3VR8A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
613
structure length
613
Chain Sequence
b'AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 206
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr8A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr8A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr8A04
1P2HA 1EL9A 1N1PA 4NZHA 4U8MA 3P4RA 2C3CA 1E7PA 2EQ9A 4EQXA 2BXSA 1ZOYA 1QJDA 3GYIA 4H2NA 1NHQA 3RNMA 3EANA 1GTHA 1VG0A 2R4EA 2JAEA 1L0VA 4J34A 3PS9A 3CN8A 2XFOA 4YSZA 3DMEA 3AE3A 3JSKA 3QSMA 4J2WA 4OPLA 4GRTA 2GR3A 1PBCA 3RHAA 2GB0A 1FEBA 1K0IA 4Z2RA 1B37A 4YT0A 3AEDA 1ZOVA 4REKA 1YQ4A 3T37A 1YY5A 5IQ1A 1PBDA 1EL5A 2YLZA 3QFBA 1GETA 5FS8A 3UOYA 3EAOA 3V76A 4A6NB 3M13A 3UKHA 4BJYA 3NN6X 4U8NA 3VR9A 1TDNA 2X8GA 3IHGA 2WQYA 4X9NA 3NK1X 2YR5A 3F8DA 3V3NA 4A79A 2EQ7A 3GDPA 4IVOB 4U8PA 1D4DA 1PXBA 4DNAA 1OJAA 3ATQA 2WP6A 3NN0X 5U1OA 2YM1A 4KPRA 3UTGA 4EQWA 3LADA 1CJ4A 1TDEA 1ZDLA 5U25A 1E1NA 5IQ4A 2C66A 2GQFA 3AEEA 1GRGA 1FECA 1JRXA 4EIQA 2FJAA 2X50A 4RG3A 3ZYXA 3ALMA 1BGNA 1W4XA 4C77A 1Y56B 4A6NA 4JDRA 3CGDA 4OPDA 1IUSA 2V6OA 3AEFA 2XVEA 3II4A 1EL7A 4IVMB 4Z2TA 1GERA 1CC4A 1D5TA 2X3NA 1N4VA 4ZCDA 2QA2A 5BUKA 2WPFA 1Q1WA 3NNEA 3CPJG 2WU2A 1XDIA 5C2TA 3DH9A 2AAQA 2Z5YA 3BI2A 3FPZA 3SQPA 2Y6QA 3UKLA 2R46A 1L9EA 1SEZA 4XWRA 3AB1A 3C4NA 2YG3A 3SM8A 3B6DA 2XFUA 1F8WA 3NHOX 2RGOA 1D7LA 3DJGX 1DODA 3ISHA 1VQWA 1GXFA 2DKHA 1ZX9A 3F8PA 3LZWA 2H88A 1JNZA 2EQ8A 3AXBA 4NTEA 2DKIA 1JOAA 3AEAA 3CNPA 1IUTA 3LOVA 1KNRA 3UTFA 5EOWA 1NAAA 4O5UA 4WCTA 1JEHA 2XLTA 4Y4LA 2R0PA 2GQWA 1LTXR 1KNPA 2GR2A 3NGCX 3DK9A 1QO8A 3AYJA 3QSEA 2YR4A 3VQRA 1PJ7A 1E1MA 3NK2X 3KU9A 3FMWA 1F6MA 1DNCA 3LJPA 2BK5A 5BVAA 3KD9A 3CTYA 1KSUA 3EF6A 5HY5A 2B7RA 4TM1A 1GREA 2WPEA 2YM2A 3AE9A 1QLBA 3DJEA 1GNDA 5BRTA 4K7ZA 1AOGA 5BULA 3GRTA 4H4SA 2GMJA 1D4CA 3GQKA 3QVPA 2Q0LA 1BGJA 1RYIA 4HB9A 4USRA 3QSSA 4YWOA 1GRBA 3AE7A 2FJDA 1O94A 2QA1A 2XLUA 4JY3A 4AP1A 3CPHG 2VQ7A 3CPIG 4BK1A 3SUCA 2BACA 2XLSA 2WOIA 3M12A 4A99A 4AOSA 1CJ3A 5GSNA 3K30A 1ELIA 2QCUA 4D04A 5EB5A 4B69A 1OJTA 2R9ZA 1ZMCA 2C73A 2XFQA 2CVJA 3C96A 3G5QA 4LA1A 2F5ZA 4A5LA 4KX6A 4Z44A 4Y4MA 4YSYA 1EL8A 2APGA 2XVJA 3UP5A 5JCNA 3DK8A 2CULA 1LQTA 4AT0A 4EM4A 4Z43A 1XANA 4OPIA 3ICRA 1H7WA 2R0CA 1FOHA 5CQFA 4BJZA 3IF9A 2B76A 2V3BA 1ZKQA 2YLRA 4U2SA 3K7QX 3UKFA 4A65A 2XVFA 5KOXA 2WDRA 3AE6A 4J31A 1VDCA 2VRMA 4ICYA 1ZMDA 2BCPA 4OPTA 2WESA 4EQRA 3P4QA 2C67A 4HA6A 4EMIA 4K2XA 2WOWA 3RP7A 1GEUA 1Z6LA 3CGEA 4Z25A 1LPFA 2OLOA 2C70A 3VR8A 2O9ZA 1DJQA 1NDAA 2AR8A 1VRQB 2Z5XA 3NTAA 4FDCB 4U8OA 4APNA 2HQMA 1S2YA 4O5QA 3AYIA 3ZDNA 4YTPA 1PBEA 2LFCA 2Y6RA 3CNJA 3VRBA 4C5OA 1NHSA 1ZK7A 2YAUA 3CGCA 3IC9A 4OPGA 3B3RA 5M10A 2VVLA 4B64A 2YG7A 5LV9A 1NHPA 1PDHA 4K8DA 3VRAA 4CCQA 2ZZ0A 3SFDA 3URHA 4U2TA 2YLSA 3GMBA 2RABA 1COYA 3AECA 1F3PA 4YKFA 2GVCA 3GWFA 3GYXA 2WP9A 4UDRA 4WX1A 1E39A 5U63A 4B68A 3D1CA 2JK6A 1V59A 1NEKA 2FJEA 2WDVA 1F8SA 4A7AA 4K22A 4RSLA 1IUUA 2R4JA 2WP5A 4GDEA 2QAEA 4H4TA 4FK1A 4YKGA 2YVGA 3CNDA 4K5SA 4RG4A 5FMHA 4PABA 2GR1A 2YVFA 2ACZA 4UP3A 4IA5A 4XWZA 3VRDB 1GTEA 4EQSA 3DGZA 1IUXA 3S61A 2RGHA 4OVIA 2YG5A 4J36A 5FS6A 2BS4A 5C3JA 1LJ1A 1S3BA 4JY2A 1PJ5A 3DGHA 4BURA 3GQHA 2VZ2A 3CGBA 3CNTA 3KKJA 5J60A 1X31B 2V5ZA 2BXRA 3UCLA 1CJ2A 5KVHA 2B9XA 1JRYA 1N4WA 3Q9TA 4JQ9A 2GRTA 3AEGA 2VVMA 2VQBA 2R0GA 4TM4A 3NYFA 1YKJA 3OC4A 2XYOA 1L9CA 2B9YA 2GH5A 4H4VA 4LIIA 1PN0A 1DJNA 3AD9B 3ATRA 3NIXA 5HHFA 2ZZBA 3ADAB 3E1TA 1ZY8A 1GESA 1FCDA 1LV0A 3DA1A 3REDA 5KVIA 1PS9A 2GEWA 1H84A 4EM3A 2JB1A 3FBSA 2E1MA 2YVJA 1VG9A 4NTDA 4CNKA 1K0JA 2GMHA 2V61A 3BHFA 1NG3A 4H7UA 4OPCA 2XVIA 3GRSA 5ER0A 1GRHA 2H89A 2W0HA 1TRBA 1DXLA 3NLCA 4H50A 3AE4A 2C65A 4H4YA 4EMWA 4CY8A 4MJWA 4M52A 2BYBA 2BC0A 3UKPA 3ABVA 3Q6JA 4JNAA 1H6VA 4B67A 1FEAA 4GF7A 2NPXA 1PXAA 4CNJA 1M6IA 1RP0A 4YSXA 3UTHA 4GCMA 5FS7A 1IUVA 2CFYA 3H4KA 3ALJA 4D03A 1CF3A 4CBQA 1EBDA 2JBVA 5JCKA 5KXJA 2WPCA 3HZLA 2C7GA 5JCMA 2WEUA 3L1RA 3COXA 4N9XA 2XFNA 2I0ZA 2J3NA 3BNMA 2ZBWA 4GUVA 4JNQA 4EMJA 4C3YA 1D4EA 2A87A 2BK3A 2C72A 4FX9A 5FS9A 1H7XA 5KRQA 1GV4A 3FG2P 3P9UA 4B63A 2JB3A 2WS3A 4ECHA 1H83A 2YQUA 3NKSA 4U8LA 2GAHB 3UKKA 2YG6A 1H82A 2YLWA 4H4ZA 4OPUA 2YWLA 4GDPA 3UKAA 1L9DA 3UOXA 3S5WA 3G5SA 3KPFA 2TPRA 5GRTA 4UDQA 1GALA 4TM3A 3ALLA 2WDQA 1CL0A 2AQJA 5JCIA 4U8JA 1TDFA 1GRAA 1CJCA 1XPQA 1NG4A 1KF6A 1Y0PA 3GYJA 1GSNA 1NHRA 2X8CA 4CCRA 1JU2A 1OJCA 4I59A 4NTCA 3QJ4A 4J56A 3DK4A 2XFPA 3K7TA 1H81A 4U2LA 4H4RA 2WU5A 1MXTA 1OJDA 3P4SA 3NG7X 4U8IA 4BV6A 4Z2UA 2C64A 4ADWA 3AE1A 2YG4A 5JCLA 3I3LA 1K0LA 4H4XA 1XHCA 4H4UA 2GV8A 3KLJA 2Q0KA 3F8RA 4H4QA 1ONFA 2BC1A 2VVLG 2FBWA 1REOA 5TR3A 1JNRA 1M64A 2ARDA 3BI4A 3AE8A 3V3OA 1E1KA 1TYTA 2C75A 1HYUA 1UKVG 2XLRA 2X8HA 1GOSA 3G5RA 3M0OA 1PJ6A 2GF3A 1N4UA 2YR6A 4NEWA 3ICTA 5HXIA 1YQZA 3GDNA 3IWAA 4Y4NA 1OJ9A 3WE0A 3D8XA 4H4PA 4XXGA 4A9WA 1S2QA 2XLPA 1DOEA 5EB4A 2JKCA 3AE2A 2A8XA 3NYCA 3IHMA 2BA9A 5KOWA 2TMDA 1BKWA 4EIPA 4TLZA 2OALA 1GT8A 2E5VA 2BABA 1B8SA 4UDPA 4TLXA 3SGLA 1CHUA 5IPYA 4LU6A 1H86A 4BK3A 1BZLA 2XCGA 4ZN0A 4J57A 3H8IA 1B4VA 3EPTA 3AWIA 3GD3A 4CRTA 3GWDA 3LXDA 1KDGA 4OCGA 1LQUA 1RSGA 4H2RA 3QVRA 4FK1C 1B5QA 3O0HA 4YSHA 1GPEA 2X99A 4H4WA 1CC6A 1Q1RA 2OAMA 4X4JA 4B65A 1YQ3A 4DSHA 2IIDA 4USQA 2YLXA 1E1LA 1IJHA 2XDOA 3I6DA 1CBOA 3OZ2A 3ICSA 4U8KA 5M0ZA 1NENA 1CC2A 2PYXA 1TYPA 2Q7VA 3RP6A 2CDUA 3AD7B 2YLTA 1E6EA 3FIMB 4P9SA 1Q9IA 1Y56A 2BK4A 3UTEA 3SFEA 4AP3A 3KA7A 4C3XA 5HYMA 2C76A 2ZZCA 3R9UA 3LZXA 3QFAA 3UOZA 2JB2A 3LB8A 5KWFA 3KVEA 2V3AA 4TM0A 1O5WA 3NH3X 3RP8A 1LVLA 4YTNA 2B9WA 4B66A 2C3DA 2GR0A 1TDKA 1GRFA 2BS2A 2XVHA 4YTMA 4AOXA 4I58A 3DJJA 4IA6A 2Q6UA 3C4AA 4K5RA 3ITJA 5EBKA 1BWCA 1DOCA 3GSIA 2V60A 3BNUA 2IVEA 2GAGB 3BI5A 1NPXA 2OA1A 2VOUA 3K7MX 3BHKA 3CNSA 2B7SA 1PXCA 1S3EA 2NVKX 3NK0X 4C74A 3P4PA 2BS3A 1KSSA 2EQ6A 1PHHA 5DBJA 4DGKA 3AE5A 1KFYA 2VRLA 1P2EA 3PVCA 2FJBA 5CKUA 4CY6A 1BF3A 3H8LA 2IVDA 2WBAA 2OLNA 4B1BA 1TDOA 1JRZA 2BCGG 2RGJA 3PO7A 4J33A 4ZCCA 3UOVA 2WOVA 1IUWA 4DSGA 1MO9A 1K4QA 3NYEA 3AYLA 3P1WA 3UKQA 2WETA 1FL2A 5J7XA 4BK2A 1PBFA 4NEVA 1ZP0A 1GRTA 1O95A 4IV9A 3UP4A 4H2QA 4YXDA 2WHDA 4AT2A 1D7YA 1DOBA 4H2PA 3CIRA 4JN9A 3GMCA 2A89A 2PHHA 1PBBA 3NT6A 3NTDA 4X9MA 2UZZA 2R45A 3DJDA 3AD8B 3GD4A 3NRNA 4GR1A 3AEBA 1MOKA 4Z26A 1F8RA 4PAAA 4Z24A 4E0VA 5L46A 3L8KA 2E4GA
chains in the Genus database with same CATH superfamily
5LBQB 4NZHA 3RX6A 2C3CA 4EQXA 1ZOYA 4H2NA 4AKHA 1VBB4 2XQ8A 3SS1A 2HN1A 2R4EA 3PV0F 2I59A 2ZLYA 2X9YA 2ZMAA 3OBVE 4LF5T 4YSZA 3JSKA 3QSMA 4J2WA 2VWAA 3OJAA 2GR3A 3RHAA 1XI1A 4Z2RA 4DR4T 4TWFA 3T37A 5IQ1A 2YLZA 1MNDA 3V76A 1XMQT 3M13A 4BJYA 4U8NA 3VR9A 4JV5T 1TDNA 2OV9A 2X8GA 2WQYA 4PFOA 4DBRA 1XDOA 4X9NA 3NK1X 3V3NA 3T2YA 1COV4 4GB34 2X0HA 3Q5XA 1MNEA 3UTGA 4EQWA 4HFHA 1E1NA 4HTEA 3C4ZA 1FECA 4IT4A 1QUUA 4X1KE 3SOLA 3ZSSA 4JDRA 3CGDA 2NR4A 2PBIA 4OPDA 3AEFA 4AQGA 4OYKA 2QA2A 2WPFA 2BG9A 1Q1WA 2WU2A 3DH9A 3CX8B 3SQPA 3BQKA 1U4QA 2VQFT 4Q25A 4B3ST 5AQNB 2RGOA 3HL6A 3KV9A 5KX5E 1DODA 2F4VT 3ISHA 1G73A 3MXZA 1GXFA 5ABFA 4X64T 5EOWA 4GYSA 3G06A 2CRBA 2X66A 1LTXR 3BK9A 5F8PA 3N9LA 5FXVA 2YR4A 5J2TE 1PJ7A 3KU9A 1F6MA 1DNCA 1HXS4 4TUYE 2BK5A 2R064 4LF7T 3VKHA 4TM1A 2DI4A 2YM2A 3AE9A 4H63V 1IAPA 4IE7A 3DJEA 2X67A 3VHLA 4O8SA 5AQTB 1EV14 1D4CA 2C4CA 2YDSA 1BGJA 3N9MA 1RYIA 4HB9A 4YWOA 4YJ2E 2VK9A 2QA1A 4GOUA 4ILBA 2WOIA 3CQGB 4AOSA 3MZKB 3K30A 3Q5WA 5EK4A 1FJGT 5HEHA 5AQHB 2XFQA 3C98B 4MALA 2VASA 4Z44A 2CM0A 4YSYA 2XASB 1EL8A 2APGA 2XVJA 3CQXC 5HXRA 2NW8A 2UXXB 4ZZCA 4IE4A 2IW5B 4EM4A 4Z43A 3ICRA 4G74A 2B76A 4U2SA 3UKFA 2XVFA 4J31A 1VDCA 1ZMDA 2RS14 1HFAA 1VRBA 1HX8A 3LK3B 4RHV4 4K2XA 2LE8A 1Z6LA 3CGEA 3OYXA 1LPFA 4I43B 4PDWD 2OLOA 1MMAA 1DJQA 2AR8A 2NW9A 4U8OA 2XJ7A 2W0GA 1PBEA 4TZ4C 2D5UA 1NHSA 2NW7A 3B3RA 5M10A 2VVLA 4JYAT 2CBIA 2E5LT 4JI6T 4Z91A 5HXSA 3VRAA 1GQEA 2XM2A 5DQWA 2ZZ0A 3SFDA 4U2TA 2YLSA 4EAHA 1COYA 3RIUC 4YKFA 2GVCA 3GYXA 4H9SE 3DTOA 1OXZA 1V59A 2BRYA 4PNIA 1NEKA 2FJEA 5ABGA 4FI5A 1D0XA 2XPKA 4A7AA 4RSLA 1IUUA 2WP5A 2KLQA 5AQSB 4DNDA 4FK1A 1AJ3A 3ZJ1A 4UVCB 4PABA 3RC8A 3TLUA 4IA5A 1GTEA 3DGZA 1IUXA 2D0UA 1HNZT 2YG5A 1H8TD 5C3JA 1S3BA 4N78D 4A5XA 4BURA 3CGBA 3CNTA 1X31B 2IMLA 3Q9TA 4JQ9A 3AEGA 3JC6C 3QOFA 5L47A 2XYOA 2GH5A 3A8YC 3ATRA 2ZZBA 2V26A 4O4IE 1FCDA 1LV0A 2KZ7B 1UURA 4EM3A 5LB7B 2BDEA 1VG9A 5LHHB 5KDMC 4IE0A 3BHFA 3PE0A 3GRSA 4HFIA 3O9XA 1GRHA 5AQQB 3MJXA 3PJAJ 5L4EA 3Q2MA 4MJWA 4M52A 1YKHB 2DWKA 3ZYKA 3Q6JA 1PXAA 4GCMA 2YINA 3PURA 4CBQA 1EBDA 2JBVA 1B7TA 1PVC4 2ZM2A 3HZLA 1OEDC 5LCYA 2C7GA 5JCMA 3COXA 1IBMT 2V5DA 3UFEA 2I0ZA 5JR9C 3BNMA 4GUVA 4JNQA 4C3YA 1H7XA 1Y64B 5HCJA 2WS3A 1H83A 2HPLA 3NKSA 3UKKA 2YG6A 4JI5T 4AQFA 2YLWA 4IDPA 4KP3C 3S5WA 3G5SA 2V7IA 4DV3T 3H3AA 3LK42 4TM3A 2WDQA 1LVKA 1SUMB 2XQ6A 3EABA 4X20E 4U8JA 2JMKA 1NHRA 4CCRA 4I59A 1T8BA 3QJ4A 2VB6A 2XFPA 4U2LA 3LBXA 3SWHA 1OJDA 3NG7X 4PJLA 2XQ4A 2W4XA 4BV6A 3PUWF 2OLTA 4CQIA 3T31A 4H4XA 4PFPA 4HE8A 2HPJA 1REOA 1T7SA 1JNRA 4QXHB 1M64A 3CMLA 3AE8A 3BI4A 5AQUB 1DU2A 1GOSA 4O4LE 3M0OA 4V1Av 1PJ6A 1N4UA 3ICTA 5C8YE 4WYVA 3IWAA 2DHRA 4A9WA 2RPAA 1S2QA 1DOEA 4QKNA 4AI6A 3OVUA 5AQOB 1D0YA 1YKEB 2YEVC 4UVAB 4LU6A 2W67A 2XCGA 2RP4A 3X1DA 4HGAA 4J57A 3H8IA 3P50A 2V7KA 5ABEA 3ZN1B 2WM9A 3PUGA 4U72A 4Z90A 1LQUA 4H2RA 5JRCB 4X4JA 1Q1RA 1YQ3A 2IIDA 4G73A 1E1LA 3I6DA 5HEUA 2JQKA 1CBOA 4U8KA 5M0ZA 1CC2A 1TYPA 1E6EA 4P9SA 3WAJA 5HEGA 4AP3A 1T72A 2XAQB 4C3XA 2C76A 2V5CA 2JB2A 4WNKA 5KWFA 2VVSA 1LVLA 3M65A 5E0OA 2C3DA 2GR0A 1TDKA 4E7ZA 1GRFA 1X9BA 4YTMA 2Q6UA 2C5IT 4K5RA 5FMNA 2V60A 4GAVA 2GAGB 3CNSA 4ISSA 4LMJA 2BS3A 2X0YA 5JDHA 1KFYA 5CKUA 2FJBA 2K9AA 2WZIA 4B1BA 2RGJA 4Z2TA 3TLVA 3I0OA 4U7IA 2CLYB 3PU3A 4BK2A 3T14A 3JAEA 1GRTA 1VBE4 4IV9A 3JBG4 4A97A 4H2QA 2K48A 2V7LA 1D7YA 4F8HA 5DABA 2PHHA 4YHJA 4YHHT 2UZZA 2C5KT 3AD8B 3GD4A 2XTLA 5AQMB 1EL9A 1N1PA 2PYLA 3JADA 1I6ZA 4O4HE 2KWIB 2BXSA 1QJDA 1V9DA 3EANA 3C64A 4QH1A 2NWBA 1VG0A 4UXNB 1WR6A 2LSIA 2RA1A 3AE3A 3NZPA 5DQVA 3DMEA 3AA7B 1SA0E 1N32T 3HR0A 1B37A 3AEDA 1ZOVA 4KI0F 4ZS2A 1YY5A 2OA5A 4X1YE 1I94T 1PBDA 3QFBA 4EEBA 5FS8A 3UOYA 2CEAA 3EAOA 4A6NB 3UKHA 1IZNB 1KNZA 1XWMA 3N2KE 4A79A 3GDPA 3C50A 3HYXA 4DNAA 4PW8A 4QWNB 1EZ3A 4ZOLE 4O2AE 3LADA 1BR4A 1HRV4 4U7YA 2GQFA 1GRGA 1M7KA 3UUNA 4H9QC 3FZHB 1W4XA 4C77A 1RUC4 3P4WA 3QB5K 1OWAA 1EL7A 4B6XA 4ASKA 1CC4A 1D5TA 2XAFB 3PU8A 1N4VA 3F31A 4YLHA 5BUKA 3KV4A 4PK5A 3CPJG 3CX6B 3FZMB 3BI2A 3FPZA 4FJOA 1SEZA 1WFDA 3AB1A 5AQGB 3T1HT 2A2FX 2YU2A 3RGLA 4ISTA 3F8PA 4U2ZA 2EQ8A 3AXBA 1JOAA 2XQYA 5AQKB 2PY5A 1KNRA 3UTFA 4WCTA 5JR9B 4Y4LA 3QNUA 4HFEA 3NGCX 3QUJA 5CGMA 2ZM0A 1QO8A 3AYJA 2C0SA 3QSEA 3VQRA 3NK2X 2YN6A 3FMWA 3LJPA 4DUZT 5BVAA 1AR74 2LM2A 1KSUA 3EF6A 2B7RA 4UIGA 1WRDA 1GNDA 3IF8B 4JEHB 4K7ZA 1AOGA 2X68A 2GMJA 3RYFE 4XAXB 2XUEA 2Q0LA 4X65T 2JQQA 3I1AA 3QSSA 1GRBA 2LOSA 2CMRA 3AE7A 2FJDA 1O94A 4AP1A 2VQ7A 2WBLA 4TNVA 1CJ3A 2MOZA 1IBLT 1ELIA 2QCUA 2KT9A 2E9XC 5EZYE 3EUHA 2LSGA 4A5LA 3UP5A 2XQ3A 3ZYLA 3SY4A 1RHI4 4DV6T 2LKHA 3ZMSB 4Q4X4 2J47A 3K3OA 1XANA 4OPIA 1H7WA 2R0CA 2A9UA 1FOHA 3IF9A 2N9DA 2V3BA 4H9OC 5LXTE 2VRMA 2BCPA 2IIUA 2VVNA 3W15B 2UXDT 4EQRA 2PW9A 1VCSA 3ZC0A 3ESLA 2C67A 4HA6A 3RF1A 2W62A 1QSDA 4J2CA 3N5LA 1GEUA 1AL24 4P0BA 5LP6E 4AKIA 2C70A 3VR8A 2XAHB 4AIUA 2H7OA 3NRYA 3BQLA 1VRQB 2Z5XA 4FDCB 3AB3B 1S2YA 2X51A 2HQMA 3V5UA 1HG5A 3UULA 1W0AA 2YAUA 3SYIA 2N2NA 4B64A 4HWFA 2AE9A 4QH5A 1PDHA 2BZBA 1XHZA 1MIVA 2RABA 3CQCB 2XM1A 2VL8A 5FVKA 2WP9A 3SX6A 4B68A 4NIQA 2JK6A 3ZMTB 2WDVA 1XNRT 2JRKA 4RG4A 3Q5EA 2IHR1 1HNWT 2ACZA 3VRDB 1O3XA 4EQSA 1AR64 1OEDE 3HKCE 4OVIA 5IWAT 4J36A 5FS6A 2BS4A 1LJ1A 1PJ5A 5FP3A 4DR6T 4OYJA 1BEV4 2BG9C 3UCLA 5KVHA 2B9XA 1JRYA 1N4WA 3ANWB 2VVMA 2VQBA 2R0GA 4TM4A 1IJ5A 5LJNA 1YKJA 4H4VA 2EHOA 1XNQT 5HHFA 3ADAB 3E1TA 2X5ID 1YD8G 2UUCT 4U3CA 1MMNA 2BRAA 3ETUA 3FBSA 2YVJA 4CNKA 1K0JA 2WB5A 2GMHA 3SRZA 4KHZF 4OPCA 2XVIA 5JRCA 3ZT7A 3GN5B 5FY0A 3RKGA 5ER0A 5JVDE 2W0HA 1TRBA 1DXLA 3NLCA 4H50A 2C65A 4H4YA 3RYIE 3RH3A 3UKPA 4OK0A 3ABVA 3ZCIA 4B67A 4IE5A 1FEAA 4GF7A 4CNJA 1M6IA 2M6BA 4YSXA 4IREA 1IUVA 4D03A 4ZI7E 2WMOA 4U2YA 3D0TA 5KXJA 1RUG4 2YU1A 3K8PC 4CN6A 2K3WA 1XHXA 4AKLA 2V6YB 4EMJA 2ZBWA 4OFZA 3N9OA 5KRQA 1RUE4 3FG2P 4B63A 3KVBA 2JB3A 3AXJB 4UEMA 5L3GB 2JJ9A 2GAHB 4OPUA 2YWLA 4EXTA 4GDPA 5ETWA 3ZCJA 1L9DA 3UU4A 2NTXA 3GWHA 5HAXA 2AQJA 4DBQA 2BKOA 1NA1D 4EOZB 4UV9B 1TDFA 1UK5A 2H3RA 5HEOA 5A1LA 3N9QA 5F3JA 3GYJA 4HKAA 2X8CA 4H63H 3UU3A 1JU2A 4NTCA 4IDQA 1YW0A 2Y8DA 3ZJ2A 3K7TA 5H6RB 4BJMA 4H4RA 2WU5A 1MXTA 3P4SA 3ZYMA 4NWZA 2C64A 3UFGA 4ADWA 3AE1A 1RVF4 5CB4E 4TWHA 1XHCA 4H4UA 2GV8A 3KLJA 1ASJ4 3UUMA 1US7B 5TR3A 2ARDA 4ZI2C 3ZPOA 3V3OA 1E1KA 4GIWA 2C75A 1UKVG 2X8HA 5HXEA 3FHNA 5HXIA 4DUYT 3GDNA 4Q4V4 4Y4NA 5HEJA 3WE0A 3NVOA 2XLPA 5EB4A 4LFBT 2DCFA 3NYCA 3SZ0A 2JQ9A 1BKWA 1IBKT 3L8RA 3JC6D 3SXIA 1GT8A 4UDPA 2VKHA 2YOEA 1CHUA 3KV5A 2UXNB 3CMMA 4Q4W4 4ZN0A 3UUBA 1B4VA 3RYHE 2N1GA 3PUSA 1RSGA 2Q9QA 4MBQA 1B5QA 3QVRA 4QX8B 1GPEA 4FK1C 4YSHA 2OAMA 5AQLB 4AISA 4F6RC 4JI3T 1IJHA 3ZC1A 3ICSA 5J0ZA 3RP6A 2XSBA 3AD7B 3FIMB 3SFEA 3N9NA 2ZZCA 2NOXA 1LKXA 3O1JA 4PAGA 4TM0A 3V5SA 2PTFA 4L0RA 2XVHA 4AOXA 2FUPA 4I58A 1Y01A 3O4XE 4IA6A 5EK3A 3ITJA 5EBKA 1BWCA 3PUVF 5EK2A 1LVFA 2IVEA 1NPXA 2VOUA 5LGTB 1PXCA 3NK0X 4C74A 5DJQC 3AE5A 1ZEEA 2MTQA 2W63A 5FXWA 3ZSTA 3FZLB 1WYCA 2CBJA 1S35A 2I6HA 2WBAA 2OLNA 1JRZA 2BCGG 3PO7A 4J33A 4ZCCA 3FBLA 5CA0E 4ZI3C 3ZT5A 3AYLA 3UKQA 2H7VC 2WETA 4NEVA 2KMFA 3UP4A 3RI5A 2XY8B 2WHDA 2CHNA 3CIRA 3GMCA 4Q4Y4 3PUYF 4PJMA 3UU8A 2A89A 3NTDA 3ZT6A 1J5WA 2LSKA 2UUAT 2VQET 2R45A 1VBC4 3DJDA 3MACA 4GR1A 2K5BB 1YXRA 1MOKA 4Z26A 1AR94 3AA0B 3T0KA 3RRWA 3L8KA 2E4GA 5L46A 4IL4A 1P2HA 1RUF4 4LF4T 3T8OA 3RC3A 2EQ9A 2E8IA 4PJJA 3DJBA 3GYIA 1NHQA 3RNMA 1GTHA 3O1IA 4DR5T 2LSYA 4J34A 4AQFC 2XFOA 2JPFA 4OPLA 3U78A 2GB0A 2V8SV 1FEBA 1K0IA 2JMHA 5L3BB 3T2KA 4YT0A 1YQ4A 2YDQA 3SZCA 1EL5A 1U5PA 1GETA 2YR5A 3F8DA 1NWMX 2X0LB 4ZXLA 3NRXA 4IE6A 1D4DA 1OJAA 3ATQA 3NN0X 2BG9B 2YM1A 4KPRA 3PJAA 4I4TE 1CJ4A 2WWUA 3WI3A 1TDEA 5U25A 1R094 2C66A 4EIQA 1RUI4 4RG3A 3ALMA 2KXPB 1Y56B 1IUSA 2V6OA 3B5MA 2CPTA 3FB2A 1GERA 3N2OA 1UUSA 1PIV4 2KSRA 2X3NA 2RMU4 1W9RA 3IEEA 1R8IA 4PK6A 3NNEA 1ZV4X 4QH4A 1W0BA 4K0KT 1XDIA 5C2TA 2AAQA 2WMNA 3UKLA 1L9EA 5L4HA 4XWRA 4ZEYA 4ILAA 4DV4T 2YG3A 3SM8A 5LA6E 1D7LA 3DJGX 2WZHA 2UUBT 2Y6XA 4P0AA 3C4WA 5BR8T 1FEWA 1VQWA 2DKHA 1ZX9A 3LZWA 4TN7B 4NTEA 2DKIA 4I50E 3AEAA 3OPCA 1IUTA 4NUVA 3H3MA 3UQ7A 1JEHA 1E2AA 2DNXA 2GQWA 1KNPA 5FNVE 3WAKA 3FZFB 2V6XA 4G6GA 3KD9A 5IHYA 1MMDA 1PO14 3P7IA 5BRTA 5FYMA 5BULA 4H4SA 1WR0A 3ZMUB 3GQKA 3QVPA 1Z8UA 4USRA 4KUMB 2E2AA 3CX7B 3FI7A 4JY3A 3RPUA 4ZZBA 1VBA4 3CPHG 3CPIG 1XMOT 3M12A 4HFCA 2IDOB 4LFCT 4OHFA 4GK5E 4B69A 1OJTA 2R9ZA 2CCQA 5M4YA 2CVJA 3G5QA 4A98A 4QXCB 4UELA 4AKGA 3J7Yq 4OX9T 3T1YT 4Y4MA 3GN5A 4BAYB 2CULA 2MBGA 4AT0A 5CQFA 2YLRA 1WCRA 3K7QX 4A65A 5KOXA 2WDRA 3AE6A 4ICYA 3UU6A 5JREA 4WBNE 4OPTA 3BQIA 3LG7A 4EMIA 3K3QC 2WOWA 3RP7A 4Z25A 5JDQA 4O4JE 2BG9E 4O5QA 4MFRA 5HXCA 3J9X1 3AXJA 3ZMZB 2Y6RA 4C5OA 3CGCA 3IC9A 4OPGA 3UT5E 4TX5A 5LV9A 3LSVA 1NHPA 4DMVA 5LHGB 4K8DA 3URHA 3N9PA 2R7FA 5LGNB 2LHNA 1F3PA 4IHJE 3UQ4A 2IC9A 4O2BE 4WX1A 4HFDA 4G63A 2CXDA 4DIDB 1J1JA 1MIWA 1F8SA 4K22A 2Y48B 3FZKB 1HR0T 1VOMA 4C90A 4YKGA 3CNDA 1XDPA 2GR1A 2YVFA 4LF9T 4U31A 4ZHQE 5AQJB 5HCMA 4L9IA 1RMU4 1D0ZA 4NXNT 3AVRA 4KBMB 3ONJA 3DGHA 4COFA 5J60A 2XSAA 2CA5A 1OEDB 4H9NC 4I0UA 3TKLB 2RR14 3E22E 4DV5T 1L9CA 2B9YA 4LIIA 1PN0A 2ODUA 4P09A 3AD9B 4X5TA 2E9XD 3DA1A 1WYBA 5KVIA 1PS9A 3J8F4 2GEWA 3IA3A 5KMGP 3H37A 3AA6B 3R6NA 3RHWA 5GONE 4EEDA 4CI3B 5L3FB 3PUZF 2H89A 3MK7C 3AE4A 4EMWA 2BYBA 5FY7A 2YK0A 3N2GE 1N34T 2BC0A 4JNAA 1H6VA 3TLWA 3HA4A 2NPXA 1PO24 2XQ9A 3EVYA 2CFYA 2A3DA 3ALJA 1CF3A 3K1SA 4ERRA 4IIJE 2A72A 2QRXA 3HKEE 1VRH4 2D0TA 1NAFA 4E7SA 2J3NA 5KMPA 2C72A 2A87A 4XZCA 4FX9A 1GV4A 3T2ZA 3PUAA 4ILUA 5FXZA 3LBXB 2J62A 4QX7B 2WAUA 5JQGE 4AQYT 2KWHA 4U8LA 4H4ZA 5L3CB 4B3TT 1BR0A 2UXCT 2WCAA 3UOXA 4UDQA 3KBUA 5JCIA 1UGOA 5CFBA 2XQ7A 1GRAA 1CJCA 1NG4A 2MPKA 4QXBB 1GSNA 1WLXA 2M67A 4G2AA 4J56A 3DK4A 4IL9A 1D1AA 1UX5A 3OYZA 4U8IA 5HWYA 5BMVE 2YG4A 3I3LA 2XQ5A 2Q0KA 3F8RA 2BBJA 4JLEA 1ONFA 2VVLG 4EYUA 2XLRA 5J1GA 4JI0T 4NEWA 3CK6A 3QC9A 2QVAA 1YQZA 1OJ9A 4K0UA 4X1IE 5LOVE 3NKZA 3D8XA 4EB6E 2JKCA 2XZEA 3AE2A 3NWIA 2BA9A 5KOWA 2XHEB 4TLZA 1T98A 4GAPA 2E5VA 2BABA 1B8SA 4DMWA 1FMWA 3SGLA 5IPYA 5JH7E 1H86A 4HWCA 3AWIA 3GD3A 3LFMA 3LXDA 4EYYR 4OCGA 3UU5A 3L39A 4UF0B 2LSJA 3O0HA 2XQAA 2X99A 1K5MD 4USQA 2YLXA 2EHOD 4JI4T 3MA9A 2D9DA 1FMVA 1H7CA 4B3MT 2PYXA 2NP9A 2Q7VA 2YLTA 1Y56A 2BK4A 3UTEA 5HYMA 3KA7A 3R9UA 4IDOA 3LZXA 3QFAA 3UOZA 1HX1B 2V3AA 1XZYA 3RYCE 3RP8A 2DWGA 3PUQA 4QHOA 2B9WA 4B66A 4IDNA 3RQUA 2PJQA 3GMIA 1HS7A 2PYJA 3C4AA 3PUXF 5FKYA 4NNJA 4MHCA 5LNKA 2EHOC 3R84B 3GSIA 5F5WA 5FY1A 3BI5A 2OA1A 3K7MX 3BHKA 3AAAB 1S3EA 3U3IA 5DBJA 2UXBT 4DGKA 3ONLC 2XAGB 1J5ET 3KBTA 3PVCA 1HRI4 4CXWA 1D1BA 1BF3A 3H8LA 2IVDA 3UTKA 1TDOA 5LG3A 2WOVA 2PG8A 1HG2A 4UR9A 5AQIB 4GYRA 1FL2A 5J7XA 1PBFA 4PJNA 1O95A 4TWDA 4YXDA 4DR3T 4AT2A 4HFBA 1PBBA 3NT6A 2Z6EA 4U74A 3NRNA 3EDUA 3AEBA 4PAAA 2KNDA 4ZI2D 4Z24A 3HI2A 1HNXT 4GK0E 3DP7A 4U8MA 2LOPA 3C4XA 3P4RA 2X9XA 1E7PA 4DV7T 4CI1B 1RUH4 2JAEA 1L0VA 1N36T 3PS9A 2L9QA 3CN8A 3NZQA 5KMQA 1KK7A 4GRTA 3L09A 1PBCA 4JI1T 4JUYA 2CLYC 4JEUB 5HXHA 5KMSA 2RS34 3C51A 1D4M4 4IGUA 1CUNA 4REKA 4NXMT 2HHHT 3AA1B 3RIUA 4CI2B 2K24A 3QB5A 3NN6X 2LEHA 3IHGA 2BKNA 4ILCA 2IUBA 2ODVA 2EQ7A 4IVOB 4U8PA 1PXBA 5U1OA 2WP6A 4YFSA 1IJ6A 3I9YA 1ZDLA 1N33T 5IQ4A 3AEEA 1JRXA 2FJAA 2X50A 5L3DB 3ZYXA 2R6GF 5CA1E 1BGNA 4A6NA 4IDZA 2XVEA 3II4A 4IVMB 4GKJT 2Q9QD 4ZS3A 4P1NA 2BKPA 4CZZB 4ZCDA 1HCIA 3FXDB 4BJNA 1HF8A 2BVMA 3P8CD 2Z5YA 2Y6QA 2R46A 3CWZB 3C4NA 2LM9A 3B6DA 2XFUA 2CWYA 1F8WA 3NHOX 2LRLA 3EDVA 3UUXB 5JDNA 2BVLA 2WY2A 2E9XB 2Q9QC 2H88A 1JNZA 4Z8XA 4ZI3D 1UX4A 3CNPA 3LOVA 4A56A 3EAMA 4HN9A 1NAAA 3SZWA 4O5UA 2M6IA 4JI8T 2XLTA 2R0PA 2IC6A 2GR2A 2VKOA 4PK4A 3ZEFB 3DK9A 4X66T 4CXYA 1E1MA 4DV1T 2VL0A 3F57A 3IHRA 2G0UA 3KFWX 2UU9T 3CTYA 5HY5A 5FVLA 1GREA 2WPEA 4XBFB 1QLBA 1OEDA 3EHZA 4EIWA 3GRTA 2VKDA 5JR9A 1BR2A 1KEYA 3QK6A 3IBPA 2XLUA 4BK1A 5JDLA 1RUJ4 3SUCA 4CXXA 2BACA 2XLSA 3VKGA 4YJ3E 4A99A 5GSNA 4D04A 4L5GA 5EB5A 3Q5DA 4HFVA 1ZMCA 2C73A 3C96A 3K3NA 2F5ZA 4LA1A 4KX6A 5J2UE 2I0MA 5JCNA 5JDGA 4AKRB 3DK8A 5LMUT 4TNWA 1LQTA 3HYWA 3RIAA 1AR84 2HWC4 4C91A 4BJZA 3CKDA 1ZKQA 2DLRA 1RUD4 3EI0A 3OTOT 1SE7A 2B1EA 4KHPT 2WESA 3PTRB 3P4QA 3RQWA 2BBHA 3KDSE 2O9ZA 1NDAA 5LGUB 3NTAA 4APNA 4JI2T 3AYIA 4TV9E 3ZDNA 4YTPA 2LFCA 3CNJA 3VRBA 2J1DG 5JDFA 1ZK7A 2YG7A 5IUXA 4CCQA 3JAFA 4LF6T 3GA8A 4UV8B 3GMBA 3AECA 4CN1A 4EZHA 3GWFA 2LJLA 4UDRA 1MMGA 3E08A 4LFAT 2ZM6T 1E39A 5U63A 3D1CA 2C5JA 2PLV4 3HKBE 2R4JA 4GDEA 2QAEA 2SPCA 1S94A 5AQPB 5ABFB 2YDRA 4H4TA 2YVGA 4K5SA 5FMHA 4ANJA 4UP3A 4XWZA 2EHOB 3S61A 2RGHA 3S4UA 4JY2A 4BA9A 1E1HB 4G9KA 3LJCA 4II3A 4LF8T 3GQHA 2VZ2A 5LJMA 3KKJA 3ONXA 5AQVB 1D1CA 2V5ZA 2BXRA 3HYVA 3TLSA 1CJ2A 5H6QB 3CVRA 2GRTA 5HWXA 3NYFA 2R074 4TV8E 3OC4A 2ES0A 3I0QA 1DJNA 2X9HA 3NIXA 3F2EA 1GESA 1ZY8A 2LT3A 2MYSA 3REDA 1MIYA 1H84A 2JB1A 4DR7T 4ADZA 2E1MA 4NTDA 3RLFF 4DR1T 5JDMA 2V61A 4UF0A 1NG3A 4H7UA 3B13A 2PFVA 1FIOA 2V1DB 5CJ5A 3KINB 1POV0 3ANWA 3MKDA 5FXXA 5LBMA 4CY8A 5AQRB 4GKKT 3RRCA 1RP0A 2R044 2CWOA 3UTHA 1Z7S4 2YKSA 5FS7A 2JIWA 3H4KA 2PZSA 4DVDA 4DV2T 5JCKA 4HEAA 2WPCA 5ADXL 2WEUA 4H9PC 3L1RA 3M3ZB 4N9XA 2XFNA 4NPPA 3VU7H 2QYWA 1D4EA 5FS9A 2BK3A 3A5XA 5ABHA 4LMKA 3P9UA 4ECHA 2YQUA 4I55E 1H82A 4EZ4A 1VCTA 1LRZA 4YY3T 3UKAA 3RIFA 2X9WA 3KPFA 2TPRA 5GRTA 1GALA 3ALLA 3SZFA 1MQTD 1CL0A 3Q9DA 3AAIA 3ZLIA 1OOPD 4MLKA 3JD74 2V6YA 3JCFA 1XPQA 1M62A 1KF6A 4AXPA 1Y0PA 1SHZC 1OJCA 5FL1A 1H81A 4II2A 4B3RT 2L3LA 4Z2UA 3CPZA 4M1PA 5JCLA 2DL1A 2WSSV 2RM24 4EV6A 1K0LA 4H4QA 5LG4A 4JI7T 2W66A 2BC1A 2FBWA 1EAH4 2XAJB 1TYTA 1HYUA 4WZXA 2V7JA 3L3PA 2NTYA 3G5RA 2MAWA 4U33A 2YR6A 2GF3A 1ZKEA 5FL0A 1W09A 4XXGA 4H4PA 2RS54 4HWDA 2A8XA 2Q9QB 3IHMA 5LMNT 4G6HA 1HTJF 5KNLA 2TMDA 4EIPA 2CXLA 2OALA 4TLXA 4BK3A 1BZLA 3NBXX 2EX3A 2LHRA 5L2LA 4WW0A 2W2UA 3EPTA 2LRKA 2VKJA 4CRTA 1R084 3GWDA 5JTGA 4EGWA 3ZN0B 1KDGA 3FXEB 4H4WA 2JQHA 3KV6A 3LK2B 5TAOA 2GK9A 1CC6A 4B65A 2KINB 4DSHA 2L8KA 2W00A 2XDOA 2CXFA 3OZ2A 2ACXA 1NENA 2CDUA 4DO0A 4CN4A 2CHOA 1Q9IA 2AXDS 3ETVA 3AVSA 3TLTA 5HYAA 3LB8A 3A7MA 5AQFB 3KVEA 4DR2T 2V7MA 1O5WA 1X79A 1Z0PA 3NH3X 4NUUA 4YTNA 4H9RC 4KMCA 4JBWF 2HWB4 1G8XA 2BS2A 5LYJE 3E0ZA 2HN2A 3PDYA 2J4GA 3RKOA 3DJJA 2LKGA 3AAEB 4HWIB 2IAKA 1VBD4 2HH7A 1DOCA 3BNUA 5LHIB 2B7SA 1UCUA 3LDQB 1ZHCA 3I9WA 3P4PA 2NVKX 1KSSA 2EQ6A 1PHHA 2LLYA 4WBOA 4X62T 2VRLA 1P2EA 2E9XA 4CY6A 2P9BA 3ZMVB 2QGSA 3UOVA 3HKDE 2CE7A 1IUWA 4DSGA 1MO9A 3FBZA 1K4QA 3NYEA 3B57A 3P1WA 3ZKRA 2WWVA 2ZM8A 4HWHA 5AFUL 1ZP0A 4LMLA 2D2SA 4UVBB 3O1HA 1NCQD 3OKQA 1BR1A 5IYZE 1DOBA 4H2PA 4JN9A 5KMRA 4X9MA 2VURA 5L3EB 1F8RA 3KVAA 4E0VA 3KPKA 2W61A 4DV0T 2QA7A
chains in the Genus database with same CATH topology
1P2HA 1EL9A 1N1PA 4NZHA 4U8MA 3P4RA 2C3CA 1E7PA 2EQ9A 4EQXA 2BXSA 1ZOYA 1QJDA 3GYIA 4H2NA 1NHQA 3RNMA 3EANA 1GTHA 1VG0A 2R4EA 2JAEA 1L0VA 5KMPA 4J34A 3PS9A 3CN8A 2XFOA 5KMQA 4YSZA 3DMEA 3AE3A 3JSKA 3QSMA 4J2WA 4OPLA 4GRTA 2GR3A 1PBCA 3RHAA 2GB0A 1FEBA 1K0IA 4Z2RA 3T2KA 1B37A 5KMSA 4YT0A 3AEDA 1ZOVA 4REKA 1YQ4A 3T37A 1YY5A 3SZCA 5IQ1A 1PBDA 1EL5A 2YLZA 3QFBA 1GETA 5FS8A 3UOYA 3EAOA 3V76A 4A6NB 3M13A 3UKHA 4BJYA 3NN6X 4U8NA 3VR9A 1TDNA 2X8GA 3IHGA 2WQYA 4X9NA 3NK1X 2YR5A 3F8DA 3V3NA 4A79A 3T2YA 2EQ7A 3GDPA 4IVOB 4U8PA 1D4DA 1PXBA 3HYXA 4DNAA 1OJAA 3ATQA 2WP6A 3NN0X 5U1OA 2YM1A 4KPRA 3UTGA 4EQWA 3LADA 1CJ4A 1TDEA 1ZDLA 5U25A 1E1NA 5IQ4A 2C66A 2GQFA 3AEEA 1GRGA 1FECA 1JRXA 4EIQA 2FJAA 2X50A 4RG3A 3ZYXA 3ALMA 1BGNA 1W4XA 4C77A 1Y56B 4A6NA 4JDRA 3CGDA 4OPDA 1IUSA 2V6OA 3AEFA 2XVEA 3II4A 1EL7A 4IVMB 4Z2TA 1GERA 1CC4A 1D5TA 2X3NA 1N4VA 4ZCDA 2QA2A 5BUKA 2WPFA 1Q1WA 3NNEA 3CPJG 2WU2A 1XDIA 5C2TA 3DH9A 2AAQA 2Z5YA 3BI2A 3FPZA 3SQPA 2Y6QA 3UKLA 2R46A 1L9EA 1SEZA 4XWRA 3AB1A 3C4NA 2YG3A 3SM8A 3B6DA 2XFUA 1F8WA 3NHOX 2RGOA 1D7LA 3DJGX 1DODA 3ISHA 1VQWA 1GXFA 2DKHA 1ZX9A 3F8PA 3LZWA 2H88A 1JNZA 2EQ8A 3AXBA 4NTEA 2DKIA 1JOAA 3AEAA 3CNPA 1IUTA 3LOVA 1KNRA 3UTFA 5EOWA 1NAAA 3SZWA 4O5UA 4WCTA 1JEHA 2XLTA 4Y4LA 2R0PA 2GQWA 1LTXR 1KNPA 2GR2A 3NGCX 3DK9A 1QO8A 3AYJA 3QSEA 2YR4A 3VQRA 1PJ7A 1E1MA 3NK2X 3KU9A 3FMWA 1F6MA 1DNCA 3LJPA 4G6GA 2BK5A 5BVAA 3KD9A 3CTYA 1KSUA 3EF6A 5HY5A 2B7RA 4TM1A 1GREA 2WPEA 2YM2A 3AE9A 1QLBA 3DJEA 1GNDA 5BRTA 4K7ZA 1AOGA 5BULA 3GRTA 4H4SA 2GMJA 1D4CA 3GQKA 3QVPA 2C4CA 2Q0LA 1BGJA 1RYIA 4HB9A 4USRA 3QSSA 4YWOA 1GRBA 3AE7A 2FJDA 1O94A 2QA1A 2XLUA 4JY3A 4AP1A 3CPHG 2VQ7A 3CPIG 4BK1A 3SUCA 2BACA 2XLSA 2WOIA 3M12A 4A99A 4AOSA 1CJ3A 5GSNA 3K30A 1ELIA 2QCUA 4D04A 5EB5A 4B69A 1OJTA 2R9ZA 1ZMCA 2C73A 2XFQA 2CVJA 3C96A 3G5QA 4LA1A 2F5ZA 4A5LA 4KX6A 4Z44A 4Y4MA 4YSYA 1EL8A 2APGA 2XVJA 3UP5A 5JCNA 3SY4A 3DK8A 2CULA 1LQTA 4AT0A 3HYWA 4EM4A 4Z43A 1XANA 4OPIA 3ICRA 1H7WA 4G74A 2R0CA 1FOHA 5CQFA 4BJZA 3IF9A 2B76A 2V3BA 1ZKQA 2YLRA 4U2SA 3K7QX 3UKFA 4A65A 2XVFA 5KOXA 2WDRA 3AE6A 4J31A 1VDCA 2VRMA 4ICYA 1ZMDA 2BCPA 4OPTA 2WESA 4EQRA 3P4QA 2C67A 4HA6A 4EMIA 4K2XA 2WOWA 3RP7A 1GEUA 1Z6LA 3CGEA 4Z25A 1LPFA 2OLOA 2C70A 3VR8A 2O9ZA 1DJQA 1NDAA 2AR8A 1VRQB 2Z5XA 3NTAA 4FDCB 4U8OA 4APNA 2HQMA 1S2YA 4O5QA 3AYIA 3ZDNA 4YTPA 1PBEA 2LFCA 2Y6RA 3CNJA 3VRBA 4C5OA 1NHSA 1ZK7A 2YAUA 3SYIA 3CGCA 3IC9A 4OPGA 3B3RA 5M10A 2VVLA 4B64A 2YG7A 5LV9A 1NHPA 1PDHA 4K8DA 3VRAA 4CCQA 2ZZ0A 3SFDA 3URHA 4U2TA 2YLSA 3GMBA 2RABA 1COYA 3AECA 1F3PA 4YKFA 2GVCA 3GWFA 3GYXA 2WP9A 4UDRA 3SX6A 4WX1A 1E39A 5U63A 4B68A 3D1CA 2JK6A 1V59A 2BRYA 1NEKA 2FJEA 2WDVA 1F8SA 4A7AA 4K22A 4RSLA 1IUUA 2R4JA 2WP5A 4GDEA 2QAEA 4H4TA 4FK1A 4YKGA 2YVGA 3CNDA 4K5SA 4RG4A 5FMHA 4PABA 2GR1A 2YVFA 2ACZA 4UP3A 4IA5A 4XWZA 3VRDB 1GTEA 4EQSA 3DGZA 1IUXA 3S61A 2RGHA 4OVIA 2YG5A 4J36A 5FS6A 2BS4A 5C3JA 1LJ1A 1S3BA 4JY2A 4G9KA 4II3A 1PJ5A 3DGHA 4BURA 3GQHA 2VZ2A 3CGBA 3CNTA 3KKJA 5J60A 1X31B 2V5ZA 2BXRA 3HYVA 3UCLA 1CJ2A 5KVHA 2B9XA 1JRYA 1N4WA 3Q9TA 4JQ9A 2GRTA 3AEGA 2VVMA 2VQBA 2R0GA 4TM4A 3NYFA 1YKJA 3OC4A 2XYOA 1L9CA 2B9YA 2GH5A 4H4VA 4LIIA 1PN0A 1DJNA 3AD9B 3ATRA 3NIXA 5HHFA 2ZZBA 3ADAB 3E1TA 1ZY8A 1GESA 1FCDA 1LV0A 3DA1A 3REDA 5KVIA 1PS9A 2GEWA 1H84A 4EM3A 2JB1A 2BRAA 3FBSA 2E1MA 2YVJA 1VG9A 4NTDA 4CNKA 1K0JA 2GMHA 2V61A 3BHFA 1NG3A 4H7UA 4OPCA 2XVIA 3GRSA 5ER0A 1GRHA 2H89A 2W0HA 1TRBA 1DXLA 3NLCA 4H50A 3AE4A 2C65A 4H4YA 4EMWA 4CY8A 4MJWA 4M52A 2BYBA 2BC0A 3UKPA 3ABVA 3Q6JA 4JNAA 1H6VA 4B67A 1FEAA 4GF7A 2NPXA 1PXAA 4CNJA 1M6IA 1RP0A 4YSXA 3UTHA 4GCMA 5FS7A 1IUVA 2CFYA 3H4KA 3ALJA 4D03A 1CF3A 4CBQA 1EBDA 2JBVA 5JCKA 5KXJA 2WPCA 3HZLA 2C7GA 5JCMA 2WEUA 3L1RA 3COXA 4N9XA 2XFNA 2I0ZA 2J3NA 3BNMA 2ZBWA 4GUVA 4JNQA 4EMJA 4C3YA 1D4EA 2A87A 2BK3A 2C72A 4FX9A 5FS9A 1H7XA 5KRQA 1GV4A 3FG2P 3P9UA 4B63A 3T2ZA 2JB3A 2WS3A 4ECHA 1H83A 2YQUA 3NKSA 4U8LA 2GAHB 3UKKA 2YG6A 1H82A 2YLWA 4H4ZA 4OPUA 2YWLA 4GDPA 3UKAA 1L9DA 3UOXA 3S5WA 3G5SA 3KPFA 2TPRA 5GRTA 4UDQA 1GALA 4TM3A 3ALLA 3SZFA 2WDQA 1CL0A 2AQJA 5JCIA 4U8JA 1TDFA 1GRAA 1CJCA 1XPQA 1NG4A 1KF6A 1Y0PA 3GYJA 1GSNA 1NHRA 2X8CA 4CCRA 1JU2A 1OJCA 4I59A 4NTCA 3QJ4A 4J56A 3DK4A 2XFPA 3K7TA 1H81A 4U2LA 4H4RA 2WU5A 1MXTA 1OJDA 3P4SA 3NG7X 4II2A 4U8IA 4BV6A 4Z2UA 4NWZA 2C64A 4ADWA 3AE1A 2YG4A 5JCLA 3I3LA 1K0LA 3T31A 4H4XA 1XHCA 4H4UA 2GV8A 3KLJA 2Q0KA 3F8RA 4H4QA 1ONFA 2BC1A 2VVLG 2FBWA 1REOA 5TR3A 1JNRA 1M64A 2ARDA 3BI4A 3AE8A 3V3OA 1E1KA 1TYTA 2C75A 1HYUA 1UKVG 2XLRA 2X8HA 1GOSA 3G5RA 3M0OA 1PJ6A 2GF3A 1N4UA 2YR6A 4NEWA 3ICTA 5HXIA 1YQZA 3GDNA 3IWAA 4Y4NA 1OJ9A 3WE0A 3D8XA 4H4PA 4XXGA 4A9WA 1S2QA 2XLPA 1DOEA 5EB4A 2JKCA 3AE2A 2A8XA 3NYCA 3IHMA 2BA9A 4G6HA 3SZ0A 5KOWA 5KNLA 2TMDA 1BKWA 4EIPA 4TLZA 3SXIA 2OALA 1GT8A 4GAPA 2E5VA 2BABA 1B8SA 4UDPA 4TLXA 3SGLA 1CHUA 5IPYA 4LU6A 3CMMA 1H86A 4BK3A 1BZLA 2XCGA 4ZN0A 4J57A 3H8IA 1B4VA 3EPTA 3AWIA 3GD3A 4CRTA 3GWDA 3LXDA 1KDGA 4OCGA 1LQUA 1RSGA 4H2RA 3QVRA 4FK1C 1B5QA 3O0HA 4YSHA 1GPEA 2X99A 4H4WA 1CC6A 1Q1RA 2OAMA 4X4JA 4B65A 1YQ3A 4DSHA 2IIDA 4USQA 2YLXA 4G73A 1E1LA 1IJHA 2XDOA 3I6DA 1CBOA 3OZ2A 3ICSA 4U8KA 5M0ZA 1NENA 1CC2A 2PYXA 1TYPA 2Q7VA 3RP6A 2CDUA 3AD7B 2YLTA 1E6EA 3FIMB 4P9SA 1Q9IA 1Y56A 2BK4A 3UTEA 3SFEA 4AP3A 3KA7A 4C3XA 5HYMA 2C76A 2ZZCA 3R9UA 3LZXA 3QFAA 3UOZA 2JB2A 3LB8A 5KWFA 3KVEA 2V3AA 4TM0A 1O5WA 3NH3X 3RP8A 1LVLA 4YTNA 2B9WA 4B66A 2C3DA 2GR0A 1TDKA 1GRFA 2BS2A 2XVHA 4YTMA 4AOXA 4I58A 3DJJA 4IA6A 2Q6UA 3C4AA 4K5RA 4NNJA 3ITJA 5EBKA 1BWCA 1DOCA 3GSIA 2V60A 3BNUA 4GAVA 2IVEA 2GAGB 3BI5A 1NPXA 2OA1A 2VOUA 3K7MX 3BHKA 3CNSA 2B7SA 1PXCA 1S3EA 2NVKX 3NK0X 4C74A 3P4PA 2BS3A 1KSSA 2EQ6A 1PHHA 5DBJA 4DGKA 3AE5A 1KFYA 2VRLA 1P2EA 3PVCA 2FJBA 5CKUA 4CY6A 1BF3A 3H8LA 2IVDA 2WBAA 2OLNA 4B1BA 1TDOA 1JRZA 2BCGG 2RGJA 3PO7A 4J33A 4ZCCA 3UOVA 2WOVA 1IUWA 4DSGA 1MO9A 1K4QA 3NYEA 3AYLA 3P1WA 3UKQA 2WETA 1FL2A 5J7XA 4BK2A 1PBFA 4NEVA 1ZP0A 1GRTA 1O95A 3T14A 4IV9A 3UP4A 4H2QA 4YXDA 2WHDA 4AT2A 1D7YA 5KMRA 1DOBA 4H2PA 3CIRA 4JN9A 3GMCA 2A89A 2PHHA 1PBBA 3NT6A 3NTDA 4X9MA 2UZZA 2R45A 3DJDA 3AD8B 3GD4A 3NRNA 4GR1A 3AEBA 1MOKA 4Z26A 1F8RA 4PAAA 4Z24A 4E0VA 3KPKA 3T0KA 5L46A 3L8KA 2E4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2H A;  1EL9 A;  1N1P A;  4NZH A;  4U8M A;  3P4R A;  2C3C A;  1E7P A;  2EQ9 A;  4EQX A;  2BXS A;  1ZOY A;  1QJD A;  3GYI A;  4H2N A;  1NHQ A;  3RNM A;  3EAN A;  1GTH A;  1VG0 A;  2R4E A;  2JAE A;  1L0V A;  4J34 A;  3PS9 A;  3CN8 A;  2XFO A;  4YSZ A;  3DME A;  3AE3 A;  3JSK A;  3QSM A;  4J2W A;  4OPL A;  4GRT A;  2GR3 A;  1PBC A;  3RHA A;  2GB0 A;  1FEB A;  1K0I A;  4Z2R A;  1B37 A;  4YT0 A;  3AED A;  1ZOV A;  4REK A;  1YQ4 A;  3T37 A;  1YY5 A;  5IQ1 A;  1PBD A;  1EL5 A;  2YLZ A;  3QFB A;  1GET A;  5FS8 A;  3UOY A;  3EAO A;  3V76 A;  4A6N B;  3M13 A;  3UKH A;  4BJY A;  3NN6 X;  4U8N A;  3VR9 A;  1TDN A;  2X8G A;  3IHG A;  2WQY A;  4X9N A;  3NK1 X;  2YR5 A;  3F8D A;  3V3N A;  4A79 A;  2EQ7 A;  3GDP A;  4IVO B;  4U8P A;  1D4D A;  1PXB A;  4DNA A;  1OJA A;  3ATQ A;  2WP6 A;  3NN0 X;  5U1O A;  2YM1 A;  4KPR A;  3UTG A;  4EQW A;  3LAD A;  1CJ4 A;  1TDE A;  1ZDL A;  5U25 A;  1E1N A;  5IQ4 A;  2C66 A;  2GQF A;  3AEE A;  1GRG A;  1FEC A;  1JRX A;  4EIQ A;  2FJA A;  2X50 A;  4RG3 A;  3ZYX A;  3ALM A;  1BGN A;  1W4X A;  4C77 A;  1Y56 B;  4A6N A;  4JDR A;  3CGD A;  4OPD A;  1IUS A;  2V6O A;  3AEF A;  2XVE A;  3II4 A;  1EL7 A;  4IVM B;  4Z2T A;  1GER A;  1CC4 A;  1D5T A;  2X3N A;  1N4V A;  4ZCD A;  2QA2 A;  5BUK A;  2WPF A;  1Q1W A;  3NNE A;  3CPJ G;  2WU2 A;  1XDI A;  5C2T A;  3DH9 A;  2AAQ A;  2Z5Y A;  3BI2 A;  3FPZ A;  3SQP A;  2Y6Q A;  3UKL A;  2R46 A;  1L9E A;  1SEZ A;  4XWR A;  3AB1 A;  3C4N A;  2YG3 A;  3SM8 A;  3B6D A;  2XFU A;  1F8W A;  3NHO X;  2RGO A;  1D7L A;  3DJG X;  1DOD A;  3ISH A;  1VQW A;  1GXF A;  2DKH A;  1ZX9 A;  3F8P A;  3LZW A;  2H88 A;  1JNZ A;  2EQ8 A;  3AXB A;  4NTE A;  2DKI A;  1JOA A;  3AEA A;  3CNP A;  1IUT A;  3LOV A;  1KNR A;  3UTF A;  5EOW A;  1NAA A;  4O5U A;  4WCT A;  1JEH A;  2XLT A;  4Y4L A;  2R0P A;  2GQW A;  1LTX R;  1KNP A;  2GR2 A;  3NGC X;  3DK9 A;  1QO8 A;  3AYJ A;  3QSE A;  2YR4 A;  3VQR A;  1PJ7 A;  1E1M A;  3NK2 X;  3KU9 A;  3FMW A;  1F6M A;  1DNC A;  3LJP A;  2BK5 A;  5BVA A;  3KD9 A;  3CTY A;  1KSU A;  3EF6 A;  5HY5 A;  2B7R A;  4TM1 A;  1GRE A;  2WPE A;  2YM2 A;  3AE9 A;  1QLB A;  3DJE A;  1GND A;  5BRT A;  4K7Z A;  1AOG A;  5BUL A;  3GRT A;  4H4S A;  2GMJ A;  1D4C A;  3GQK A;  3QVP A;  2Q0L A;  1BGJ A;  1RYI A;  4HB9 A;  4USR A;  3QSS A;  4YWO A;  1GRB A;  3AE7 A;  2FJD A;  1O94 A;  2QA1 A;  2XLU A;  4JY3 A;  4AP1 A;  3CPH G;  2VQ7 A;  3CPI G;  4BK1 A;  3SUC A;  2BAC A;  2XLS A;  2WOI A;  3M12 A;  4A99 A;  4AOS A;  1CJ3 A;  5GSN A;  3K30 A;  1ELI A;  2QCU A;  4D04 A;  5EB5 A;  4B69 A;  1OJT A;  2R9Z A;  1ZMC A;  2C73 A;  2XFQ A;  2CVJ A;  3C96 A;  3G5Q A;  4LA1 A;  2F5Z A;  4A5L A;  4KX6 A;  4Z44 A;  4Y4M A;  4YSY A;  1EL8 A;  2APG A;  2XVJ A;  3UP5 A;  5JCN A;  3DK8 A;  2CUL A;  1LQT A;  4AT0 A;  4EM4 A;  4Z43 A;  1XAN A;  4OPI A;  3ICR A;  1H7W A;  2R0C A;  1FOH A;  5CQF A;  4BJZ A;  3IF9 A;  2B76 A;  2V3B A;  1ZKQ A;  2YLR A;  4U2S A;  3K7Q X;  3UKF A;  4A65 A;  2XVF A;  5KOX A;  2WDR A;  3AE6 A;  4J31 A;  1VDC A;  2VRM A;  4ICY A;  1ZMD A;  2BCP A;  4OPT A;  2WES A;  4EQR A;  3P4Q A;  2C67 A;  4HA6 A;  4EMI A;  4K2X A;  2WOW A;  3RP7 A;  1GEU A;  1Z6L A;  3CGE A;  4Z25 A;  1LPF A;  2OLO A;  2C70 A;  3VR8 A;  2O9Z A;  1DJQ A;  1NDA A;  2AR8 A;  1VRQ B;  2Z5X A;  3NTA A;  4FDC B;  4U8O A;  4APN A;  2HQM A;  1S2Y A;  4O5Q A;  3AYI A;  3ZDN A;  4YTP A;  1PBE A;  2LFC A;  2Y6R A;  3CNJ A;  3VRB A;  4C5O A;  1NHS A;  1ZK7 A;  2YAU A;  3CGC A;  3IC9 A;  4OPG A;  3B3R A;  5M10 A;  2VVL A;  4B64 A;  2YG7 A;  5LV9 A;  1NHP A;  1PDH A;  4K8D A;  3VRA A;  4CCQ A;  2ZZ0 A;  3SFD A;  3URH A;  4U2T A;  2YLS A;  3GMB A;  2RAB A;  1COY A;  3AEC A;  1F3P A;  4YKF A;  2GVC A;  3GWF A;  3GYX A;  2WP9 A;  4UDR A;  4WX1 A;  1E39 A;  5U63 A;  4B68 A;  3D1C A;  2JK6 A;  1V59 A;  1NEK A;  2FJE A;  2WDV A;  1F8S A;  4A7A A;  4K22 A;  4RSL A;  1IUU A;  2R4J A;  2WP5 A;  4GDE A;  2QAE A;  4H4T A;  4FK1 A;  4YKG A;  2YVG A;  3CND A;  4K5S A;  4RG4 A;  5FMH A;  4PAB A;  2GR1 A;  2YVF A;  2ACZ A;  4UP3 A;  4IA5 A;  4XWZ A;  3VRD B;  1GTE A;  4EQS A;  3DGZ A;  1IUX A;  3S61 A;  2RGH A;  4OVI A;  2YG5 A;  4J36 A;  5FS6 A;  2BS4 A;  5C3J A;  1LJ1 A;  1S3B A;  4JY2 A;  1PJ5 A;  3DGH A;  4BUR A;  3GQH A;  2VZ2 A;  3CGB A;  3CNT A;  3KKJ A;  5J60 A;  1X31 B;  2V5Z A;  2BXR A;  3UCL A;  1CJ2 A;  5KVH A;  2B9X A;  1JRY A;  1N4W A;  3Q9T A;  4JQ9 A;  2GRT A;  3AEG A;  2VVM A;  2VQB A;  2R0G A;  4TM4 A;  3NYF A;  1YKJ A;  3OC4 A;  2XYO A;  1L9C A;  2B9Y A;  2GH5 A;  4H4V A;  4LII A;  1PN0 A;  1DJN A;  3AD9 B;  3ATR A;  3NIX A;  5HHF A;  2ZZB A;  3ADA B;  3E1T A;  1ZY8 A;  1GES A;  1FCD A;  1LV0 A;  3DA1 A;  3RED A;  5KVI A;  1PS9 A;  2GEW A;  1H84 A;  4EM3 A;  2JB1 A;  3FBS A;  2E1M A;  2YVJ A;  1VG9 A;  4NTD A;  4CNK A;  1K0J A;  2GMH A;  2V61 A;  3BHF A;  1NG3 A;  4H7U A;  4OPC A;  2XVI A;  3GRS A;  5ER0 A;  1GRH A;  2H89 A;  2W0H A;  1TRB A;  1DXL A;  3NLC A;  4H50 A;  3AE4 A;  2C65 A;  4H4Y A;  4EMW A;  4CY8 A;  4MJW A;  4M52 A;  2BYB A;  2BC0 A;  3UKP A;  3ABV A;  3Q6J A;  4JNA A;  1H6V A;  4B67 A;  1FEA A;  4GF7 A;  2NPX A;  1PXA A;  4CNJ A;  1M6I A;  1RP0 A;  4YSX A;  3UTH A;  4GCM A;  5FS7 A;  1IUV A;  2CFY A;  3H4K A;  3ALJ A;  4D03 A;  1CF3 A;  4CBQ A;  1EBD A;  2JBV A;  5JCK A;  5KXJ A;  2WPC A;  3HZL A;  2C7G A;  5JCM A;  2WEU A;  3L1R A;  3COX A;  4N9X A;  2XFN A;  2I0Z A;  2J3N A;  3BNM A;  2ZBW A;  4GUV A;  4JNQ A;  4EMJ A;  4C3Y A;  1D4E A;  2A87 A;  2BK3 A;  2C72 A;  4FX9 A;  5FS9 A;  1H7X A;  5KRQ A;  1GV4 A;  3FG2 P;  3P9U A;  4B63 A;  2JB3 A;  2WS3 A;  4ECH A;  1H83 A;  2YQU A;  3NKS A;  4U8L A;  2GAH B;  3UKK A;  2YG6 A;  1H82 A;  2YLW A;  4H4Z A;  4OPU A;  2YWL A;  4GDP A;  3UKA A;  1L9D A;  3UOX A;  3S5W A;  3G5S A;  3KPF A;  2TPR A;  5GRT A;  4UDQ A;  1GAL A;  4TM3 A;  3ALL A;  2WDQ A;  1CL0 A;  2AQJ A;  5JCI A;  4U8J A;  1TDF A;  1GRA A;  1CJC A;  1XPQ A;  1NG4 A;  1KF6 A;  1Y0P A;  3GYJ A;  1GSN A;  1NHR A;  2X8C A;  4CCR A;  1JU2 A;  1OJC A;  4I59 A;  4NTC A;  3QJ4 A;  4J56 A;  3DK4 A;  2XFP A;  3K7T A;  1H81 A;  4U2L A;  4H4R A;  2WU5 A;  1MXT A;  1OJD A;  3P4S A;  3NG7 X;  4U8I A;  4BV6 A;  4Z2U A;  2C64 A;  4ADW A;  3AE1 A;  2YG4 A;  5JCL A;  3I3L A;  1K0L A;  4H4X A;  1XHC A;  4H4U A;  2GV8 A;  3KLJ A;  2Q0K A;  3F8R A;  4H4Q A;  1ONF A;  2BC1 A;  2VVL G;  2FBW A;  1REO A;  5TR3 A;  1JNR A;  1M64 A;  2ARD A;  3BI4 A;  3AE8 A;  3V3O A;  1E1K A;  1TYT A;  2C75 A;  1HYU A;  1UKV G;  2XLR A;  2X8H A;  1GOS A;  3G5R A;  3M0O A;  1PJ6 A;  2GF3 A;  1N4U A;  2YR6 A;  4NEW A;  3ICT A;  5HXI A;  1YQZ A;  3GDN A;  3IWA A;  4Y4N A;  1OJ9 A;  3WE0 A;  3D8X A;  4H4P A;  4XXG A;  4A9W A;  1S2Q A;  2XLP A;  1DOE A;  5EB4 A;  2JKC A;  3AE2 A;  2A8X A;  3NYC A;  3IHM A;  2BA9 A;  5KOW A;  2TMD A;  1BKW A;  4EIP A;  4TLZ A;  2OAL A;  1GT8 A;  2E5V A;  2BAB A;  1B8S A;  4UDP A;  4TLX A;  3SGL A;  1CHU A;  5IPY A;  4LU6 A;  1H86 A;  4BK3 A;  1BZL A;  2XCG A;  4ZN0 A;  4J57 A;  3H8I A;  1B4V A;  3EPT A;  3AWI A;  3GD3 A;  4CRT A;  3GWD A;  3LXD A;  1KDG A;  4OCG A;  1LQU A;  1RSG A;  4H2R A;  3QVR A;  4FK1 C;  1B5Q A;  3O0H A;  4YSH A;  1GPE A;  2X99 A;  4H4W A;  1CC6 A;  1Q1R A;  2OAM A;  4X4J A;  4B65 A;  1YQ3 A;  4DSH A;  2IID A;  4USQ A;  2YLX A;  1E1L A;  1IJH A;  2XDO A;  3I6D A;  1CBO A;  3OZ2 A;  3ICS A;  4U8K A;  5M0Z A;  1NEN A;  1CC2 A;  2PYX A;  1TYP A;  2Q7V A;  3RP6 A;  2CDU A;  3AD7 B;  2YLT A;  1E6E A;  3FIM B;  4P9S A;  1Q9I A;  1Y56 A;  2BK4 A;  3UTE A;  3SFE A;  4AP3 A;  3KA7 A;  4C3X A;  5HYM A;  2C76 A;  2ZZC A;  3R9U A;  3LZX A;  3QFA A;  3UOZ A;  2JB2 A;  3LB8 A;  5KWF A;  3KVE A;  2V3A A;  4TM0 A;  1O5W A;  3NH3 X;  3RP8 A;  1LVL A;  4YTN A;  2B9W A;  4B66 A;  2C3D A;  2GR0 A;  1TDK A;  1GRF A;  2BS2 A;  2XVH A;  4YTM A;  4AOX A;  4I58 A;  3DJJ A;  4IA6 A;  2Q6U A;  3C4A A;  4K5R A;  3ITJ A;  5EBK A;  1BWC A;  1DOC A;  3GSI A;  2V60 A;  3BNU A;  2IVE A;  2GAG B;  3BI5 A;  1NPX A;  2OA1 A;  2VOU A;  3K7M X;  3BHK A;  3CNS A;  2B7S A;  1PXC A;  1S3E A;  2NVK X;  3NK0 X;  4C74 A;  3P4P A;  2BS3 A;  1KSS A;  2EQ6 A;  1PHH A;  5DBJ A;  4DGK A;  3AE5 A;  1KFY A;  2VRL A;  1P2E A;  3PVC A;  2FJB A;  5CKU A;  4CY6 A;  1BF3 A;  3H8L A;  2IVD A;  2WBA A;  2OLN A;  4B1B A;  1TDO A;  1JRZ A;  2BCG G;  2RGJ A;  3PO7 A;  4J33 A;  4ZCC A;  3UOV A;  2WOV A;  1IUW A;  4DSG A;  1MO9 A;  1K4Q A;  3NYE A;  3AYL A;  3P1W A;  3UKQ A;  2WET A;  1FL2 A;  5J7X A;  4BK2 A;  1PBF A;  4NEV A;  1ZP0 A;  1GRT A;  1O95 A;  4IV9 A;  3UP4 A;  4H2Q A;  4YXD A;  2WHD A;  4AT2 A;  1D7Y A;  1DOB A;  4H2P A;  3CIR A;  4JN9 A;  3GMC A;  2A89 A;  2PHH A;  1PBB A;  3NT6 A;  3NTD A;  4X9M A;  2UZZ A;  2R45 A;  3DJD A;  3AD8 B;  3GD4 A;  3NRN A;  4GR1 A;  3AEB A;  1MOK A;  4Z26 A;  1F8R A;  4PAA A;  4Z24 A;  4E0V A;  5L46 A;  3L8K A;  2E4G A; 
#chains in the Genus database with same CATH topology
 5LBQ B;  4NZH A;  3RX6 A;  2C3C A;  4EQX A;  1ZOY A;  4H2N A;  4AKH A;  1VBB 4;  2XQ8 A;  3SS1 A;  2HN1 A;  2R4E A;  3PV0 F;  2I59 A;  2ZLY A;  2X9Y A;  2ZMA A;  3OBV E;  4LF5 T;  4YSZ A;  3JSK A;  3QSM A;  4J2W A;  2VWA A;  3OJA A;  2GR3 A;  3RHA A;  1XI1 A;  4Z2R A;  4DR4 T;  4TWF A;  3T37 A;  5IQ1 A;  2YLZ A;  1MND A;  3V76 A;  1XMQ T;  3M13 A;  4BJY A;  4U8N A;  3VR9 A;  4JV5 T;  1TDN A;  2OV9 A;  2X8G A;  2WQY A;  4PFO A;  4DBR A;  1XDO A;  4X9N A;  3NK1 X;  3V3N A;  3T2Y A;  1COV 4;  4GB3 4;  2X0H A;  3Q5X A;  1MNE A;  3UTG A;  4EQW A;  4HFH A;  1E1N A;  4HTE A;  3C4Z A;  1FEC A;  4IT4 A;  1QUU A;  4X1K E;  3SOL A;  3ZSS A;  4JDR A;  3CGD A;  2NR4 A;  2PBI A;  4OPD A;  3AEF A;  4AQG A;  4OYK A;  2QA2 A;  2WPF A;  2BG9 A;  1Q1W A;  2WU2 A;  3DH9 A;  3CX8 B;  3SQP A;  3BQK A;  1U4Q A;  2VQF T;  4Q25 A;  4B3S T;  5AQN B;  2RGO A;  3HL6 A;  3KV9 A;  5KX5 E;  1DOD A;  2F4V T;  3ISH A;  1G73 A;  3MXZ A;  1GXF A;  5ABF A;  4X64 T;  5EOW A;  4GYS A;  3G06 A;  2CRB A;  2X66 A;  1LTX R;  3BK9 A;  5F8P A;  3N9L A;  5FXV A;  2YR4 A;  5J2T E;  1PJ7 A;  3KU9 A;  1F6M A;  1DNC A;  1HXS 4;  4TUY E;  2BK5 A;  2R06 4;  4LF7 T;  3VKH A;  4TM1 A;  2DI4 A;  2YM2 A;  3AE9 A;  4H63 V;  1IAP A;  4IE7 A;  3DJE A;  2X67 A;  3VHL A;  4O8S A;  5AQT B;  1EV1 4;  1D4C A;  2C4C A;  2YDS A;  1BGJ A;  3N9M A;  1RYI A;  4HB9 A;  4YWO A;  4YJ2 E;  2VK9 A;  2QA1 A;  4GOU A;  4ILB A;  2WOI A;  3CQG B;  4AOS A;  3MZK B;  3K30 A;  3Q5W A;  5EK4 A;  1FJG T;  5HEH A;  5AQH B;  2XFQ A;  3C98 B;  4MAL A;  2VAS A;  4Z44 A;  2CM0 A;  4YSY A;  2XAS B;  1EL8 A;  2APG A;  2XVJ A;  3CQX C;  5HXR A;  2NW8 A;  2UXX B;  4ZZC A;  4IE4 A;  2IW5 B;  4EM4 A;  4Z43 A;  3ICR A;  4G74 A;  2B76 A;  4U2S A;  3UKF A;  2XVF A;  4J31 A;  1VDC A;  1ZMD A;  2RS1 4;  1HFA A;  1VRB A;  1HX8 A;  3LK3 B;  4RHV 4;  4K2X A;  2LE8 A;  1Z6L A;  3CGE A;  3OYX A;  1LPF A;  4I43 B;  4PDW D;  2OLO A;  1MMA A;  1DJQ A;  2AR8 A;  2NW9 A;  4U8O A;  2XJ7 A;  2W0G A;  1PBE A;  4TZ4 C;  2D5U A;  1NHS A;  2NW7 A;  3B3R A;  5M10 A;  2VVL A;  4JYA T;  2CBI A;  2E5L T;  4JI6 T;  4Z91 A;  5HXS A;  3VRA A;  1GQE A;  2XM2 A;  5DQW A;  2ZZ0 A;  3SFD A;  4U2T A;  2YLS A;  4EAH A;  1COY A;  3RIU C;  4YKF A;  2GVC A;  3GYX A;  4H9S E;  3DTO A;  1OXZ A;  1V59 A;  2BRY A;  4PNI A;  1NEK A;  2FJE A;  5ABG A;  4FI5 A;  1D0X A;  2XPK A;  4A7A A;  4RSL A;  1IUU A;  2WP5 A;  2KLQ A;  5AQS B;  4DND A;  4FK1 A;  1AJ3 A;  3ZJ1 A;  4UVC B;  4PAB A;  3RC8 A;  3TLU A;  4IA5 A;  1GTE A;  3DGZ A;  1IUX A;  2D0U A;  1HNZ T;  2YG5 A;  1H8T D;  5C3J A;  1S3B A;  4N78 D;  4A5X A;  4BUR A;  3CGB A;  3CNT A;  1X31 B;  2IML A;  3Q9T A;  4JQ9 A;  3AEG A;  3JC6 C;  3QOF A;  5L47 A;  2XYO A;  2GH5 A;  3A8Y C;  3ATR A;  2ZZB A;  2V26 A;  4O4I E;  1FCD A;  1LV0 A;  2KZ7 B;  1UUR A;  4EM3 A;  5LB7 B;  2BDE A;  1VG9 A;  5LHH B;  5KDM C;  4IE0 A;  3BHF A;  3PE0 A;  3GRS A;  4HFI A;  3O9X A;  1GRH A;  5AQQ B;  3MJX A;  3PJA J;  5L4E A;  3Q2M A;  4MJW A;  4M52 A;  1YKH B;  2DWK A;  3ZYK A;  3Q6J A;  1PXA A;  4GCM A;  2YIN A;  3PUR A;  4CBQ A;  1EBD A;  2JBV A;  1B7T A;  1PVC 4;  2ZM2 A;  3HZL A;  1OED C;  5LCY A;  2C7G A;  5JCM A;  3COX A;  1IBM T;  2V5D A;  3UFE A;  2I0Z A;  5JR9 C;  3BNM A;  4GUV A;  4JNQ A;  4C3Y A;  1H7X A;  1Y64 B;  5HCJ A;  2WS3 A;  1H83 A;  2HPL A;  3NKS A;  3UKK A;  2YG6 A;  4JI5 T;  4AQF A;  2YLW A;  4IDP A;  4KP3 C;  3S5W A;  3G5S A;  2V7I A;  4DV3 T;  3H3A A;  3LK4 2;  4TM3 A;  2WDQ A;  1LVK A;  1SUM B;  2XQ6 A;  3EAB A;  4X20 E;  4U8J A;  2JMK A;  1NHR A;  4CCR A;  4I59 A;  1T8B A;  3QJ4 A;  2VB6 A;  2XFP A;  4U2L A;  3LBX A;  3SWH A;  1OJD A;  3NG7 X;  4PJL A;  2XQ4 A;  2W4X A;  4BV6 A;  3PUW F;  2OLT A;  4CQI A;  3T31 A;  4H4X A;  4PFP A;  4HE8 A;  2HPJ A;  1REO A;  1T7S A;  1JNR A;  4QXH B;  1M64 A;  3CML A;  3AE8 A;  3BI4 A;  5AQU B;  1DU2 A;  1GOS A;  4O4L E;  3M0O A;  4V1A v;  1PJ6 A;  1N4U A;  3ICT A;  5C8Y E;  4WYV A;  3IWA A;  2DHR A;  4A9W A;  2RPA A;  1S2Q A;  1DOE A;  4QKN A;  4AI6 A;  3OVU A;  5AQO B;  1D0Y A;  1YKE B;  2YEV C;  4UVA B;  4LU6 A;  2W67 A;  2XCG A;  2RP4 A;  3X1D A;  4HGA A;  4J57 A;  3H8I A;  3P50 A;  2V7K A;  5ABE A;  3ZN1 B;  2WM9 A;  3PUG A;  4U72 A;  4Z90 A;  1LQU A;  4H2R A;  5JRC B;  4X4J A;  1Q1R A;  1YQ3 A;  2IID A;  4G73 A;  1E1L A;  3I6D A;  5HEU A;  2JQK A;  1CBO A;  4U8K A;  5M0Z A;  1CC2 A;  1TYP A;  1E6E A;  4P9S A;  3WAJ A;  5HEG A;  4AP3 A;  1T72 A;  2XAQ B;  4C3X A;  2C76 A;  2V5C A;  2JB2 A;  4WNK A;  5KWF A;  2VVS A;  1LVL A;  3M65 A;  5E0O A;  2C3D A;  2GR0 A;  1TDK A;  4E7Z A;  1GRF A;  1X9B A;  4YTM A;  2Q6U A;  2C5I T;  4K5R A;  5FMN A;  2V60 A;  4GAV A;  2GAG B;  3CNS A;  4ISS A;  4LMJ A;  2BS3 A;  2X0Y A;  5JDH A;  1KFY A;  5CKU A;  2FJB A;  2K9A A;  2WZI A;  4B1B A;  2RGJ A;  4Z2T A;  3TLV A;  3I0O A;  4U7I A;  2CLY B;  3PU3 A;  4BK2 A;  3T14 A;  3JAE A;  1GRT A;  1VBE 4;  4IV9 A;  3JBG 4;  4A97 A;  4H2Q A;  2K48 A;  2V7L A;  1D7Y A;  4F8H A;  5DAB A;  2PHH A;  4YHJ A;  4YHH T;  2UZZ A;  2C5K T;  3AD8 B;  3GD4 A;  2XTL A;  5AQM B;  1EL9 A;  1N1P A;  2PYL A;  3JAD A;  1I6Z A;  4O4H E;  2KWI B;  2BXS A;  1QJD A;  1V9D A;  3EAN A;  3C64 A;  4QH1 A;  2NWB A;  1VG0 A;  4UXN B;  1WR6 A;  2LSI A;  2RA1 A;  3AE3 A;  3NZP A;  5DQV A;  3DME A;  3AA7 B;  1SA0 E;  1N32 T;  3HR0 A;  1B37 A;  3AED A;  1ZOV A;  4KI0 F;  4ZS2 A;  1YY5 A;  2OA5 A;  4X1Y E;  1I94 T;  1PBD A;  3QFB A;  4EEB A;  5FS8 A;  3UOY A;  2CEA A;  3EAO A;  4A6N B;  3UKH A;  1IZN B;  1KNZ A;  1XWM A;  3N2K E;  4A79 A;  3GDP A;  3C50 A;  3HYX A;  4DNA A;  4PW8 A;  4QWN B;  1EZ3 A;  4ZOL E;  4O2A E;  3LAD A;  1BR4 A;  1HRV 4;  4U7Y A;  2GQF A;  1GRG A;  1M7K A;  3UUN A;  4H9Q C;  3FZH B;  1W4X A;  4C77 A;  1RUC 4;  3P4W A;  3QB5 K;  1OWA A;  1EL7 A;  4B6X A;  4ASK A;  1CC4 A;  1D5T A;  2XAF B;  3PU8 A;  1N4V A;  3F31 A;  4YLH A;  5BUK A;  3KV4 A;  4PK5 A;  3CPJ G;  3CX6 B;  3FZM B;  3BI2 A;  3FPZ A;  4FJO A;  1SEZ A;  1WFD A;  3AB1 A;  5AQG B;  3T1H T;  2A2F X;  2YU2 A;  3RGL A;  4IST A;  3F8P A;  4U2Z A;  2EQ8 A;  3AXB A;  1JOA A;  2XQY A;  5AQK B;  2PY5 A;  1KNR A;  3UTF A;  4WCT A;  5JR9 B;  4Y4L A;  3QNU A;  4HFE A;  3NGC X;  3QUJ A;  5CGM A;  2ZM0 A;  1QO8 A;  3AYJ A;  2C0S A;  3QSE A;  3VQR A;  3NK2 X;  2YN6 A;  3FMW A;  3LJP A;  4DUZ T;  5BVA A;  1AR7 4;  2LM2 A;  1KSU A;  3EF6 A;  2B7R A;  4UIG A;  1WRD A;  1GND A;  3IF8 B;  4JEH B;  4K7Z A;  1AOG A;  2X68 A;  2GMJ A;  3RYF E;  4XAX B;  2XUE A;  2Q0L A;  4X65 T;  2JQQ A;  3I1A A;  3QSS A;  1GRB A;  2LOS A;  2CMR A;  3AE7 A;  2FJD A;  1O94 A;  4AP1 A;  2VQ7 A;  2WBL A;  4TNV A;  1CJ3 A;  2MOZ A;  1IBL T;  1ELI A;  2QCU A;  2KT9 A;  2E9X C;  5EZY E;  3EUH A;  2LSG A;  4A5L A;  3UP5 A;  2XQ3 A;  3ZYL A;  3SY4 A;  1RHI 4;  4DV6 T;  2LKH A;  3ZMS B;  4Q4X 4;  2J47 A;  3K3O A;  1XAN A;  4OPI A;  1H7W A;  2R0C A;  2A9U A;  1FOH A;  3IF9 A;  2N9D A;  2V3B A;  4H9O C;  5LXT E;  2VRM A;  2BCP A;  2IIU A;  2VVN A;  3W15 B;  2UXD T;  4EQR A;  2PW9 A;  1VCS A;  3ZC0 A;  3ESL A;  2C67 A;  4HA6 A;  3RF1 A;  2W62 A;  1QSD A;  4J2C A;  3N5L A;  1GEU A;  1AL2 4;  4P0B A;  5LP6 E;  4AKI A;  2C70 A;  3VR8 A;  2XAH B;  4AIU A;  2H7O A;  3NRY A;  3BQL A;  1VRQ B;  2Z5X A;  4FDC B;  3AB3 B;  1S2Y A;  2X51 A;  2HQM A;  3V5U A;  1HG5 A;  3UUL A;  1W0A A;  2YAU A;  3SYI A;  2N2N A;  4B64 A;  4HWF A;  2AE9 A;  4QH5 A;  1PDH A;  2BZB A;  1XHZ A;  1MIV A;  2RAB A;  3CQC B;  2XM1 A;  2VL8 A;  5FVK A;  2WP9 A;  3SX6 A;  4B68 A;  4NIQ A;  2JK6 A;  3ZMT B;  2WDV A;  1XNR T;  2JRK A;  4RG4 A;  3Q5E A;  2IHR 1;  1HNW T;  2ACZ A;  3VRD B;  1O3X A;  4EQS A;  1AR6 4;  1OED E;  3HKC E;  4OVI A;  5IWA T;  4J36 A;  5FS6 A;  2BS4 A;  1LJ1 A;  1PJ5 A;  5FP3 A;  4DR6 T;  4OYJ A;  1BEV 4;  2BG9 C;  3UCL A;  5KVH A;  2B9X A;  1JRY A;  1N4W A;  3ANW B;  2VVM A;  2VQB A;  2R0G A;  4TM4 A;  1IJ5 A;  5LJN A;  1YKJ A;  4H4V A;  2EHO A;  1XNQ T;  5HHF A;  3ADA B;  3E1T A;  2X5I D;  1YD8 G;  2UUC T;  4U3C A;  1MMN A;  2BRA A;  3ETU A;  3FBS A;  2YVJ A;  4CNK A;  1K0J A;  2WB5 A;  2GMH A;  3SRZ A;  4KHZ F;  4OPC A;  2XVI A;  5JRC A;  3ZT7 A;  3GN5 B;  5FY0 A;  3RKG A;  5ER0 A;  5JVD E;  2W0H A;  1TRB A;  1DXL A;  3NLC A;  4H50 A;  2C65 A;  4H4Y A;  3RYI E;  3RH3 A;  3UKP A;  4OK0 A;  3ABV A;  3ZCI A;  4B67 A;  4IE5 A;  1FEA A;  4GF7 A;  4CNJ A;  1M6I A;  2M6B A;  4YSX A;  4IRE A;  1IUV A;  4D03 A;  4ZI7 E;  2WMO A;  4U2Y A;  3D0T A;  5KXJ A;  1RUG 4;  2YU1 A;  3K8P C;  4CN6 A;  2K3W A;  1XHX A;  4AKL A;  2V6Y B;  4EMJ A;  2ZBW A;  4OFZ A;  3N9O A;  5KRQ A;  1RUE 4;  3FG2 P;  4B63 A;  3KVB A;  2JB3 A;  3AXJ B;  4UEM A;  5L3G B;  2JJ9 A;  2GAH B;  4OPU A;  2YWL A;  4EXT A;  4GDP A;  5ETW A;  3ZCJ A;  1L9D A;  3UU4 A;  2NTX A;  3GWH A;  5HAX A;  2AQJ A;  4DBQ A;  2BKO A;  1NA1 D;  4EOZ B;  4UV9 B;  1TDF A;  1UK5 A;  2H3R A;  5HEO A;  5A1L A;  3N9Q A;  5F3J A;  3GYJ A;  4HKA A;  2X8C A;  4H63 H;  3UU3 A;  1JU2 A;  4NTC A;  4IDQ A;  1YW0 A;  2Y8D A;  3ZJ2 A;  3K7T A;  5H6R B;  4BJM A;  4H4R A;  2WU5 A;  1MXT A;  3P4S A;  3ZYM A;  4NWZ A;  2C64 A;  3UFG A;  4ADW A;  3AE1 A;  1RVF 4;  5CB4 E;  4TWH A;  1XHC A;  4H4U A;  2GV8 A;  3KLJ A;  1ASJ 4;  3UUM A;  1US7 B;  5TR3 A;  2ARD A;  4ZI2 C;  3ZPO A;  3V3O A;  1E1K A;  4GIW A;  2C75 A;  1UKV G;  2X8H A;  5HXE A;  3FHN A;  5HXI A;  4DUY T;  3GDN A;  4Q4V 4;  4Y4N A;  5HEJ A;  3WE0 A;  3NVO A;  2XLP A;  5EB4 A;  4LFB T;  2DCF A;  3NYC A;  3SZ0 A;  2JQ9 A;  1BKW A;  1IBK T;  3L8R A;  3JC6 D;  3SXI A;  1GT8 A;  4UDP A;  2VKH A;  2YOE A;  1CHU A;  3KV5 A;  2UXN B;  3CMM A;  4Q4W 4;  4ZN0 A;  3UUB A;  1B4V A;  3RYH E;  2N1G A;  3PUS A;  1RSG A;  2Q9Q A;  4MBQ A;  1B5Q A;  3QVR A;  4QX8 B;  1GPE A;  4FK1 C;  4YSH A;  2OAM A;  5AQL B;  4AIS A;  4F6R C;  4JI3 T;  1IJH A;  3ZC1 A;  3ICS A;  5J0Z A;  3RP6 A;  2XSB A;  3AD7 B;  3FIM B;  3SFE A;  3N9N A;  2ZZC A;  2NOX A;  1LKX A;  3O1J A;  4PAG A;  4TM0 A;  3V5S A;  2PTF A;  4L0R A;  2XVH A;  4AOX A;  2FUP A;  4I58 A;  1Y01 A;  3O4X E;  4IA6 A;  5EK3 A;  3ITJ A;  5EBK A;  1BWC A;  3PUV F;  5EK2 A;  1LVF A;  2IVE A;  1NPX A;  2VOU A;  5LGT B;  1PXC A;  3NK0 X;  4C74 A;  5DJQ C;  3AE5 A;  1ZEE A;  2MTQ A;  2W63 A;  5FXW A;  3ZST A;  3FZL B;  1WYC A;  2CBJ A;  1S35 A;  2I6H A;  2WBA A;  2OLN A;  1JRZ A;  2BCG G;  3PO7 A;  4J33 A;  4ZCC A;  3FBL A;  5CA0 E;  4ZI3 C;  3ZT5 A;  3AYL A;  3UKQ A;  2H7V C;  2WET A;  4NEV A;  2KMF A;  3UP4 A;  3RI5 A;  2XY8 B;  2WHD A;  2CHN A;  3CIR A;  3GMC A;  4Q4Y 4;  3PUY F;  4PJM A;  3UU8 A;  2A89 A;  3NTD A;  3ZT6 A;  1J5W A;  2LSK A;  2UUA T;  2VQE T;  2R45 A;  1VBC 4;  3DJD A;  3MAC A;  4GR1 A;  2K5B B;  1YXR A;  1MOK A;  4Z26 A;  1AR9 4;  3AA0 B;  3T0K A;  3RRW A;  3L8K A;  2E4G A;  5L46 A;  4IL4 A;  1P2H A;  1RUF 4;  4LF4 T;  3T8O A;  3RC3 A;  2EQ9 A;  2E8I A;  4PJJ A;  3DJB A;  3GYI A;  1NHQ A;  3RNM A;  1GTH A;  3O1I A;  4DR5 T;  2LSY A;  4J34 A;  4AQF C;  2XFO A;  2JPF A;  4OPL A;  3U78 A;  2GB0 A;  2V8S V;  1FEB A;  1K0I A;  2JMH A;  5L3B B;  3T2K A;  4YT0 A;  1YQ4 A;  2YDQ A;  3SZC A;  1EL5 A;  1U5P A;  1GET A;  2YR5 A;  3F8D A;  1NWM X;  2X0L B;  4ZXL A;  3NRX A;  4IE6 A;  1D4D A;  1OJA A;  3ATQ A;  3NN0 X;  2BG9 B;  2YM1 A;  4KPR A;  3PJA A;  4I4T E;  1CJ4 A;  2WWU A;  3WI3 A;  1TDE A;  5U25 A;  1R09 4;  2C66 A;  4EIQ A;  1RUI 4;  4RG3 A;  3ALM A;  2KXP B;  1Y56 B;  1IUS A;  2V6O A;  3B5M A;  2CPT A;  3FB2 A;  1GER A;  3N2O A;  1UUS A;  1PIV 4;  2KSR A;  2X3N A;  2RMU 4;  1W9R A;  3IEE A;  1R8I A;  4PK6 A;  3NNE A;  1ZV4 X;  4QH4 A;  1W0B A;  4K0K T;  1XDI A;  5C2T A;  2AAQ A;  2WMN A;  3UKL A;  1L9E A;  5L4H A;  4XWR A;  4ZEY A;  4ILA A;  4DV4 T;  2YG3 A;  3SM8 A;  5LA6 E;  1D7L A;  3DJG X;  2WZH A;  2UUB T;  2Y6X A;  4P0A A;  3C4W A;  5BR8 T;  1FEW A;  1VQW A;  2DKH A;  1ZX9 A;  3LZW A;  4TN7 B;  4NTE A;  2DKI A;  4I50 E;  3AEA A;  3OPC A;  1IUT A;  4NUV A;  3H3M A;  3UQ7 A;  1JEH A;  1E2A A;  2DNX A;  2GQW A;  1KNP A;  5FNV E;  3WAK A;  3FZF B;  2V6X A;  4G6G A;  3KD9 A;  5IHY A;  1MMD A;  1PO1 4;  3P7I A;  5BRT A;  5FYM A;  5BUL A;  4H4S A;  1WR0 A;  3ZMU B;  3GQK A;  3QVP A;  1Z8U A;  4USR A;  4KUM B;  2E2A A;  3CX7 B;  3FI7 A;  4JY3 A;  3RPU A;  4ZZB A;  1VBA 4;  3CPH G;  3CPI G;  1XMO T;  3M12 A;  4HFC A;  2IDO B;  4LFC T;  4OHF A;  4GK5 E;  4B69 A;  1OJT A;  2R9Z A;  2CCQ A;  5M4Y A;  2CVJ A;  3G5Q A;  4A98 A;  4QXC B;  4UEL A;  4AKG A;  3J7Y q;  4OX9 T;  3T1Y T;  4Y4M A;  3GN5 A;  4BAY B;  2CUL A;  2MBG A;  4AT0 A;  5CQF A;  2YLR A;  1WCR A;  3K7Q X;  4A65 A;  5KOX A;  2WDR A;  3AE6 A;  4ICY A;  3UU6 A;  5JRE A;  4WBN E;  4OPT A;  3BQI A;  3LG7 A;  4EMI A;  3K3Q C;  2WOW A;  3RP7 A;  4Z25 A;  5JDQ A;  4O4J E;  2BG9 E;  4O5Q A;  4MFR A;  5HXC A;  3J9X 1;  3AXJ A;  3ZMZ B;  2Y6R A;  4C5O A;  3CGC A;  3IC9 A;  4OPG A;  3UT5 E;  4TX5 A;  5LV9 A;  3LSV A;  1NHP A;  4DMV A;  5LHG B;  4K8D A;  3URH A;  3N9P A;  2R7F A;  5LGN B;  2LHN A;  1F3P A;  4IHJ E;  3UQ4 A;  2IC9 A;  4O2B E;  4WX1 A;  4HFD A;  4G63 A;  2CXD A;  4DID B;  1J1J A;  1MIW A;  1F8S A;  4K22 A;  2Y48 B;  3FZK B;  1HR0 T;  1VOM A;  4C90 A;  4YKG A;  3CND A;  1XDP A;  2GR1 A;  2YVF A;  4LF9 T;  4U31 A;  4ZHQ E;  5AQJ B;  5HCM A;  4L9I A;  1RMU 4;  1D0Z A;  4NXN T;  3AVR A;  4KBM B;  3ONJ A;  3DGH A;  4COF A;  5J60 A;  2XSA A;  2CA5 A;  1OED B;  4H9N C;  4I0U A;  3TKL B;  2RR1 4;  3E22 E;  4DV5 T;  1L9C A;  2B9Y A;  4LII A;  1PN0 A;  2ODU A;  4P09 A;  3AD9 B;  4X5T A;  2E9X D;  3DA1 A;  1WYB A;  5KVI A;  1PS9 A;  3J8F 4;  2GEW A;  3IA3 A;  5KMG P;  3H37 A;  3AA6 B;  3R6N A;  3RHW A;  5GON E;  4EED A;  4CI3 B;  5L3F B;  3PUZ F;  2H89 A;  3MK7 C;  3AE4 A;  4EMW A;  2BYB A;  5FY7 A;  2YK0 A;  3N2G E;  1N34 T;  2BC0 A;  4JNA A;  1H6V A;  3TLW A;  3HA4 A;  2NPX A;  1PO2 4;  2XQ9 A;  3EVY A;  2CFY A;  2A3D A;  3ALJ A;  1CF3 A;  3K1S A;  4ERR A;  4IIJ E;  2A72 A;  2QRX A;  3HKE E;  1VRH 4;  2D0T A;  1NAF A;  4E7S A;  2J3N A;  5KMP A;  2C72 A;  2A87 A;  4XZC A;  4FX9 A;  1GV4 A;  3T2Z A;  3PUA A;  4ILU A;  5FXZ A;  3LBX B;  2J62 A;  4QX7 B;  2WAU A;  5JQG E;  4AQY T;  2KWH A;  4U8L A;  4H4Z A;  5L3C B;  4B3T T;  1BR0 A;  2UXC T;  2WCA A;  3UOX A;  4UDQ A;  3KBU A;  5JCI A;  1UGO A;  5CFB A;  2XQ7 A;  1GRA A;  1CJC A;  1NG4 A;  2MPK A;  4QXB B;  1GSN A;  1WLX A;  2M67 A;  4G2A A;  4J56 A;  3DK4 A;  4IL9 A;  1D1A A;  1UX5 A;  3OYZ A;  4U8I A;  5HWY A;  5BMV E;  2YG4 A;  3I3L A;  2XQ5 A;  2Q0K A;  3F8R A;  2BBJ A;  4JLE A;  1ONF A;  2VVL G;  4EYU A;  2XLR A;  5J1G A;  4JI0 T;  4NEW A;  3CK6 A;  3QC9 A;  2QVA A;  1YQZ A;  1OJ9 A;  4K0U A;  4X1I E;  5LOV E;  3NKZ A;  3D8X A;  4EB6 E;  2JKC A;  2XZE A;  3AE2 A;  3NWI A;  2BA9 A;  5KOW A;  2XHE B;  4TLZ A;  1T98 A;  4GAP A;  2E5V A;  2BAB A;  1B8S A;  4DMW A;  1FMW A;  3SGL A;  5IPY A;  5JH7 E;  1H86 A;  4HWC A;  3AWI A;  3GD3 A;  3LFM A;  3LXD A;  4EYY R;  4OCG A;  3UU5 A;  3L39 A;  4UF0 B;  2LSJ A;  3O0H A;  2XQA A;  2X99 A;  1K5M D;  4USQ A;  2YLX A;  2EHO D;  4JI4 T;  3MA9 A;  2D9D A;  1FMV A;  1H7C A;  4B3M T;  2PYX A;  2NP9 A;  2Q7V A;  2YLT A;  1Y56 A;  2BK4 A;  3UTE A;  5HYM A;  3KA7 A;  3R9U A;  4IDO A;  3LZX A;  3QFA A;  3UOZ A;  1HX1 B;  2V3A A;  1XZY A;  3RYC E;  3RP8 A;  2DWG A;  3PUQ A;  4QHO A;  2B9W A;  4B66 A;  4IDN A;  3RQU A;  2PJQ A;  3GMI A;  1HS7 A;  2PYJ A;  3C4A A;  3PUX F;  5FKY A;  4NNJ A;  4MHC A;  5LNK A;  2EHO C;  3R84 B;  3GSI A;  5F5W A;  5FY1 A;  3BI5 A;  2OA1 A;  3K7M X;  3BHK A;  3AAA B;  1S3E A;  3U3I A;  5DBJ A;  2UXB T;  4DGK A;  3ONL C;  2XAG B;  1J5E T;  3KBT A;  3PVC A;  1HRI 4;  4CXW A;  1D1B A;  1BF3 A;  3H8L A;  2IVD A;  3UTK A;  1TDO A;  5LG3 A;  2WOV A;  2PG8 A;  1HG2 A;  4UR9 A;  5AQI B;  4GYR A;  1FL2 A;  5J7X A;  1PBF A;  4PJN A;  1O95 A;  4TWD A;  4YXD A;  4DR3 T;  4AT2 A;  4HFB A;  1PBB A;  3NT6 A;  2Z6E A;  4U74 A;  3NRN A;  3EDU A;  3AEB A;  4PAA A;  2KND A;  4ZI2 D;  4Z24 A;  3HI2 A;  1HNX T;  4GK0 E;  3DP7 A;  4U8M A;  2LOP A;  3C4X A;  3P4R A;  2X9X A;  1E7P A;  4DV7 T;  4CI1 B;  1RUH 4;  2JAE A;  1L0V A;  1N36 T;  3PS9 A;  2L9Q A;  3CN8 A;  3NZQ A;  5KMQ A;  1KK7 A;  4GRT A;  3L09 A;  1PBC A;  4JI1 T;  4JUY A;  2CLY C;  4JEU B;  5HXH A;  5KMS A;  2RS3 4;  3C51 A;  1D4M 4;  4IGU A;  1CUN A;  4REK A;  4NXM T;  2HHH T;  3AA1 B;  3RIU A;  4CI2 B;  2K24 A;  3QB5 A;  3NN6 X;  2LEH A;  3IHG A;  2BKN A;  4ILC A;  2IUB A;  2ODV A;  2EQ7 A;  4IVO B;  4U8P A;  1PXB A;  5U1O A;  2WP6 A;  4YFS A;  1IJ6 A;  3I9Y A;  1ZDL A;  1N33 T;  5IQ4 A;  3AEE A;  1JRX A;  2FJA A;  2X50 A;  5L3D B;  3ZYX A;  2R6G F;  5CA1 E;  1BGN A;  4A6N A;  4IDZ A;  2XVE A;  3II4 A;  4IVM B;  4GKJ T;  2Q9Q D;  4ZS3 A;  4P1N A;  2BKP A;  4CZZ B;  4ZCD A;  1HCI A;  3FXD B;  4BJN A;  1HF8 A;  2BVM A;  3P8C D;  2Z5Y A;  2Y6Q A;  2R46 A;  3CWZ B;  3C4N A;  2LM9 A;  3B6D A;  2XFU A;  2CWY A;  1F8W A;  3NHO X;  2LRL A;  3EDV A;  3UUX B;  5JDN A;  2BVL A;  2WY2 A;  2E9X B;  2Q9Q C;  2H88 A;  1JNZ A;  4Z8X A;  4ZI3 D;  1UX4 A;  3CNP A;  3LOV A;  4A56 A;  3EAM A;  4HN9 A;  1NAA A;  3SZW A;  4O5U A;  2M6I A;  4JI8 T;  2XLT A;  2R0P A;  2IC6 A;  2GR2 A;  2VKO A;  4PK4 A;  3ZEF B;  3DK9 A;  4X66 T;  4CXY A;  1E1M A;  4DV1 T;  2VL0 A;  3F57 A;  3IHR A;  2G0U A;  3KFW X;  2UU9 T;  3CTY A;  5HY5 A;  5FVL A;  1GRE A;  2WPE A;  4XBF B;  1QLB A;  1OED A;  3EHZ A;  4EIW A;  3GRT A;  2VKD A;  5JR9 A;  1BR2 A;  1KEY A;  3QK6 A;  3IBP A;  2XLU A;  4BK1 A;  5JDL A;  1RUJ 4;  3SUC A;  4CXX A;  2BAC A;  2XLS A;  3VKG A;  4YJ3 E;  4A99 A;  5GSN A;  4D04 A;  4L5G A;  5EB5 A;  3Q5D A;  4HFV A;  1ZMC A;  2C73 A;  3C96 A;  3K3N A;  2F5Z A;  4LA1 A;  4KX6 A;  5J2U E;  2I0M A;  5JCN A;  5JDG A;  4AKR B;  3DK8 A;  5LMU T;  4TNW A;  1LQT A;  3HYW A;  3RIA A;  1AR8 4;  2HWC 4;  4C91 A;  4BJZ A;  3CKD A;  1ZKQ A;  2DLR A;  1RUD 4;  3EI0 A;  3OTO T;  1SE7 A;  2B1E A;  4KHP T;  2WES A;  3PTR B;  3P4Q A;  3RQW A;  2BBH A;  3KDS E;  2O9Z A;  1NDA A;  5LGU B;  3NTA A;  4APN A;  4JI2 T;  3AYI A;  4TV9 E;  3ZDN A;  4YTP A;  2LFC A;  3CNJ A;  3VRB A;  2J1D G;  5JDF A;  1ZK7 A;  2YG7 A;  5IUX A;  4CCQ A;  3JAF A;  4LF6 T;  3GA8 A;  4UV8 B;  3GMB A;  3AEC A;  4CN1 A;  4EZH A;  3GWF A;  2LJL A;  4UDR A;  1MMG A;  3E08 A;  4LFA T;  2ZM6 T;  1E39 A;  5U63 A;  3D1C A;  2C5J A;  2PLV 4;  3HKB E;  2R4J A;  4GDE A;  2QAE A;  2SPC A;  1S94 A;  5AQP B;  5ABF B;  2YDR A;  4H4T A;  2YVG A;  4K5S A;  5FMH A;  4ANJ A;  4UP3 A;  4XWZ A;  2EHO B;  3S61 A;  2RGH A;  3S4U A;  4JY2 A;  4BA9 A;  1E1H B;  4G9K A;  3LJC A;  4II3 A;  4LF8 T;  3GQH A;  2VZ2 A;  5LJM A;  3KKJ A;  3ONX A;  5AQV B;  1D1C A;  2V5Z A;  2BXR A;  3HYV A;  3TLS A;  1CJ2 A;  5H6Q B;  3CVR A;  2GRT A;  5HWX A;  3NYF A;  2R07 4;  4TV8 E;  3OC4 A;  2ES0 A;  3I0Q A;  1DJN A;  2X9H A;  3NIX A;  3F2E A;  1GES A;  1ZY8 A;  2LT3 A;  2MYS A;  3RED A;  1MIY A;  1H84 A;  2JB1 A;  4DR7 T;  4ADZ A;  2E1M A;  4NTD A;  3RLF F;  4DR1 T;  5JDM A;  2V61 A;  4UF0 A;  1NG3 A;  4H7U A;  3B13 A;  2PFV A;  1FIO A;  2V1D B;  5CJ5 A;  3KIN B;  1POV 0;  3ANW A;  3MKD A;  5FXX A;  5LBM A;  4CY8 A;  5AQR B;  4GKK T;  3RRC A;  1RP0 A;  2R04 4;  2CWO A;  3UTH A;  1Z7S 4;  2YKS A;  5FS7 A;  2JIW A;  3H4K A;  2PZS A;  4DVD A;  4DV2 T;  5JCK A;  4HEA A;  2WPC A;  5ADX L;  2WEU A;  4H9P C;  3L1R A;  3M3Z B;  4N9X A;  2XFN A;  4NPP A;  3VU7 H;  2QYW A;  1D4E A;  5FS9 A;  2BK3 A;  3A5X A;  5ABH A;  4LMK A;  3P9U A;  4ECH A;  2YQU A;  4I55 E;  1H82 A;  4EZ4 A;  1VCT A;  1LRZ A;  4YY3 T;  3UKA A;  3RIF A;  2X9W A;  3KPF A;  2TPR A;  5GRT A;  1GAL A;  3ALL A;  3SZF A;  1MQT D;  1CL0 A;  3Q9D A;  3AAI A;  3ZLI A;  1OOP D;  4MLK A;  3JD7 4;  2V6Y A;  3JCF A;  1XPQ A;  1M62 A;  1KF6 A;  4AXP A;  1Y0P A;  1SHZ C;  1OJC A;  5FL1 A;  1H81 A;  4II2 A;  4B3R T;  2L3L A;  4Z2U A;  3CPZ A;  4M1P A;  5JCL A;  2DL1 A;  2WSS V;  2RM2 4;  4EV6 A;  1K0L A;  4H4Q A;  5LG4 A;  4JI7 T;  2W66 A;  2BC1 A;  2FBW A;  1EAH 4;  2XAJ B;  1TYT A;  1HYU A;  4WZX A;  2V7J A;  3L3P A;  2NTY A;  3G5R A;  2MAW A;  4U33 A;  2YR6 A;  2GF3 A;  1ZKE A;  5FL0 A;  1W09 A;  4XXG A;  4H4P A;  2RS5 4;  4HWD A;  2A8X A;  2Q9Q B;  3IHM A;  5LMN T;  4G6H A;  1HTJ F;  5KNL A;  2TMD A;  4EIP A;  2CXL A;  2OAL A;  4TLX A;  4BK3 A;  1BZL A;  3NBX X;  2EX3 A;  2LHR A;  5L2L A;  4WW0 A;  2W2U A;  3EPT A;  2LRK A;  2VKJ A;  4CRT A;  1R08 4;  3GWD A;  5JTG A;  4EGW A;  3ZN0 B;  1KDG A;  3FXE B;  4H4W A;  2JQH A;  3KV6 A;  3LK2 B;  5TAO A;  2GK9 A;  1CC6 A;  4B65 A;  2KIN B;  4DSH A;  2L8K A;  2W00 A;  2XDO A;  2CXF A;  3OZ2 A;  2ACX A;  1NEN A;  2CDU A;  4DO0 A;  4CN4 A;  2CHO A;  1Q9I A;  2AXD S;  3ETV A;  3AVS A;  3TLT A;  5HYA A;  3LB8 A;  3A7M A;  5AQF B;  3KVE A;  4DR2 T;  2V7M A;  1O5W A;  1X79 A;  1Z0P A;  3NH3 X;  4NUU A;  4YTN A;  4H9R C;  4KMC A;  4JBW F;  2HWB 4;  1G8X A;  2BS2 A;  5LYJ E;  3E0Z A;  2HN2 A;  3PDY A;  2J4G A;  3RKO A;  3DJJ A;  2LKG A;  3AAE B;  4HWI B;  2IAK A;  1VBD 4;  2HH7 A;  1DOC A;  3BNU A;  5LHI B;  2B7S A;  1UCU A;  3LDQ B;  1ZHC A;  3I9W A;  3P4P A;  2NVK X;  1KSS A;  2EQ6 A;  1PHH A;  2LLY A;  4WBO A;  4X62 T;  2VRL A;  1P2E A;  2E9X A;  4CY6 A;  2P9B A;  3ZMV B;  2QGS A;  3UOV A;  3HKD E;  2CE7 A;  1IUW A;  4DSG A;  1MO9 A;  3FBZ A;  1K4Q A;  3NYE A;  3B57 A;  3P1W A;  3ZKR A;  2WWV A;  2ZM8 A;  4HWH A;  5AFU L;  1ZP0 A;  4LML A;  2D2S A;  4UVB B;  3O1H A;  1NCQ D;  3OKQ A;  1BR1 A;  5IYZ E;  1DOB A;  4H2P A;  4JN9 A;  5KMR A;  4X9M A;  2VUR A;  5L3E B;  1F8R A;  3KVA A;  4E0V A;  3KPK A;  2W61 A;  4DV0 T;  2QA7 A; 
#chains in the Genus database with same CATH homology
 1P2H A;  1EL9 A;  1N1P A;  4NZH A;  4U8M A;  3P4R A;  2C3C A;  1E7P A;  2EQ9 A;  4EQX A;  2BXS A;  1ZOY A;  1QJD A;  3GYI A;  4H2N A;  1NHQ A;  3RNM A;  3EAN A;  1GTH A;  1VG0 A;  2R4E A;  2JAE A;  1L0V A;  5KMP A;  4J34 A;  3PS9 A;  3CN8 A;  2XFO A;  5KMQ A;  4YSZ A;  3DME A;  3AE3 A;  3JSK A;  3QSM A;  4J2W A;  4OPL A;  4GRT A;  2GR3 A;  1PBC A;  3RHA A;  2GB0 A;  1FEB A;  1K0I A;  4Z2R A;  3T2K A;  1B37 A;  5KMS A;  4YT0 A;  3AED A;  1ZOV A;  4REK A;  1YQ4 A;  3T37 A;  1YY5 A;  3SZC A;  5IQ1 A;  1PBD A;  1EL5 A;  2YLZ A;  3QFB A;  1GET A;  5FS8 A;  3UOY A;  3EAO A;  3V76 A;  4A6N B;  3M13 A;  3UKH A;  4BJY A;  3NN6 X;  4U8N A;  3VR9 A;  1TDN A;  2X8G A;  3IHG A;  2WQY A;  4X9N A;  3NK1 X;  2YR5 A;  3F8D A;  3V3N A;  4A79 A;  3T2Y A;  2EQ7 A;  3GDP A;  4IVO B;  4U8P A;  1D4D A;  1PXB A;  3HYX A;  4DNA A;  1OJA A;  3ATQ A;  2WP6 A;  3NN0 X;  5U1O A;  2YM1 A;  4KPR A;  3UTG A;  4EQW A;  3LAD A;  1CJ4 A;  1TDE A;  1ZDL A;  5U25 A;  1E1N A;  5IQ4 A;  2C66 A;  2GQF A;  3AEE A;  1GRG A;  1FEC A;  1JRX A;  4EIQ A;  2FJA A;  2X50 A;  4RG3 A;  3ZYX A;  3ALM A;  1BGN A;  1W4X A;  4C77 A;  1Y56 B;  4A6N A;  4JDR A;  3CGD A;  4OPD A;  1IUS A;  2V6O A;  3AEF A;  2XVE A;  3II4 A;  1EL7 A;  4IVM B;  4Z2T A;  1GER A;  1CC4 A;  1D5T A;  2X3N A;  1N4V A;  4ZCD A;  2QA2 A;  5BUK A;  2WPF A;  1Q1W A;  3NNE A;  3CPJ G;  2WU2 A;  1XDI A;  5C2T A;  3DH9 A;  2AAQ A;  2Z5Y A;  3BI2 A;  3FPZ A;  3SQP A;  2Y6Q A;  3UKL A;  2R46 A;  1L9E A;  1SEZ A;  4XWR A;  3AB1 A;  3C4N A;  2YG3 A;  3SM8 A;  3B6D A;  2XFU A;  1F8W A;  3NHO X;  2RGO A;  1D7L A;  3DJG X;  1DOD A;  3ISH A;  1VQW A;  1GXF A;  2DKH A;  1ZX9 A;  3F8P A;  3LZW A;  2H88 A;  1JNZ A;  2EQ8 A;  3AXB A;  4NTE A;  2DKI A;  1JOA A;  3AEA A;  3CNP A;  1IUT A;  3LOV A;  1KNR A;  3UTF A;  5EOW A;  1NAA A;  3SZW A;  4O5U A;  4WCT A;  1JEH A;  2XLT A;  4Y4L A;  2R0P A;  2GQW A;  1LTX R;  1KNP A;  2GR2 A;  3NGC X;  3DK9 A;  1QO8 A;  3AYJ A;  3QSE A;  2YR4 A;  3VQR A;  1PJ7 A;  1E1M A;  3NK2 X;  3KU9 A;  3FMW A;  1F6M A;  1DNC A;  3LJP A;  4G6G A;  2BK5 A;  5BVA A;  3KD9 A;  3CTY A;  1KSU A;  3EF6 A;  5HY5 A;  2B7R A;  4TM1 A;  1GRE A;  2WPE A;  2YM2 A;  3AE9 A;  1QLB A;  3DJE A;  1GND A;  5BRT A;  4K7Z A;  1AOG A;  5BUL A;  3GRT A;  4H4S A;  2GMJ A;  1D4C A;  3GQK A;  3QVP A;  2C4C A;  2Q0L A;  1BGJ A;  1RYI A;  4HB9 A;  4USR A;  3QSS A;  4YWO A;  1GRB A;  3AE7 A;  2FJD A;  1O94 A;  2QA1 A;  2XLU A;  4JY3 A;  4AP1 A;  3CPH G;  2VQ7 A;  3CPI G;  4BK1 A;  3SUC A;  2BAC A;  2XLS A;  2WOI A;  3M12 A;  4A99 A;  4AOS A;  1CJ3 A;  5GSN A;  3K30 A;  1ELI A;  2QCU A;  4D04 A;  5EB5 A;  4B69 A;  1OJT A;  2R9Z A;  1ZMC A;  2C73 A;  2XFQ A;  2CVJ A;  3C96 A;  3G5Q A;  4LA1 A;  2F5Z A;  4A5L A;  4KX6 A;  4Z44 A;  4Y4M A;  4YSY A;  1EL8 A;  2APG A;  2XVJ A;  3UP5 A;  5JCN A;  3SY4 A;  3DK8 A;  2CUL A;  1LQT A;  4AT0 A;  3HYW A;  4EM4 A;  4Z43 A;  1XAN A;  4OPI A;  3ICR A;  1H7W A;  4G74 A;  2R0C A;  1FOH A;  5CQF A;  4BJZ A;  3IF9 A;  2B76 A;  2V3B A;  1ZKQ A;  2YLR A;  4U2S A;  3K7Q X;  3UKF A;  4A65 A;  2XVF A;  5KOX A;  2WDR A;  3AE6 A;  4J31 A;  1VDC A;  2VRM A;  4ICY A;  1ZMD A;  2BCP A;  4OPT A;  2WES A;  4EQR A;  3P4Q A;  2C67 A;  4HA6 A;  4EMI A;  4K2X A;  2WOW A;  3RP7 A;  1GEU A;  1Z6L A;  3CGE A;  4Z25 A;  1LPF A;  2OLO A;  2C70 A;  3VR8 A;  2O9Z A;  1DJQ A;  1NDA A;  2AR8 A;  1VRQ B;  2Z5X A;  3NTA A;  4FDC B;  4U8O A;  4APN A;  2HQM A;  1S2Y A;  4O5Q A;  3AYI A;  3ZDN A;  4YTP A;  1PBE A;  2LFC A;  2Y6R A;  3CNJ A;  3VRB A;  4C5O A;  1NHS A;  1ZK7 A;  2YAU A;  3SYI A;  3CGC A;  3IC9 A;  4OPG A;  3B3R A;  5M10 A;  2VVL A;  4B64 A;  2YG7 A;  5LV9 A;  1NHP A;  1PDH A;  4K8D A;  3VRA A;  4CCQ A;  2ZZ0 A;  3SFD A;  3URH A;  4U2T A;  2YLS A;  3GMB A;  2RAB A;  1COY A;  3AEC A;  1F3P A;  4YKF A;  2GVC A;  3GWF A;  3GYX A;  2WP9 A;  4UDR A;  3SX6 A;  4WX1 A;  1E39 A;  5U63 A;  4B68 A;  3D1C A;  2JK6 A;  1V59 A;  2BRY A;  1NEK A;  2FJE A;  2WDV A;  1F8S A;  4A7A A;  4K22 A;  4RSL A;  1IUU A;  2R4J A;  2WP5 A;  4GDE A;  2QAE A;  4H4T A;  4FK1 A;  4YKG A;  2YVG A;  3CND A;  4K5S A;  4RG4 A;  5FMH A;  4PAB A;  2GR1 A;  2YVF A;  2ACZ A;  4UP3 A;  4IA5 A;  4XWZ A;  3VRD B;  1GTE A;  4EQS A;  3DGZ A;  1IUX A;  3S61 A;  2RGH A;  4OVI A;  2YG5 A;  4J36 A;  5FS6 A;  2BS4 A;  5C3J A;  1LJ1 A;  1S3B A;  4JY2 A;  4G9K A;  4II3 A;  1PJ5 A;  3DGH A;  4BUR A;  3GQH A;  2VZ2 A;  3CGB A;  3CNT A;  3KKJ A;  5J60 A;  1X31 B;  2V5Z A;  2BXR A;  3HYV A;  3UCL A;  1CJ2 A;  5KVH A;  2B9X A;  1JRY A;  1N4W A;  3Q9T A;  4JQ9 A;  2GRT A;  3AEG A;  2VVM A;  2VQB A;  2R0G A;  4TM4 A;  3NYF A;  1YKJ A;  3OC4 A;  2XYO A;  1L9C A;  2B9Y A;  2GH5 A;  4H4V A;  4LII A;  1PN0 A;  1DJN A;  3AD9 B;  3ATR A;  3NIX A;  5HHF A;  2ZZB A;  3ADA B;  3E1T A;  1ZY8 A;  1GES A;  1FCD A;  1LV0 A;  3DA1 A;  3RED A;  5KVI A;  1PS9 A;  2GEW A;  1H84 A;  4EM3 A;  2JB1 A;  2BRA A;  3FBS A;  2E1M A;  2YVJ A;  1VG9 A;  4NTD A;  4CNK A;  1K0J A;  2GMH A;  2V61 A;  3BHF A;  1NG3 A;  4H7U A;  4OPC A;  2XVI A;  3GRS A;  5ER0 A;  1GRH A;  2H89 A;  2W0H A;  1TRB A;  1DXL A;  3NLC A;  4H50 A;  3AE4 A;  2C65 A;  4H4Y A;  4EMW A;  4CY8 A;  4MJW A;  4M52 A;  2BYB A;  2BC0 A;  3UKP A;  3ABV A;  3Q6J A;  4JNA A;  1H6V A;  4B67 A;  1FEA A;  4GF7 A;  2NPX A;  1PXA A;  4CNJ A;  1M6I A;  1RP0 A;  4YSX A;  3UTH A;  4GCM A;  5FS7 A;  1IUV A;  2CFY A;  3H4K A;  3ALJ A;  4D03 A;  1CF3 A;  4CBQ A;  1EBD A;  2JBV A;  5JCK A;  5KXJ A;  2WPC A;  3HZL A;  2C7G A;  5JCM A;  2WEU A;  3L1R A;  3COX A;  4N9X A;  2XFN A;  2I0Z A;  2J3N A;  3BNM A;  2ZBW A;  4GUV A;  4JNQ A;  4EMJ A;  4C3Y A;  1D4E A;  2A87 A;  2BK3 A;  2C72 A;  4FX9 A;  5FS9 A;  1H7X A;  5KRQ A;  1GV4 A;  3FG2 P;  3P9U A;  4B63 A;  3T2Z A;  2JB3 A;  2WS3 A;  4ECH A;  1H83 A;  2YQU A;  3NKS A;  4U8L A;  2GAH B;  3UKK A;  2YG6 A;  1H82 A;  2YLW A;  4H4Z A;  4OPU A;  2YWL A;  4GDP A;  3UKA A;  1L9D A;  3UOX A;  3S5W A;  3G5S A;  3KPF A;  2TPR A;  5GRT A;  4UDQ A;  1GAL A;  4TM3 A;  3ALL A;  3SZF A;  2WDQ A;  1CL0 A;  2AQJ A;  5JCI A;  4U8J A;  1TDF A;  1GRA A;  1CJC A;  1XPQ A;  1NG4 A;  1KF6 A;  1Y0P A;  3GYJ A;  1GSN A;  1NHR A;  2X8C A;  4CCR A;  1JU2 A;  1OJC A;  4I59 A;  4NTC A;  3QJ4 A;  4J56 A;  3DK4 A;  2XFP A;  3K7T A;  1H81 A;  4U2L A;  4H4R A;  2WU5 A;  1MXT A;  1OJD A;  3P4S A;  3NG7 X;  4II2 A;  4U8I A;  4BV6 A;  4Z2U A;  4NWZ A;  2C64 A;  4ADW A;  3AE1 A;  2YG4 A;  5JCL A;  3I3L A;  1K0L A;  3T31 A;  4H4X A;  1XHC A;  4H4U A;  2GV8 A;  3KLJ A;  2Q0K A;  3F8R A;  4H4Q A;  1ONF A;  2BC1 A;  2VVL G;  2FBW A;  1REO A;  5TR3 A;  1JNR A;  1M64 A;  2ARD A;  3BI4 A;  3AE8 A;  3V3O A;  1E1K A;  1TYT A;  2C75 A;  1HYU A;  1UKV G;  2XLR A;  2X8H A;  1GOS A;  3G5R A;  3M0O A;  1PJ6 A;  2GF3 A;  1N4U A;  2YR6 A;  4NEW A;  3ICT A;  5HXI A;  1YQZ A;  3GDN A;  3IWA A;  4Y4N A;  1OJ9 A;  3WE0 A;  3D8X A;  4H4P A;  4XXG A;  4A9W A;  1S2Q A;  2XLP A;  1DOE A;  5EB4 A;  2JKC A;  3AE2 A;  2A8X A;  3NYC A;  3IHM A;  2BA9 A;  4G6H A;  3SZ0 A;  5KOW A;  5KNL A;  2TMD A;  1BKW A;  4EIP A;  4TLZ A;  3SXI A;  2OAL A;  1GT8 A;  4GAP A;  2E5V A;  2BAB A;  1B8S A;  4UDP A;  4TLX A;  3SGL A;  1CHU A;  5IPY A;  4LU6 A;  3CMM A;  1H86 A;  4BK3 A;  1BZL A;  2XCG A;  4ZN0 A;  4J57 A;  3H8I A;  1B4V A;  3EPT A;  3AWI A;  3GD3 A;  4CRT A;  3GWD A;  3LXD A;  1KDG A;  4OCG A;  1LQU A;  1RSG A;  4H2R A;  3QVR A;  4FK1 C;  1B5Q A;  3O0H A;  4YSH A;  1GPE A;  2X99 A;  4H4W A;  1CC6 A;  1Q1R A;  2OAM A;  4X4J A;  4B65 A;  1YQ3 A;  4DSH A;  2IID A;  4USQ A;  2YLX A;  4G73 A;  1E1L A;  1IJH A;  2XDO A;  3I6D A;  1CBO A;  3OZ2 A;  3ICS A;  4U8K A;  5M0Z A;  1NEN A;  1CC2 A;  2PYX A;  1TYP A;  2Q7V A;  3RP6 A;  2CDU A;  3AD7 B;  2YLT A;  1E6E A;  3FIM B;  4P9S A;  1Q9I A;  1Y56 A;  2BK4 A;  3UTE A;  3SFE A;  4AP3 A;  3KA7 A;  4C3X A;  5HYM A;  2C76 A;  2ZZC A;  3R9U A;  3LZX A;  3QFA A;  3UOZ A;  2JB2 A;  3LB8 A;  5KWF A;  3KVE A;  2V3A A;  4TM0 A;  1O5W A;  3NH3 X;  3RP8 A;  1LVL A;  4YTN A;  2B9W A;  4B66 A;  2C3D A;  2GR0 A;  1TDK A;  1GRF A;  2BS2 A;  2XVH A;  4YTM A;  4AOX A;  4I58 A;  3DJJ A;  4IA6 A;  2Q6U A;  3C4A A;  4K5R A;  4NNJ A;  3ITJ A;  5EBK A;  1BWC A;  1DOC A;  3GSI A;  2V60 A;  3BNU A;  4GAV A;  2IVE A;  2GAG B;  3BI5 A;  1NPX A;  2OA1 A;  2VOU A;  3K7M X;  3BHK A;  3CNS A;  2B7S A;  1PXC A;  1S3E A;  2NVK X;  3NK0 X;  4C74 A;  3P4P A;  2BS3 A;  1KSS A;  2EQ6 A;  1PHH A;  5DBJ A;  4DGK A;  3AE5 A;  1KFY A;  2VRL A;  1P2E A;  3PVC A;  2FJB A;  5CKU A;  4CY6 A;  1BF3 A;  3H8L A;  2IVD A;  2WBA A;  2OLN A;  4B1B A;  1TDO A;  1JRZ A;  2BCG G;  2RGJ A;  3PO7 A;  4J33 A;  4ZCC A;  3UOV A;  2WOV A;  1IUW A;  4DSG A;  1MO9 A;  1K4Q A;  3NYE A;  3AYL A;  3P1W A;  3UKQ A;  2WET A;  1FL2 A;  5J7X A;  4BK2 A;  1PBF A;  4NEV A;  1ZP0 A;  1GRT A;  1O95 A;  3T14 A;  4IV9 A;  3UP4 A;  4H2Q A;  4YXD A;  2WHD A;  4AT2 A;  1D7Y A;  5KMR A;  1DOB A;  4H2P A;  3CIR A;  4JN9 A;  3GMC A;  2A89 A;  2PHH A;  1PBB A;  3NT6 A;  3NTD A;  4X9M A;  2UZZ A;  2R45 A;  3DJD A;  3AD8 B;  3GD4 A;  3NRN A;  4GR1 A;  3AEB A;  1MOK A;  4Z26 A;  1F8R A;  4PAA A;  4Z24 A;  4E0V A;  3KPK A;  3T0K A;  5L46 A;  3L8K A;  2E4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...