1CHUA

Structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
532
structure length
478
Chain Sequence
NTLPEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMHDISTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPSILSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-ASPARTATE OXIDASE)
publication title Structure of L-aspartate oxidase: implications for the succinate dehydrogenase/fumarate reductase oxidoreductase family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Flavoenzyme
total genus 152
structure length 478
sequence length 532
ec nomenclature ec 1.4.3.16: L-aspartate oxidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 1chuA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1chuA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1chuA02
2FBWA 3DGHA 1LVLA 2NPXA 2RGOA 3NK1X 1VDCA 4J34A 1GERA 5FMHA 3EAOA 1MOKA 1JNZA 2VVLA 4AOXA 3ATRA 1PJ6A 5C2TA 2BACA 3CNJA 2HQMA 2WDRA 2VQ7A 3KA7A 3M12A 4YTMA 3QSSA 4UDPA 1K4QA 1LJ1A 2F5ZA 1PBBA 3IC9A 2A87A 3K7MX 3RHAA 4EM3A 1TRBA 5U1OA 4NZHA 2R45A 3DK4A 1QJDA 2Q6UA 5EB4A 4OPGA 1F6MA 1Z6LA 4U2TA 2V60A 4X9NA 3SFDA 3AD9B 4OPUA 1KNPA 2QA1A 4ZCCA 3RP6A 1GREA 4LU6A 1Y0PA 4X4JA 2NVKX 2C64A 4J33A 2GF3A 1D7YA 1CC2A 2WU5A 1BGNA 1PXAA 2C73A 1NHSA 4H2NA 4AP3A 1CF3A 3CPJG 2TMDA 2I0ZA 2R4JA 1NEKA 2WP9A 2YLRA 3G5SA 3P9UA 4CNJA 3QVRA 3GDNA 4EQSA 2YLXA 3P4SA 1V59A 3C96A 3EPTA 4GCMA 3P1WA 1H86A 2GMJA 4U8LA 2XYOA 4YSHA 4CY6A 3UKKA 4H4SA 2GAGB 3KPFA 3LB8A 4K2XA 5CQFA 4YSYA 2Z5XA 5M0ZA 2LFCA 4U8KA 1O5WA 3P4PA 2OALA 4K8DA 4H2RA 1JRZA 2YR5A 3T37A 2GVCA 4GDEA 2V3BA 1ONFA 2XLTA 3QFAA 4FX9A 3UTEA 2E5VA 3O0HA 3FG2P 2WS3A 4UP3A 3COXA 3NRNA 2WPCA 1GRHA 1FL2A 1B37A 1H83A 1JEHA 2YG7A 2BC0A 1GRGA 3AYIA 3QVPA 4OPDA 2R0PA 2R0GA 2BABA 3LZXA 3K30A 4XWZA 3QFBA 2XFUA 2CULA 4TM4A 3SGLA 4H7UA 3UKLA 3UOYA 3NYCA 2BXRA 4I59A 4J57A 1COYA 3NYEA 1DJNA 4GRTA 3AEBA 1GV4A 3DJJA 4H4YA 3L1RA 4A79A 3G5QA 4OPIA 2GR3A 4D03A 3VQRA 4A6NB 5KOWA 2IVDA 4U2SA 5EB5A 2Q0LA 2X50A 3PVCA 1NG3A 1L9EA 2Q7VA 1VRQB 4A65A 1E39A 3ADAB 1PJ5A 4TM0A 2YLSA 2APGA 2ZZ0A 5BVAA 2WETA 1D7LA 1NDAA 2H88A 2YG5A 3NN6X 3UOZA 2BCGG 4J56A 2WOWA 2VVLG 1IUXA 3NLCA 2B9WA 2V5ZA 3QSEA 4EMWA 4YTNA 1DXLA 1FEAA 2WPFA 5IPYA 1E7PA 1N4VA 2JKCA 2IIDA 2YR6A 2BK3A 5TR3A 3CPHG 4Y4NA 3QSMA 4RSLA 4Z24A 3AE6A 1F3PA 1YY5A 3RNMA 2C70A 3BHKA 3KVEA 2V6OA 2C75A 1CJ3A 4H4UA 2ACZA 4JNAA 4Y4MA 2V61A 3RP7A 4C77A 2Q0KA 2XFNA 3AB1A 4CCRA 3AE4A 3NYFA 2R46A 4NTCA 3VRDB 1OJDA 3VRBA 4PAAA 1ZMDA 2GR1A 3UTFA 1XDIA 3S61A 1DOBA 4BV6A 2YM2A 2JB1A 3E1TA 4B66A 5J7XA 1IUVA 1DOCA 1GTEA 2QAEA 1K0LA 4H2QA 5FS8A 4CBQA 4WCTA 4B64A 1S3BA 3GD3A 3EF6A 2B7RA 2ZBWA 4Z2TA 2FJBA 1IUWA 5BULA 4KX6A 3CTYA 1IUUA 2VVMA 4U8JA 4IA6A 2B7SA 4DSGA 1KDGA 2OAMA 3ICSA 3ALLA 5JCLA 1GETA 2JB2A 5M10A 4EIPA 4A5LA 3V76A 1XPQA 4TLZA 3CGDA 4B63A 1S2YA 4NEWA 1PXBA 1CC6A 4RG4A 4YSZA 2OLOA 2EQ6A 1GRFA 2Y6QA 3NT6A 4IVOB 2WHDA 3PS9A 4USQA 1ZY8A 1ZOYA 2Y6RA 1DODA 4YTPA 3C4NA 4NEVA 5JCKA 2XFOA 2JK6A 1CHUA 3SFEA 3BI2A 3GD4A 4P9SA 3IHGA 1CL0A 3KLJA 2PHHA 1GRBA 3AE2A 1Q9IA 3GRSA 5KOXA 4K7ZA 1MO9A 1E1MA 3BI4A 1H7WA 2TPRA 4ECHA 5BUKA 4AT2A 3GSIA 1EL5A 1EBDA 4MJWA 1UKVG 2C66A 1ZDLA 1FEBA 3G5RA 2ZZCA 1DNCA 3GWDA 4H50A 4CNKA 1BF3A 4CRTA 1BKWA 1EL7A 1JRXA 1QO8A 1YKJA 1L9DA 3ABVA 3CNTA 3FBSA 3QJ4A 3H8LA 1JRYA 2C72A 3LXDA 1IUTA 2AR8A 4GR1A 4APNA 2OA1A 3JSKA 4M52A 1QLBA 3UKPA 1E1NA 1M6IA 2XVHA 3AEEA 4BK3A 1N4UA 2AAQA 2JB3A 2YR4A 3KKJA 5GSNA 3UOVA 3F8RA 4C5OA 2H89A 1VG9A 3GYIA 4N9XA 4Z25A 3K7QX 3AWIA 4JY2A 1ZP0A 5CKUA 1GOSA 1FCDA 2GQFA 3CNPA 3LJPA 1K0IA 4U8OA 4TM3A 4U2LA 5KWFA 1LQTA 2XLUA 4PABA 5KVIA 4A6NA 1KFYA 4HA6A 2EQ8A 4EQWA 1PBFA 2GR0A 1TDNA 4WX1A 2YG6A 3KU9A 4XXGA 1KSUA 1BWCA 2O9ZA 2YVJA 3AE5A 2C3CA 2GR2A 4TM1A 1EL9A 2BXSA 3FPZA 4HB9A 3UTGA 4DGKA 2CFYA 5KVHA 2RABA 3UKHA 4YXDA 4E0VA 3EANA 3HZLA 3UCLA 4A99A 4C74A 1KNRA 3NTDA 2ZZBA 3K7TA 1XHCA 2A8XA 4C3XA 4OVIA 4B68A 1IUSA 1PHHA 1CC4A 4USRA 1TDEA 1RSGA 2WEUA 3DMEA 1FECA 3BNUA 4H4XA 1NHQA 3AEDA 3II4A 2YVGA 3V3OA 3CGEA 1KSSA 1H7XA 3GMCA 3DJEA 2YG4A 3NH3X 2BS3A 3AEAA 2WESA 4FK1A 1ZOVA 2VRMA 3C4AA 1P2EA 1TDOA 1KF6A 2GEWA 5HHFA 1ELIA 1E1KA 2R9ZA 5HXIA 3IWAA 3AE8A 3AEFA 1LTXR 1IJHA 2BA9A 2BK5A 2EQ9A 2R0CA 3NN0X 2GQWA 2B9XA 3UOXA 4OPCA 3AE1A 1L0VA 4CCQA 2BC1A 4EIQA 5BRTA 2X8HA 4A9WA 1P2HA 1NHRA 4FK1C 2A89A 3AYJA 5IQ1A 3D1CA 3DK8A 2GRTA 2XVFA 1DOEA 5U63A 4B67A 3VR8A 2ARDA 1XANA 4ADWA 5C3JA 4OCGA 3DJGX 2GB0A 1PDHA 2UZZA 2YAUA 4B69A 4EQRA 3UKQA 4IV9A 3NNEA 1GALA 3B3RA 1B8SA 3DJDA 3URHA 5IQ4A 1OJCA 2DKHA 3ITJA 4REKA 2CDUA 2C67A 3CNDA 2XVIA 2E1MA 5LV9A 3S5WA 1VQWA 3AD7B 3UP5A 3UP4A 2C65A 1B5QA 2WBAA 4D04A 1GRAA 3WE0A 4A7AA 1MXTA 1O94A 1GSNA 4H4TA 2W0HA 2X3NA 4H4ZA 3FMWA 3P4RA 3FIMB 3ATQA 3UKFA 4BURA 5J60A 4ICYA 1PN0A 1F8SA 2WP5A 4YKFA 1F8WA 3M13A 4H4VA 4AP1A 1O95A 1CBOA 4EM4A 2GH5A 2YG3A 2XCGA 2Z5YA 4H2PA 1CJCA 4YKGA 2WDVA 2BCPA 1H6VA 2OLNA 2YWLA 4AT0A 3NTAA 1W4XA 3CN8A 1M64A 4EMJA 3D8XA 2BS2A 1L9CA 5FS9A 5FS6A 4Z44A 1YQ4A 1D4EA 1TYPA 4DNAA 4U8MA 4U8PA 1JOAA 3L8KA 2VQBA 1NHPA 3CPIG 1EL8A 2WQYA 1ZX9A 2XLSA 1LPFA 2R4EA 1H82A 2J3NA 3GMBA 1D4CA 3V3NA 3H4KA 4JY3A 4I58A 1JU2A 4ZN0A 3DH9A 4BJYA 1OJ9A 3OC4A 4JQ9A 3OZ2A 3GRTA 3NGCX 2CVJA 4JDRA 1DJQA 4GDPA 3AEGA 2WPEA 3NK0X 3PO7A 1ZMCA 1Y56A 2EQ7A 3NKSA 1LV0A 1CJ4A 2GV8A 3CNSA 3GYJA 4H4WA 4RG3A 4DSHA 3RP8A 1AOGA 3BNMA 1E1LA 3P4QA 1REOA 3R9UA 2XFPA 4X9MA 2VRLA 4O5UA 4BK1A 4K5SA 2YM1A 4J2WA 2YQUA 1NAAA 2XVJA 5EBKA 1Q1WA 1TDFA 3M0OA 4H4QA 4J36A 5FS7A 1OJAA 1D4DA 2VZ2A 3GDPA 5EOWA 5JCMA 5KRQA 3DGZA 1PXCA 1S2QA 1N1PA 2BYBA 2BK4A 3ISHA 1PBDA 2E4GA 2WOIA 1PBEA 3AXBA 1GEUA 4Z2RA 2FJAA 3F8PA 3I3LA 4NTDA 5GRTA 3VRAA 3AECA 4NTEA 1NENA 3CGBA 1K0JA 2WOVA 2XLPA 1HYUA 2GMHA 1CJ2A 1F8RA 1NG4A 1Y56B 4EQXA 2C7GA 4JNQA 2VOUA 3UTHA 3REDA 4KPRA 1GNDA 3NK2X 4B1BA 1TDKA 4BJZA 1PBCA 2YLTA 2FJEA 1OJTA 1Q1RA 1GRTA 1GESA 3LOVA 3I6DA 2YLZA 4UDRA 2PYXA 4K5RA 4LIIA 3AE9A 3ICTA 3IHMA 4LA1A 3GYXA 3BHFA 3NG7X 3VR9A 1YQ3A 1PJ7A 2WP6A 4U8NA 4JN9A 4XWRA 4Z43A 1TYTA 3UKAA 2RGJA 4IVMB 3F8DA 4OPLA 1GXFA 4H4RA 1NPXA 1X31B 1LQUA 1SEZA 2YLWA 4C3YA 1N4WA 2IVEA 2XFQA 5KXJA 4Z26A 3GWFA 1H81A 3ZYXA 5L46A 5JCNA 1E6EA 2C76A 2QCUA 4GF7A 1B4VA 1S3EA 2V3AA 3Q6JA 4CY8A 4OPTA 3H8IA 3CIRA 2X99A 2XDOA 5U25A 4O5QA 2BS4A 1ZK7A 4H4PA 5DBJA 4TLXA 4Y4LA 1FOHA 3B6DA 4BK2A 4ZCDA 2YVFA 3BI5A 5HY5A 3AE7A 3AD8B 4YWOA 3NHOX 5JCIA 1JNRA 4AOSA 1VG0A 1D5TA 4J31A 2X8CA 1RP0A 3CGCA 3LADA 3SQPA 1BZLA 3NIXA 2GAHB 4B65A 1GPEA 2B9YA 2RGHA 2FJDA 2WU2A 3Q9TA 2JAEA 2DKIA 4U8IA 1GTHA 3ALMA 2QA2A 3AE3A 3IF9A 4IA5A 2WDQA 4FDCB 3DA1A 4YT0A 2XLRA 5ER0A 4Z2UA 4GUVA 3SM8A 4YSXA 3ICRA 2JBVA 1RYIA 1BGJA 1ZKQA 2X8GA 5HYMA 3ALJA 2AQJA 3ZDNA 1H84A 2XVEA 3LZWA 3DK9A 4UDQA 2B76A 2C3DA 3KD9A 4K22A 4EMIA 1PS9A 1GT8A 3AYLA 1YQZA
chains in the Genus database with same CATH superfamily
1LVLA 3NK1X 4DUZT 5FMHA 2V8SV 1MIWA 1NWMX 5C2TA 2VQ7A 5LGUB 1K4QA 1HG5A 3RHAA 5BR8T 4G63A 2M6IA 2XTLA 4P0BA 4PK5A 2Q6UA 2ES0A 2V60A 2LSGA 2LKGA 2VKJA 1GREA 1SE7A 2IHR1 4J33A 2MOZA 4ZHQE 1D7YA 1CC2A 2WU5A 1GQEA 2AXDS 2DI4A 5IHYA 3SS1A 1SHZC 2WP9A 4OYJA 5FY7A 4CNJA 3QVRA 3GDNA 3EPTA 2GMJA 2XYOA 2GAGB 3KPFA 3LB8A 4K2XA 4YSYA 2Z5XA 2YOEA 2OALA 5DJQC 4K0UA 2JQHA 3UTEA 5KX5E 3FG2P 2LSJA 4UP3A 4UV8B 4GK5E 1B37A 1T7SA 5TAOA 3E22E 1EZ3A 1JEHA 3T14A 3AYIA 1E1HB 3FZKB 4U7IA 5JR9A 2CULA 4I59A 1B7TA 4J57A 1UX4A 4EZHA 3NYEA 3PUVF 5AQUB 5C8YE 4GRTA 1GV4A 4FI5A 3G5QA 4OPIA 4D03A 3C4ZA 4A6NB 5KOWA 4IT4A 3AA0B 4X1YE 2Q0LA 4IDQA 1NG3A 2WAUA 1E39A 3RKOA 4TM0A 5IUXA 3F57A 1D0ZA 2YK0A 3K3OA 2CA5A 2BCGG 3T2KA 2VVLG 1IUXA 3NLCA 3QSEA 4ZZBA 2XJ7A 4HFCA 3O1IA 1N34T 3K3NA 4DR4T 1N4VA 2JKCA 2YR6A 2JRKA 2BK3A 2VQET 4UIGA 4UVCB 4IDPA 2E2AA 4RSLA 4Z24A 1HNXT 2V7IA 3KVEA 5L3BB 2X9WA 2XAFB 3U78A 1CJ3A 2ACZA 4Y4MA 1IBMT 2X66A 4AQYT 3RP7A 2XFNA 4CCRA 3AE4A 3NYFA 3T2ZA 3VRBA 3ZCIA 2GR1A 3S61A 1FIOA 4JI6T 3HKEE 4X62T 2JB1A 3LK2B 2WB5A 3WAJA 4H2QA 1T72A 4CXXA 2CMRA 1S3BA 2ZBWA 4Z2TA 2FJBA 5FY0A 3CX6B 2K24A 4KX6A 5EZYE 2B7SA 4TX5A 3ICSA 3ALLA 5LGTB 4GOUA 2YDSA 2ACXA 4B63A 4TLZA 2W61A 1UCUA 1HR0T 4RG4A 1O3XA 4IVOB 2CHNA 5HEOA 3C4NA 1ZOYA 4NEVA 1DODA 3BI2A 4JI3T 3T1YT 2VWAA 4F8HA 2PHHA 3N2OA 2E9XB 4K7ZA 1MO9A 2R6GF 3LBXA 5BUKA 3MKDA 4HEAA 1EBDA 4MJWA 2C66A 2ZZCA 3W15B 3PURA 2UXBT 1EL7A 1JRXA 4Q25A 3LG7A 3QJ4A 2DWGA 4GYRA 4PJJA 5KDMC 5ADXL 2C72A 4APNA 4M52A 4ZS3A 1N4UA 2YR4A 3UOVA 3LFMA 4O4LE 2Q9QD 1VG9A 1VRBA 3K7QX 3S4UA 3FHNA 4JY2A 1US7B 3PTRB 2GQFA 4U8OA 3LJPA 5KWFA 4TN7B 1LQTA 3BQLA 2Q9QC 2HN1A 5CB4E 4HA6A 2VQFT 4JBWF 3AAIA 4U31A 2PFVA 2HH7A 1KSUA 2YVJA 3AE5A 1EL9A 3FPZA 4DGKA 3UTGA 2RABA 4YFSA 1KNRA 2X0HA 3AA7B 4UF0B 2LHNA 3K7TA 1PHHA 1WR0A 4ZXLA 5LGNB 4LFAT 2LE8A 2QRXA 1TDEA 2WY2A 4NNJA 2D0UA 3DMEA 3UULA 3EUHA 3II4A 4EZ4A 5L4HA 3V3OA 3CGEA 1KSSA 1WYBA 3GMCA 2WWVA 5HXRA 3KV6A 3QB5A 3C4AA 1P2EA 1KF6A 1ELIA 1IBKT 5HXIA 2VL0A 1LTXR 2BA9A 2GQWA 4NUUA 2BC1A 4UEMA 3DK8A 2XVFA 4B67A 2F4VT 4ADWA 1XANA 2Y6XA 2GB0A 5LBQB 2UZZA 2M67A 2V26A 3EAMA 1GALA 1N33T 3C51A 4K0KT 1IBLT 2DKHA 4O8SA 3UU4A 4CXWA 2CDUA 4U7YA 2XVIA 3UP4A 1I6ZA 1FMVA 4F6RC 2XAHB 1GSNA 4UVAB 3X1DA 4JLEA 3FIMB 4HFDA 4ICYA 1F8SA 3PDYA 3G06A 4XZCA 2YG3A 2Z5YA 2K3WA 1CJCA 2OLNA 3CN8A 1M64A 3PJAJ 3D8XA 1L9CA 3N9QA 1YQ4A 5JRCB 3NWIA 5AQVB 4YJ2E 2BVMA 3SRZA 2R4EA 2WWUA 3N2KE 1D4CA 3PUZF 4L9IA 3H4KA 5AQSB 2BZBA 2LM9A 3OC4A 3OZ2A 3GMIA 2CVJA 2B1EA 4ADZA 1BR4A 4DV0T 1XMQT 2XM2A 1LV0A 3CNSA 4IDZA 1YW0A 3OPCA 3RP8A 2BDEA 4DMWA 1E1LA 4BK1A 2YM1A 5LBMA 5EBKA 3M0OA 4H4QA 5FS7A 2XM1A 5JDNA 4PJMA 3DGZA 1S2QA 4IE4A 3HYVA 3ISHA 4Z2RA 5L47A 2FJAA 3AAAB 3Q9DA 4ASKA 4PFPA 5GRTA 3LJCA 2VL8A 1CUNA 3K1SA 1NG4A 1D1AA 3P8CD 2VOUA 3REDA 3NK2X 3U3IA 1TDKA 4WYVA 1PBCA 3RYHE 1Q1RA 3QK6A 3GA8A 3LOVA 2XQ7A 4X20E 1J5ET 2KT9A 5J2UE 4LIIA 3AE9A 2CRBA 3IHMA 3BHFA 3VR9A 2A2FX 1ZEEA 4DUYT 5HEJA 2RGJA 4IVMB 2XAQB 3AVSA 1NPXA 2YLWA 4DR6T 5FP3A 4LF6T 4Z26A 1QUUA 2V1DB 5L46A 4IE5A 2Z6EA 3Q6JA 3NKZA 2X99A 2DNXA 5U25A 2VB6A 2LSKA 3KFWX 4HTEA 1ZK7A 4Y4LA 1FOHA 3ZCJA 5HEGA 2YVFA 5HY5A 2NW7A 3NHOX 5JCIA 4AOSA 1WCRA 4J31A 1HFAA 1J5WA 3L39A 3RLFF 3CGCA 3SYIA 4G2AA 4DV7T 2C4CA 2B9YA 3Q9TA 4AQGA 1Y01A 2DKIA 3AE3A 4E7ZA 3ZSTA 4FDCB 3DA1A 2XLRA 5AQHB 4HN9A 2J47A 1ZKQA 3ZMUB 5ABGA 2W63A 4NWZA 2B76A 4J2CA 4LFBT 3JAEA 1GT8A 1YQZA 3DGHA 2WSSV 2CLYC 1HG2A 1GERA 4B3ST 3Q5XA 2YDQA 2V6YB 3QB5K 3CNJA 4JI4T 2HQMA 3KA7A 3M12A 4UDPA 1LJ1A 2F5ZA 1PBBA 3DJBA 5U1OA 4NZHA 4A97A 4HWHA 4ZCCA 2XHEB 3FZMB 1Y0PA 5J1GA 4HGAA 1NHSA 1CF3A 3CPJG 2TMDA 1NEKA 3BQIA 3ZYLA 4GIWA 4LF4T 5F3JA 3OBVE 3AXJA 1V59A 3RC3A 4GCMA 2CWYA 2VKHA 1H86A 3WI3A 4IGUA 4YSHA 3UKKA 5CQFA 2UU9T 2LFCA 2A72A 1O5WA 4K8DA 4H2RA 2IC9A 2X9YA 4GDEA 1WLXA 2LEHA 5AQGB 1ONFA 2WS3A 5JTGA 2LJLA 4Z91A 1Z0PA 4B3MT 5EK3A 5LCYA 1FL2A 2HPLA 5FKYA 4H9SE 2Q9QB 2YG7A 3QNUA 2BC0A 1GRGA 3QVPA 3I9YA 4OPDA 2R0PA 2R0GA 4ISTA 2BABA 3LZXA 3QFBA 3VU7H 4DO0A 3SGLA 3UKLA 4MALA 1COYA 4QX8B 4A56A 4G74A 3AEBA 4H4YA 3L1RA 4XBFB 4P1NA 3T0KA 4GKKT 2L3LA 3FBZA 3PVCA 1SUMB 1L9EA 4QH4A 4EYYR 4A65A 3ADAB 2APGA 5JR9C 2YG5A 2H88A 1R8IA 2XPKA 3UOZA 2LSIA 5FXVA 3ZMTB 1BR0A 2B9WA 4EMWA 1DXLA 5IPYA 2KINB 2KWIB 1E7PA 1NAFA 5IYZE 4Y4NA 4IE7A 3QSMA 1YY5A 4YHHT 3BHKA 4EGWA 2V6OA 2MPKA 4X1IE 2JQQA 3A7MA 4GYSA 3AB1A 2R46A 4X65T 4U2YA 2WBLA 5AQOB 4PAAA 3UTFA 1E2AA 2CBJA 5LG3A 2QAEA 4B64A 3GD3A 3K8PC 1FEWA 1IUWA 1OWAA 5BULA 2UUCT 4HWCA 1IUUA 4PK4A 4QWNB 2N9DA 1GETA 5M10A 3F2EA 3SX6A 3ZN1B 2OLOA 1GRFA 2Y6QA 2RPAA 2WHDA 2CBIA 4U74A 4USQA 4YTPA 2XFOA 1CHUA 2EHOA 1CL0A 3KLJA 3DP7A 3N9LA 3UQ7A 5CA1E 5L3CB 2TPRA 5L2LA 4IE0A 2C5KT 5AQIB 1EL5A 3CPZA 4LMLA 1FEBA 3G5RA 1DNCA 3GWDA 4CNKA 1BF3A 2IC6A 4CRTA 5E0OA 1YD8G 1YKJA 4C90A 2W0GA 5FL0A 2AR8A 3ZKRA 3PU3A 3GN5B 1QLBA 3UKPA 4BK3A 4COFA 2JB3A 3F8RA 2H89A 4Z25A 3PJAA 4HFEA 1IJ6A 1ZP0A 5CKUA 2UXXB 1GOSA 1UK5A 4AKGA 4U2LA 2XLUA 3LSVA 4DR1T 4I4TE 1PBFA 2YG6A 3KU9A 3I9WA 2YKSA 1BWCA 2O9ZA 3NZQA 4HB9A 2CFYA 3RIUC 5KVHA 3AVRA 4KHZF 3TLWA 1HX1B 4E0VA 3EANA 3UCLA 4ZS2A 3NTDA 2A8XA 4KUMB 4OVIA 3CMLA 2XQ6A 5LMNT 3P7IA 2J4GA 2JQKA 4OFZA 3AEDA 3I0OA 2YVGA 1VCSA 4B6XA 3CVRA 2UUAT 3DJEA 2YG4A 3NRYA 2WESA 3B57A 3HR0A 3ZEFB 3MK7C 1U5PA 2JJ9A 5ABHA 2BKPA 2WMOA 5HHFA 1YXRA 2R9ZA 4DIDB 3IWAA 1W0AA 2BBHA 3JADA 3AE8A 2EQ9A 1UGOA 3UOXA 4OPCA 4EIQA 3HA4A 4A9WA 4PK6A 4JV5T 4ZZCA 3AYJA 5IQ1A 2E5LT 3D1CA 2GRTA 3ZT7A 1J1JA 1IZNB 5U63A 1XZYA 1OXZA 3UFEA 5C3JA 4AQFA 2XQAA 4OCGA 3DJGX 3T8OA 2YAUA 4EQRA 3UKQA 3B3RA 3DJDA 2XQ3A 4OHFA 4UV9B 5IQ4A 3J7Yq 5AFUL 1XNQT 4TWFA 4REKA 4IREA 4UR9A 2NTXA 4Z8XA 3SOLA 5LV9A 3AD7B 5JRCA 2WBAA 4NIQA 1MXTA 2W0HA 2HN2A 3OTOT 2M6BA 4JI2T 5J60A 2BG9E 4BURA 1XWMA 1F8WA 3FB2A 3EDVA 4H4VA 3LK42 1O95A 3PUYF 2NTYA 2XCGA 4H2PA 2WDVA 2BCPA 1H6VA 2YWLA 3LDQB 2OV9A 3CX8B 2I6HA 4EMJA 3PUQA 3ZYKA 5FS9A 4OK0A 5JREA 4Z44A 1KNZA 1HX8A 1TYPA 4DNAA 4U8MA 1IAPA 5F8PA 1EL8A 2RP4A 3ZPOA 1ZX9A 2CLYB 2D9DA 1LPFA 3GMBA 3V3NA 4L0RA 3VHLA 4JY3A 1T98A 4I58A 1JU2A 5JDGA 4JQ9A 2KMFA 3NGCX 2WPEA 3NK0X 3MXZA 3PO7A 1N32T 3GWHA 2IAKA 3AAEB 4DSHA 5HEHA 1MMNA 3SZFA 2YN6A 4YY3T 4HFBA 3CQCB 2G0UA 3KVBA 4X9MA 4O5UA 4K5SA 4J2WA 4ILCA 2XVJA 3H3MA 3KPKA 4TZ4C 2X51A 2VZ2A 4QH5A 3A8YC 3CWZB 5KMRA 1S94A 2BKNA 2BYBA 2XQ8A 4QHOA 4NTDA 4TV9E 4YHJA 4NTEA 2ZM2A 1Y56B 4N78D 4KPRA 3RI5A 1GNDA 2JIWA 2XASB 3HYXA 4B1BA 2MBGA 4GAVA 4BJZA 2DHRA 1GESA 1XDOA 3IHRA 5KMGP 3C4XA 3TLVA 3KBTA 3ICTA 3NG7X 1YQ3A 4XWRA 4Z43A 2MTQA 2WZHA 5FVKA 3WAKA 1TYTA 5JVDE 2WCAA 3ZN0B 2RA1A 2IVEA 2J62A 3VKGA 2XFQA 3LK3B 3FXDB 4LF9T 3UUBA 1E6EA 2QCUA 3PUGA 4DNDA 1MNDA 1B4VA 4LF5T 2V3AA 2YEVC 4OPTA 3H8IA 2P9BA 3RIAA 2XY8B 4LFCT 2XDOA 2LOPA 1XMOT 4BK2A 5JR9B 4II2A 3AE7A 4YWOA 2NWBA 4LMJA 2CHOA 1JNRA 1VG0A 2X8CA 2IMLA 2CXLA 2H7OA 2V6YA 5A1LA 3ZJ2A 5BMVE 2CE7A 2RGHA 3J9X1 3AA6B 3RRWA 1GTHA 5EK2A 3ALMA 3IF9A 3B13A 4TNVA 4GK0E 2JBVA 3C50A 3NBXX 2XVEA 3DK9A 4UDQA 2BG9B 4TV8E 1YKEB 2VURA 3AYLA 1FJGT 2RGOA 1VDCA 4CN6A 2UXDT 1MOKA 3HYWA 3UU8A 2VVLA 4AOXA 1PJ6A 2BRAA 2WDRA 3I0QA 2BBJA 3F31A 3IC9A 5KNLA 3K7MX 1X9BA 4HFIA 2N2NA 3N9OA 5KMPA 3DK4A 5EB4A 1Z6LA 4X9NA 4OPUA 2QA1A 2ODUA 4X4JA 5KMSA 2NVKX 5M4YA 2YU2A 2JPFA 2V6XA 2L8KA 1PXAA 2C73A 4AP3A 2I0ZA 1HCIA 2W66A 2YLRA 4AKRB 2CWOA 3G5SA 4O2AE 4EQSA 2YLXA 3N9NA 2XQ4A 3C96A 5CFBA 5IWAT 4GAPA 5M0ZA 2PBIA 3O1JA 5J2TE 3RYFE 3TKLB 3P4PA 1JRZA 2YR5A 3VKHA 5LJNA 4QXHB 2V3BA 3QFAA 4FX9A 1MMAA 1Z8UA 3NRNA 2WPCA 3RQWA 2LM2A 4QX7B 4JEUB 4WBOA 3K30A 4XWZA 5LOVE 4EYUA 3H3AA 4H7UA 5HAXA 1DJNA 2JMHA 3DJJA 4QKNA 4A79A 3PU8A 2GR3A 2IVDA 4U2SA 5EB5A 3IF8B 4O4JE 1WFDA 5CA0E 2Q7VA 1VRQB 1PJ5A 3CKDA 2YLSA 2KZ7B 2IDOB 5BVAA 3ANWB 2MAWA 3NN6X 4HWFA 2WOWA 5AQLB 4G6GA 2QGSA 4YTNA 5ABFB 2QVAA 3KBUA 5HXCA 3MA9A 5JH7E 4AI6A 3CPHG 3UT5E 1XDPA 4H9NC 4CI2B 3Q5EA 3O9XA 2W62A 2Y8DA 4A98A 2LOSA 2C75A 3CMMA 4H4UA 4JNAA 4C77A 2Q0KA 3SZCA 3N5LA 3P50A 4QH1A 4KI0F 4UXNB 5LHHB 3JC6D 5J7XA 1GTEA 4DR7T 2H7VC 5FS8A 2X9HA 4KMCA 2ZM6T 3FXEB 1OEDC 2B7RA 3NVOA 3CTYA 3JC6C 1I94T 2VVMA 2D0TA 4ERRA 2YDRA 4U8JA 2OAMA 4DSGA 4A5LA 2HPJA 1S2YA 1PXBA 1CC6A 1VCTA 4DV4T 3NT6A 2PG8A 5AQKB 2Y6RA 2JK6A 3SXIA 1M62A 4P9SA 2XQYA 3GRSA 1E1MA 2LHRA 1H7WA 2EHOD 4O4HE 4ECHA 4WNKA 2ODVA 4EXTA 1ZDLA 1MMDA 4CN4A 2EHOC 1XNRT 3IA3A 1N36T 3FBSA 4DBQA 5F5WA 3H8LA 3LXDA 2ZMAA 3T31A 2OA1A 3JSKA 2N1GA 1E1NA 2QYWA 2AAQA 5GSNA 3RYCE 4C5OA 4IL9A 2X0YA 4BAYB 3GYIA 3HI2A 3O4XE 2X68A 3CQGB 3ETUA 3TLTA 5L3FB 4CQIA 1FCDA 3CNPA 2V7KA 1K0IA 2VK9A 3ZMSB 3PUWF 5KVIA 4A6NA 3KV9A 1KFYA 2LSYA 2V7MA 4PJNA 2EQ8A 5FXZA 2GR0A 4WX1A 3L09A 5LNKA 3RC8A 4XXGA 1WRDA 4G73A 3SZ0A 2BXSA 4UVBB 3UKHA 3CK6A 4A99A 1X79A 4C74A 2ZZBA 1D0XA 1Y64B 5EK4A 3RPUA 4ZI3D 1CC4A 1RSGA 2WEUA 1FECA 4H4XA 1KEYA 3MACA 4U33A 1MIVA 4ZI3C 2LKHA 4B3RT 4FK1A 1ZOVA 5HWXA 1G8XA 2D2SA 2GEWA 1E1KA 5AQQB 4H9QC 3CX7B 3TLUA 2X9XA 3NN0X 2BK5A 2R0CA 4H9OC 3EABA 2B9XA 3AE1A 1L0VA 4CCQA 2IW5B 5BRTA 1P2HA 1NHRA 4U2ZA 2I59A 2A89A 3N9MA 2K5BB 3VR8A 2ARDA 4KP3C 5JDFA 2WMNA 1MIYA 4B69A 4IV9A 3HKDE 1LRZA 4IL4A 5HCJA 5FXXA 2E9XA 2XZEA 3URHA 3UUXB 1OJCA 1W09A 2W00A 3S5WA 3UP5A 2C65A 1B5QA 4D04A 1GRAA 5HXHA 1O94A 2DWKA 2X3NA 3FMWA 3P4RA 3ESLA 3UKFA 4P0AA 5LXTE 1PN0A 4YKFA 3B5MA 5HWYA 5AQMB 4EM4A 1OEDE 4IIJE 4AT0A 5JDMA 1W4XA 1QSDA 2VVNA 4EB6E 3FBLA 2V7LA 2BS2A 3BK9A 4X5TA 2UXCT 5FS6A 1D4EA 5LG4A 3ZMVB 1HTJF 4U8PA 1JOAA 3L8KA 2VQBA 2IIUA 4U72A 1H82A 5LB7B 2W67A 4ZOLE 2MYSA 3DH9A 5FMNA 4TUYE 3GRTA 1HS7A 3Q2MA 4UF0A 3PE0A 4GDPA 3AEGA 4MFRA 1Y56A 2EQ7A 3NKSA 2GV8A 3GYJA 2FUPA 4H4WA 4RG3A 5DQVA 3BNMA 3ETVA 4ILUA 3T2YA 2J1DG 5LP6E 2XFPA 5LA6E 2VRLA 2YQUA 1Q1WA 4A5XA 4O2BE 5EOWA 2QA7A 1LKXA 2E8IA 1PXCA 2V5DA 5DABA 1PBDA 3AXBA 1PBEA 1GEUA 3F8PA 2ZM0A 3VRAA 3AECA 1NENA 3CGBA 4X66T 2C5IT 1K0JA 2WOVA 1HYUA 2XLPA 2UUBT 4G9KA 2XSAA 1F8RA 4EQXA 2C7GA 4JNQA 2VVSA 3UTHA 4DVDA 2IUBA 5JDQA 5H6QB 2ZLYA 1OJTA 4LF8T 3OYZA 3AXJB 3I6DA 4NXNT 2YLZA 4PAGA 3UFGA 2PYXA 3D0TA 4IDOA 3GYXA 3UTKA 2V5CA 2WP6A 1PJ7A 4HE8A 4V1Av 3UKAA 4IE6A 3F8DA 3K3QC 5FXWA 1GXFA 1LQUA 3RH3A 5KMQA 3ZYXA 3RGLA 4M1PA 1W0BA 4CY8A 3ZC0A 3CIRA 4O5QA 4H4PA 4TLXA 2BG9A 3V5UA 4B3TT 1D5TA 3L3PA 3LADA 2WZIA 1BZLA 3NIXA 1WYCA 2GAHB 2DLRA 1GPEA 2FJDA 1D1CA 4U8IA 2QA2A 4Z2UA 3UQ4A 3N2GE 2XSBA 4YT0A 2C5JA 4GUVA 4YSXA 3ICRA 2Y48B 1RYIA 1BGJA 2CPTA 2X8GA 5HYMA 2AQJA 4WZXA 1UX5A 3PV0F 5ETWA 5L3GB 4NXMT 3KD9A 3SY4A 1PS9A 2FBWA 2NPXA 4J34A 3EVYA 2CXDA 3EAOA 1OEDB 1DU2A 2KNDA 1JNZA 4YJ3E 3ATRA 2BACA 4YTMA 3IBPA 3QSSA 1ZKEA 3KDSE 2PJQA 4CI3B 1UURA 3ZJ1A 2A87A 4EM3A 2NOXA 3A5XA 1TRBA 5JDHA 3Q5WA 3ZYMA 2R45A 1QJDA 4OPGA 2W4XA 1F6MA 4U2TA 3SFDA 3AD9B 3AB3B 2LRKA 1KNPA 4I55E 3RP6A 3TLSA 5ABEA 2KSRA 4LU6A 3Q5DA 2C0SA 2C64A 2GF3A 4JI0T 3QC9A 1BGNA 4H2NA 2X0LB 2VKOA 2NP9A 2R4JA 2SPCA 4II3A 3RQUA 3P4WA 4JI5T 4DV5T 4JUYA 4I50E 2WM9A 3P9UA 3P4SA 3OYXA 4CXYA 3P1WA 4U8LA 2EHOB 3UU5A 4CY6A 4H4SA 4ILBA 3EDUA 1MNEA 4U8KA 3RIUA 5LJMA 3NRXA 2K9AA 4ZI7E 4NPPA 5JQGE 3T37A 2GVCA 4ISSA 3MZKB 2XLTA 2E5VA 2CM0A 3O0HA 4NUVA 3CQXC 2V7JA 3COXA 1KK7A 3UUNA 1GRHA 3ANWA 3ZT5A 2BVLA 1H83A 4AKLA 3EI0A 5FNVE 5ABFA 2ZM8A 3E08A 1ZHCA 2XFUA 4DBRA 4H9RC 3C98B 4TM4A 3UOYA 3NYCA 2BXRA 5HXSA 5CGMA 3UU6A 3ZLIA 2L9QA 2OLTA 3SZWA 3EHZA 3VQRA 3JAFA 3JCFA 2X50A 4OYKA 4UELA 2ZZ0A 5L4EA 2WETA 5LHIB 1D7LA 1NDAA 5LYJE 4J56A 1BR1A 2V5ZA 2WPFA 1FEAA 2IIDA 5TR3A 5AQNB 5LMUT 3AE6A 1F3PA 3RKGA 3RNMA 3ONXA 2C70A 4CI1B 2V61A 5AQFB 1G73A 4JYAT 4NTCA 3VRDB 1OJDA 1ZMDA 1XDIA 1DOBA 4BV6A 2YM2A 3E1TA 4B66A 1IUVA 1DOCA 4C91A 1K0LA 3O1HA 4CBQA 4WCTA 2JQ9A 3EF6A 4L5GA 2UXNB 4QXCB 3T1HT 4ILAA 2LLYA 4IA6A 3R84B 1KDGA 5JCLA 2JMKA 2JB2A 4EIPA 3V76A 1XPQA 3CGDA 3OVUA 4NEWA 4YSZA 2EQ6A 2XAGB 4ANJA 5FY1A 3RF1A 3PS9A 1ZY8A 5JCKA 5FL1A 4QXBB 3SFEA 3GD4A 3IHGA 4EOZB 4P09A 1GRBA 4WBNE 3AE2A 1Q9IA 5KOXA 4DR2T 3BI4A 4AT2A 4LMKA 3GSIA 1IJ5A 5J0ZA 1U4QA 1UKVG 4H50A 2CCQA 1BKWA 4I0UA 1QO8A 3CNTA 1L9DA 3ABVA 4G6HA 3ZMZB 1HNWT 2D5UA 2Q9QA 1JRYA 4GR1A 1IUTA 4PFOA 3M3ZB 2XVHA 1M6IA 3AEEA 1ZV4X 3KKJA 4N9XA 4ZEYA 1UUSA 4EEBA 3FZLB 3AWIA 4FJOA 4XAXB 2LT3A 4DV3T 4TM3A 3LBXB 4H63V 3HKCE 4PABA 2NW8A 2YU1A 4PNIA 5FYMA 3UU3A 4EQWA 4X1KE 4GKJT 2VKDA 3PUSA 1TDNA 2BRYA 2VASA 2C3CA 3KV4A 2GR2A 4TM1A 1LVFA 5AQRB 4TWHA 3L8RA 1AJ3A 4YXDA 4DR5T 3HZLA 1YKHB 5JDLA 1XHCA 4C3XA 4B68A 4KHPT 4PJLA 1IUSA 3PUXF 4Z90A 4JI1T 4USRA 3RIFA 4H9PC 4HWIB 4H63H 4E7SA 3BNUA 1NHQA 1H7XA 3NH3X 1M7KA 2BS3A 3AEAA 2VRMA 4CN1A 5LHGB 1TDOA 1FMWA 3QOFA 3AEFA 1IJHA 3RX6A 3SWHA 3C64A 2X8HA 3H37A 1T8BA 4FK1C 3KVAA 2A3DA 4DR3T 5AQPB 3ZC1A 1DOEA 4DMVA 4BJMA 3UUMA 3KINB 1PDHA 3M65A 4DV2T 4HFHA 3NNEA 5AQTB 2PTFA 4DV6T 1B8SA 1SA0E 4KBMB 2NW9A 3ITJA 3ZT6A 3ONJA 2AE9A 1H7CA 3RYIE 2C67A 3QUJA 3CNDA 2E9XD 2E1MA 4HKAA 4EIWA 1VQWA 4AXPA 3WE0A 2H3RA 4BJNA 4A7AA 4H4TA 3ONLC 2HHHT 2W2UA 4H4ZA 3HL6A 2BKOA 2E9XC 3ATQA 2WP5A 4YLHA 1WR6A 3M13A 3GN5A 4AP1A 4JEHB 1CBOA 2GH5A 4YKGA 2GK9A 3BQKA 3NTAA 4JI8T 2XQ9A 5L3DB 4LF7T 1VOMA 4TWDA 4ZI2D 1NHPA 4HFVA 3CPIG 4JI7T 2WQYA 2XLSA 4OX9T 2J3NA 2KXPB 4AIUA 4ZI2C 2X67A 3N9PA 4ZN0A 4BJYA 1OJ9A 2YINA 4MBQA 4JDRA 4AISA 4DV1T 1ZMCA 1CJ4A 3DTOA 1AOGA 2A9UA 3P4QA 1REOA 3KV5A 3R9UA 1NAAA 1TDFA 4J36A 1OJAA 1D4DA 4EV6A 3GDPA 5JCMA 4EAHA 1BR2A 5KRQA 1N1PA 2BK4A 3ZSSA 2WOIA 2E4GA 3I3LA 3C4WA 5HYAA 3E0ZA 5DQWA 2LRLA 3FZHB 2GMHA 3PUAA 4EEDA 1CJ2A 5H6RB 2I0MA 3V5SA 2DL1A 5HEUA 5CJ5A 4U3CA 2YLTA 2FJEA 4TNWA 4O4IE 4IDNA 1GRTA 3I1AA 2XAJB 2XQ5A 1HNZT 4UDRA 4K5RA 2XUEA 3AA1B 5FVLA 4LA1A 3MJXA 4U8NA 4JN9A 2K48A 3FZFB 4AKIA 3NZPA 4OPLA 1W9RA 5HCMA 3R6NA 2CEAA 4H4RA 1X31B 3OJAA 4BA9A 1SEZA 1MMGA 4C3YA 1V9DA 2NR4A 1N4WA 4PW8A 2CXFA 3HKBE 5KXJA 3GWFA 1H81A 5HXEA 3RRCA 5JCNA 2C76A 4GF7A 1S35A 1S3EA 2KLQA 4CZZB 4AKHA 2BS4A 5DBJA 1LVKA 4MLKA 3B6DA 4ZCDA 3BI5A 2KWHA 3AD8B 3IEEA 3OKQA 4AQFC 1RP0A 1OEDA 1HF8A 3SQPA 1D1BA 3RHWA 4B65A 4WW0A 2WU2A 2DCFA 4HWDA 2JAEA 2BG9C 4IA5A 4IHJE 2WDQA 5ER0A 4I43B 5AQJB 3SM8A 2OA5A 4X64T 5L3EB 4MHCA 1D0YA 5GONE 3ALJA 3ZDNA 1H84A 3LZWA 2C3DA 4K22A 4EMIA 1DJQA
chains in the Genus database with same CATH topology
2FBWA 3DGHA 1LVLA 2NPXA 2RGOA 3NK1X 1VDCA 4J34A 1GERA 5FMHA 3EAOA 1MOKA 3HYWA 1JNZA 2VVLA 4AOXA 3ATRA 1PJ6A 5C2TA 2BACA 2BRAA 3CNJA 2HQMA 2WDRA 2VQ7A 3KA7A 3M12A 4YTMA 3QSSA 4UDPA 1K4QA 1LJ1A 2F5ZA 1PBBA 3IC9A 5KNLA 2A87A 3K7MX 3RHAA 4EM3A 5KMPA 1TRBA 5U1OA 4NZHA 2R45A 3DK4A 1QJDA 2Q6UA 5EB4A 4OPGA 1F6MA 1Z6LA 4U2TA 2V60A 4X9NA 3SFDA 3AD9B 4OPUA 1KNPA 2QA1A 4ZCCA 3RP6A 1GREA 4LU6A 1Y0PA 4X4JA 5KMSA 2NVKX 2C64A 4J33A 2GF3A 1D7YA 1CC2A 2WU5A 1BGNA 1PXAA 2C73A 1NHSA 4H2NA 4AP3A 1CF3A 3CPJG 2TMDA 2I0ZA 2R4JA 1NEKA 2WP9A 4II3A 2YLRA 3G5SA 3P9UA 4CNJA 3QVRA 3GDNA 4EQSA 2YLXA 3P4SA 1V59A 3C96A 3EPTA 4GCMA 3P1WA 1H86A 2GMJA 4U8LA 2XYOA 4YSHA 4CY6A 3UKKA 4H4SA 4GAPA 2GAGB 3KPFA 3LB8A 4K2XA 5CQFA 4YSYA 2Z5XA 5M0ZA 2LFCA 4U8KA 1O5WA 3P4PA 2OALA 4K8DA 4H2RA 1JRZA 2YR5A 3T37A 2GVCA 4GDEA 2V3BA 1ONFA 2XLTA 3QFAA 4FX9A 3UTEA 2E5VA 3O0HA 3FG2P 2WS3A 4UP3A 3COXA 3NRNA 2WPCA 1GRHA 1FL2A 1B37A 1H83A 1JEHA 2YG7A 2BC0A 1GRGA 3T14A 3AYIA 3QVPA 4OPDA 2R0PA 2R0GA 2BABA 3LZXA 3K30A 4XWZA 3QFBA 2XFUA 2CULA 4TM4A 3SGLA 4H7UA 3UKLA 3UOYA 3NYCA 2BXRA 4I59A 4J57A 1COYA 3NYEA 1DJNA 4G74A 4GRTA 3AEBA 1GV4A 3DJJA 4H4YA 3L1RA 4A79A 3G5QA 4OPIA 2GR3A 4D03A 3SZWA 3VQRA 4A6NB 2IVDA 5KOWA 4U2SA 5EB5A 3T0KA 2Q0LA 2X50A 3PVCA 1NG3A 1L9EA 2Q7VA 1VRQB 4A65A 1E39A 3ADAB 1PJ5A 4TM0A 2YLSA 2APGA 2ZZ0A 5BVAA 2WETA 1D7LA 1NDAA 2H88A 2YG5A 3NN6X 3UOZA 2BCGG 3T2KA 4J56A 2WOWA 2VVLG 1IUXA 4G6GA 3NLCA 2B9WA 2V5ZA 3QSEA 4EMWA 4YTNA 1DXLA 1FEAA 2WPFA 5IPYA 1E7PA 1N4VA 2JKCA 2IIDA 2YR6A 2BK3A 5TR3A 3CPHG 4Y4NA 3QSMA 4RSLA 4Z24A 3AE6A 1F3PA 1YY5A 3RNMA 2C70A 3BHKA 3KVEA 2V6OA 3CMMA 2C75A 1CJ3A 4H4UA 2ACZA 4JNAA 4Y4MA 2V61A 3RP7A 4C77A 2Q0KA 2XFNA 3AB1A 4CCRA 3AE4A 3SZCA 3NYFA 2R46A 3T2ZA 4NTCA 3VRDB 1OJDA 3VRBA 4PAAA 1ZMDA 2GR1A 3UTFA 1XDIA 3S61A 1DOBA 4BV6A 2YM2A 2JB1A 3E1TA 4B66A 5J7XA 1IUVA 1DOCA 1GTEA 2QAEA 1K0LA 4H2QA 5FS8A 4CBQA 4WCTA 4B64A 1S3BA 3GD3A 3EF6A 2B7RA 2ZBWA 4Z2TA 2FJBA 1IUWA 5BULA 4KX6A 3CTYA 1IUUA 2VVMA 4U8JA 4IA6A 2B7SA 4DSGA 1KDGA 2OAMA 3ICSA 3ALLA 5JCLA 1GETA 2JB2A 5M10A 4EIPA 4A5LA 3V76A 1XPQA 4TLZA 3CGDA 3SX6A 4B63A 1S2YA 4NEWA 1PXBA 1CC6A 4RG4A 4YSZA 2OLOA 2EQ6A 1GRFA 2Y6QA 3NT6A 4IVOB 2WHDA 3PS9A 4USQA 1ZY8A 1ZOYA 2Y6RA 1DODA 4YTPA 3C4NA 4NEVA 5JCKA 2XFOA 2JK6A 1CHUA 3SFEA 3BI2A 3GD4A 3SXIA 4P9SA 3IHGA 1CL0A 3KLJA 2PHHA 1GRBA 3AE2A 1Q9IA 3GRSA 5KOXA 4K7ZA 1MO9A 1E1MA 3BI4A 1H7WA 2TPRA 4ECHA 5BUKA 4AT2A 3GSIA 1EL5A 1EBDA 4MJWA 1UKVG 2C66A 1ZDLA 1FEBA 3G5RA 2ZZCA 1DNCA 3GWDA 4H50A 4CNKA 1BF3A 4CRTA 1BKWA 1EL7A 1JRXA 1QO8A 1YKJA 1L9DA 3ABVA 3CNTA 3FBSA 3QJ4A 4G6HA 3H8LA 1JRYA 2C72A 3LXDA 1IUTA 2AR8A 4GR1A 3T31A 2OA1A 4APNA 3JSKA 4M52A 1QLBA 3UKPA 1E1NA 1M6IA 2XVHA 3AEEA 4BK3A 1N4UA 2AAQA 2JB3A 2YR4A 3KKJA 5GSNA 3UOVA 3F8RA 4C5OA 2H89A 1VG9A 3GYIA 4N9XA 4Z25A 3K7QX 3AWIA 4JY2A 1ZP0A 5CKUA 1GOSA 1FCDA 2GQFA 3CNPA 3LJPA 1K0IA 4U8OA 4TM3A 4U2LA 5KWFA 1LQTA 2XLUA 4PABA 5KVIA 4A6NA 1KFYA 4HA6A 2EQ8A 4EQWA 1PBFA 2GR0A 1TDNA 2BRYA 2YG6A 3KU9A 4WX1A 4XXGA 1KSUA 1BWCA 2O9ZA 2YVJA 4G73A 3AE5A 2C3CA 2GR2A 4TM1A 3SZ0A 1EL9A 2BXSA 3FPZA 4HB9A 3UTGA 4DGKA 2CFYA 5KVHA 2RABA 3UKHA 4YXDA 4E0VA 3EANA 3HZLA 3UCLA 4A99A 4C74A 1KNRA 3NTDA 2ZZBA 3K7TA 1XHCA 2A8XA 4C3XA 4OVIA 4B68A 1IUSA 1PHHA 1CC4A 4USRA 1TDEA 1RSGA 2WEUA 4NNJA 3DMEA 1FECA 3BNUA 4H4XA 1NHQA 3AEDA 3II4A 2YVGA 3V3OA 3CGEA 1KSSA 1H7XA 3GMCA 3DJEA 2YG4A 3NH3X 2BS3A 3AEAA 2WESA 4FK1A 1ZOVA 2VRMA 3C4AA 1P2EA 1TDOA 1KF6A 2GEWA 5HHFA 1ELIA 1E1KA 2R9ZA 5HXIA 3IWAA 3AE8A 3AEFA 1LTXR 1IJHA 2BA9A 2BK5A 2EQ9A 2R0CA 3NN0X 2GQWA 2B9XA 3UOXA 4OPCA 3AE1A 1L0VA 4CCQA 2BC1A 4EIQA 5BRTA 2X8HA 4A9WA 1P2HA 1NHRA 4FK1C 2A89A 3AYJA 5IQ1A 3D1CA 3DK8A 2GRTA 2XVFA 1DOEA 5U63A 4B67A 3VR8A 2ARDA 1XANA 4ADWA 5C3JA 4OCGA 3DJGX 2GB0A 1PDHA 2UZZA 2YAUA 4B69A 4EQRA 3UKQA 4IV9A 3NNEA 1GALA 3B3RA 1B8SA 3DJDA 3URHA 5IQ4A 1OJCA 2DKHA 3ITJA 4REKA 2CDUA 2C67A 3CNDA 2XVIA 2E1MA 5LV9A 3S5WA 1VQWA 3AD7B 3UP5A 3UP4A 2C65A 1B5QA 2WBAA 4D04A 1GRAA 3WE0A 4A7AA 1MXTA 1O94A 1GSNA 4H4TA 2W0HA 2X3NA 4H4ZA 3FMWA 3P4RA 3FIMB 3ATQA 3UKFA 4BURA 5J60A 4ICYA 1PN0A 1F8SA 2WP5A 4YKFA 1F8WA 3M13A 4H4VA 4AP1A 1O95A 1CBOA 4EM4A 2GH5A 2YG3A 2XCGA 2Z5YA 4H2PA 1CJCA 4YKGA 2WDVA 2BCPA 1H6VA 2OLNA 2YWLA 4AT0A 3NTAA 1W4XA 3CN8A 1M64A 4EMJA 3D8XA 2BS2A 1L9CA 5FS9A 5FS6A 4Z44A 1YQ4A 1D4EA 1TYPA 4DNAA 4U8MA 4U8PA 1JOAA 3L8KA 2VQBA 1NHPA 3CPIG 1EL8A 2WQYA 1ZX9A 2XLSA 1LPFA 2R4EA 1H82A 2J3NA 3GMBA 1D4CA 3V3NA 3H4KA 4JY3A 4I58A 1JU2A 4ZN0A 3DH9A 4BJYA 1OJ9A 3OC4A 4JQ9A 3OZ2A 3GRTA 3NGCX 2CVJA 4JDRA 1DJQA 4GDPA 3AEGA 2WPEA 3NK0X 3PO7A 1ZMCA 1Y56A 2EQ7A 3NKSA 1LV0A 1CJ4A 2GV8A 3CNSA 3GYJA 4H4WA 4RG3A 4DSHA 3RP8A 3SZFA 1AOGA 3BNMA 1E1LA 3P4QA 3T2YA 1REOA 3R9UA 2XFPA 4X9MA 2VRLA 4O5UA 4BK1A 4K5SA 2YM1A 4J2WA 2YQUA 1NAAA 2XVJA 5EBKA 1Q1WA 1TDFA 3M0OA 4H4QA 4J36A 3KPKA 1OJAA 1D4DA 5FS7A 2VZ2A 3GDPA 5EOWA 5JCMA 5KRQA 3DGZA 1PXCA 1S2QA 1N1PA 5KMRA 2BYBA 3HYVA 2BK4A 3ISHA 1PBDA 2E4GA 2WOIA 1PBEA 3AXBA 1GEUA 4Z2RA 2FJAA 3F8PA 3I3LA 4NTDA 5GRTA 3VRAA 3AECA 4NTEA 1NENA 3CGBA 1K0JA 2WOVA 2XLPA 1HYUA 4G9KA 2GMHA 1CJ2A 1F8RA 1NG4A 1Y56B 4EQXA 2C7GA 4JNQA 2VOUA 3UTHA 3REDA 4KPRA 1GNDA 3NK2X 3HYXA 4B1BA 1TDKA 4GAVA 4BJZA 1PBCA 2YLTA 2FJEA 1OJTA 1Q1RA 1GRTA 1GESA 3LOVA 3I6DA 2YLZA 4UDRA 2PYXA 4K5RA 4LIIA 3AE9A 3ICTA 3IHMA 3GYXA 4LA1A 3BHFA 3NG7X 3VR9A 1YQ3A 1PJ7A 2WP6A 4U8NA 4JN9A 4XWRA 4Z43A 1TYTA 3UKAA 2RGJA 4IVMB 3F8DA 4OPLA 1GXFA 4H4RA 1NPXA 1X31B 1LQUA 1SEZA 2YLWA 4C3YA 1N4WA 2IVEA 2XFQA 5KMQA 5KXJA 4Z26A 3GWFA 1H81A 3ZYXA 5L46A 5JCNA 1E6EA 2C76A 2QCUA 4GF7A 1B4VA 1S3EA 2V3AA 3Q6JA 4CY8A 4OPTA 3H8IA 3CIRA 2X99A 2XDOA 5U25A 4O5QA 2BS4A 1ZK7A 4H4PA 5DBJA 4TLXA 4Y4LA 1FOHA 3B6DA 4BK2A 4II2A 4ZCDA 2YVFA 3BI5A 5HY5A 3AE7A 3AD8B 4YWOA 3NHOX 5JCIA 1JNRA 4AOSA 1VG0A 1D5TA 4J31A 2X8CA 1RP0A 3CGCA 3LADA 3SYIA 3SQPA 1BZLA 3NIXA 2GAHB 4B65A 2C4CA 1GPEA 2B9YA 2RGHA 2FJDA 2WU2A 3Q9TA 2JAEA 2DKIA 4U8IA 1GTHA 3ALMA 2QA2A 3AE3A 3IF9A 4IA5A 2WDQA 4FDCB 3DA1A 4YT0A 2XLRA 5ER0A 4Z2UA 4GUVA 3SM8A 4YSXA 3ICRA 2JBVA 1RYIA 1BGJA 1ZKQA 2X8GA 5HYMA 3ALJA 2AQJA 3ZDNA 4NWZA 1H84A 2XVEA 3LZWA 3DK9A 4UDQA 2B76A 2C3DA 3KD9A 4K22A 3SY4A 4EMIA 1PS9A 1GT8A 3AYLA 1YQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW A;  3DGH A;  1LVL A;  2NPX A;  2RGO A;  3NK1 X;  1VDC A;  4J34 A;  1GER A;  5FMH A;  3EAO A;  1MOK A;  1JNZ A;  2VVL A;  4AOX A;  3ATR A;  1PJ6 A;  5C2T A;  2BAC A;  3CNJ A;  2HQM A;  2WDR A;  2VQ7 A;  3KA7 A;  3M12 A;  4YTM A;  3QSS A;  4UDP A;  1K4Q A;  1LJ1 A;  2F5Z A;  1PBB A;  3IC9 A;  2A87 A;  3K7M X;  3RHA A;  4EM3 A;  1TRB A;  5U1O A;  4NZH A;  2R45 A;  3DK4 A;  1QJD A;  2Q6U A;  5EB4 A;  4OPG A;  1F6M A;  1Z6L A;  4U2T A;  2V60 A;  4X9N A;  3SFD A;  3AD9 B;  4OPU A;  1KNP A;  2QA1 A;  4ZCC A;  3RP6 A;  1GRE A;  4LU6 A;  1Y0P A;  4X4J A;  2NVK X;  2C64 A;  4J33 A;  2GF3 A;  1D7Y A;  1CC2 A;  2WU5 A;  1BGN A;  1PXA A;  2C73 A;  1NHS A;  4H2N A;  4AP3 A;  1CF3 A;  3CPJ G;  2TMD A;  2I0Z A;  2R4J A;  1NEK A;  2WP9 A;  2YLR A;  3G5S A;  3P9U A;  4CNJ A;  3QVR A;  3GDN A;  4EQS A;  2YLX A;  3P4S A;  1V59 A;  3C96 A;  3EPT A;  4GCM A;  3P1W A;  1H86 A;  2GMJ A;  4U8L A;  2XYO A;  4YSH A;  4CY6 A;  3UKK A;  4H4S A;  2GAG B;  3KPF A;  3LB8 A;  4K2X A;  5CQF A;  4YSY A;  2Z5X A;  5M0Z A;  2LFC A;  4U8K A;  1O5W A;  3P4P A;  2OAL A;  4K8D A;  4H2R A;  1JRZ A;  2YR5 A;  3T37 A;  2GVC A;  4GDE A;  2V3B A;  1ONF A;  2XLT A;  3QFA A;  4FX9 A;  3UTE A;  2E5V A;  3O0H A;  3FG2 P;  2WS3 A;  4UP3 A;  3COX A;  3NRN A;  2WPC A;  1GRH A;  1FL2 A;  1B37 A;  1H83 A;  1JEH A;  2YG7 A;  2BC0 A;  1GRG A;  3AYI A;  3QVP A;  4OPD A;  2R0P A;  2R0G A;  2BAB A;  3LZX A;  3K30 A;  4XWZ A;  3QFB A;  2XFU A;  2CUL A;  4TM4 A;  3SGL A;  4H7U A;  3UKL A;  3UOY A;  3NYC A;  2BXR A;  4I59 A;  4J57 A;  1COY A;  3NYE A;  1DJN A;  4GRT A;  3AEB A;  1GV4 A;  3DJJ A;  4H4Y A;  3L1R A;  4A79 A;  3G5Q A;  4OPI A;  2GR3 A;  4D03 A;  3VQR A;  4A6N B;  5KOW A;  2IVD A;  4U2S A;  5EB5 A;  2Q0L A;  2X50 A;  3PVC A;  1NG3 A;  1L9E A;  2Q7V A;  1VRQ B;  4A65 A;  1E39 A;  3ADA B;  1PJ5 A;  4TM0 A;  2YLS A;  2APG A;  2ZZ0 A;  5BVA A;  2WET A;  1D7L A;  1NDA A;  2H88 A;  2YG5 A;  3NN6 X;  3UOZ A;  2BCG G;  4J56 A;  2WOW A;  2VVL G;  1IUX A;  3NLC A;  2B9W A;  2V5Z A;  3QSE A;  4EMW A;  4YTN A;  1DXL A;  1FEA A;  2WPF A;  5IPY A;  1E7P A;  1N4V A;  2JKC A;  2IID A;  2YR6 A;  2BK3 A;  5TR3 A;  3CPH G;  4Y4N A;  3QSM A;  4RSL A;  4Z24 A;  3AE6 A;  1F3P A;  1YY5 A;  3RNM A;  2C70 A;  3BHK A;  3KVE A;  2V6O A;  2C75 A;  1CJ3 A;  4H4U A;  2ACZ A;  4JNA A;  4Y4M A;  2V61 A;  3RP7 A;  4C77 A;  2Q0K A;  2XFN A;  3AB1 A;  4CCR A;  3AE4 A;  3NYF A;  2R46 A;  4NTC A;  3VRD B;  1OJD A;  3VRB A;  4PAA A;  1ZMD A;  2GR1 A;  3UTF A;  1XDI A;  3S61 A;  1DOB A;  4BV6 A;  2YM2 A;  2JB1 A;  3E1T A;  4B66 A;  5J7X A;  1IUV A;  1DOC A;  1GTE A;  2QAE A;  1K0L A;  4H2Q A;  5FS8 A;  4CBQ A;  4WCT A;  4B64 A;  1S3B A;  3GD3 A;  3EF6 A;  2B7R A;  2ZBW A;  4Z2T A;  2FJB A;  1IUW A;  5BUL A;  4KX6 A;  3CTY A;  1IUU A;  2VVM A;  4U8J A;  4IA6 A;  2B7S A;  4DSG A;  1KDG A;  2OAM A;  3ICS A;  3ALL A;  5JCL A;  1GET A;  2JB2 A;  5M10 A;  4EIP A;  4A5L A;  3V76 A;  1XPQ A;  4TLZ A;  3CGD A;  4B63 A;  1S2Y A;  4NEW A;  1PXB A;  1CC6 A;  4RG4 A;  4YSZ A;  2OLO A;  2EQ6 A;  1GRF A;  2Y6Q A;  3NT6 A;  4IVO B;  2WHD A;  3PS9 A;  4USQ A;  1ZY8 A;  1ZOY A;  2Y6R A;  1DOD A;  4YTP A;  3C4N A;  4NEV A;  5JCK A;  2XFO A;  2JK6 A;  1CHU A;  3SFE A;  3BI2 A;  3GD4 A;  4P9S A;  3IHG A;  1CL0 A;  3KLJ A;  2PHH A;  1GRB A;  3AE2 A;  1Q9I A;  3GRS A;  5KOX A;  4K7Z A;  1MO9 A;  1E1M A;  3BI4 A;  1H7W A;  2TPR A;  4ECH A;  5BUK A;  4AT2 A;  3GSI A;  1EL5 A;  1EBD A;  4MJW A;  1UKV G;  2C66 A;  1ZDL A;  1FEB A;  3G5R A;  2ZZC A;  1DNC A;  3GWD A;  4H50 A;  4CNK A;  1BF3 A;  4CRT A;  1BKW A;  1EL7 A;  1JRX A;  1QO8 A;  1YKJ A;  1L9D A;  3ABV A;  3CNT A;  3FBS A;  3QJ4 A;  3H8L A;  1JRY A;  2C72 A;  3LXD A;  1IUT A;  2AR8 A;  4GR1 A;  4APN A;  2OA1 A;  3JSK A;  4M52 A;  1QLB A;  3UKP A;  1E1N A;  1M6I A;  2XVH A;  3AEE A;  4BK3 A;  1N4U A;  2AAQ A;  2JB3 A;  2YR4 A;  3KKJ A;  5GSN A;  3UOV A;  3F8R A;  4C5O A;  2H89 A;  1VG9 A;  3GYI A;  4N9X A;  4Z25 A;  3K7Q X;  3AWI A;  4JY2 A;  1ZP0 A;  5CKU A;  1GOS A;  1FCD A;  2GQF A;  3CNP A;  3LJP A;  1K0I A;  4U8O A;  4TM3 A;  4U2L A;  5KWF A;  1LQT A;  2XLU A;  4PAB A;  5KVI A;  4A6N A;  1KFY A;  4HA6 A;  2EQ8 A;  4EQW A;  1PBF A;  2GR0 A;  1TDN A;  4WX1 A;  2YG6 A;  3KU9 A;  4XXG A;  1KSU A;  1BWC A;  2O9Z A;  2YVJ A;  3AE5 A;  2C3C A;  2GR2 A;  4TM1 A;  1EL9 A;  2BXS A;  3FPZ A;  4HB9 A;  3UTG A;  4DGK A;  2CFY A;  5KVH A;  2RAB A;  3UKH A;  4YXD A;  4E0V A;  3EAN A;  3HZL A;  3UCL A;  4A99 A;  4C74 A;  1KNR A;  3NTD A;  2ZZB A;  3K7T A;  1XHC A;  2A8X A;  4C3X A;  4OVI A;  4B68 A;  1IUS A;  1PHH A;  1CC4 A;  4USR A;  1TDE A;  1RSG A;  2WEU A;  3DME A;  1FEC A;  3BNU A;  4H4X A;  1NHQ A;  3AED A;  3II4 A;  2YVG A;  3V3O A;  3CGE A;  1KSS A;  1H7X A;  3GMC A;  3DJE A;  2YG4 A;  3NH3 X;  2BS3 A;  3AEA A;  2WES A;  4FK1 A;  1ZOV A;  2VRM A;  3C4A A;  1P2E A;  1TDO A;  1KF6 A;  2GEW A;  5HHF A;  1ELI A;  1E1K A;  2R9Z A;  5HXI A;  3IWA A;  3AE8 A;  3AEF A;  1LTX R;  1IJH A;  2BA9 A;  2BK5 A;  2EQ9 A;  2R0C A;  3NN0 X;  2GQW A;  2B9X A;  3UOX A;  4OPC A;  3AE1 A;  1L0V A;  4CCQ A;  2BC1 A;  4EIQ A;  5BRT A;  2X8H A;  4A9W A;  1P2H A;  1NHR A;  4FK1 C;  2A89 A;  3AYJ A;  5IQ1 A;  3D1C A;  3DK8 A;  2GRT A;  2XVF A;  1DOE A;  5U63 A;  4B67 A;  3VR8 A;  2ARD A;  1XAN A;  4ADW A;  5C3J A;  4OCG A;  3DJG X;  2GB0 A;  1PDH A;  2UZZ A;  2YAU A;  4B69 A;  4EQR A;  3UKQ A;  4IV9 A;  3NNE A;  1GAL A;  3B3R A;  1B8S A;  3DJD A;  3URH A;  5IQ4 A;  1OJC A;  2DKH A;  3ITJ A;  4REK A;  2CDU A;  2C67 A;  3CND A;  2XVI A;  2E1M A;  5LV9 A;  3S5W A;  1VQW A;  3AD7 B;  3UP5 A;  3UP4 A;  2C65 A;  1B5Q A;  2WBA A;  4D04 A;  1GRA A;  3WE0 A;  4A7A A;  1MXT A;  1O94 A;  1GSN A;  4H4T A;  2W0H A;  2X3N A;  4H4Z A;  3FMW A;  3P4R A;  3FIM B;  3ATQ A;  3UKF A;  4BUR A;  5J60 A;  4ICY A;  1PN0 A;  1F8S A;  2WP5 A;  4YKF A;  1F8W A;  3M13 A;  4H4V A;  4AP1 A;  1O95 A;  1CBO A;  4EM4 A;  2GH5 A;  2YG3 A;  2XCG A;  2Z5Y A;  4H2P A;  1CJC A;  4YKG A;  2WDV A;  2BCP A;  1H6V A;  2OLN A;  2YWL A;  4AT0 A;  3NTA A;  1W4X A;  3CN8 A;  1M64 A;  4EMJ A;  3D8X A;  2BS2 A;  1L9C A;  5FS9 A;  5FS6 A;  4Z44 A;  1YQ4 A;  1D4E A;  1TYP A;  4DNA A;  4U8M A;  4U8P A;  1JOA A;  3L8K A;  2VQB A;  1NHP A;  3CPI G;  1EL8 A;  2WQY A;  1ZX9 A;  2XLS A;  1LPF A;  2R4E A;  1H82 A;  2J3N A;  3GMB A;  1D4C A;  3V3N A;  3H4K A;  4JY3 A;  4I58 A;  1JU2 A;  4ZN0 A;  3DH9 A;  4BJY A;  1OJ9 A;  3OC4 A;  4JQ9 A;  3OZ2 A;  3GRT A;  3NGC X;  2CVJ A;  4JDR A;  1DJQ A;  4GDP A;  3AEG A;  2WPE A;  3NK0 X;  3PO7 A;  1ZMC A;  1Y56 A;  2EQ7 A;  3NKS A;  1LV0 A;  1CJ4 A;  2GV8 A;  3CNS A;  3GYJ A;  4H4W A;  4RG3 A;  4DSH A;  3RP8 A;  1AOG A;  3BNM A;  1E1L A;  3P4Q A;  1REO A;  3R9U A;  2XFP A;  4X9M A;  2VRL A;  4O5U A;  4BK1 A;  4K5S A;  2YM1 A;  4J2W A;  2YQU A;  1NAA A;  2XVJ A;  5EBK A;  1Q1W A;  1TDF A;  3M0O A;  4H4Q A;  4J36 A;  5FS7 A;  1OJA A;  1D4D A;  2VZ2 A;  3GDP A;  5EOW A;  5JCM A;  5KRQ A;  3DGZ A;  1PXC A;  1S2Q A;  1N1P A;  2BYB A;  2BK4 A;  3ISH A;  1PBD A;  2E4G A;  2WOI A;  1PBE A;  3AXB A;  1GEU A;  4Z2R A;  2FJA A;  3F8P A;  3I3L A;  4NTD A;  5GRT A;  3VRA A;  3AEC A;  4NTE A;  1NEN A;  3CGB A;  1K0J A;  2WOV A;  2XLP A;  1HYU A;  2GMH A;  1CJ2 A;  1F8R A;  1NG4 A;  1Y56 B;  4EQX A;  2C7G A;  4JNQ A;  2VOU A;  3UTH A;  3RED A;  4KPR A;  1GND A;  3NK2 X;  4B1B A;  1TDK A;  4BJZ A;  1PBC A;  2YLT A;  2FJE A;  1OJT A;  1Q1R A;  1GRT A;  1GES A;  3LOV A;  3I6D A;  2YLZ A;  4UDR A;  2PYX A;  4K5R A;  4LII A;  3AE9 A;  3ICT A;  3IHM A;  4LA1 A;  3GYX A;  3BHF A;  3NG7 X;  3VR9 A;  1YQ3 A;  1PJ7 A;  2WP6 A;  4U8N A;  4JN9 A;  4XWR A;  4Z43 A;  1TYT A;  3UKA A;  2RGJ A;  4IVM B;  3F8D A;  4OPL A;  1GXF A;  4H4R A;  1NPX A;  1X31 B;  1LQU A;  1SEZ A;  2YLW A;  4C3Y A;  1N4W A;  2IVE A;  2XFQ A;  5KXJ A;  4Z26 A;  3GWF A;  1H81 A;  3ZYX A;  5L46 A;  5JCN A;  1E6E A;  2C76 A;  2QCU A;  4GF7 A;  1B4V A;  1S3E A;  2V3A A;  3Q6J A;  4CY8 A;  4OPT A;  3H8I A;  3CIR A;  2X99 A;  2XDO A;  5U25 A;  4O5Q A;  2BS4 A;  1ZK7 A;  4H4P A;  5DBJ A;  4TLX A;  4Y4L A;  1FOH A;  3B6D A;  4BK2 A;  4ZCD A;  2YVF A;  3BI5 A;  5HY5 A;  3AE7 A;  3AD8 B;  4YWO A;  3NHO X;  5JCI A;  1JNR A;  4AOS A;  1VG0 A;  1D5T A;  4J31 A;  2X8C A;  1RP0 A;  3CGC A;  3LAD A;  3SQP A;  1BZL A;  3NIX A;  2GAH B;  4B65 A;  1GPE A;  2B9Y A;  2RGH A;  2FJD A;  2WU2 A;  3Q9T A;  2JAE A;  2DKI A;  4U8I A;  1GTH A;  3ALM A;  2QA2 A;  3AE3 A;  3IF9 A;  4IA5 A;  2WDQ A;  4FDC B;  3DA1 A;  4YT0 A;  2XLR A;  5ER0 A;  4Z2U A;  4GUV A;  3SM8 A;  4YSX A;  3ICR A;  2JBV A;  1RYI A;  1BGJ A;  1ZKQ A;  2X8G A;  5HYM A;  3ALJ A;  2AQJ A;  3ZDN A;  1H84 A;  2XVE A;  3LZW A;  3DK9 A;  4UDQ A;  2B76 A;  2C3D A;  3KD9 A;  4K22 A;  4EMI A;  1PS9 A;  1GT8 A;  3AYL A;  1YQZ A; 
#chains in the Genus database with same CATH topology
 1LVL A;  3NK1 X;  4DUZ T;  5FMH A;  2V8S V;  1MIW A;  1NWM X;  5C2T A;  2VQ7 A;  5LGU B;  1K4Q A;  1HG5 A;  3RHA A;  5BR8 T;  4G63 A;  2M6I A;  2XTL A;  4P0B A;  4PK5 A;  2Q6U A;  2ES0 A;  2V60 A;  2LSG A;  2LKG A;  2VKJ A;  1GRE A;  1SE7 A;  2IHR 1;  4J33 A;  2MOZ A;  4ZHQ E;  1D7Y A;  1CC2 A;  2WU5 A;  1GQE A;  2AXD S;  2DI4 A;  5IHY A;  3SS1 A;  1SHZ C;  2WP9 A;  4OYJ A;  5FY7 A;  4CNJ A;  3QVR A;  3GDN A;  3EPT A;  2GMJ A;  2XYO A;  2GAG B;  3KPF A;  3LB8 A;  4K2X A;  4YSY A;  2Z5X A;  2YOE A;  2OAL A;  5DJQ C;  4K0U A;  2JQH A;  3UTE A;  5KX5 E;  3FG2 P;  2LSJ A;  4UP3 A;  4UV8 B;  4GK5 E;  1B37 A;  1T7S A;  5TAO A;  3E22 E;  1EZ3 A;  1JEH A;  3T14 A;  3AYI A;  1E1H B;  3FZK B;  4U7I A;  5JR9 A;  2CUL A;  4I59 A;  1B7T A;  4J57 A;  1UX4 A;  4EZH A;  3NYE A;  3PUV F;  5AQU B;  5C8Y E;  4GRT A;  1GV4 A;  4FI5 A;  3G5Q A;  4OPI A;  4D03 A;  3C4Z A;  4A6N B;  5KOW A;  4IT4 A;  3AA0 B;  4X1Y E;  2Q0L A;  4IDQ A;  1NG3 A;  2WAU A;  1E39 A;  3RKO A;  4TM0 A;  5IUX A;  3F57 A;  1D0Z A;  2YK0 A;  3K3O A;  2CA5 A;  2BCG G;  3T2K A;  2VVL G;  1IUX A;  3NLC A;  3QSE A;  4ZZB A;  2XJ7 A;  4HFC A;  3O1I A;  1N34 T;  3K3N A;  4DR4 T;  1N4V A;  2JKC A;  2YR6 A;  2JRK A;  2BK3 A;  2VQE T;  4UIG A;  4UVC B;  4IDP A;  2E2A A;  4RSL A;  4Z24 A;  1HNX T;  2V7I A;  3KVE A;  5L3B B;  2X9W A;  2XAF B;  3U78 A;  1CJ3 A;  2ACZ A;  4Y4M A;  1IBM T;  2X66 A;  4AQY T;  3RP7 A;  2XFN A;  4CCR A;  3AE4 A;  3NYF A;  3T2Z A;  3VRB A;  3ZCI A;  2GR1 A;  3S61 A;  1FIO A;  4JI6 T;  3HKE E;  4X62 T;  2JB1 A;  3LK2 B;  2WB5 A;  3WAJ A;  4H2Q A;  1T72 A;  4CXX A;  2CMR A;  1S3B A;  2ZBW A;  4Z2T A;  2FJB A;  5FY0 A;  3CX6 B;  2K24 A;  4KX6 A;  5EZY E;  2B7S A;  4TX5 A;  3ICS A;  3ALL A;  5LGT B;  4GOU A;  2YDS A;  2ACX A;  4B63 A;  4TLZ A;  2W61 A;  1UCU A;  1HR0 T;  4RG4 A;  1O3X A;  4IVO B;  2CHN A;  5HEO A;  3C4N A;  1ZOY A;  4NEV A;  1DOD A;  3BI2 A;  4JI3 T;  3T1Y T;  2VWA A;  4F8H A;  2PHH A;  3N2O A;  2E9X B;  4K7Z A;  1MO9 A;  2R6G F;  3LBX A;  5BUK A;  3MKD A;  4HEA A;  1EBD A;  4MJW A;  2C66 A;  2ZZC A;  3W15 B;  3PUR A;  2UXB T;  1EL7 A;  1JRX A;  4Q25 A;  3LG7 A;  3QJ4 A;  2DWG A;  4GYR A;  4PJJ A;  5KDM C;  5ADX L;  2C72 A;  4APN A;  4M52 A;  4ZS3 A;  1N4U A;  2YR4 A;  3UOV A;  3LFM A;  4O4L E;  2Q9Q D;  1VG9 A;  1VRB A;  3K7Q X;  3S4U A;  3FHN A;  4JY2 A;  1US7 B;  3PTR B;  2GQF A;  4U8O A;  3LJP A;  5KWF A;  4TN7 B;  1LQT A;  3BQL A;  2Q9Q C;  2HN1 A;  5CB4 E;  4HA6 A;  2VQF T;  4JBW F;  3AAI A;  4U31 A;  2PFV A;  2HH7 A;  1KSU A;  2YVJ A;  3AE5 A;  1EL9 A;  3FPZ A;  4DGK A;  3UTG A;  2RAB A;  4YFS A;  1KNR A;  2X0H A;  3AA7 B;  4UF0 B;  2LHN A;  3K7T A;  1PHH A;  1WR0 A;  4ZXL A;  5LGN B;  4LFA T;  2LE8 A;  2QRX A;  1TDE A;  2WY2 A;  4NNJ A;  2D0U A;  3DME A;  3UUL A;  3EUH A;  3II4 A;  4EZ4 A;  5L4H A;  3V3O A;  3CGE A;  1KSS A;  1WYB A;  3GMC A;  2WWV A;  5HXR A;  3KV6 A;  3QB5 A;  3C4A A;  1P2E A;  1KF6 A;  1ELI A;  1IBK T;  5HXI A;  2VL0 A;  1LTX R;  2BA9 A;  2GQW A;  4NUU A;  2BC1 A;  4UEM A;  3DK8 A;  2XVF A;  4B67 A;  2F4V T;  4ADW A;  1XAN A;  2Y6X A;  2GB0 A;  5LBQ B;  2UZZ A;  2M67 A;  2V26 A;  3EAM A;  1GAL A;  1N33 T;  3C51 A;  4K0K T;  1IBL T;  2DKH A;  4O8S A;  3UU4 A;  4CXW A;  2CDU A;  4U7Y A;  2XVI A;  3UP4 A;  1I6Z A;  1FMV A;  4F6R C;  2XAH B;  1GSN A;  4UVA B;  3X1D A;  4JLE A;  3FIM B;  4HFD A;  4ICY A;  1F8S A;  3PDY A;  3G06 A;  4XZC A;  2YG3 A;  2Z5Y A;  2K3W A;  1CJC A;  2OLN A;  3CN8 A;  1M64 A;  3PJA J;  3D8X A;  1L9C A;  3N9Q A;  1YQ4 A;  5JRC B;  3NWI A;  5AQV B;  4YJ2 E;  2BVM A;  3SRZ A;  2R4E A;  2WWU A;  3N2K E;  1D4C A;  3PUZ F;  4L9I A;  3H4K A;  5AQS B;  2BZB A;  2LM9 A;  3OC4 A;  3OZ2 A;  3GMI A;  2CVJ A;  2B1E A;  4ADZ A;  1BR4 A;  4DV0 T;  1XMQ T;  2XM2 A;  1LV0 A;  3CNS A;  4IDZ A;  1YW0 A;  3OPC A;  3RP8 A;  2BDE A;  4DMW A;  1E1L A;  4BK1 A;  2YM1 A;  5LBM A;  5EBK A;  3M0O A;  4H4Q A;  5FS7 A;  2XM1 A;  5JDN A;  4PJM A;  3DGZ A;  1S2Q A;  4IE4 A;  3HYV A;  3ISH A;  4Z2R A;  5L47 A;  2FJA A;  3AAA B;  3Q9D A;  4ASK A;  4PFP A;  5GRT A;  3LJC A;  2VL8 A;  1CUN A;  3K1S A;  1NG4 A;  1D1A A;  3P8C D;  2VOU A;  3RED A;  3NK2 X;  3U3I A;  1TDK A;  4WYV A;  1PBC A;  3RYH E;  1Q1R A;  3QK6 A;  3GA8 A;  3LOV A;  2XQ7 A;  4X20 E;  1J5E T;  2KT9 A;  5J2U E;  4LII A;  3AE9 A;  2CRB A;  3IHM A;  3BHF A;  3VR9 A;  2A2F X;  1ZEE A;  4DUY T;  5HEJ A;  2RGJ A;  4IVM B;  2XAQ B;  3AVS A;  1NPX A;  2YLW A;  4DR6 T;  5FP3 A;  4LF6 T;  4Z26 A;  1QUU A;  2V1D B;  5L46 A;  4IE5 A;  2Z6E A;  3Q6J A;  3NKZ A;  2X99 A;  2DNX A;  5U25 A;  2VB6 A;  2LSK A;  3KFW X;  4HTE A;  1ZK7 A;  4Y4L A;  1FOH A;  3ZCJ A;  5HEG A;  2YVF A;  5HY5 A;  2NW7 A;  3NHO X;  5JCI A;  4AOS A;  1WCR A;  4J31 A;  1HFA A;  1J5W A;  3L39 A;  3RLF F;  3CGC A;  3SYI A;  4G2A A;  4DV7 T;  2C4C A;  2B9Y A;  3Q9T A;  4AQG A;  1Y01 A;  2DKI A;  3AE3 A;  4E7Z A;  3ZST A;  4FDC B;  3DA1 A;  2XLR A;  5AQH B;  4HN9 A;  2J47 A;  1ZKQ A;  3ZMU B;  5ABG A;  2W63 A;  4NWZ A;  2B76 A;  4J2C A;  4LFB T;  3JAE A;  1GT8 A;  1YQZ A;  3DGH A;  2WSS V;  2CLY C;  1HG2 A;  1GER A;  4B3S T;  3Q5X A;  2YDQ A;  2V6Y B;  3QB5 K;  3CNJ A;  4JI4 T;  2HQM A;  3KA7 A;  3M12 A;  4UDP A;  1LJ1 A;  2F5Z A;  1PBB A;  3DJB A;  5U1O A;  4NZH A;  4A97 A;  4HWH A;  4ZCC A;  2XHE B;  3FZM B;  1Y0P A;  5J1G A;  4HGA A;  1NHS A;  1CF3 A;  3CPJ G;  2TMD A;  1NEK A;  3BQI A;  3ZYL A;  4GIW A;  4LF4 T;  5F3J A;  3OBV E;  3AXJ A;  1V59 A;  3RC3 A;  4GCM A;  2CWY A;  2VKH A;  1H86 A;  3WI3 A;  4IGU A;  4YSH A;  3UKK A;  5CQF A;  2UU9 T;  2LFC A;  2A72 A;  1O5W A;  4K8D A;  4H2R A;  2IC9 A;  2X9Y A;  4GDE A;  1WLX A;  2LEH A;  5AQG B;  1ONF A;  2WS3 A;  5JTG A;  2LJL A;  4Z91 A;  1Z0P A;  4B3M T;  5EK3 A;  5LCY A;  1FL2 A;  2HPL A;  5FKY A;  4H9S E;  2Q9Q B;  2YG7 A;  3QNU A;  2BC0 A;  1GRG A;  3QVP A;  3I9Y A;  4OPD A;  2R0P A;  2R0G A;  4IST A;  2BAB A;  3LZX A;  3QFB A;  3VU7 H;  4DO0 A;  3SGL A;  3UKL A;  4MAL A;  1COY A;  4QX8 B;  4A56 A;  4G74 A;  3AEB A;  4H4Y A;  3L1R A;  4XBF B;  4P1N A;  3T0K A;  4GKK T;  2L3L A;  3FBZ A;  3PVC A;  1SUM B;  1L9E A;  4QH4 A;  4EYY R;  4A65 A;  3ADA B;  2APG A;  5JR9 C;  2YG5 A;  2H88 A;  1R8I A;  2XPK A;  3UOZ A;  2LSI A;  5FXV A;  3ZMT B;  1BR0 A;  2B9W A;  4EMW A;  1DXL A;  5IPY A;  2KIN B;  2KWI B;  1E7P A;  1NAF A;  5IYZ E;  4Y4N A;  4IE7 A;  3QSM A;  1YY5 A;  4YHH T;  3BHK A;  4EGW A;  2V6O A;  2MPK A;  4X1I E;  2JQQ A;  3A7M A;  4GYS A;  3AB1 A;  2R46 A;  4X65 T;  4U2Y A;  2WBL A;  5AQO B;  4PAA A;  3UTF A;  1E2A A;  2CBJ A;  5LG3 A;  2QAE A;  4B64 A;  3GD3 A;  3K8P C;  1FEW A;  1IUW A;  1OWA A;  5BUL A;  2UUC T;  4HWC A;  1IUU A;  4PK4 A;  4QWN B;  2N9D A;  1GET A;  5M10 A;  3F2E A;  3SX6 A;  3ZN1 B;  2OLO A;  1GRF A;  2Y6Q A;  2RPA A;  2WHD A;  2CBI A;  4U74 A;  4USQ A;  4YTP A;  2XFO A;  1CHU A;  2EHO A;  1CL0 A;  3KLJ A;  3DP7 A;  3N9L A;  3UQ7 A;  5CA1 E;  5L3C B;  2TPR A;  5L2L A;  4IE0 A;  2C5K T;  5AQI B;  1EL5 A;  3CPZ A;  4LML A;  1FEB A;  3G5R A;  1DNC A;  3GWD A;  4CNK A;  1BF3 A;  2IC6 A;  4CRT A;  5E0O A;  1YD8 G;  1YKJ A;  4C90 A;  2W0G A;  5FL0 A;  2AR8 A;  3ZKR A;  3PU3 A;  3GN5 B;  1QLB A;  3UKP A;  4BK3 A;  4COF A;  2JB3 A;  3F8R A;  2H89 A;  4Z25 A;  3PJA A;  4HFE A;  1IJ6 A;  1ZP0 A;  5CKU A;  2UXX B;  1GOS A;  1UK5 A;  4AKG A;  4U2L A;  2XLU A;  3LSV A;  4DR1 T;  4I4T E;  1PBF A;  2YG6 A;  3KU9 A;  3I9W A;  2YKS A;  1BWC A;  2O9Z A;  3NZQ A;  4HB9 A;  2CFY A;  3RIU C;  5KVH A;  3AVR A;  4KHZ F;  3TLW A;  1HX1 B;  4E0V A;  3EAN A;  3UCL A;  4ZS2 A;  3NTD A;  2A8X A;  4KUM B;  4OVI A;  3CML A;  2XQ6 A;  5LMN T;  3P7I A;  2J4G A;  2JQK A;  4OFZ A;  3AED A;  3I0O A;  2YVG A;  1VCS A;  4B6X A;  3CVR A;  2UUA T;  3DJE A;  2YG4 A;  3NRY A;  2WES A;  3B57 A;  3HR0 A;  3ZEF B;  3MK7 C;  1U5P A;  2JJ9 A;  5ABH A;  2BKP A;  2WMO A;  5HHF A;  1YXR A;  2R9Z A;  4DID B;  3IWA A;  1W0A A;  2BBH A;  3JAD A;  3AE8 A;  2EQ9 A;  1UGO A;  3UOX A;  4OPC A;  4EIQ A;  3HA4 A;  4A9W A;  4PK6 A;  4JV5 T;  4ZZC A;  3AYJ A;  5IQ1 A;  2E5L T;  3D1C A;  2GRT A;  3ZT7 A;  1J1J A;  1IZN B;  5U63 A;  1XZY A;  1OXZ A;  3UFE A;  5C3J A;  4AQF A;  2XQA A;  4OCG A;  3DJG X;  3T8O A;  2YAU A;  4EQR A;  3UKQ A;  3B3R A;  3DJD A;  2XQ3 A;  4OHF A;  4UV9 B;  5IQ4 A;  3J7Y q;  5AFU L;  1XNQ T;  4TWF A;  4REK A;  4IRE A;  4UR9 A;  2NTX A;  4Z8X A;  3SOL A;  5LV9 A;  3AD7 B;  5JRC A;  2WBA A;  4NIQ A;  1MXT A;  2W0H A;  2HN2 A;  3OTO T;  2M6B A;  4JI2 T;  5J60 A;  2BG9 E;  4BUR A;  1XWM A;  1F8W A;  3FB2 A;  3EDV A;  4H4V A;  3LK4 2;  1O95 A;  3PUY F;  2NTY A;  2XCG A;  4H2P A;  2WDV A;  2BCP A;  1H6V A;  2YWL A;  3LDQ B;  2OV9 A;  3CX8 B;  2I6H A;  4EMJ A;  3PUQ A;  3ZYK A;  5FS9 A;  4OK0 A;  5JRE A;  4Z44 A;  1KNZ A;  1HX8 A;  1TYP A;  4DNA A;  4U8M A;  1IAP A;  5F8P A;  1EL8 A;  2RP4 A;  3ZPO A;  1ZX9 A;  2CLY B;  2D9D A;  1LPF A;  3GMB A;  3V3N A;  4L0R A;  3VHL A;  4JY3 A;  1T98 A;  4I58 A;  1JU2 A;  5JDG A;  4JQ9 A;  2KMF A;  3NGC X;  2WPE A;  3NK0 X;  3MXZ A;  3PO7 A;  1N32 T;  3GWH A;  2IAK A;  3AAE B;  4DSH A;  5HEH A;  1MMN A;  3SZF A;  2YN6 A;  4YY3 T;  4HFB A;  3CQC B;  2G0U A;  3KVB A;  4X9M A;  4O5U A;  4K5S A;  4J2W A;  4ILC A;  2XVJ A;  3H3M A;  3KPK A;  4TZ4 C;  2X51 A;  2VZ2 A;  4QH5 A;  3A8Y C;  3CWZ B;  5KMR A;  1S94 A;  2BKN A;  2BYB A;  2XQ8 A;  4QHO A;  4NTD A;  4TV9 E;  4YHJ A;  4NTE A;  2ZM2 A;  1Y56 B;  4N78 D;  4KPR A;  3RI5 A;  1GND A;  2JIW A;  2XAS B;  3HYX A;  4B1B A;  2MBG A;  4GAV A;  4BJZ A;  2DHR A;  1GES A;  1XDO A;  3IHR A;  5KMG P;  3C4X A;  3TLV A;  3KBT A;  3ICT A;  3NG7 X;  1YQ3 A;  4XWR A;  4Z43 A;  2MTQ A;  2WZH A;  5FVK A;  3WAK A;  1TYT A;  5JVD E;  2WCA A;  3ZN0 B;  2RA1 A;  2IVE A;  2J62 A;  3VKG A;  2XFQ A;  3LK3 B;  3FXD B;  4LF9 T;  3UUB A;  1E6E A;  2QCU A;  3PUG A;  4DND A;  1MND A;  1B4V A;  4LF5 T;  2V3A A;  2YEV C;  4OPT A;  3H8I A;  2P9B A;  3RIA A;  2XY8 B;  4LFC T;  2XDO A;  2LOP A;  1XMO T;  4BK2 A;  5JR9 B;  4II2 A;  3AE7 A;  4YWO A;  2NWB A;  4LMJ A;  2CHO A;  1JNR A;  1VG0 A;  2X8C A;  2IML A;  2CXL A;  2H7O A;  2V6Y A;  5A1L A;  3ZJ2 A;  5BMV E;  2CE7 A;  2RGH A;  3J9X 1;  3AA6 B;  3RRW A;  1GTH A;  5EK2 A;  3ALM A;  3IF9 A;  3B13 A;  4TNV A;  4GK0 E;  2JBV A;  3C50 A;  3NBX X;  2XVE A;  3DK9 A;  4UDQ A;  2BG9 B;  4TV8 E;  1YKE B;  2VUR A;  3AYL A;  1FJG T;  2RGO A;  1VDC A;  4CN6 A;  2UXD T;  1MOK A;  3HYW A;  3UU8 A;  2VVL A;  4AOX A;  1PJ6 A;  2BRA A;  2WDR A;  3I0Q A;  2BBJ A;  3F31 A;  3IC9 A;  5KNL A;  3K7M X;  1X9B A;  4HFI A;  2N2N A;  3N9O A;  5KMP A;  3DK4 A;  5EB4 A;  1Z6L A;  4X9N A;  4OPU A;  2QA1 A;  2ODU A;  4X4J A;  5KMS A;  2NVK X;  5M4Y A;  2YU2 A;  2JPF A;  2V6X A;  2L8K A;  1PXA A;  2C73 A;  4AP3 A;  2I0Z A;  1HCI A;  2W66 A;  2YLR A;  4AKR B;  2CWO A;  3G5S A;  4O2A E;  4EQS A;  2YLX A;  3N9N A;  2XQ4 A;  3C96 A;  5CFB A;  5IWA T;  4GAP A;  5M0Z A;  2PBI A;  3O1J A;  5J2T E;  3RYF E;  3TKL B;  3P4P A;  1JRZ A;  2YR5 A;  3VKH A;  5LJN A;  4QXH B;  2V3B A;  3QFA A;  4FX9 A;  1MMA A;  1Z8U A;  3NRN A;  2WPC A;  3RQW A;  2LM2 A;  4QX7 B;  4JEU B;  4WBO A;  3K30 A;  4XWZ A;  5LOV E;  4EYU A;  3H3A A;  4H7U A;  5HAX A;  1DJN A;  2JMH A;  3DJJ A;  4QKN A;  4A79 A;  3PU8 A;  2GR3 A;  2IVD A;  4U2S A;  5EB5 A;  3IF8 B;  4O4J E;  1WFD A;  5CA0 E;  2Q7V A;  1VRQ B;  1PJ5 A;  3CKD A;  2YLS A;  2KZ7 B;  2IDO B;  5BVA A;  3ANW B;  2MAW A;  3NN6 X;  4HWF A;  2WOW A;  5AQL B;  4G6G A;  2QGS A;  4YTN A;  5ABF B;  2QVA A;  3KBU A;  5HXC A;  3MA9 A;  5JH7 E;  4AI6 A;  3CPH G;  3UT5 E;  1XDP A;  4H9N C;  4CI2 B;  3Q5E A;  3O9X A;  2W62 A;  2Y8D A;  4A98 A;  2LOS A;  2C75 A;  3CMM A;  4H4U A;  4JNA A;  4C77 A;  2Q0K A;  3SZC A;  3N5L A;  3P50 A;  4QH1 A;  4KI0 F;  4UXN B;  5LHH B;  3JC6 D;  5J7X A;  1GTE A;  4DR7 T;  2H7V C;  5FS8 A;  2X9H A;  4KMC A;  2ZM6 T;  3FXE B;  1OED C;  2B7R A;  3NVO A;  3CTY A;  3JC6 C;  1I94 T;  2VVM A;  2D0T A;  4ERR A;  2YDR A;  4U8J A;  2OAM A;  4DSG A;  4A5L A;  2HPJ A;  1S2Y A;  1PXB A;  1CC6 A;  1VCT A;  4DV4 T;  3NT6 A;  2PG8 A;  5AQK B;  2Y6R A;  2JK6 A;  3SXI A;  1M62 A;  4P9S A;  2XQY A;  3GRS A;  1E1M A;  2LHR A;  1H7W A;  2EHO D;  4O4H E;  4ECH A;  4WNK A;  2ODV A;  4EXT A;  1ZDL A;  1MMD A;  4CN4 A;  2EHO C;  1XNR T;  3IA3 A;  1N36 T;  3FBS A;  4DBQ A;  5F5W A;  3H8L A;  3LXD A;  2ZMA A;  3T31 A;  2OA1 A;  3JSK A;  2N1G A;  1E1N A;  2QYW A;  2AAQ A;  5GSN A;  3RYC E;  4C5O A;  4IL9 A;  2X0Y A;  4BAY B;  3GYI A;  3HI2 A;  3O4X E;  2X68 A;  3CQG B;  3ETU A;  3TLT A;  5L3F B;  4CQI A;  1FCD A;  3CNP A;  2V7K A;  1K0I A;  2VK9 A;  3ZMS B;  3PUW F;  5KVI A;  4A6N A;  3KV9 A;  1KFY A;  2LSY A;  2V7M A;  4PJN A;  2EQ8 A;  5FXZ A;  2GR0 A;  4WX1 A;  3L09 A;  5LNK A;  3RC8 A;  4XXG A;  1WRD A;  4G73 A;  3SZ0 A;  2BXS A;  4UVB B;  3UKH A;  3CK6 A;  4A99 A;  1X79 A;  4C74 A;  2ZZB A;  1D0X A;  1Y64 B;  5EK4 A;  3RPU A;  4ZI3 D;  1CC4 A;  1RSG A;  2WEU A;  1FEC A;  4H4X A;  1KEY A;  3MAC A;  4U33 A;  1MIV A;  4ZI3 C;  2LKH A;  4B3R T;  4FK1 A;  1ZOV A;  5HWX A;  1G8X A;  2D2S A;  2GEW A;  1E1K A;  5AQQ B;  4H9Q C;  3CX7 B;  3TLU A;  2X9X A;  3NN0 X;  2BK5 A;  2R0C A;  4H9O C;  3EAB A;  2B9X A;  3AE1 A;  1L0V A;  4CCQ A;  2IW5 B;  5BRT A;  1P2H A;  1NHR A;  4U2Z A;  2I59 A;  2A89 A;  3N9M A;  2K5B B;  3VR8 A;  2ARD A;  4KP3 C;  5JDF A;  2WMN A;  1MIY A;  4B69 A;  4IV9 A;  3HKD E;  1LRZ A;  4IL4 A;  5HCJ A;  5FXX A;  2E9X A;  2XZE A;  3URH A;  3UUX B;  1OJC A;  1W09 A;  2W00 A;  3S5W A;  3UP5 A;  2C65 A;  1B5Q A;  4D04 A;  1GRA A;  5HXH A;  1O94 A;  2DWK A;  2X3N A;  3FMW A;  3P4R A;  3ESL A;  3UKF A;  4P0A A;  5LXT E;  1PN0 A;  4YKF A;  3B5M A;  5HWY A;  5AQM B;  4EM4 A;  1OED E;  4IIJ E;  4AT0 A;  5JDM A;  1W4X A;  1QSD A;  2VVN A;  4EB6 E;  3FBL A;  2V7L A;  2BS2 A;  3BK9 A;  4X5T A;  2UXC T;  5FS6 A;  1D4E A;  5LG4 A;  3ZMV B;  1HTJ F;  4U8P A;  1JOA A;  3L8K A;  2VQB A;  2IIU A;  4U72 A;  1H82 A;  5LB7 B;  2W67 A;  4ZOL E;  2MYS A;  3DH9 A;  5FMN A;  4TUY E;  3GRT A;  1HS7 A;  3Q2M A;  4UF0 A;  3PE0 A;  4GDP A;  3AEG A;  4MFR A;  1Y56 A;  2EQ7 A;  3NKS A;  2GV8 A;  3GYJ A;  2FUP A;  4H4W A;  4RG3 A;  5DQV A;  3BNM A;  3ETV A;  4ILU A;  3T2Y A;  2J1D G;  5LP6 E;  2XFP A;  5LA6 E;  2VRL A;  2YQU A;  1Q1W A;  4A5X A;  4O2B E;  5EOW A;  2QA7 A;  1LKX A;  2E8I A;  1PXC A;  2V5D A;  5DAB A;  1PBD A;  3AXB A;  1PBE A;  1GEU A;  3F8P A;  2ZM0 A;  3VRA A;  3AEC A;  1NEN A;  3CGB A;  4X66 T;  2C5I T;  1K0J A;  2WOV A;  1HYU A;  2XLP A;  2UUB T;  4G9K A;  2XSA A;  1F8R A;  4EQX A;  2C7G A;  4JNQ A;  2VVS A;  3UTH A;  4DVD A;  2IUB A;  5JDQ A;  5H6Q B;  2ZLY A;  1OJT A;  4LF8 T;  3OYZ A;  3AXJ B;  3I6D A;  4NXN T;  2YLZ A;  4PAG A;  3UFG A;  2PYX A;  3D0T A;  4IDO A;  3GYX A;  3UTK A;  2V5C A;  2WP6 A;  1PJ7 A;  4HE8 A;  4V1A v;  3UKA A;  4IE6 A;  3F8D A;  3K3Q C;  5FXW A;  1GXF A;  1LQU A;  3RH3 A;  5KMQ A;  3ZYX A;  3RGL A;  4M1P A;  1W0B A;  4CY8 A;  3ZC0 A;  3CIR A;  4O5Q A;  4H4P A;  4TLX A;  2BG9 A;  3V5U A;  4B3T T;  1D5T A;  3L3P A;  3LAD A;  2WZI A;  1BZL A;  3NIX A;  1WYC A;  2GAH B;  2DLR A;  1GPE A;  2FJD A;  1D1C A;  4U8I A;  2QA2 A;  4Z2U A;  3UQ4 A;  3N2G E;  2XSB A;  4YT0 A;  2C5J A;  4GUV A;  4YSX A;  3ICR A;  2Y48 B;  1RYI A;  1BGJ A;  2CPT A;  2X8G A;  5HYM A;  2AQJ A;  4WZX A;  1UX5 A;  3PV0 F;  5ETW A;  5L3G B;  4NXM T;  3KD9 A;  3SY4 A;  1PS9 A;  2FBW A;  2NPX A;  4J34 A;  3EVY A;  2CXD A;  3EAO A;  1OED B;  1DU2 A;  2KND A;  1JNZ A;  4YJ3 E;  3ATR A;  2BAC A;  4YTM A;  3IBP A;  3QSS A;  1ZKE A;  3KDS E;  2PJQ A;  4CI3 B;  1UUR A;  3ZJ1 A;  2A87 A;  4EM3 A;  2NOX A;  3A5X A;  1TRB A;  5JDH A;  3Q5W A;  3ZYM A;  2R45 A;  1QJD A;  4OPG A;  2W4X A;  1F6M A;  4U2T A;  3SFD A;  3AD9 B;  3AB3 B;  2LRK A;  1KNP A;  4I55 E;  3RP6 A;  3TLS A;  5ABE A;  2KSR A;  4LU6 A;  3Q5D A;  2C0S A;  2C64 A;  2GF3 A;  4JI0 T;  3QC9 A;  1BGN A;  4H2N A;  2X0L B;  2VKO A;  2NP9 A;  2R4J A;  2SPC A;  4II3 A;  3RQU A;  3P4W A;  4JI5 T;  4DV5 T;  4JUY A;  4I50 E;  2WM9 A;  3P9U A;  3P4S A;  3OYX A;  4CXY A;  3P1W A;  4U8L A;  2EHO B;  3UU5 A;  4CY6 A;  4H4S A;  4ILB A;  3EDU A;  1MNE A;  4U8K A;  3RIU A;  5LJM A;  3NRX A;  2K9A A;  4ZI7 E;  4NPP A;  5JQG E;  3T37 A;  2GVC A;  4ISS A;  3MZK B;  2XLT A;  2E5V A;  2CM0 A;  3O0H A;  4NUV A;  3CQX C;  2V7J A;  3COX A;  1KK7 A;  3UUN A;  1GRH A;  3ANW A;  3ZT5 A;  2BVL A;  1H83 A;  4AKL A;  3EI0 A;  5FNV E;  5ABF A;  2ZM8 A;  3E08 A;  1ZHC A;  2XFU A;  4DBR A;  4H9R C;  3C98 B;  4TM4 A;  3UOY A;  3NYC A;  2BXR A;  5HXS A;  5CGM A;  3UU6 A;  3ZLI A;  2L9Q A;  2OLT A;  3SZW A;  3EHZ A;  3VQR A;  3JAF A;  3JCF A;  2X50 A;  4OYK A;  4UEL A;  2ZZ0 A;  5L4E A;  2WET A;  5LHI B;  1D7L A;  1NDA A;  5LYJ E;  4J56 A;  1BR1 A;  2V5Z A;  2WPF A;  1FEA A;  2IID A;  5TR3 A;  5AQN B;  5LMU T;  3AE6 A;  1F3P A;  3RKG A;  3RNM A;  3ONX A;  2C70 A;  4CI1 B;  2V61 A;  5AQF B;  1G73 A;  4JYA T;  4NTC A;  3VRD B;  1OJD A;  1ZMD A;  1XDI A;  1DOB A;  4BV6 A;  2YM2 A;  3E1T A;  4B66 A;  1IUV A;  1DOC A;  4C91 A;  1K0L A;  3O1H A;  4CBQ A;  4WCT A;  2JQ9 A;  3EF6 A;  4L5G A;  2UXN B;  4QXC B;  3T1H T;  4ILA A;  2LLY A;  4IA6 A;  3R84 B;  1KDG A;  5JCL A;  2JMK A;  2JB2 A;  4EIP A;  3V76 A;  1XPQ A;  3CGD A;  3OVU A;  4NEW A;  4YSZ A;  2EQ6 A;  2XAG B;  4ANJ A;  5FY1 A;  3RF1 A;  3PS9 A;  1ZY8 A;  5JCK A;  5FL1 A;  4QXB B;  3SFE A;  3GD4 A;  3IHG A;  4EOZ B;  4P09 A;  1GRB A;  4WBN E;  3AE2 A;  1Q9I A;  5KOX A;  4DR2 T;  3BI4 A;  4AT2 A;  4LMK A;  3GSI A;  1IJ5 A;  5J0Z A;  1U4Q A;  1UKV G;  4H50 A;  2CCQ A;  1BKW A;  4I0U A;  1QO8 A;  3CNT A;  1L9D A;  3ABV A;  4G6H A;  3ZMZ B;  1HNW T;  2D5U A;  2Q9Q A;  1JRY A;  4GR1 A;  1IUT A;  4PFO A;  3M3Z B;  2XVH A;  1M6I A;  3AEE A;  1ZV4 X;  3KKJ A;  4N9X A;  4ZEY A;  1UUS A;  4EEB A;  3FZL B;  3AWI A;  4FJO A;  4XAX B;  2LT3 A;  4DV3 T;  4TM3 A;  3LBX B;  4H63 V;  3HKC E;  4PAB A;  2NW8 A;  2YU1 A;  4PNI A;  5FYM A;  3UU3 A;  4EQW A;  4X1K E;  4GKJ T;  2VKD A;  3PUS A;  1TDN A;  2BRY A;  2VAS A;  2C3C A;  3KV4 A;  2GR2 A;  4TM1 A;  1LVF A;  5AQR B;  4TWH A;  3L8R A;  1AJ3 A;  4YXD A;  4DR5 T;  3HZL A;  1YKH B;  5JDL A;  1XHC A;  4C3X A;  4B68 A;  4KHP T;  4PJL A;  1IUS A;  3PUX F;  4Z90 A;  4JI1 T;  4USR A;  3RIF A;  4H9P C;  4HWI B;  4H63 H;  4E7S A;  3BNU A;  1NHQ A;  1H7X A;  3NH3 X;  1M7K A;  2BS3 A;  3AEA A;  2VRM A;  4CN1 A;  5LHG B;  1TDO A;  1FMW A;  3QOF A;  3AEF A;  1IJH A;  3RX6 A;  3SWH A;  3C64 A;  2X8H A;  3H37 A;  1T8B A;  4FK1 C;  3KVA A;  2A3D A;  4DR3 T;  5AQP B;  3ZC1 A;  1DOE A;  4DMV A;  4BJM A;  3UUM A;  3KIN B;  1PDH A;  3M65 A;  4DV2 T;  4HFH A;  3NNE A;  5AQT B;  2PTF A;  4DV6 T;  1B8S A;  1SA0 E;  4KBM B;  2NW9 A;  3ITJ A;  3ZT6 A;  3ONJ A;  2AE9 A;  1H7C A;  3RYI E;  2C67 A;  3QUJ A;  3CND A;  2E9X D;  2E1M A;  4HKA A;  4EIW A;  1VQW A;  4AXP A;  3WE0 A;  2H3R A;  4BJN A;  4A7A A;  4H4T A;  3ONL C;  2HHH T;  2W2U A;  4H4Z A;  3HL6 A;  2BKO A;  2E9X C;  3ATQ A;  2WP5 A;  4YLH A;  1WR6 A;  3M13 A;  3GN5 A;  4AP1 A;  4JEH B;  1CBO A;  2GH5 A;  4YKG A;  2GK9 A;  3BQK A;  3NTA A;  4JI8 T;  2XQ9 A;  5L3D B;  4LF7 T;  1VOM A;  4TWD A;  4ZI2 D;  1NHP A;  4HFV A;  3CPI G;  4JI7 T;  2WQY A;  2XLS A;  4OX9 T;  2J3N A;  2KXP B;  4AIU A;  4ZI2 C;  2X67 A;  3N9P A;  4ZN0 A;  4BJY A;  1OJ9 A;  2YIN A;  4MBQ A;  4JDR A;  4AIS A;  4DV1 T;  1ZMC A;  1CJ4 A;  3DTO A;  1AOG A;  2A9U A;  3P4Q A;  1REO A;  3KV5 A;  3R9U A;  1NAA A;  1TDF A;  4J36 A;  1OJA A;  1D4D A;  4EV6 A;  3GDP A;  5JCM A;  4EAH A;  1BR2 A;  5KRQ A;  1N1P A;  2BK4 A;  3ZSS A;  2WOI A;  2E4G A;  3I3L A;  3C4W A;  5HYA A;  3E0Z A;  5DQW A;  2LRL A;  3FZH B;  2GMH A;  3PUA A;  4EED A;  1CJ2 A;  5H6R B;  2I0M A;  3V5S A;  2DL1 A;  5HEU A;  5CJ5 A;  4U3C A;  2YLT A;  2FJE A;  4TNW A;  4O4I E;  4IDN A;  1GRT A;  3I1A A;  2XAJ B;  2XQ5 A;  1HNZ T;  4UDR A;  4K5R A;  2XUE A;  3AA1 B;  5FVL A;  4LA1 A;  3MJX A;  4U8N A;  4JN9 A;  2K48 A;  3FZF B;  4AKI A;  3NZP A;  4OPL A;  1W9R A;  5HCM A;  3R6N A;  2CEA A;  4H4R A;  1X31 B;  3OJA A;  4BA9 A;  1SEZ A;  1MMG A;  4C3Y A;  1V9D A;  2NR4 A;  1N4W A;  4PW8 A;  2CXF A;  3HKB E;  5KXJ A;  3GWF A;  1H81 A;  5HXE A;  3RRC A;  5JCN A;  2C76 A;  4GF7 A;  1S35 A;  1S3E A;  2KLQ A;  4CZZ B;  4AKH A;  2BS4 A;  5DBJ A;  1LVK A;  4MLK A;  3B6D A;  4ZCD A;  3BI5 A;  2KWH A;  3AD8 B;  3IEE A;  3OKQ A;  4AQF C;  1RP0 A;  1OED A;  1HF8 A;  3SQP A;  1D1B A;  3RHW A;  4B65 A;  4WW0 A;  2WU2 A;  2DCF A;  4HWD A;  2JAE A;  2BG9 C;  4IA5 A;  4IHJ E;  2WDQ A;  5ER0 A;  4I43 B;  5AQJ B;  3SM8 A;  2OA5 A;  4X64 T;  5L3E B;  4MHC A;  1D0Y A;  5GON E;  3ALJ A;  3ZDN A;  1H84 A;  3LZW A;  2C3D A;  4K22 A;  4EMI A;  1DJQ A; 
#chains in the Genus database with same CATH homology
 2FBW A;  3DGH A;  1LVL A;  2NPX A;  2RGO A;  3NK1 X;  1VDC A;  4J34 A;  1GER A;  5FMH A;  3EAO A;  1MOK A;  3HYW A;  1JNZ A;  2VVL A;  4AOX A;  3ATR A;  1PJ6 A;  5C2T A;  2BAC A;  2BRA A;  3CNJ A;  2HQM A;  2WDR A;  2VQ7 A;  3KA7 A;  3M12 A;  4YTM A;  3QSS A;  4UDP A;  1K4Q A;  1LJ1 A;  2F5Z A;  1PBB A;  3IC9 A;  5KNL A;  2A87 A;  3K7M X;  3RHA A;  4EM3 A;  5KMP A;  1TRB A;  5U1O A;  4NZH A;  2R45 A;  3DK4 A;  1QJD A;  2Q6U A;  5EB4 A;  4OPG A;  1F6M A;  1Z6L A;  4U2T A;  2V60 A;  4X9N A;  3SFD A;  3AD9 B;  4OPU A;  1KNP A;  2QA1 A;  4ZCC A;  3RP6 A;  1GRE A;  4LU6 A;  1Y0P A;  4X4J A;  5KMS A;  2NVK X;  2C64 A;  4J33 A;  2GF3 A;  1D7Y A;  1CC2 A;  2WU5 A;  1BGN A;  1PXA A;  2C73 A;  1NHS A;  4H2N A;  4AP3 A;  1CF3 A;  3CPJ G;  2TMD A;  2I0Z A;  2R4J A;  1NEK A;  2WP9 A;  4II3 A;  2YLR A;  3G5S A;  3P9U A;  4CNJ A;  3QVR A;  3GDN A;  4EQS A;  2YLX A;  3P4S A;  1V59 A;  3C96 A;  3EPT A;  4GCM A;  3P1W A;  1H86 A;  2GMJ A;  4U8L A;  2XYO A;  4YSH A;  4CY6 A;  3UKK A;  4H4S A;  4GAP A;  2GAG B;  3KPF A;  3LB8 A;  4K2X A;  5CQF A;  4YSY A;  2Z5X A;  5M0Z A;  2LFC A;  4U8K A;  1O5W A;  3P4P A;  2OAL A;  4K8D A;  4H2R A;  1JRZ A;  2YR5 A;  3T37 A;  2GVC A;  4GDE A;  2V3B A;  1ONF A;  2XLT A;  3QFA A;  4FX9 A;  3UTE A;  2E5V A;  3O0H A;  3FG2 P;  2WS3 A;  4UP3 A;  3COX A;  3NRN A;  2WPC A;  1GRH A;  1FL2 A;  1B37 A;  1H83 A;  1JEH A;  2YG7 A;  2BC0 A;  1GRG A;  3T14 A;  3AYI A;  3QVP A;  4OPD A;  2R0P A;  2R0G A;  2BAB A;  3LZX A;  3K30 A;  4XWZ A;  3QFB A;  2XFU A;  2CUL A;  4TM4 A;  3SGL A;  4H7U A;  3UKL A;  3UOY A;  3NYC A;  2BXR A;  4I59 A;  4J57 A;  1COY A;  3NYE A;  1DJN A;  4G74 A;  4GRT A;  3AEB A;  1GV4 A;  3DJJ A;  4H4Y A;  3L1R A;  4A79 A;  3G5Q A;  4OPI A;  2GR3 A;  4D03 A;  3SZW A;  3VQR A;  4A6N B;  2IVD A;  5KOW A;  4U2S A;  5EB5 A;  3T0K A;  2Q0L A;  2X50 A;  3PVC A;  1NG3 A;  1L9E A;  2Q7V A;  1VRQ B;  4A65 A;  1E39 A;  3ADA B;  1PJ5 A;  4TM0 A;  2YLS A;  2APG A;  2ZZ0 A;  5BVA A;  2WET A;  1D7L A;  1NDA A;  2H88 A;  2YG5 A;  3NN6 X;  3UOZ A;  2BCG G;  3T2K A;  4J56 A;  2WOW A;  2VVL G;  1IUX A;  4G6G A;  3NLC A;  2B9W A;  2V5Z A;  3QSE A;  4EMW A;  4YTN A;  1DXL A;  1FEA A;  2WPF A;  5IPY A;  1E7P A;  1N4V A;  2JKC A;  2IID A;  2YR6 A;  2BK3 A;  5TR3 A;  3CPH G;  4Y4N A;  3QSM A;  4RSL A;  4Z24 A;  3AE6 A;  1F3P A;  1YY5 A;  3RNM A;  2C70 A;  3BHK A;  3KVE A;  2V6O A;  3CMM A;  2C75 A;  1CJ3 A;  4H4U A;  2ACZ A;  4JNA A;  4Y4M A;  2V61 A;  3RP7 A;  4C77 A;  2Q0K A;  2XFN A;  3AB1 A;  4CCR A;  3AE4 A;  3SZC A;  3NYF A;  2R46 A;  3T2Z A;  4NTC A;  3VRD B;  1OJD A;  3VRB A;  4PAA A;  1ZMD A;  2GR1 A;  3UTF A;  1XDI A;  3S61 A;  1DOB A;  4BV6 A;  2YM2 A;  2JB1 A;  3E1T A;  4B66 A;  5J7X A;  1IUV A;  1DOC A;  1GTE A;  2QAE A;  1K0L A;  4H2Q A;  5FS8 A;  4CBQ A;  4WCT A;  4B64 A;  1S3B A;  3GD3 A;  3EF6 A;  2B7R A;  2ZBW A;  4Z2T A;  2FJB A;  1IUW A;  5BUL A;  4KX6 A;  3CTY A;  1IUU A;  2VVM A;  4U8J A;  4IA6 A;  2B7S A;  4DSG A;  1KDG A;  2OAM A;  3ICS A;  3ALL A;  5JCL A;  1GET A;  2JB2 A;  5M10 A;  4EIP A;  4A5L A;  3V76 A;  1XPQ A;  4TLZ A;  3CGD A;  3SX6 A;  4B63 A;  1S2Y A;  4NEW A;  1PXB A;  1CC6 A;  4RG4 A;  4YSZ A;  2OLO A;  2EQ6 A;  1GRF A;  2Y6Q A;  3NT6 A;  4IVO B;  2WHD A;  3PS9 A;  4USQ A;  1ZY8 A;  1ZOY A;  2Y6R A;  1DOD A;  4YTP A;  3C4N A;  4NEV A;  5JCK A;  2XFO A;  2JK6 A;  1CHU A;  3SFE A;  3BI2 A;  3GD4 A;  3SXI A;  4P9S A;  3IHG A;  1CL0 A;  3KLJ A;  2PHH A;  1GRB A;  3AE2 A;  1Q9I A;  3GRS A;  5KOX A;  4K7Z A;  1MO9 A;  1E1M A;  3BI4 A;  1H7W A;  2TPR A;  4ECH A;  5BUK A;  4AT2 A;  3GSI A;  1EL5 A;  1EBD A;  4MJW A;  1UKV G;  2C66 A;  1ZDL A;  1FEB A;  3G5R A;  2ZZC A;  1DNC A;  3GWD A;  4H50 A;  4CNK A;  1BF3 A;  4CRT A;  1BKW A;  1EL7 A;  1JRX A;  1QO8 A;  1YKJ A;  1L9D A;  3ABV A;  3CNT A;  3FBS A;  3QJ4 A;  4G6H A;  3H8L A;  1JRY A;  2C72 A;  3LXD A;  1IUT A;  2AR8 A;  4GR1 A;  3T31 A;  2OA1 A;  4APN A;  3JSK A;  4M52 A;  1QLB A;  3UKP A;  1E1N A;  1M6I A;  2XVH A;  3AEE A;  4BK3 A;  1N4U A;  2AAQ A;  2JB3 A;  2YR4 A;  3KKJ A;  5GSN A;  3UOV A;  3F8R A;  4C5O A;  2H89 A;  1VG9 A;  3GYI A;  4N9X A;  4Z25 A;  3K7Q X;  3AWI A;  4JY2 A;  1ZP0 A;  5CKU A;  1GOS A;  1FCD A;  2GQF A;  3CNP A;  3LJP A;  1K0I A;  4U8O A;  4TM3 A;  4U2L A;  5KWF A;  1LQT A;  2XLU A;  4PAB A;  5KVI A;  4A6N A;  1KFY A;  4HA6 A;  2EQ8 A;  4EQW A;  1PBF A;  2GR0 A;  1TDN A;  2BRY A;  2YG6 A;  3KU9 A;  4WX1 A;  4XXG A;  1KSU A;  1BWC A;  2O9Z A;  2YVJ A;  4G73 A;  3AE5 A;  2C3C A;  2GR2 A;  4TM1 A;  3SZ0 A;  1EL9 A;  2BXS A;  3FPZ A;  4HB9 A;  3UTG A;  4DGK A;  2CFY A;  5KVH A;  2RAB A;  3UKH A;  4YXD A;  4E0V A;  3EAN A;  3HZL A;  3UCL A;  4A99 A;  4C74 A;  1KNR A;  3NTD A;  2ZZB A;  3K7T A;  1XHC A;  2A8X A;  4C3X A;  4OVI A;  4B68 A;  1IUS A;  1PHH A;  1CC4 A;  4USR A;  1TDE A;  1RSG A;  2WEU A;  4NNJ A;  3DME A;  1FEC A;  3BNU A;  4H4X A;  1NHQ A;  3AED A;  3II4 A;  2YVG A;  3V3O A;  3CGE A;  1KSS A;  1H7X A;  3GMC A;  3DJE A;  2YG4 A;  3NH3 X;  2BS3 A;  3AEA A;  2WES A;  4FK1 A;  1ZOV A;  2VRM A;  3C4A A;  1P2E A;  1TDO A;  1KF6 A;  2GEW A;  5HHF A;  1ELI A;  1E1K A;  2R9Z A;  5HXI A;  3IWA A;  3AE8 A;  3AEF A;  1LTX R;  1IJH A;  2BA9 A;  2BK5 A;  2EQ9 A;  2R0C A;  3NN0 X;  2GQW A;  2B9X A;  3UOX A;  4OPC A;  3AE1 A;  1L0V A;  4CCQ A;  2BC1 A;  4EIQ A;  5BRT A;  2X8H A;  4A9W A;  1P2H A;  1NHR A;  4FK1 C;  2A89 A;  3AYJ A;  5IQ1 A;  3D1C A;  3DK8 A;  2GRT A;  2XVF A;  1DOE A;  5U63 A;  4B67 A;  3VR8 A;  2ARD A;  1XAN A;  4ADW A;  5C3J A;  4OCG A;  3DJG X;  2GB0 A;  1PDH A;  2UZZ A;  2YAU A;  4B69 A;  4EQR A;  3UKQ A;  4IV9 A;  3NNE A;  1GAL A;  3B3R A;  1B8S A;  3DJD A;  3URH A;  5IQ4 A;  1OJC A;  2DKH A;  3ITJ A;  4REK A;  2CDU A;  2C67 A;  3CND A;  2XVI A;  2E1M A;  5LV9 A;  3S5W A;  1VQW A;  3AD7 B;  3UP5 A;  3UP4 A;  2C65 A;  1B5Q A;  2WBA A;  4D04 A;  1GRA A;  3WE0 A;  4A7A A;  1MXT A;  1O94 A;  1GSN A;  4H4T A;  2W0H A;  2X3N A;  4H4Z A;  3FMW A;  3P4R A;  3FIM B;  3ATQ A;  3UKF A;  4BUR A;  5J60 A;  4ICY A;  1PN0 A;  1F8S A;  2WP5 A;  4YKF A;  1F8W A;  3M13 A;  4H4V A;  4AP1 A;  1O95 A;  1CBO A;  4EM4 A;  2GH5 A;  2YG3 A;  2XCG A;  2Z5Y A;  4H2P A;  1CJC A;  4YKG A;  2WDV A;  2BCP A;  1H6V A;  2OLN A;  2YWL A;  4AT0 A;  3NTA A;  1W4X A;  3CN8 A;  1M64 A;  4EMJ A;  3D8X A;  2BS2 A;  1L9C A;  5FS9 A;  5FS6 A;  4Z44 A;  1YQ4 A;  1D4E A;  1TYP A;  4DNA A;  4U8M A;  4U8P A;  1JOA A;  3L8K A;  2VQB A;  1NHP A;  3CPI G;  1EL8 A;  2WQY A;  1ZX9 A;  2XLS A;  1LPF A;  2R4E A;  1H82 A;  2J3N A;  3GMB A;  1D4C A;  3V3N A;  3H4K A;  4JY3 A;  4I58 A;  1JU2 A;  4ZN0 A;  3DH9 A;  4BJY A;  1OJ9 A;  3OC4 A;  4JQ9 A;  3OZ2 A;  3GRT A;  3NGC X;  2CVJ A;  4JDR A;  1DJQ A;  4GDP A;  3AEG A;  2WPE A;  3NK0 X;  3PO7 A;  1ZMC A;  1Y56 A;  2EQ7 A;  3NKS A;  1LV0 A;  1CJ4 A;  2GV8 A;  3CNS A;  3GYJ A;  4H4W A;  4RG3 A;  4DSH A;  3RP8 A;  3SZF A;  1AOG A;  3BNM A;  1E1L A;  3P4Q A;  3T2Y A;  1REO A;  3R9U A;  2XFP A;  4X9M A;  2VRL A;  4O5U A;  4BK1 A;  4K5S A;  2YM1 A;  4J2W A;  2YQU A;  1NAA A;  2XVJ A;  5EBK A;  1Q1W A;  1TDF A;  3M0O A;  4H4Q A;  4J36 A;  3KPK A;  1OJA A;  1D4D A;  5FS7 A;  2VZ2 A;  3GDP A;  5EOW A;  5JCM A;  5KRQ A;  3DGZ A;  1PXC A;  1S2Q A;  1N1P A;  5KMR A;  2BYB A;  3HYV A;  2BK4 A;  3ISH A;  1PBD A;  2E4G A;  2WOI A;  1PBE A;  3AXB A;  1GEU A;  4Z2R A;  2FJA A;  3F8P A;  3I3L A;  4NTD A;  5GRT A;  3VRA A;  3AEC A;  4NTE A;  1NEN A;  3CGB A;  1K0J A;  2WOV A;  2XLP A;  1HYU A;  4G9K A;  2GMH A;  1CJ2 A;  1F8R A;  1NG4 A;  1Y56 B;  4EQX A;  2C7G A;  4JNQ A;  2VOU A;  3UTH A;  3RED A;  4KPR A;  1GND A;  3NK2 X;  3HYX A;  4B1B A;  1TDK A;  4GAV A;  4BJZ A;  1PBC A;  2YLT A;  2FJE A;  1OJT A;  1Q1R A;  1GRT A;  1GES A;  3LOV A;  3I6D A;  2YLZ A;  4UDR A;  2PYX A;  4K5R A;  4LII A;  3AE9 A;  3ICT A;  3IHM A;  3GYX A;  4LA1 A;  3BHF A;  3NG7 X;  3VR9 A;  1YQ3 A;  1PJ7 A;  2WP6 A;  4U8N A;  4JN9 A;  4XWR A;  4Z43 A;  1TYT A;  3UKA A;  2RGJ A;  4IVM B;  3F8D A;  4OPL A;  1GXF A;  4H4R A;  1NPX A;  1X31 B;  1LQU A;  1SEZ A;  2YLW A;  4C3Y A;  1N4W A;  2IVE A;  2XFQ A;  5KMQ A;  5KXJ A;  4Z26 A;  3GWF A;  1H81 A;  3ZYX A;  5L46 A;  5JCN A;  1E6E A;  2C76 A;  2QCU A;  4GF7 A;  1B4V A;  1S3E A;  2V3A A;  3Q6J A;  4CY8 A;  4OPT A;  3H8I A;  3CIR A;  2X99 A;  2XDO A;  5U25 A;  4O5Q A;  2BS4 A;  1ZK7 A;  4H4P A;  5DBJ A;  4TLX A;  4Y4L A;  1FOH A;  3B6D A;  4BK2 A;  4II2 A;  4ZCD A;  2YVF A;  3BI5 A;  5HY5 A;  3AE7 A;  3AD8 B;  4YWO A;  3NHO X;  5JCI A;  1JNR A;  4AOS A;  1VG0 A;  1D5T A;  4J31 A;  2X8C A;  1RP0 A;  3CGC A;  3LAD A;  3SYI A;  3SQP A;  1BZL A;  3NIX A;  2GAH B;  4B65 A;  2C4C A;  1GPE A;  2B9Y A;  2RGH A;  2FJD A;  2WU2 A;  3Q9T A;  2JAE A;  2DKI A;  4U8I A;  1GTH A;  3ALM A;  2QA2 A;  3AE3 A;  3IF9 A;  4IA5 A;  2WDQ A;  4FDC B;  3DA1 A;  4YT0 A;  2XLR A;  5ER0 A;  4Z2U A;  4GUV A;  3SM8 A;  4YSX A;  3ICR A;  2JBV A;  1RYI A;  1BGJ A;  1ZKQ A;  2X8G A;  5HYM A;  3ALJ A;  2AQJ A;  3ZDN A;  4NWZ A;  1H84 A;  2XVE A;  3LZW A;  3DK9 A;  4UDQ A;  2B76 A;  2C3D A;  3KD9 A;  4K22 A;  3SY4 A;  4EMI A;  1PS9 A;  1GT8 A;  3AYL A;  1YQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...