;  2Q9Q B;  4H9Q C;  1O94 A;  4Q4Y 4;  2BA9 A;  2R07 4;  5ABF B;  4DV3 T;  1L9D A;  4MFR A;  4USR A;  3UTG A;  2NW7 A;  4DUZ T;  4DV5 T;  4IVO B;  2XVJ A;  2PYJ A;  2LM9 A;  1MMD A;  3URH A;  5JR9 C;  4NEW A;  4RG3 A;  1HCI A;  1KSS A;  5JCM A;  1NHP A;  2K24 A;  1E1K A;  1KNZ A;  5KMQ A;  1DOD A;  4AQF C;  2OAM A;  2KZ7 B;  2XQA A;  3AYJ A;  2QA7 A;  2XCG A;  3NKS A;  2YLT A;  2GEW A;  5DJQ C;  3R9U A;  3JBG 4;  1ZK7 A;  1GV4 A;  1VRB A;  2KSR A;  3ZCJ A;  3GYJ A;  4YY3 T;  4AQG A;  5FS6 A;  3X1D A;  2GB0 A;  5FVK A;  2RP4 A;  5HXR A;  2DL1 A;  4CN6 A;  2I59 A;  2J62 A;  2NR4 A;  5C8Y E;  5FS7 A;  2X8H A;  1VG0 A;  4QWN B;  2YAU A;  2XTL A;  4UEM A;  2N9D A;  2AR8 A;  3KU9 A;  4PK5 A;  3HYV A;  4H7U A;  2VUR A;  1D7L A;  1OXZ A;  4DMW A;  2CBI A;  3GN5 A;  4PAG A;  1E6E A;  1DOE A;  5IQ4 A;  4CZZ B;  2E4G A;  2PFV A;  2JB3 A;  2HWB 4;  2H7V C;  4GF7 A;  3SZW A;  1EZ3 A;  4C74 A;  4WYV A;  4U8N A;  4JN9 A;  4K8D A;  1GND A;  1P2H A;  3DJJ A;  3SM8 A;  3H3A A;  3I0O A;  5KMS A;  2RR1 4;  3UUB A;  1WFD A;  4WBN E;  1JU2 A;  2VQ7 A;  3C64 A;  1NDA A;  1BR0 A;  1GSN A;  3ZSS A;  2V7K A;  3EAM A;  2WP6 A;  4JY2 A;  1LTX R;  2UXD T;  3UKF A;  1WYB A;  1HX1 B;  4OHF A;  3LBX A;  2V60 A;  3DK8 A;  2K5B B;  1VCT A;  3JAE A;  2B1E A;  2AAQ A;  2PW9 A;  4OK0 A;  5KXJ A;  1F8S A;  3FXD B;  3GRT A;  2IUB A;  5FXX A;  4DV4 T;  2C72 A;  2UZZ A;  2IVD A;  1U4Q A;  3NG7 X;  2A9U A;  2BXR A;  1OJC A;  1YXR A;  1PJ6 A;  3C50 A;  1XNR T;  3O1I A;  4YHJ A;  3LJP A;  3M13 A;  4JY3 A;  2JMH A;  3VKG A;  4UV8 B;  5J2T E;  3KV9 A;  3PUW F;  4C90 A;  1EAH 4;  3OZ2 A;  3RYC E;  2W2U A;  4IE7 A;  3RED A;  3UP4 A;  4QKN A;  4TM0 A;  3H8I A;  3N9N A;  3C4N A;  3ZDN A;  4LF4 T;  5L3C B;  1GRE A;  4YHH T;  3NYE A;  3RIU A;  1W0A A;  4DUY T;  5EBK A;  5LA6 E;  2X9X A;  4H4Y A;  3GA8 A;  4OPD A;  3EUH A;  4HFI A;  4H2R A;  2LSG A;  3RQW A;  3AAA B;  1TRB A;  1NEK A;  4LF6 T;  1IJ6 A;  4D03 A;  4P1N A;  5AFU L;  1MQT D;  3Q5W A;  1ZMD A;  4X1Y E;  1T7S A;  3DGZ A;  4NTE A;  3QVP A;  4PJL A;  1GES A;  3CML A;  5LHG B;  3RYI E;  1D5T A;  5JR9 B;  2JJ9 A;  4U8O A;  2VVS A;  2WAU A;  4KUM B;  4GYS A;  2DI4 A;  2VVM A;  4I0U A;  1TDK A;  4K5S A;  5FXW A;  3HKE E;  5FVL A;  2VAS A;  2XSA A;  4G2A A;  4TM1 A;  1JOA A;  2CWO A;  2C75 A;  4RSL A;  4GAV A;  3K8P C;  3OJA A;  3JSK A;  5CQF A;  2K48 A;  3B5M A;  3D1C A;  4JEU B;  4OYJ A;  4O2B E;  5L3D B;  1IUW A;  1REO A;  4PAB A;  3ICS A;  2NOX A;  4I4T E;  1BR4 A;  1XAN A;  2BAC A;  1FOH A;  2E9X C;  3P7I A;  4EQX A;  5AQT B;  3EF6 A;  4ZHQ E;  3EHZ A;  2F5Z A;  1HG5 A;  4I55 E;  4CXW A;  2EQ8 A;  5FL0 A;  3RX6 A;  2LRK A;  2C5I T;  1HRI 4;  5AQJ B;  2XFQ A;  1H84 A;  4JYA T;  4AIU A;  1LQT A;  2BVL A;  4JI7 T;  2E8I A;  2C7G A;  3ZT7 A;  3LSV A;  2GK9 A;  3UFE A;  2R6G F;  3QFB A;  3PS9 A;  4AKL A;  3NTA A;  5DQV A;  4G6H A;  3IF8 B;  1XHZ A;  2GAH B;  4GIW A;  3AE3 A;  4CI2 B;  3UKL A;  1COY A;  2X0H A;  2D2S A;  3T8O A;  2Q0K A;  4OYK A;  5L3G B;  2BK4 A;  4D04 A;  5LHH B;  1XMO T;  3GMI A;  4XWZ A;  3L09 A;  3D8X A;  4ZI2 C;  4LF7 T;  4G9K A;  2JBV A;  1BR1 A;  3EAO A;  1I6Z A;  2X99 A;  1W0B A;  1F8R A;  3FBL A;  2V8S V;  1N32 T;  2V7J A;  3EDU A;  5JQG E;  3UOV A;  4AKI A;  4BJZ A;  2TMD A;  1MIY A;  4A99 A;  4ZI3 D;  5CA0 E;  5GON E;  2DKH A;  1SA0 E;  2B9Y A;  4OPI A;  1B4V A;  1IJ5 A;  3P4S A;  3R6N A;  3U78 A;  3K7Q X;  4DBQ A;  2DWG A;  4H4W A;  4GR1 A;  4DGK A;  2LE8 A;  5LOV E;  2K9A A;  2CDU A;  4NIQ A;  3SFD A;  2R7F A;  3UOX A;  5FY1 A;  4TWF A;  4IRE A;  3K7M X;  2VKJ A;  5LBQ B;  4O8S A;  2XFN A;  3C96 A;  2X66 A;  2GQW A;  2WMO A;  5LG4 A;  4BUR A;  2V26 A;  2YLX A;  1J5E T;  4A79 A;  2L8K A;  4JI3 T;  2NP9 A;  4IL9 A;  1S2Q A;  4A5X A;  2APG A;  2IDO B;  3NRY A;  3RYH E;  4U7Y A;  4U8L A;  4UDP A;  2XAJ B;  4REK A;  1GRG A;  3K3Q C;  2PBI A; 
#chains in the Genus database with same CATH homology
 1GPE A;  3KA7 A;  1VDC A;  3AE6 A;  4U2L A;  4Z24 A;  1TDN A;  3SFE A;  3FIM B;  4U8J A;  2C3D A;  4FX9 A;  4XWR A;  3RP8 A;  1DOC A;  1DNC A;  1LJ1 A;  1FEA A;  1H7W A;  2QCU A;  1E39 A;  3H8L A;  3VQR A;  4AOS A;  5JCL A;  2R45 A;  4Y4M A;  3AWI A;  5KVH A;  1RYI A;  3GD4 A;  1LPF A;  3S5W A;  2R0C A;  1VQW A;  2YLS A;  3NYF A;  4G6G A;  4AOX A;  1NEN A;  4B66 A;  1L9E A;  4K2X A;  3GRS A;  2BAB A;  1CJ2 A;  1GER A;  3RNM A;  4YSY A;  1M64 A;  3B6D A;  4CY8 A;  1V59 A;  3AEF A;  1E7P A;  1S3B A;  2VQB A;  3NRN A;  3SYI A;  2YVG A;  4CCR A;  2A89 A;  2HQM A;  1DJN A;  2ZZ0 A;  1OJD A;  4AT2 A;  4EQR A;  1MO9 A;  2EQ7 A;  3F8D A;  1NHS A;  3GYI A;  4YXD A;  2R0G A;  4FK1 A;  3AE8 A;  2OA1 A;  2RGJ A;  3QVR A;  1LVL A;  2ACZ A;  3DJE A;  3T2K A;  2B7S A;  2Z5Y A;  3CMM A;  4H4Z A;  1PBF A;  1QO8 A;  1N4V A;  3SZC A;  3L8K A;  1GRA A;  3AB1 A;  4EQS A;  4Z26 A;  1JEH A;  3K7T A;  2LFC A;  2DKI A;  3CNJ A;  4CY6 A;  2WEU A;  3SGL A;  1H83 A;  2YLZ A;  2OLO A;  3LAD A;  5IPY A;  4M52 A;  4Z2T A;  4OPL A;  1JRZ A;  4O5Q A;  3IHG A;  4N9X A;  5IQ1 A;  2VVL G;  1CJC A;  2E1M A;  3DJG X;  4G74 A;  1O5W A;  1YY5 A;  3NNE A;  1GRB A;  4UP3 A;  4ZN0 A;  5JCI A;  5HY5 A;  2BCG G;  1BF3 A;  4XXG A;  1GET A;  1AOG A;  4BK3 A;  2BS4 A;  2XVH A;  2WPF A;  3CPJ G;  5CKU A;  3ALM A;  3DH9 A;  1KDG A;  4GRT A;  4UDR A;  4YKF A;  3AEA A;  3ADA B;  4JNQ A;  4PAA A;  1PBD A;  2H88 A;  4YSZ A;  2BS3 A;  3BHF A;  3FPZ A;  2V6O A;  4K22 A;  3AE2 A;  2WOW A;  4ZCC A;  4CCQ A;  3ABV A;  1YQZ A;  4OPG A;  1L9C A;  2RGO A;  2ZBW A;  3NK2 X;  4H4P A;  2CUL A;  3AE4 A;  1YQ4 A;  4EM3 A;  5BUK A;  3AEG A;  3RP7 A;  3VR9 A;  2VOU A;  4YWO A;  3BNU A;  3K30 A;  2IID A;  3BNM A;  3HYX A;  3OC4 A;  4IA5 A;  2GMH A;  4II2 A;  1ELI A;  1ONF A;  3GQH A;  5HHF A;  3M12 A;  2PYX A;  2XLU A;  3CNP A;  3AE9 A;  2O9Z A;  4U2S A;  2WBA A;  2BRA A;  3O0H A;  1FEB A;  4GDP A;  1BGJ A;  4J56 A;  5HYM A;  1Z6L A;  2YG4 A;  2IVE A;  2XYO A;  4P9S A;  1F6M A;  1NPX A;  3SZF A;  4EMW A;  3KKJ A;  3AD9 B;  4H4S A;  4O5U A;  3NT6 A;  4IVM B;  3CN8 A;  3NH3 X;  3AD8 B;  3KVE A;  1F3P A;  1D4D A;  4U8M A;  3G5Q A;  3BI5 A;  1N1P A;  3DGH A;  3V3O A;  3UKH A;  4YTM A;  2R46 A;  1NHR A;  2ZZB A;  3AEB A;  5U63 A;  3DK9 A;  5FS9 A;  3P4Q A;  2XLP A;  2YG7 A;  3ZYX A;  2VVL A;  2E5V A;  2YVF A;  2X50 A;  4EMI A;  1OJA A;  1EL5 A;  1EL8 A;  1GRT A;  1E1N A;  2XFU A;  2XFO A;  3AEC A;  3PO7 A;  1B37 A;  2WES A;  4YSX A;  1S3E A;  2VRL A;  2ARD A;  2YR5 A;  5FS8 A;  4X4J A;  2VZ2 A;  3SQP A;  3UKP A;  3CPI G;  4JQ9 A;  1ZX9 A;  1N4W A;  2QA1 A;  3IC9 A;  3KD9 A;  2XFP A;  3QSS A;  1NHQ A;  1E1L A;  2EQ9 A;  1IUS A;  5JCN A;  3QJ4 A;  3CGC A;  3P1W A;  1IUU A;  1GOS A;  1PXB A;  3QSM A;  2R4E A;  4ICY A;  3CNS A;  2YM1 A;  2WOV A;  3QSE A;  5KNL A;  2JB1 A;  3SXI A;  4AP1 A;  3B3R A;  2XVF A;  2Z5X A;  1IUV A;  1NG3 A;  3CTY A;  3LXD A;  4U8I A;  4WX1 A;  3V3N A;  4H4X A;  4Z25 A;  2WOI A;  3IHM A;  3KPF A;  3CGE A;  5C3J A;  1Y56 B;  5KOX A;  4FDC B;  5GRT A;  4TLX A;  3LZW A;  1PXC A;  2B7R A;  2YQU A;  1EBD A;  1H7X A;  4J57 A;  1KSU A;  3GSI A;  1Q1W A;  4J2W A;  5JCK A;  1PBC A;  4IA6 A;  1DOB A;  1O94 A;  3I6D A;  5KWF A;  3LOV A;  4YT0 A;  1KFY A;  3KLJ A;  3QFA A;  4EQW A;  2BA9 A;  3UP5 A;  3IWA A;  1PS9 A;  4GUV A;  2AQJ A;  3P9U A;  1K0I A;  2B76 A;  4FK1 C;  5U25 A;  1L9D A;  1P2E A;  2GRT A;  4B1B A;  4USR A;  3UKQ A;  3T0K A;  3ICR A;  2WQY A;  3FMW A;  4G73 A;  3UTG A;  1K4Q A;  2GAG B;  5C2T A;  4IVO B;  2XVJ A;  5DBJ A;  3F8P A;  3Q9T A;  3SX6 A;  2Q6U A;  3GDP A;  3URH A;  4NEW A;  4RG3 A;  4B64 A;  1KSS A;  5JCM A;  1NHP A;  3LZX A;  3GQK A;  2BC1 A;  1E1K A;  4GCM A;  4AT0 A;  1QJD A;  5KMQ A;  4B69 A;  1DOD A;  2OAM A;  3II4 A;  1XHC A;  3AYJ A;  2GF3 A;  4KPR A;  2XCG A;  2V3B A;  2V61 A;  1K0L A;  3NKS A;  2YLT A;  2JK6 A;  2GEW A;  3GMB A;  1GAL A;  3R9U A;  3LB8 A;  1GRF A;  1X31 B;  1ZK7 A;  1ZDL A;  4H50 A;  5EB5 A;  1OJT A;  1GV4 A;  5EB4 A;  4TLZ A;  4AP3 A;  2R9Z A;  1D4E A;  1PBE A;  3AD7 B;  3GYJ A;  4HB9 A;  4OPT A;  4A7A A;  2NPX A;  1CBO A;  5FS6 A;  2GB0 A;  3UOZ A;  2RGH A;  2BRY A;  1DJQ A;  4CNJ A;  1BKW A;  4Z44 A;  1ZY8 A;  3NK1 X;  4B67 A;  3VRA A;  2YG6 A;  1M6I A;  5BUL A;  1QLB A;  3UKA A;  3BI2 A;  1ZOY A;  5FS7 A;  2C67 A;  2XVI A;  2X8H A;  4EM4 A;  2C76 A;  1VG0 A;  4OVI A;  2YAU A;  1PJ5 A;  4B68 A;  4Z43 A;  4HA6 A;  1Y56 A;  2AR8 A;  2YR4 A;  3KU9 A;  3HYV A;  4H7U A;  4A6N A;  4Z2U A;  2Q7V A;  1D7L A;  1D4C A;  1XDI A;  4OCG A;  1CC6 A;  3EPT A;  4E0V A;  1CL0 A;  1E6E A;  2C4C A;  1DOE A;  5IQ4 A;  1ZOV A;  4YTP A;  4A6N B;  4C5O A;  2WHD A;  2E4G A;  3COX A;  4DNA A;  2JB3 A;  3T31 A;  1OJ9 A;  4DSG A;  4GF7 A;  3NIX A;  3UTH A;  3SZW A;  1YKJ A;  3UKK A;  2CFY A;  4C74 A;  3NN6 X;  1RSG A;  1IUX A;  2GR1 A;  4U8N A;  1KNP A;  4JN9 A;  4K8D A;  1GND A;  1F8W A;  2A87 A;  4U8P A;  1P2H A;  5KMP A;  2GH5 A;  4X9M A;  3F8R A;  3DJJ A;  4I58 A;  3SM8 A;  5M10 A;  1VRQ B;  4A5L A;  3ATQ A;  3CGB A;  4IV9 A;  3AXB A;  5KMS A;  4CBQ A;  1SEZ A;  4J36 A;  1W4X A;  3RP6 A;  2BS2 A;  3UCL A;  4TM4 A;  2BC0 A;  2FJA A;  4U8K A;  1TDF A;  1JU2 A;  2VQ7 A;  1UKV G;  3ISH A;  3T14 A;  1NDA A;  1CJ4 A;  2B9X A;  1JRY A;  1GSN A;  2EQ6 A;  2WP6 A;  4II3 A;  2YM2 A;  4JY2 A;  4EMJ A;  1LTX R;  2WS3 A;  1ZKQ A;  4NWZ A;  3UKF A;  3H4K A;  1RP0 A;  2V60 A;  3DK8 A;  4C3Y A;  1IJH A;  2AAQ A;  2WP5 A;  5KXJ A;  1ZMC A;  3C4A A;  1CJ3 A;  1F8S A;  3GRT A;  2C72 A;  3GYX A;  2UZZ A;  2H89 A;  3NG7 X;  2GQF A;  5KVI A;  2BXR A;  3I3L A;  2IVD A;  1OJC A;  2RAB A;  1PJ6 A;  3LJP A;  3M13 A;  3GWD A;  3P4P A;  1BZL A;  3FG2 P;  4JY3 A;  4LU6 A;  2FJB A;  4YTN A;  2I0Z A;  3NLC A;  4MJW A;  2Y6Q A;  3P4R A;  4B63 A;  1Y0P A;  3OZ2 A;  3RED A;  2R4J A;  3UP4 A;  4TM0 A;  3H8I A;  3C4N A;  1BWC A;  1H82 A;  1GTH A;  2XVE A;  3V76 A;  2WDR A;  4NZH A;  3ZDN A;  5LV9 A;  3NHO X;  4TM3 A;  2C64 A;  1GRE A;  3G5R A;  4A65 A;  3WE0 A;  2XLR A;  3NYE A;  3AED A;  2XLS A;  4RG4 A;  5EBK A;  4OPD A;  4H4Y A;  5KMR A;  4H2R A;  4H4U A;  3E1T A;  1TRB A;  1NEK A;  4BV6 A;  4GAP A;  2V3A A;  5L46 A;  1EL9 A;  1Q9I A;  4D03 A;  3UTE A;  1EL7 A;  4H4Q A;  4JDR A;  1JNR A;  4NTD A;  1TYP A;  3AE7 A;  1ZMD A;  4C3X A;  2YG3 A;  1TDE A;  1VG9 A;  3S61 A;  3CGD A;  3DGZ A;  4NTE A;  2YWL A;  4WCT A;  2XDO A;  3QVP A;  1H81 A;  4H4T A;  5J7X A;  2YR6 A;  1FCD A;  1K0J A;  3PVC A;  1GES A;  3DME A;  3NTD A;  2J3N A;  4CRT A;  2YG5 A;  3ALJ A;  3ITJ A;  1JRX A;  4YKG A;  1D5T A;  3AEE A;  1PHH A;  4U8O A;  2BXS A;  2V5Z A;  2YLR A;  4J31 A;  4Y4L A;  4ZCD A;  2WP9 A;  2VVM A;  3GMC A;  2Y6R A;  2GR0 A;  1TDK A;  4K5S A;  2YVJ A;  4J34 A;  2BYB A;  3VRD B;  1FL2 A;  5KOW A;  3SZ0 A;  4TM1 A;  4UDQ A;  1JOA A;  4GDE A;  2C75 A;  3HZL A;  3M0O A;  4GAV A;  4RSL A;  4CNK A;  5CQF A;  3JSK A;  1PXA A;  3D1C A;  4H4R A;  3CIR A;  4Y4N A;  3BHK A;  1IUW A;  3UTF A;  2JB2 A;  2X8G A;  1GT8 A;  1REO A;  3IF9 A;  4PAB A;  4USQ A;  1GTE A;  3ICS A;  2ZZC A;  1GRH A;  2WET A;  5KRQ A;  4U2T A;  2OLN A;  3NK0 X;  2PHH A;  5GSN A;  1XAN A;  2QA2 A;  2BAC A;  1FOH A;  4EQX A;  3EF6 A;  4KX6 A;  3Q6J A;  2F5Z A;  3BI4 A;  4ECH A;  4A9W A;  2EQ8 A;  3KPK A;  1B5Q A;  1CF3 A;  4JNA A;  2XFQ A;  2GVC A;  1H84 A;  2JKC A;  3NYC A;  2WDV A;  1LQT A;  3SUC A;  2TPR A;  2Q0L A;  2WPC A;  2C7G A;  2FBW A;  1FEC A;  4I59 A;  4H4V A;  3EAN A;  3RHA A;  2BK5 A;  2X3N A;  4OPC A;  1D7Y A;  5HXI A;  1CC4 A;  2WPE A;  2WDQ A;  1MOK A;  4J33 A;  3T2Z A;  4APN A;  1MXT A;  3QFB A;  3PS9 A;  1PJ7 A;  3GDN A;  1S2Y A;  3NTA A;  4G6H A;  5M0Z A;  3ICT A;  2BCP A;  2GAH B;  3AE3 A;  3UKL A;  1YQ3 A;  2X8C A;  2WU5 A;  1COY A;  2C3C A;  3NGC X;  2Q0K A;  3CPH G;  5EOW A;  4ADW A;  4Z2R A;  2BK4 A;  1JNZ A;  3FBS A;  3GD3 A;  4D04 A;  3AE1 A;  4XWZ A;  1NAA A;  1PBB A;  3D8X A;  4G9K A;  2JBV A;  2JAE A;  3VR8 A;  4NNJ A;  2GMJ A;  3AYL A;  3EAO A;  2OAL A;  2X99 A;  1F8R A;  4OPU A;  2GR2 A;  2GV8 A;  2VRM A;  3CND A;  4BK1 A;  2WU2 A;  1CHU A;  1KNR A;  5ER0 A;  1Q1R A;  4YSH A;  1PDH A;  1BGN A;  3UOV A;  4BJZ A;  3CNT A;  1GEU A;  2TMD A;  3DJD A;  4H2N A;  1E1M A;  1LV0 A;  4K7Z A;  4A99 A;  1N4U A;  2DKH A;  1CC2 A;  5FMH A;  3AE5 A;  3VRB A;  1XPQ A;  2B9Y A;  3NN0 X;  4OPI A;  1B4V A;  1H86 A;  3P4S A;  3K7Q X;  2C73 A;  2BK3 A;  4H4W A;  5J60 A;  1HYU A;  4GR1 A;  2GR3 A;  4DGK A;  4BK2 A;  4C77 A;  2XLT A;  1ZP0 A;  3ALL A;  2W0H A;  2NVK X;  2C70 A;  5BVA A;  2CDU A;  4H2P A;  1O95 A;  3SFD A;  2R0P A;  1LQU A;  3UOX A;  4X9N A;  3L1R A;  1IUT A;  1TYT A;  3K7M X;  4LII A;  4B65 A;  2XFN A;  4LA1 A;  4H2Q A;  3G5S A;  4EIP A;  2A8X A;  2C66 A;  2QAE A;  1TDO A;  2C65 A;  1PN0 A;  3C96 A;  3HYW A;  4DSH A;  5BRT A;  2GQW A;  2CVJ A;  3T37 A;  4BUR A;  2YLX A;  3ATR A;  4A79 A;  2FJE A;  4EIQ A;  4BJY A;  1B8S A;  3T2Y A;  1S2Q A;  4NTC A;  1GXF A;  1H6V A;  3UOY A;  2APG A;  5TR3 A;  3GWF A;  2B9W A;  1KF6 A;  4K5R A;  5U1O A;  3AYI A;  4NEV A;  3DA1 A;  4U8L A;  2FJD A;  4UDP A;  4REK A;  2YLW A;  3DK4 A;  1DXL A;  1GRG A;  1L0V A;  3SY4 A;  1NG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...