1CHUA

Structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
532
structure length
478
Chain Sequence
NTLPEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMHDISTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPSILSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of L-aspartate oxidase: implications for the succinate dehydrogenase/fumarate reductase oxidoreductase family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Flavoenzyme
molecule keywords PROTEIN (L-ASPARTATE OXIDASE)
total genus 152
structure length 478
sequence length 532
ec nomenclature ec 1.4.3.16: L-aspartate oxidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 1chuA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1chuA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1chuA02
2BS3A 3SM8A 4TM4A 4DSHA 3I6DA 3URHA 4U8JA 4A99A 3QSMA 2A87A 3AE1A 3H8LA 3V76A 3K7MX 2JAEA 1GRTA 3CPHG 1XPQA 1ZOYA 3LJPA 3GD3A 1PN0A 4D03A 1K0LA 1NHSA 3UKFA 3Q6JA 2XVIA 3COXA 4JY3A 3NYCA 3ALJA 1TDKA 3DH9A 3RP6A 1MXTA 4OPDA 4TLZA 3UKKA 4YKGA 1BGNA 1TYPA 4I58A 1PBCA 2GAHB 2RGOA 1GRBA 3AE8A 2OLOA 2GH5A 2QA2A 2YLRA 1M6IA 2XVFA 3H8IA 4H4TA 1TRBA 4OPLA 3IF9A 1K0IA 4Z2TA 4C77A 4U2LA 2VZ2A 1GT8A 2FJAA 5KOXA 1CJ4A 5JCKA 1V59A 4OPCA 5HYMA 3QSEA 5JCLA 1PJ7A 1YKJA 3CGCA 4H7UA 2WHDA 4H2NA 2GAGB 4YTNA 2V5ZA 5HXIA 4JY2A 3GDPA 2GV8A 3ISHA 2VVLA 3NGCX 4B64A 4YWOA 3SFEA 2WPEA 2WEUA 2BA9A 3F8PA 5DBJA 3GMBA 4Z2RA 1H83A 4CY6A 3AEEA 2YVFA 4IVOB 3CPIG 4YSHA 1DXLA 2IVEA 5LV9A 4AP3A 5EBKA 4MJWA 3AYIA 2C66A 2C75A 2RABA 1GXFA 2BK4A 5TR3A 4TLXA 1REOA 4C5OA 2RGHA 1F3PA 3AE5A 3LZXA 2EQ9A 2C64A 1PBFA 4P9SA 3GD4A 2YLZA 2QCUA 3AWIA 2YG3A 2PYXA 3KVEA 2YM2A 1ZP0A 1O95A 1N4VA 2V61A 2C76A 3R9UA 2GQFA 2VOUA 3CN8A 3OZ2A 3BI4A 1D7YA 4X9NA 3FBSA 2JB3A 4CCRA 1CHUA 1GPEA 2X8CA 4OPIA 1VQWA 3AE7A 4J2WA 4A79A 2YR6A 2Q0KA 3P1WA 1AOGA 2GR1A 1CJ2A 3UTFA 3GSIA 2YG6A 4NEWA 1EBDA 3AYJA 4OCGA 4C3YA 3ATQA 5KOWA 3CIRA 1H82A 2BXRA 1JRYA 3DK8A 3ICTA 3PS9A 2XLTA 3CNPA 3Q9TA 4AT0A 4EMJA 2XLSA 3CGDA 2GQWA 3G5RA 1S2YA 4IA5A 3HZLA 3VRBA 5U1OA 2BS4A 4KX6A 1KF6A 2VVLG 5FS8A 1S2QA 2Q0LA 1DJQA 4NTEA 4IVMB 3E1TA 4HB9A 5IQ1A 3SQPA 2C3DA 1OJDA 2EQ8A 3AD9B 2B9XA 3M0OA 1RP0A 2GMJA 2TPRA 3GRSA 3QVRA 1JNZA 1GRFA 1QO8A 3EAOA 1EL8A 3DGZA 3PVCA 2NVKX 3AD7B 1NG3A 1GALA 4U8LA 1TYTA 4UP3A 2CDUA 1GEUA 5GRTA 2YWLA 4BK3A 1BWCA 1TDNA 4FK1A 4ADWA 4B63A 4FK1C 2OAMA 1IJHA 1E39A 2XFQA 1CC2A 2E4GA 5EB4A 2YG7A 1DOBA 2C72A 2JB1A 3NTDA 2YAUA 3B6DA 3UOVA 4ECHA 2GVCA 2XCGA 4USQA 4U8OA 2XLPA 1K0JA 3NLCA 1D4CA 4UDPA 4FDCB 1KNRA 1YQ3A 2V3AA 4USRA 1PJ6A 2YLWA 4J56A 4J31A 1MOKA 2C3CA 3NNEA 2FBWA 4K5SA 4TM1A 4X4JA 2FJBA 4JN9A 3GYIA 1TDFA 2Y6QA 1KNPA 1ZX9A 2GF3A 3UKPA 1NPXA 2A8XA 1EL5A 3AEGA 1K4QA 3DJGX 3IC9A 5FS9A 2XFPA 1COYA 4Y4LA 2CULA 4XXGA 5HHFA 3C4AA 5KVIA 5KRQA 1DOCA 5M0ZA 1B4VA 1NEKA 1Y56A 2R4EA 3NRNA 1N4WA 4H4ZA 1B37A 1JEHA 1XANA 2GR0A 1P2EA 3GMCA 2GR3A 4KPRA 1BZLA 4U8KA 4M52A 3CNSA 2WPCA 1GETA 4JNQA 2BYBA 1GRAA 2JBVA 3NYFA 5M10A 2WDQA 2A89A 1DODA 3P4PA 2Q6UA 3BNMA 3BI2A 2QA1A 4H2QA 4UDQA 3BI5A 1PBBA 3WE0A 3FMWA 3ZDNA 5BRTA 2H88A 1CF3A 1GTEA 4CY8A 3DJEA 2XVJA 2XDOA 1FEAA 2WS3A 1H81A 2PHHA 3AYLA 1FEBA 1Z6LA 4ZCDA 4A65A 3BHKA 4K8DA 4B69A 4U8MA 4K5RA 2B9WA 3GRTA 4NZHA 2B9YA 1UKVG 3I3LA 4LA1A 4U2TA 5EOWA 4D04A 2R46A 4DNAA 2Y6RA 4EM3A 3S5WA 1D5TA 5JCIA 1OJAA 1D7LA 1W4XA 2NPXA 4AT2A 3BNUA 1JOAA 3UTEA 4B68A 3LZWA 4Y4NA 3RP8A 3UCLA 2ZZCA 1TDEA 3GDNA 1NHQA 3QVPA 4PAAA 3UKAA 2CVJA 1H6VA 1IUSA 4RSLA 3UKHA 1VRQB 2VRMA 4YXDA 1LPFA 3AD8B 2BC0A 4U8PA 3KLJA 3UOYA 1O5WA 1OJTA 1RSGA 2RGJA 1RYIA 2YR4A 3GWFA 1CJ3A 2B7RA 3G5QA 1GERA 1N1PA 3AB1A 3C4NA 3NKSA 3QJ4A 2FJDA 4A6NB 3NTAA 2X8GA 2R0CA 2I0ZA 3UP5A 1ELIA 4OPTA 1L9CA 4B66A 4YSXA 2EQ6A 1VDCA 5CKUA 3PO7A 1NENA 3DA1A 2WU2A 4UDRA 4O5QA 2WETA 3CGBA 4EIQA 1ZOVA 2YM1A 1GRGA 3C96A 3L1RA 3FG2P 5FS6A 2BCGG 2JKCA 4NTDA 2BC1A 2V6OA 4J57A 3UKQA 4BK1A 1L9DA 3NK0X 4J36A 5BUKA 4Y4MA 3DK4A 4K7ZA 3NN6X 1S3EA 3ICSA 2XLUA 4XWRA 1F8RA 3ATRA 3QFBA 3D1CA 5JCMA 3VR9A 3V3OA 4APNA 2E5VA 1E1MA 2BK3A 1L0VA 3SGLA 1YQ4A 1E1NA 1Q1RA 4K22A 4AOSA 3L8KA 4NTCA 5FS7A 1GRHA 2VQ7A 4N9XA 2YQUA 1VG9A 4H4PA 2YVGA 4IA6A 2AR8A 4OPGA 4X9MA 1ZY8A 2H89A 4LU6A 2AAQA 4GRTA 1PXBA 3CNJA 4CNKA 2WP5A 3VRDB 3LB8A 1Y56B 4I59A 4XWZA 3P4QA 3REDA 4LIIA 4CBQA 2GEWA 1X31B 3LADA 1E1LA 3F8DA 1YQZA 2BXSA 4AOXA 3AEFA 2YLTA 4WCTA 1GV4A 2JB2A 4H4QA 1NAAA 3ALMA 5BVAA 1CL0A 3JSKA 1PJ5A 3NHOX 4Z24A 2AQJA 3QSSA 4EQXA 3LXDA 4H50A 1F8WA 4BURA 4TM0A 2E1MA 4ZCCA 4Z2UA 2WOWA 2J3NA 2YLSA 2YG4A 4H4XA 4GF7A 1KSUA 1PHHA 4J33A 3AEAA 5C3JA 1IUUA 4U2SA 3AE3A 2B7SA 1LVLA 4GDPA 3NK1X 4YKFA 4AP1A 3NN0X 1ZMDA 2VRLA 5L46A 4U8IA 2JK6A 4TM3A 4A9WA 3RNMA 1E7PA 1B8SA 2R0GA 4EM4A 1H84A 1LV0A 1CC6A 3ITJA 4EMWA 4CCQA 1NHRA 1GTHA 4ZN0A 1E1KA 1DJNA 2YR5A 4K2XA 1SEZA 4OPUA 3DJJA 3AE4A 2VQBA 3BHFA 5KVHA 2Z5YA 4H4VA 4YSYA 1PXCA 3AEDA 1GSNA 1ZK7A 2XFNA 3IWAA 3EANA 1FOHA 2YLXA 1BF3A 2C65A 2R0PA 2R9ZA 2XVHA 3AXBA 3CGEA 2WP9A 1D4EA 4ICYA 1XDIA 1FECA 3VR8A 2WOIA 2BABA 1OJ9A 3UTGA 2Z5XA 5EB5A 1ONFA 2X50A 2TMDA 3EF6A 1GOSA 2GR2A 3KA7A 4Z44A 2FJEA 4GCMA 2IVDA 1QJDA 2BS2A 4Z26A 3AE6A 1ZKQA 4GDEA 3K30A 4YTPA 2LFCA 2WDRA 2B76A 1IUVA 2OALA 3H4KA 3D8XA 1KFYA 2WESA 4BK2A 4E0VA 2ZBWA 5U25A 2CFYA 4YT0A 3DMEA 1ZMCA 1F6MA 3KPFA 5ER0A 4FX9A 1EL7A 1S3BA 2ZZBA 1LJ1A 1O94A 2BCPA 5GSNA 2R45A 2WP6A 3UKLA 4RG3A 3UOZA 3K7QX 1HYUA 4A5LA 4EQRA 1CC4A 2R4JA 3FPZA 1D4DA 3DGHA 4Z25A 2HQMA 4GUVA 4H4YA 2WPFA 1PBDA 4C74A 1H86A 4B67A 2C67A 3SFDA 3VRAA 2W0HA 5KXJA 4J34A 1OJCA 1BKWA 2IIDA 3CNDA 3AE2A 2DKIA 3IHGA 3P9UA 3ABVA 1KSSA 1FCDA 1JRXA 4H4SA 4EQWA 3K7TA 4B1BA 4EIPA 2ZZ0A 1DOEA 5HY5A 3F8RA 1IUWA 3M12A 2XVEA 1P2HA 3G5SA 3M13A 4PABA 1CBOA 3S61A 2VVMA 2WOVA 3O0HA 3NH3X 1MO9A 3GYJA 1YY5A 4H4RA 4H4UA 1EL9A 1IUXA 3DK9A 1N4UA 3QFAA 3RP7A 2O9ZA 3RHAA 3P4RA 1H7XA 3GYXA 3ZYXA 4CNJA 4GR1A 1TDOA 1L9EA 2C70A 2V3BA 5CQFA 4JQ9A 1PXAA 4IV9A 2ACZA 4YSZA 2APGA 2BK5A 3B3RA 3LOVA 3P4SA 2X8HA 4OVIA 4DSGA 5FMHA 4JNAA 5KWFA 1BGJA 5JCNA 3NG7X 3NYEA 5BULA 3V3NA 1GNDA 3NT6A 3KKJA 3UP4A 1JRZA 1PBEA 4B65A 2GB0A 2YG5A 4O5UA 3II4A 3AE9A 2V60A 4A6NA 1QLBA 2GRTA 2QAEA 1PDHA 2WQYA 3UOXA 2XLRA 2OA1A 4HA6A 1XHCA 4REKA 4CRTA 5U63A 3EPTA 3NIXA 4EQSA 2XFUA 1H7WA 4H2RA 4BV6A 1Y0PA 3AEBA 1DNCA 4EMIA 2X3NA 3NK2X 4U8NA 1E6EA 2BACA 2XYOA 3ADAB 5C2TA 4Z43A 4JDRA 5J60A 4BJYA 5IQ4A 1Q1WA 3GWDA 5J7XA 4H2PA 2UZZA 1Q9IA 3ICRA 1LQUA 1JU2A 3OC4A 2F5ZA 1LQTA 4BJZA 1F8SA 3IHMA 1NHPA 1B5QA 3CPJG 4YTMA 1IUTA 2OLNA 2WBAA 2YVJA 3KD9A 4H4WA 4NEVA 4RG4A 1FL2A 1NDAA 1NG4A 1ZDLA 1PS9A 2Q7VA 3VQRA 4C3XA 4DGKA 3CTYA 1VG0A 3T37A 2C7GA 3CNTA 2WU5A 3FIMB 3ALLA 2EQ7A 1LTXR 3AECA 1KDGA 2X99A 4A7AA 2ARDA 5IPYA 2C73A 3DJDA 1M64A 1CJCA 1GREA 2GMHA 3UTHA 2XFOA 4WX1A 2DKHA 1GESA 1JNRA 3KU9A 2WDVA
chains in the Genus database with same CATH superfamily
5AQGB 3OVUA 2CE7A 2LM2A 3T0KA 2WAUA 3Q5XA 3URHA 3AE1A 4JI2T 4ZXLA 1ZOYA 4Z91A 4I0UA 5IYZE 4EZHA 4AKHA 4D03A 1Y64B 3Q6JA 3OJAA 2XVIA 2W4XA 1UGOA 2MBGA 3ALJA 5DABA 4OPDA 2GAHB 3U78A 2OLOA 3PV0F 4V1Av 2XVFA 4OPLA 3K1SA 2XTLA 1GT8A 2FJAA 2YKSA 5KOXA 2LE8A 5JCKA 1WYBA 3QSEA 3EDUA 4JLEA 3RIUA 3QOFA 5CJ5A 2V5ZA 3ISHA 3CQCB 3AEEA 2CPTA 4NUUA 4FI5A 4IVOB 3HKEE 5EBKA 2C75A 1G8XA 3RIAA 1F3PA 3LZXA 3DP7A 1PBFA 3ONLC 4JI8T 4DVDA 2CEAA 4DV2T 1O95A 2M6BA 3ZCJA 2V61A 3R9UA 4UVBB 2J62A 2GQFA 4DV7T 5JTGA 2VOUA 4TV9E 2BKPA 4X9NA 2JB3A 1CHUA 4KHZF 4OPIA 3AVRA 5HCMA 5JDNA 4TV8E 4J2WA 5CA1E 4IDZA 2E9XA 2GR1A 5L3DB 4IDOA 1T7SA 2YK0A 2I6HA 4UR9A 3ATQA 3Q9TA 2VQFT 2XM1A 3AA7B 3Q5WA 1WFDA 2GQWA 3UFGA 2BS4A 1KF6A 2VVLG 1W0AA 5FS8A 1S2QA 1HX8A 3M3ZB 2Q0LA 1DJQA 4NTEA 2BRAA 3SQPA 5AQKB 3RYFE 1XNQT 3SRZA 1JNZA 2IHR1 3S4UA 2NVKX 1GALA 2D0UA 3ZEFB 5KX5E 4FK1A 4ZEYA 4FK1C 2OAMA 1T72A 2KMFA 1CC2A 2E4GA 5EB4A 3ZSTA 5KDMC 2JB1A 3NTDA 2E9XC 4ECHA 1K0JA 3NLCA 4Z8XA 1SE7A 1SHZC 5CGMA 4USRA 3NNEA 4K5SA 2K48A 4JN9A 1D1AA 4ZHQE 1COYA 2CULA 2XAHB 5KRQA 1DOCA 3UU5A 1B4VA 1NEKA 4LMLA 3NRNA 2SPCA 4DV5T 4H4ZA 1B37A 5ABHA 2GR0A 3GMCA 5L4HA 2ACXA 5EK2A 3CNSA 2LKHA 3EDVA 2KLQA 1GRAA 4YLHA 2WDQA 2A89A 5HXCA 3P4PA 5JDHA 3BI2A 5L4EA 2JRKA 2J1DG 3ESLA 2KSRA 2X66A 2PHHA 1X9BA 4II2A 4U8MA 2B9WA 2XAJB 1FEWA 3N9NA 2V6YB 2P9BA 3TKLB 4DNAA 4EM3A 3S5WA 2YDRA 5JCIA 3KV6A 2A3DA 1OJAA 1D7LA 4X66T 4AT2A 1R8IA 4DR1T 3BNUA 5JR9B 2ZZCA 3UKAA 4WZXA 1IUSA 1VRQB 2VRMA 5JDLA 2ZLYA 2DLRA 3AD8B 2J47A 4U8PA 2ES0A 3UOYA 1OJTA 5FP3A 5JR9A 1GERA 3C4NA 4I4TE 4X1IE 3NTAA 2R0CA 3EUHA 1ELIA 4B66A 4A5XA 1VDCA 3X1DA 1W0BA 5CKUA 3PO7A 4GK5E 2D5UA 4N78D 2V1DB 1GRGA 3FG2P 2BCGG 4NTDA 3I0QA 3NK0X 4K7ZA 2XQ3A 1S3EA 2LRKA 3HKCE 2CHNA 2XLUA 2XASB 1MNEA 3ATRA 3QFBA 3D1CA 4PNIA 2E5VA 1E1MA 4K22A 3L8KA 4CXWA 4OYJA 1VG9A 4H4PA 4LU6A 2H89A 1XDPA 2WP5A 2IDOB 5HXRA 1BR1A 2XSBA 3L09A 3HI2A 2UUCT 5FXXA 4B3MT 5FMNA 3LADA 4PAGA 1E1LA 3F8DA 1YQZA 4JYAT 4Z24A 3LXDA 5AQJB 2Y8DA 4Z44A 5C3JA 3AE3A 2B7SA 4QX7B 1ZMDA 3UU3A 4A9WA 1E7PA 2R0GA 4EM4A 1H84A 1LV0A 2CBJA 3ITJA 2NOXA 5AQSB 1N36T 5L47A 3PJAJ 4YSYA 1GSNA 2ZMAA 1FOHA 2R0PA 2UXCT 5C8YE 5BMVE 3VKHA 4H63V 3VR8A 2WOIA 2BABA 1OJ9A 2IW5B 2VURA 3NWIA 2GR2A 3TLUA 2X0HA 2FJEA 2IVDA 4Z26A 4CQIA 4PK5A 3K30A 4YTPA 2XPKA 1IUVA 4X62T 4Q25A 3ZLIA 2ZBWA 2JIWA 1S3BA 3ZC1A 4CXYA 2BCPA 1T8BA 2WP6A 3SZWA 3H3MA 5HXSA 3UUNA 1CC4A 4GYSA 1D4DA 3SXIA 2HQMA 4H4YA 2WBLA 2WPFA 1H86A 5ADXL 3PUYF 1MMGA 3SFDA 3VRAA 1BKWA 2DKIA 3CPZA 1FCDA 4EQWA 5LBMA 2WB5A 4XAXB 3GN5B 4QH4A 1IAPA 2IAKA 2XQ6A 2ZZ0A 1IUWA 2XVEA 4PABA 3S61A 4LFAT 4JI3T 2QVAA 2WOVA 3O0HA 3NH3X 4ERRA 4H4RA 2NW7A 4COFA 2XHEB 1N4UA 3ZPOA 2O9ZA 1Z0PA 3RKGA 3O1HA 5CQFA 2VVSA 3UULA 1HX1B 2VL8A 3JAFA 3PUWF 4OVIA 2EHOC 4DBQA 1BGJA 4P09A 4BJNA 1UK5A 1VCSA 5FXWA 2BBJA 3UQ7A 4XBFB 2QAEA 2WQYA 2XLRA 2Y6XA 4OYKA 5U63A 2CCQA 4NUVA 2KINB 2XFUA 2DWKA 2YDQA 3AEBA 1DNCA 5LHHB 5FKYA 1E6EA 2XYOA 5C2TA 2WCAA 5J1GA 3GWDA 4QX8B 5J7XA 2V7IA 3Q5DA 3ICRA 1JU2A 2W67A 1LQTA 3ANWA 3IHMA 3FXDB 4YJ2E 3F57A 4YTMA 2OLNA 4NEVA 4RG4A 3BQLA 1FL2A 4HFVA 3GMIA 1NG4A 4C3XA 4DGKA 2QRXA 1MIYA 2UXXB 3L39A 3PURA 1D0ZA 5ABEA 4A7AA 3PUQA 2VL0A 3ONJA 2BG9A 5J2UE 2CWYA 1M64A 2CA5A 2GMHA 3ZJ1A 3C4ZA 1GESA 1JNRA 3F2EA 3P50A 3ANWB 3I6DA 4QH1A 2CLYB 4U8JA 3QSMA 2A87A 4HWHA 1VRBA 4QWNB 3H8LA 3K7MX 4H9NC 1J5WA 4TN7B 3ONXA 2K3WA 3Q5EA 2DCFA 3LJPA 1PN0A 2Q9QA 2NW9A 1N33T 1E1HB 3UKFA 4LF6T 1DU2A 2A72A 4EIWA 3NYCA 1OEDB 2V7KA 5AQOB 4K0KT 3MKDA 3DH9A 4YKGA 2YEVC 3ZT7A 1BGNA 1TYPA 4I58A 2RGOA 2OV9A 2QA2A 1J5ET 3T31A 4C77A 4Z2TA 4U2LA 2VZ2A 4WBOA 5LJMA 3QB5K 4AQGA 1PJ7A 1YKJA 4A56A 4H7UA 2WHDA 5HXIA 4JY2A 4MALA 3NGCX 2WPEA 3T1YT 2WEUA 5FXVA 2J4GA 4Z2RA 4GKKT 2CXDA 3CPIG 2IVEA 4MJWA 3AXJB 2BK4A 3AA1B 1HNWT 4TLXA 1REOA 3AE5A 4P9SA 2YLZA 4IE7A 2PYXA 3KVEA 1YKEB 4TX5A 2YM2A 2W66A 4NXMT 1N4VA 2HPLA 3RHWA 2C76A 1CUNA 1OEDE 1D7YA 2ZM2A 4CCRA 1GPEA 4DV4T 4BA9A 2CXFA 2BG9E 3P1WA 4TWFA 3SY4A 1AOGA 3MJXA 2YG6A 5FVKA 4C3YA 5KOWA 3CIRA 2W0GA 3N9MA 1H82A 4IL9A 1JRYA 4GYRA 2UXDT 2BXRA 3CNPA 3PS9A 4PFPA 2V7MA 1IJ6A 3UT5E 3G5RA 4JI7T 4IA5A 2BKNA 3AB3B 4AKIA 4IVMB 4PW8A 3CMMA 5IQ1A 1FMVA 3UFEA 1OJDA 3EI0A 3R84B 3M0OA 4IE5A 4U2ZA 3PVCA 3E08A 3EAOA 3DGZA 4UP3A 4U8LA 3F31A 5GRTA 4BK3A 4DV1T 4IDPA 3C50A 2CBIA 3O4XE 2KT9A 3RC3A 4HFIA 2RP4A 1DOBA 3AVSA 3O1JA 4HEAA 2XCGA 2W2UA 2QGSA 3FBZA 1XMQT 2X0LB 1PJ6A 3ZMTB 3ZSSA 3FZKB 3KFWX 2C3CA 3CQXC 4O4LE 2FBWA 2Y6QA 2BBHA 3PUXF 5ABFA 3UKPA 1NPXA 5CB4E 5LP6E 3C4AA 5KVIA 4ILAA 4JI1T 2NP9A 3AAEB 3CQGB 5EK3A 3ZC0A 3SZFA 1XANA 5LCYA 1U5PA 1P2EA 2GR3A 5JDQA 5AQNB 4ZS2A 1EZ3A 3SZ0A 2WPCA 4DUYT 4DV6T 4UELA 3NYFA 3FZLB 3MXZA 3FHNA 4IT4A 2LHRA 1PBBA 3C4WA 3WE0A 5J2TE 3C4XA 3UU4A 2X51A 1CF3A 3DJEA 2V7JA 2XDOA 1FEAA 1H81A 2X9XA 2K5BB 4NZHA 4YHHT 2RPAA 2Y6RA 1D5TA 2NPXA 4B68A 3Q9DA 1IBLT 3LZWA 4Y4NA 3RP8A 4IREA 4PAAA 3QVPA 2VB6A 2CVJA 2LKGA 4RSLA 3UKHA 5FL0A 1YW0A 4EXTA 2XY8B 5LHIB 2BC0A 2EHOD 4AQYT 1RSGA 2YR4A 3GWFA 2B7RA 3G5QA 2JQ9A 3NKSA 4A6NB 3G06A 5L3GB 3LK42 1BR0A 4OPTA 4YSXA 4HFEA 5L2LA 4NPPA 4P1NA 4HFCA 4GAPA 3VU7H 2FUPA 1ZOVA 2E5LT 3C96A 3L1RA 2XM2A 2JKCA 4X20E 3RQWA 3NVOA 5BUKA 3NN6X 2MYSA 5EK4A 4H9RC 3E22E 3VR9A 3OYZA 3UUMA 3P7IA 2K24A 1Q1RA 4AXPA 5AQVB 3HKDE 4DO0A 4OPGA 2AAQA 4GRTA 3CNJA 2CMRA 4L9IA 4DV3T 1Y56B 4I59A 1ZHCA 3N9LA 4UF0A 4LIIA 2GEWA 2CLYC 4WCTA 1GV4A 4ZZCA 2JB2A 3ALMA 3PU8A 2V5CA 3JSKA 4U72A 5ABGA 4BURA 4TM0A 2E1MA 4ZCCA 4Z2UA 5JDGA 4H4XA 4Z90A 4GF7A 3LK3B 5LMNT 1IUUA 1LVLA 3NK1X 4YKFA 1OEDC 4F6RC 1IBKT 4U8IA 1WCRA 1CC6A 3LDQB 1NHRA 1LKXA 1E1KA 4OPUA 1SEZA 2ZM0A 3EHZA 5KVHA 2XFNA 1ZK7A 3EANA 2R9ZA 3AXBA 1D4EA 4ICYA 4UVCB 3JC6C 3SS1A 1ONFA 2X50A 4TZ4C 4HN9A 1MIWA 1QJDA 1XZYA 3AE6A 1ZKQA 3T14A 2E8IA 2WDRA 3FBLA 4QXHB 2OALA 5AQIB 2WESA 4BK2A 5H6QB 1XNRT 3NRXA 4G6GA 1F6MA 5ER0A 2VKOA 3SWHA 4CN6A 1LJ1A 1O94A 4U2YA 2R45A 3UKLA 3UOZA 1B7TA 3K7QX 2R4JA 2XAGB 4Z25A 4GUVA 4C74A 2LSJA 2E2AA 2WM9A 1OJCA 5LXTE 1KSSA 3M65A 1JRXA 4H4SA 1XDOA 4PFOA 4L5GA 3SX6A 3BQIA 2H7OA 3ZYLA 3K7TA 4UF0B 3WAKA 4C90A 2JMHA 3UU8A 5FNVE 2F4VT 2WZHA 1MO9A 2QA7A 1IUXA 3DK9A 3RP7A 3NBXX 3GYXA 5F5WA 4CNJA 4GR1A 1L9EA 5JR9C 1Y01A 4JQ9A 4IV9A 3VHLA 3NZQA 2BK5A 3H37A 2MAWA 1W09A 4HWCA 2WZIA 2D9DA 4JNAA 5KWFA 4A98A 4IL4A 3N9OA 5JCNA 1GNDA 3KKJA 3FZMB 5KMQA 1BR2A 1JRZA 4AQFC 4O5UA 3JADA 2CM0A 1I94T 4JBWF 5FVLA 2OA1A 4HA6A 4REKA 4TNVA 1UURA 5CA0E 4BV6A 1Y0PA 2X3NA 3NK2X 4U8NA 3ADAB 3BK9A 4Z43A 5AQRB 4BJYA 5IQ4A 1IZNB 1WYCA 2VKHA 2UZZA 1Q9IA 3EABA 1UCUA 2F5ZA 5HEUA 1NHPA 2W63A 4H4WA 2PFVA 2YVJA 5DQWA 2Q7VA 4U31A 5KMSA 1VG0A 5L3FB 3UU6A 2V5DA 5LYJE 4DR7T 1KDGA 4JI5T 2X99A 3ZMVB 4CI3B 1YD8G 1GREA 3RKOA 2JJ9A 2NTYA 4WX1A 4KBMB 3KU9A 4U7YA 2WDVA 3EAMA 4UVAB 3HA4A 4A99A 4GAVA 2CWOA 1GRTA 3AAIA 3CPHG 1XPQA 4WNKA 5DJQC 4DR4T 2BZBA 3D0TA 2L9QA 1K0LA 1NHSA 4I50E 4JY3A 5HXEA 3SOLA 1TDKA 3MK7C 4H63H 4KP3C 4HGAA 4AI6A 3LG7A 2YLRA 3H8IA 4H4TA 3HKBE 1K0IA 3FXEB 5HEOA 3E0ZA 3LBXB 1CJ4A 4H9OC 5AQFB 5JCLA 4O4HE 4TWDA 1XWMA 5LA6E 3BQKA 2C4CA 4H2NA 2GAGB 2GV8A 2V26A 3KBUA 2VVLA 4YWOA 3SFEA 3PJAA 2BA9A 1H83A 2LSYA 3O9XA 2M67A 1DXLA 5LV9A 4AP3A 4DMVA 4GK0E 3AYIA 2C66A 4TWHA 2NR4A 2RABA 4NIQA 5TR3A 2W61A 1HG5A 2RGHA 2JQQA 3UCLA 2C64A 2W62A 3Q2MA 3GD4A 2N2NA 1G73A 4ISTA 2IUBA 2D0TA 3CN8A 3OZ2A 3FBSA 2BRYA 2KWIB 2Z6EA 2BDEA 2Q0KA 3RIUC 4EB6E 1AJ3A 4DMWA 4MHCA 1CJ2A 2RA1A 3PE0A 3GSIA 2LT3A 1EBDA 1SUMB 2XLTA 4P0AA 4HFHA 2XLSA 3VRBA 3RF1A 3MA9A 4HB9A 2C3DA 5LGTB 3AD9B 2B9XA 4LF9T 3GRSA 1I6ZA 2TPRA 3B5MA 1GRFA 1QO8A 1EL8A 5LHGB 1TYTA 3V5SA 4G74A 2CDUA 2YWLA 2VASA 4IE4A 3UUBA 4ZOLE 2XFQA 1IJHA 1E39A 2YG7A 4CZZB 2C72A 2YAUA 3LJCA 3PUZF 4DV0T 2VK9A 4EEDA 1SA0E 4UV9B 1D4CA 4FDCB 4G63A 2YLWA 2JPFA 3JC6D 4ANJA 4QH5A 2AXDS 4OX9T 4ILUA 3GYIA 2XJ7A 1KNPA 2WSSV 4EYYR 5FY1A 2GF3A 2HN1A 1EL5A 3DJGX 1K4QA 3IC9A 5FS9A 2XFPA 4TNWA 2WMNA 4O8SA 4Y4LA 4XXGA 5LB7B 5HHFA 1OEDA 2NWBA 4CXXA 3RX6A 1N4WA 3KPKA 1JEHA 3ZMUB 2JQKA 2Q9QB 4UIGA 3TLTA 4U8KA 4JNQA 3B13A 2WWUA 2BYBA 2JBVA 5LNKA 4HWFA 5M10A 3OPCA 3BNMA 2Q6UA 3A8YC 3RC8A 1NAFA 2QA1A 1QUUA 3RGLA 3PU3A 3C51A 3ETUA 3ZDNA 5BRTA 2I59A 4CY8A 3IHRA 2DHRA 3AYLA 4ZCDA 1FEBA 4A65A 3BHKA 2CRBA 4K8DA 4B69A 4IDQA 4U2TA 2B9YA 2C5KT 1UKVG 3I3LA 4WYVA 4LA1A 5EOWA 2R46A 3NRYA 4B3RT 4JUYA 2X9HA 1E2AA 5JRCA 1JOAA 3UTEA 2L3LA 2AE9A 5HXHA 2XQ5A 1TDEA 3GDNA 3QB5A 1NHQA 3RI5A 2LOSA 1HFAA 1LVKA 4LMKA 4YXDA 1HCIA 4HKAA 2C5JA 3KLJA 1O5WA 3GA8A 2IC9A 1RYIA 3FZFB 5AQLB 2FJDA 4O4IE 2X8GA 2I0ZA 2YN6A 3UP5A 2BG9C 4JI6T 1KK7A 1O3XA 2WU2A 1UUSA 4O5QA 1D0YA 2CXLA 3OBVE 4YY3T 4F8HA 2BC1A 2V6OA 4J57A 4BK1A 4PK6A 1L9DA 1HG2A 4OK0A 4Y4MA 4B6XA 3L8RA 1F8RA 4XWRA 5JCMA 1T98A 1L0VA 1YQ4A 1E1NA 4AOSA 4H9SE 4DR5T 2VQ7A 4J2CA 3V5UA 2YVGA 2VKJA 2AR8A 1BR4A 3LB8A 2N1GA 4XWZA 2ODVA 3P4QA 4CBQA 3GN5A 1S35A 1X31B 3AEFA 4H4QA 5BVAA 1CL0A 3H3AA 1PJ5A 3NHOX 4EQXA 1F8WA 5EZYE 2LJLA 1PHHA 3A5XA 3AEAA 4U2SA 4ADZA 4ILBA 2YDSA 2LSGA 1Z8UA 2JK6A 2XQYA 1N32T 1HF8A 1ZV4X 1B8SA 1MMDA 5LGNB 3R6NA 2VQET 1GTHA 1DJNA 2YR5A 4WBNE 3FB2A 3DJJA 3AE4A 3BHFA 2Z5YA 4H4VA 3AEDA 3PUVF 3IWAA 4ZS3A 2YLXA 1BF3A 4EYUA 2C65A 1MNDA 3I9YA 3NZPA 3KINB 3T2KA 4G2AA 4U7IA 3LK2B 1GOSA 3CK6A 5HEHA 4GCMA 2XQAA 2BS2A 1YKHB 5IUXA 2LFCA 1LVFA 2B76A 3H4KA 3D8XA 4E0VA 5JDMA 3DMEA 4FX9A 4CN4A 4LF7T 1EL7A 4DIDB 2R6GF 3I9WA 5GSNA 3ZMZB 4EQRA 2D2SA 3RH3A 2YOEA 3FPZA 1PBDA 4B67A 2XQ8A 2C67A 1WRDA 2W0HA 3DJBA 4J34A 5L3BB 1FJGT 5LG3A 3AE2A 3P9UA 3IHGA 3L3PA 3ABVA 1UX4A 3AA0B 4IE6A 5AQPB 2V6XA 3KV9A 2ZM6T 4LMJA 4B1BA 4DBRA 4CI1B 3F8RA 3CX8B 5HY5A 3G5SA 1CBOA 5HEGA 1YXRA 5J0ZA 1MMAA 4NXNT 1IJ5A 4HTEA 3RHAA 1H7XA 3ZYXA 1TDOA 2C70A 3LBXA 4LF5T 3I0OA 4YSZA 3PUSA 3QC9A 4EEBA 2APGA 3B3RA 3LOVA 2C0SA 3P4SA 2X8HA 4DSGA 5FMHA 3HL6A 2UXNB 4DR6T 3V3NA 4LFBT 3WAJA 3NT6A 4PJLA 4B65A 1VOMA 3II4A 4A6NA 1WLXA 1QLBA 5M4YA 2GRTA 4CRTA 3UOXA 4X5TA 1XHCA 2C5IT 2X67A 4M1PA 1H7WA 4H2RA 4ZI2C 2BACA 2WWVA 3RYCE 4JDRA 3I1AA 3PUGA 2I0MA 5HWXA 4H2PA 5LOVE 1LQUA 4BJZA 1F8SA 1B5QA 3CPJG 2NW8A 3KD9A 3ETVA 3U3IA 5LMUT 1NDAA 1ZDLA 4E7SA 2DWGA 5H6RB 5IHYA 4GIWA 2KXPB 3T1HT 4IIJE 2C7GA 3T8OA 3CNTA 2X9WA 2EQ7A 5LG4A 1LTXR 3AECA 2YU2A 2ARDA 1UX5A 2L8KA 3EVYA 5IPYA 2C73A 2X68A 1CJCA 3UTHA 4E7ZA 2BS3A 3SM8A 5AQTB 3TLVA 4TM4A 5HCJA 4DSHA 2ZM8A 3HR0A 4GOUA 3C64A 4U3CA 2BVLA 3V76A 3ZMSB 2JAEA 4ILCA 4EOZB 3KV4A 3GD3A 2Y48B 4KUMB 1IBMT 3COXA 3AAAB 5BR8T 3CKDA 1FIOA 1MXTA 4TLZA 2ODUA 3PDYA 3RP6A 5JREA 4G9KA 3UKKA 2BKOA 5ABFB 1PBCA 2UXBT 1GRBA 3AE8A 2GH5A 5LGUB 1M6IA 5E0OA 1TRBA 3B57A 3IF9A 4UXNB 4KHPT 4P0BA 2IMLA 4QXCB 5LJNA 1V59A 2IIUA 4OPCA 3T2ZA 5HYMA 3J7Yq 3K3QC 3CGCA 3K8PC 4PJJA 4YTNA 4C91A 3GDPA 2K9AA 4B64A 3SZCA 5DQVA 4B3TT 3F8PA 5DBJA 3GMBA 1HR0T 4CY6A 1NWMX 3CX6B 2YVFA 3IBPA 4X1YE 4YSHA 2UUAT 5F8PA 3KDSE 1GXFA 2LSKA 5JH7E 5TAOA 4C5OA 3KV5A 4ISSA 2EQ9A 3AWIA 2QCUA 5KMRA 3LFMA 2YG3A 1ZP0A 4U33A 3GWHA 2GK9A 3CVRA 5AQUB 3ZYKA 4H9QC 3BI4A 3CMLA 5F3JA 3O1IA 2VWAA 2X8CA 3SYIA 1VQWA 2E9XB 3AE7A 3RYHE 4A79A 5IWAT 2YR6A 2PBIA 2CHOA 4NWZA 3UTFA 2XUEA 1KEYA 4NEWA 2XQ9A 4K0UA 3AYJA 4OCGA 1GQEA 4AT0A 4YHJA 3ICTA 4EMJA 3CGDA 3JAEA 2X0YA 1S2YA 3HZLA 5U1OA 4KX6A 4ZI3D 3E1TA 5HEJA 4UEMA 2EQ8A 4KMCA 4QHOA 1RP0A 2GMJA 3QVRA 3AXJA 5AQQB 2PG8A 3AD7B 1NG3A 3HYWA 5JDFA 1GEUA 2B1EA 1BWCA 3KVAA 5L3CB 1TDNA 2Q9QC 4ADWA 4B63A 3UQ4A 5FYMA 3VKGA 3UOVA 4JEUB 3B6DA 3PUAA 2GVCA 4USQA 4U8OA 2XLPA 1VCTA 1H7CA 3AA6B 4UDPA 2XQ7A 1KNRA 1YQ3A 2V3AA 4J56A 4J31A 1MOKA 4I55E 3QNUA 4TUYE 4O2BE 4TM1A 2X9YA 4X4JA 2FJBA 3MZKB 4G73A 1TDFA 1M62A 4EV6A 4H9PC 1ZX9A 2PTFA 2N9DA 3TLWA 2A8XA 3AEGA 3TLSA 3ZN1B 1V9DA 5A1LA 1MMNA 5M0ZA 4IE0A 1Y56A 2R4EA 3T2YA 2KZ7B 3ZT6A 3DK8A 3ZJ2A 4GKJT 4AKGA 1WR0A 4DR3T 1BZLA 4KPRA 4M52A 4UV8B 4AIUA 1GETA 5LBQB 3N2KE 3N9QA 1DODA 2LEHA 4H2QA 3CWZB 4UDQA 3BI5A 4JI0T 3FMWA 4EAHA 2UU9T 2H88A 1GTEA 1MIVA 5AFUL 2NTXA 2BG9B 4AQFA 4EZ4A 2XVJA 2WS3A 2XQ4A 1Z6LA 3ZKRA 4K5RA 4JEHB 3GRTA 3N2GE 2PJQA 2EHOA 5AQMB 4D04A 2UUBT 3DTOA 3ZT5A 2DL1A 1W4XA 3RRCA 5JQGE 4HFDA 4EGWA 2BVMA 2JQHA 3W15B 2KNDA 1H6VA 1LPFA 3QK6A 1US7B 3P4WA 5L3EB 4LF4T 2RGJA 2YINA 1CJ3A 4I43B 3PTRB 5JRCB 1N1PA 4U74A 3AB1A 3QJ4A 4JV5T 3FZHB 3CX7B 4DNDA 5CFBA 4II3A 5HAXA 1L9CA 4A97A 2EQ6A 2HH7A 3ZCIA 5FY0A 3QUJA 1NENA 3DA1A 4UDRA 2WETA 3CGBA 3HYXA 4EIQA 3J9X1 4ZI2D 2YM1A 5FS6A 4WW0A 3RYIE 3UKQA 4XZCA 5KNLA 5FXZA 4J36A 3DK4A 4QKNA 3ICSA 2XAFB 3V3OA 4APNA 5KMPA 2MOZA 2BK3A 3SGLA 4NTCA 5FS7A 2OLTA 1GRHA 4N9XA 2YQUA 4IA6A 5FY7A 4X9MA 3LSVA 1ZY8A 2OA5A 3ZN0B 1PXBA 4CNKA 2WMOA 3VRDB 3REDA 1D1CA 4NNJA 4HWDA 2BXSA 4AOXA 2YLTA 1NAAA 4ZI7E 3KVBA 2AQJA 4YFSA 3QSSA 3K3OA 3KBTA 4H50A 3RQUA 2WOWA 4HFBA 2VKDA 2J3NA 2YLSA 2YG4A 4O2AE 4OHFA 3ZYMA 1KSUA 4J33A 2XSAA 4GDPA 4AP1A 3NN0X 2VRLA 5L46A 3P8CD 4TM3A 3RNMA 4EMWA 4IHJE 4CI2B 4L0RA 4CCQA 1X79A 4JI4T 4ZN0A 4YJ3E 4K2XA 2VQBA 4BJMA 4X64T 2E9XD 1PXCA 4AKRB 4LF8T 4OFZA 4IDNA 4PJNA 2XVHA 5ETWA 3CGEA 2A9UA 2W00A 2WP9A 3NKZA 1J1JA 5AQHB 1WR6A 1FECA 1XDIA 3UTGA 2Z5XA 2MPKA 1D0XA 5EB5A 2QYWA 2TMDA 3EF6A 2HPJA 3KA7A 4GDEA 3RPUA 1KFYA 2XAQB 5U25A 2CFYA 4YT0A 3RLFF 1ZMCA 3KPFA 3WI3A 3HYVA 2ZZBA 2DI4A 2YU1A 4RG3A 1HYUA 4A5LA 1M7KA 4LFCT 2V7LA 2LOPA 3DGHA 3IEEA 4AKLA 1N34T 3N2OA 1KNZA 2LRLA 1FMWA 5KXJA 4MFRA 2IIDA 3CNDA 2LLYA 2A2FX 3UTKA 1OXZA 1HNXT 1HNZT 1ZEEA 4EIPA 1OWAA 3OTOT 1DOEA 3M12A 1P2HA 3M13A 5HWYA 5KMGP 2LHNA 3RRWA 2JMKA 2HHHT 2VVMA 3MACA 2V8SV 1QSDA 3UUXB 3GYJA 1YY5A 4H4UA 1EL9A 4HWIB 4X1KE 5JVDE 4B3ST 2WY2A 3QFAA 4PJMA 3P4RA 4O4JE 4AISA 2LM9A 2V3BA 4ZI3C 3K3NA 2H3RA 1PXAA 3N5LA 2M6IA 2ACZA 5HYAA 2VVNA 4KI0F 4ZZBA 1S94A 1LRZA 1ZKEA 4HE8A 3NG7X 3NYEA 2DNXA 3OYXA 5BULA 2Q9QD 3A7MA 3IA3A 4ASKA 3UP4A 1HS7A 1PBEA 2GB0A 2YG5A 2IC6A 3AE9A 3RIFA 2V60A 1U4QA 1PDHA 4QXBB 4MLKA 4IGUA 3EPTA 3NIXA 4EQSA 4CN1A 4EMIA 1XMOT 4BAYB 4X65T 5FL1A 5J60A 1Q1WA 1W9RA 1HTJF 3OC4A 2LSIA 4MBQA 2H7VC 1IUTA 3IF8B 3OKQA 2WBAA 3N9PA 4FJOA 1PS9A 2XZEA 3VQRA 3JCFA 1D1BA 3CTYA 2V6YA 2EHOB 2KWHA 4G6HA 3T37A 3FIMB 2WU5A 3ALLA 2G0UA 4DUZT 3C98B 2MTQA 4DR2T 3DJDA 2HN2A 4PK4A 5GONE 2XFOA 2DKHA
chains in the Genus database with same CATH topology
2BS3A 3SM8A 3T0KA 4TM4A 4DSHA 3I6DA 3URHA 4U8JA 4A99A 3QSMA 2A87A 3AE1A 3H8LA 3V76A 4GAVA 3K7MX 2JAEA 1GRTA 3CPHG 1XPQA 1ZOYA 3LJPA 3GD3A 1PN0A 4D03A 1K0LA 1NHSA 3UKFA 3Q6JA 2XVIA 3COXA 4JY3A 3NYCA 3ALJA 1TDKA 3DH9A 3RP6A 1MXTA 4OPDA 4TLZA 3UKKA 4YKGA 4G9KA 1BGNA 1TYPA 4I58A 1PBCA 2GAHB 2RGOA 1GRBA 3AE8A 2OLOA 2GH5A 2QA2A 2YLRA 1M6IA 2XVFA 3H8IA 4H4TA 1TRBA 4OPLA 3IF9A 1K0IA 3T31A 4C77A 4Z2TA 4U2LA 2VZ2A 1GT8A 2FJAA 5KOXA 1CJ4A 5JCKA 1V59A 4OPCA 3T2ZA 3QSEA 5HYMA 1PJ7A 5JCLA 1YKJA 3CGCA 4H7UA 2WHDA 2C4CA 4H2NA 2GAGB 4YTNA 2V5ZA 5HXIA 4JY2A 3GDPA 2GV8A 3ISHA 2VVLA 3NGCX 3SZCA 4YWOA 3SFEA 2WPEA 4B64A 2WEUA 2BA9A 3F8PA 5DBJA 3GMBA 4Z2RA 1H83A 4CY6A 3AEEA 2YVFA 4IVOB 3CPIG 4YSHA 1DXLA 2IVEA 5LV9A 4AP3A 5EBKA 4MJWA 3AYIA 2C66A 2C75A 2RABA 1GXFA 2BK4A 5TR3A 4TLXA 1REOA 4C5OA 2RGHA 1F3PA 3AE5A 3LZXA 2EQ9A 2C64A 1PBFA 4P9SA 3GD4A 2YLZA 2QCUA 3AWIA 5KMRA 2YG3A 2PYXA 3KVEA 2YM2A 1ZP0A 1O95A 1N4VA 2V61A 2C76A 3R9UA 2GQFA 2VOUA 3CN8A 3OZ2A 3BI4A 1D7YA 4X9NA 3FBSA 2JB3A 2BRYA 4CCRA 1CHUA 1GPEA 3SYIA 2X8CA 4OPIA 1VQWA 3AE7A 4J2WA 4A79A 2YR6A 2Q0KA 3P1WA 3SY4A 1AOGA 2GR1A 4NWZA 1CJ2A 3UTFA 3GSIA 2YG6A 4NEWA 1EBDA 3AYJA 4OCGA 4C3YA 3ATQA 5KOWA 3CIRA 1H82A 2BXRA 1JRYA 3DK8A 3ICTA 3PS9A 2XLTA 3CNPA 3Q9TA 4AT0A 4EMJA 2XLSA 3CGDA 2GQWA 3G5RA 1S2YA 4IA5A 3HZLA 3VRBA 5U1OA 2BS4A 4KX6A 1KF6A 2VVLG 5FS8A 1S2QA 2Q0LA 1DJQA 4NTEA 2BRAA 4IVMB 3CMMA 3E1TA 4HB9A 5IQ1A 3SQPA 2C3DA 1OJDA 2EQ8A 3AD9B 2B9XA 3M0OA 1RP0A 2GMJA 2TPRA 3GRSA 3QVRA 1JNZA 1GRFA 1QO8A 3EAOA 1EL8A 3DGZA 3PVCA 2NVKX 3AD7B 1NG3A 1GALA 3HYWA 1TYTA 4U8LA 4UP3A 4G74A 2CDUA 1GEUA 5GRTA 2YWLA 4BK3A 1BWCA 1TDNA 4FK1A 4ADWA 4B63A 4FK1C 2OAMA 1IJHA 1E39A 2XFQA 1CC2A 2E4GA 5EB4A 2YG7A 1DOBA 2C72A 2JB1A 3NTDA 2YAUA 3B6DA 3UOVA 4ECHA 2GVCA 2XCGA 4USQA 4U8OA 2XLPA 1K0JA 3NLCA 1D4CA 4UDPA 4FDCB 1KNRA 1YQ3A 2V3AA 4USRA 1PJ6A 2YLWA 4J56A 4J31A 1MOKA 2C3CA 3NNEA 2FBWA 4K5SA 4TM1A 4X4JA 2FJBA 4JN9A 4G73A 3GYIA 1TDFA 2Y6QA 1KNPA 1ZX9A 2GF3A 3UKPA 1NPXA 2A8XA 1EL5A 3AEGA 1K4QA 3DJGX 3IC9A 5FS9A 2XFPA 1COYA 4Y4LA 2CULA 4XXGA 5HHFA 3C4AA 5KVIA 5KRQA 1DOCA 5M0ZA 1B4VA 1NEKA 1Y56A 2R4EA 3NRNA 1N4WA 4H4ZA 3T2YA 1B37A 1JEHA 3KPKA 3SZFA 1XANA 2GR0A 1P2EA 3GMCA 2GR3A 4KPRA 1BZLA 4U8KA 4M52A 3CNSA 3SZ0A 2WPCA 1GETA 4JNQA 2BYBA 1GRAA 2JBVA 3NYFA 5M10A 2WDQA 2A89A 1DODA 3P4PA 2Q6UA 3BNMA 3BI2A 2QA1A 4H2QA 4UDQA 3BI5A 1PBBA 3WE0A 3FMWA 3ZDNA 5BRTA 2H88A 1CF3A 1GTEA 4CY8A 3DJEA 2XVJA 2XDOA 1FEAA 2WS3A 1H81A 2PHHA 3AYLA 1FEBA 1Z6LA 4ZCDA 4A65A 3BHKA 4K8DA 4B69A 4II2A 4U8MA 4K5RA 2B9WA 3GRTA 4NZHA 2B9YA 1UKVG 3I3LA 4LA1A 4U2TA 5EOWA 4D04A 2R46A 4DNAA 2Y6RA 4EM3A 3S5WA 1D5TA 5JCIA 1OJAA 1D7LA 1W4XA 2NPXA 4AT2A 3BNUA 1JOAA 3UTEA 4B68A 3LZWA 4Y4NA 3RP8A 3UCLA 2ZZCA 1TDEA 3GDNA 1NHQA 3QVPA 4PAAA 3UKAA 2CVJA 1H6VA 1IUSA 4RSLA 3UKHA 1VRQB 2VRMA 4YXDA 1LPFA 3AD8B 2BC0A 4U8PA 3KLJA 3UOYA 1O5WA 1OJTA 1RSGA 2RGJA 1RYIA 2YR4A 3GWFA 1CJ3A 2B7RA 3G5QA 1GERA 1N1PA 3AB1A 3C4NA 3NKSA 3QJ4A 2FJDA 4A6NB 3NTAA 2X8GA 2R0CA 2I0ZA 4II3A 3UP5A 1ELIA 4OPTA 1L9CA 4B66A 4YSXA 2EQ6A 1VDCA 5CKUA 3PO7A 1NENA 3DA1A 2WU2A 4GAPA 4UDRA 4O5QA 2WETA 3CGBA 3HYXA 4EIQA 1ZOVA 2YM1A 1GRGA 3C96A 3L1RA 3FG2P 5FS6A 2BCGG 2JKCA 4NTDA 2BC1A 2V6OA 4J57A 3UKQA 4BK1A 5KNLA 1L9DA 3NK0X 4J36A 5BUKA 4Y4MA 3DK4A 4K7ZA 3NN6X 1S3EA 3ICSA 2XLUA 4XWRA 1F8RA 3ATRA 3QFBA 3D1CA 5JCMA 3VR9A 3V3OA 4APNA 5KMPA 2E5VA 1E1MA 2BK3A 1L0VA 3SGLA 1YQ4A 1E1NA 1Q1RA 4K22A 4AOSA 3L8KA 4NTCA 5FS7A 1GRHA 2VQ7A 4N9XA 2YQUA 1VG9A 4H4PA 2YVGA 4IA6A 2AR8A 4OPGA 4X9MA 1ZY8A 2H89A 4LU6A 2AAQA 4GRTA 1PXBA 3CNJA 4CNKA 2WP5A 3VRDB 3LB8A 1Y56B 4I59A 4XWZA 3P4QA 3REDA 4NNJA 4LIIA 4CBQA 2GEWA 1X31B 3LADA 1E1LA 3F8DA 1YQZA 2BXSA 4AOXA 3AEFA 2YLTA 4WCTA 1GV4A 2JB2A 4H4QA 1NAAA 3ALMA 5BVAA 1CL0A 3JSKA 1PJ5A 3NHOX 4Z24A 2AQJA 3QSSA 4EQXA 3LXDA 4H50A 1F8WA 4BURA 4TM0A 2E1MA 4ZCCA 4Z2UA 2WOWA 2J3NA 2YLSA 2YG4A 4H4XA 4GF7A 1KSUA 1PHHA 4J33A 3AEAA 5C3JA 1IUUA 4U2SA 3AE3A 2B7SA 1LVLA 4GDPA 3NK1X 4YKFA 4AP1A 3NN0X 1ZMDA 2VRLA 5L46A 4U8IA 2JK6A 4TM3A 4A9WA 3RNMA 1E7PA 1B8SA 2R0GA 4EM4A 1H84A 1LV0A 1CC6A 3ITJA 4EMWA 4CCQA 1NHRA 1GTHA 4ZN0A 1E1KA 1DJNA 2YR5A 4K2XA 1SEZA 4OPUA 3DJJA 3AE4A 2VQBA 3BHFA 5KVHA 2Z5YA 4H4VA 4YSYA 1PXCA 3AEDA 1GSNA 1ZK7A 2XFNA 3IWAA 3EANA 1FOHA 2YLXA 1BF3A 2C65A 2R0PA 2R9ZA 2XVHA 3AXBA 3CGEA 2WP9A 1D4EA 4ICYA 1XDIA 1FECA 3VR8A 2WOIA 2BABA 1OJ9A 3UTGA 2Z5XA 5EB5A 1ONFA 2X50A 3T2KA 2TMDA 3EF6A 1GOSA 2GR2A 3KA7A 4Z44A 2FJEA 4GCMA 2IVDA 1QJDA 2BS2A 4Z26A 3AE6A 1ZKQA 4GDEA 3T14A 3K30A 4YTPA 2LFCA 2WDRA 2B76A 1IUVA 2OALA 3H4KA 3D8XA 1KFYA 2WESA 4BK2A 4E0VA 2ZBWA 5U25A 2CFYA 4YT0A 3DMEA 1ZMCA 1F6MA 3KPFA 4G6GA 5ER0A 4FX9A 1EL7A 1S3BA 2ZZBA 3HYVA 1LJ1A 1O94A 2BCPA 5GSNA 2R45A 2WP6A 3UKLA 3SZWA 4RG3A 3UOZA 3K7QX 1HYUA 4A5LA 4EQRA 1CC4A 2R4JA 3FPZA 1D4DA 3DGHA 3SXIA 4Z25A 2HQMA 4GUVA 4H4YA 2WPFA 1PBDA 4C74A 1H86A 4B67A 2C67A 3SFDA 3VRAA 2W0HA 5KXJA 4J34A 1OJCA 1BKWA 2IIDA 3CNDA 3AE2A 2DKIA 3IHGA 3P9UA 3ABVA 1KSSA 1FCDA 1JRXA 4H4SA 4EQWA 3SX6A 3K7TA 4B1BA 4EIPA 2ZZ0A 1DOEA 5HY5A 3F8RA 1IUWA 3M12A 2XVEA 1P2HA 3G5SA 3M13A 4PABA 1CBOA 3S61A 2VVMA 2WOVA 3O0HA 3NH3X 1MO9A 3GYJA 1YY5A 4H4RA 4H4UA 1EL9A 1IUXA 3DK9A 1N4UA 3QFAA 3RP7A 2O9ZA 3RHAA 3P4RA 1H7XA 3GYXA 3ZYXA 4CNJA 4GR1A 1TDOA 1L9EA 2C70A 2V3BA 5CQFA 4JQ9A 1PXAA 4IV9A 2ACZA 4YSZA 2APGA 2BK5A 3B3RA 3LOVA 3P4SA 2X8HA 4OVIA 4DSGA 5FMHA 4JNAA 5KWFA 1BGJA 5JCNA 3NG7X 3NYEA 5BULA 3V3NA 1GNDA 3NT6A 3KKJA 3UP4A 5KMQA 1JRZA 1PBEA 4B65A 2GB0A 2YG5A 4O5UA 3II4A 3AE9A 2V60A 4A6NA 1QLBA 2GRTA 2QAEA 1PDHA 2WQYA 3UOXA 2XLRA 2OA1A 4HA6A 1XHCA 4REKA 4CRTA 5U63A 3EPTA 3NIXA 4EQSA 2XFUA 1H7WA 4H2RA 4BV6A 1Y0PA 3AEBA 1DNCA 4EMIA 2X3NA 3NK2X 4U8NA 1E6EA 2BACA 2XYOA 3ADAB 5C2TA 4Z43A 4JDRA 5J60A 4BJYA 5IQ4A 1Q1WA 3GWDA 5J7XA 4H2PA 2UZZA 1Q9IA 3ICRA 1LQUA 1JU2A 3OC4A 2F5ZA 1LQTA 4BJZA 1F8SA 3IHMA 1NHPA 1B5QA 3CPJG 4YTMA 1IUTA 2OLNA 2WBAA 2YVJA 3KD9A 4H4WA 4NEVA 4RG4A 1FL2A 1NDAA 1NG4A 1ZDLA 1PS9A 2Q7VA 3VQRA 4C3XA 4DGKA 3CTYA 5KMSA 1VG0A 4G6HA 3T37A 2C7GA 3CNTA 2WU5A 3FIMB 3ALLA 2EQ7A 1LTXR 3AECA 1KDGA 2X99A 4A7AA 2ARDA 5IPYA 2C73A 3DJDA 1M64A 1CJCA 1GREA 2GMHA 3UTHA 2XFOA 4WX1A 2DKHA 1GESA 1JNRA 3KU9A 2WDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 A;  3SM8 A;  4TM4 A;  4DSH A;  3I6D A;  3URH A;  4U8J A;  4A99 A;  3QSM A;  2A87 A;  3AE1 A;  3H8L A;  3V76 A;  3K7M X;  2JAE A;  1GRT A;  3CPH G;  1XPQ A;  1ZOY A;  3LJP A;  3GD3 A;  1PN0 A;  4D03 A;  1K0L A;  1NHS A;  3UKF A;  3Q6J A;  2XVI A;  3COX A;  4JY3 A;  3NYC A;  3ALJ A;  1TDK A;  3DH9 A;  3RP6 A;  1MXT A;  4OPD A;  4TLZ A;  3UKK A;  4YKG A;  1BGN A;  1TYP A;  4I58 A;  1PBC A;  2GAH B;  2RGO A;  1GRB A;  3AE8 A;  2OLO A;  2GH5 A;  2QA2 A;  2YLR A;  1M6I A;  2XVF A;  3H8I A;  4H4T A;  1TRB A;  4OPL A;  3IF9 A;  1K0I A;  4Z2T A;  4C77 A;  4U2L A;  2VZ2 A;  1GT8 A;  2FJA A;  5KOX A;  1CJ4 A;  5JCK A;  1V59 A;  4OPC A;  5HYM A;  3QSE A;  5JCL A;  1PJ7 A;  1YKJ A;  3CGC A;  4H7U A;  2WHD A;  4H2N A;  2GAG B;  4YTN A;  2V5Z A;  5HXI A;  4JY2 A;  3GDP A;  2GV8 A;  3ISH A;  2VVL A;  3NGC X;  4B64 A;  4YWO A;  3SFE A;  2WPE A;  2WEU A;  2BA9 A;  3F8P A;  5DBJ A;  3GMB A;  4Z2R A;  1H83 A;  4CY6 A;  3AEE A;  2YVF A;  4IVO B;  3CPI G;  4YSH A;  1DXL A;  2IVE A;  5LV9 A;  4AP3 A;  5EBK A;  4MJW A;  3AYI A;  2C66 A;  2C75 A;  2RAB A;  1GXF A;  2BK4 A;  5TR3 A;  4TLX A;  1REO A;  4C5O A;  2RGH A;  1F3P A;  3AE5 A;  3LZX A;  2EQ9 A;  2C64 A;  1PBF A;  4P9S A;  3GD4 A;  2YLZ A;  2QCU A;  3AWI A;  2YG3 A;  2PYX A;  3KVE A;  2YM2 A;  1ZP0 A;  1O95 A;  1N4V A;  2V61 A;  2C76 A;  3R9U A;  2GQF A;  2VOU A;  3CN8 A;  3OZ2 A;  3BI4 A;  1D7Y A;  4X9N A;  3FBS A;  2JB3 A;  4CCR A;  1CHU A;  1GPE A;  2X8C A;  4OPI A;  1VQW A;  3AE7 A;  4J2W A;  4A79 A;  2YR6 A;  2Q0K A;  3P1W A;  1AOG A;  2GR1 A;  1CJ2 A;  3UTF A;  3GSI A;  2YG6 A;  4NEW A;  1EBD A;  3AYJ A;  4OCG A;  4C3Y A;  3ATQ A;  5KOW A;  3CIR A;  1H82 A;  2BXR A;  1JRY A;  3DK8 A;  3ICT A;  3PS9 A;  2XLT A;  3CNP A;  3Q9T A;  4AT0 A;  4EMJ A;  2XLS A;  3CGD A;  2GQW A;  3G5R A;  1S2Y A;  4IA5 A;  3HZL A;  3VRB A;  5U1O A;  2BS4 A;  4KX6 A;  1KF6 A;  2VVL G;  5FS8 A;  1S2Q A;  2Q0L A;  1DJQ A;  4NTE A;  4IVM B;  3E1T A;  4HB9 A;  5IQ1 A;  3SQP A;  2C3D A;  1OJD A;  2EQ8 A;  3AD9 B;  2B9X A;  3M0O A;  1RP0 A;  2GMJ A;  2TPR A;  3GRS A;  3QVR A;  1JNZ A;  1GRF A;  1QO8 A;  3EAO A;  1EL8 A;  3DGZ A;  3PVC A;  2NVK X;  3AD7 B;  1NG3 A;  1GAL A;  4U8L A;  1TYT A;  4UP3 A;  2CDU A;  1GEU A;  5GRT A;  2YWL A;  4BK3 A;  1BWC A;  1TDN A;  4FK1 A;  4ADW A;  4B63 A;  4FK1 C;  2OAM A;  1IJH A;  1E39 A;  2XFQ A;  1CC2 A;  2E4G A;  5EB4 A;  2YG7 A;  1DOB A;  2C72 A;  2JB1 A;  3NTD A;  2YAU A;  3B6D A;  3UOV A;  4ECH A;  2GVC A;  2XCG A;  4USQ A;  4U8O A;  2XLP A;  1K0J A;  3NLC A;  1D4C A;  4UDP A;  4FDC B;  1KNR A;  1YQ3 A;  2V3A A;  4USR A;  1PJ6 A;  2YLW A;  4J56 A;  4J31 A;  1MOK A;  2C3C A;  3NNE A;  2FBW A;  4K5S A;  4TM1 A;  4X4J A;  2FJB A;  4JN9 A;  3GYI A;  1TDF A;  2Y6Q A;  1KNP A;  1ZX9 A;  2GF3 A;  3UKP A;  1NPX A;  2A8X A;  1EL5 A;  3AEG A;  1K4Q A;  3DJG X;  3IC9 A;  5FS9 A;  2XFP A;  1COY A;  4Y4L A;  2CUL A;  4XXG A;  5HHF A;  3C4A A;  5KVI A;  5KRQ A;  1DOC A;  5M0Z A;  1B4V A;  1NEK A;  1Y56 A;  2R4E A;  3NRN A;  1N4W A;  4H4Z A;  1B37 A;  1JEH A;  1XAN A;  2GR0 A;  1P2E A;  3GMC A;  2GR3 A;  4KPR A;  1BZL A;  4U8K A;  4M52 A;  3CNS A;  2WPC A;  1GET A;  4JNQ A;  2BYB A;  1GRA A;  2JBV A;  3NYF A;  5M10 A;  2WDQ A;  2A89 A;  1DOD A;  3P4P A;  2Q6U A;  3BNM A;  3BI2 A;  2QA1 A;  4H2Q A;  4UDQ A;  3BI5 A;  1PBB A;  3WE0 A;  3FMW A;  3ZDN A;  5BRT A;  2H88 A;  1CF3 A;  1GTE A;  4CY8 A;  3DJE A;  2XVJ A;  2XDO A;  1FEA A;  2WS3 A;  1H81 A;  2PHH A;  3AYL A;  1FEB A;  1Z6L A;  4ZCD A;  4A65 A;  3BHK A;  4K8D A;  4B69 A;  4U8M A;  4K5R A;  2B9W A;  3GRT A;  4NZH A;  2B9Y A;  1UKV G;  3I3L A;  4LA1 A;  4U2T A;  5EOW A;  4D04 A;  2R46 A;  4DNA A;  2Y6R A;  4EM3 A;  3S5W A;  1D5T A;  5JCI A;  1OJA A;  1D7L A;  1W4X A;  2NPX A;  4AT2 A;  3BNU A;  1JOA A;  3UTE A;  4B68 A;  3LZW A;  4Y4N A;  3RP8 A;  3UCL A;  2ZZC A;  1TDE A;  3GDN A;  1NHQ A;  3QVP A;  4PAA A;  3UKA A;  2CVJ A;  1H6V A;  1IUS A;  4RSL A;  3UKH A;  1VRQ B;  2VRM A;  4YXD A;  1LPF A;  3AD8 B;  2BC0 A;  4U8P A;  3KLJ A;  3UOY A;  1O5W A;  1OJT A;  1RSG A;  2RGJ A;  1RYI A;  2YR4 A;  3GWF A;  1CJ3 A;  2B7R A;  3G5Q A;  1GER A;  1N1P A;  3AB1 A;  3C4N A;  3NKS A;  3QJ4 A;  2FJD A;  4A6N B;  3NTA A;  2X8G A;  2R0C A;  2I0Z A;  3UP5 A;  1ELI A;  4OPT A;  1L9C A;  4B66 A;  4YSX A;  2EQ6 A;  1VDC A;  5CKU A;  3PO7 A;  1NEN A;  3DA1 A;  2WU2 A;  4UDR A;  4O5Q A;  2WET A;  3CGB A;  4EIQ A;  1ZOV A;  2YM1 A;  1GRG A;  3C96 A;  3L1R A;  3FG2 P;  5FS6 A;  2BCG G;  2JKC A;  4NTD A;  2BC1 A;  2V6O A;  4J57 A;  3UKQ A;  4BK1 A;  1L9D A;  3NK0 X;  4J36 A;  5BUK A;  4Y4M A;  3DK4 A;  4K7Z A;  3NN6 X;  1S3E A;  3ICS A;  2XLU A;  4XWR A;  1F8R A;  3ATR A;  3QFB A;  3D1C A;  5JCM A;  3VR9 A;  3V3O A;  4APN A;  2E5V A;  1E1M A;  2BK3 A;  1L0V A;  3SGL A;  1YQ4 A;  1E1N A;  1Q1R A;  4K22 A;  4AOS A;  3L8K A;  4NTC A;  5FS7 A;  1GRH A;  2VQ7 A;  4N9X A;  2YQU A;  1VG9 A;  4H4P A;  2YVG A;  4IA6 A;  2AR8 A;  4OPG A;  4X9M A;  1ZY8 A;  2H89 A;  4LU6 A;  2AAQ A;  4GRT A;  1PXB A;  3CNJ A;  4CNK A;  2WP5 A;  3VRD B;  3LB8 A;  1Y56 B;  4I59 A;  4XWZ A;  3P4Q A;  3RED A;  4LII A;  4CBQ A;  2GEW A;  1X31 B;  3LAD A;  1E1L A;  3F8D A;  1YQZ A;  2BXS A;  4AOX A;  3AEF A;  2YLT A;  4WCT A;  1GV4 A;  2JB2 A;  4H4Q A;  1NAA A;  3ALM A;  5BVA A;  1CL0 A;  3JSK A;  1PJ5 A;  3NHO X;  4Z24 A;  2AQJ A;  3QSS A;  4EQX A;  3LXD A;  4H50 A;  1F8W A;  4BUR A;  4TM0 A;  2E1M A;  4ZCC A;  4Z2U A;  2WOW A;  2J3N A;  2YLS A;  2YG4 A;  4H4X A;  4GF7 A;  1KSU A;  1PHH A;  4J33 A;  3AEA A;  5C3J A;  1IUU A;  4U2S A;  3AE3 A;  2B7S A;  1LVL A;  4GDP A;  3NK1 X;  4YKF A;  4AP1 A;  3NN0 X;  1ZMD A;  2VRL A;  5L46 A;  4U8I A;  2JK6 A;  4TM3 A;  4A9W A;  3RNM A;  1E7P A;  1B8S A;  2R0G A;  4EM4 A;  1H84 A;  1LV0 A;  1CC6 A;  3ITJ A;  4EMW A;  4CCQ A;  1NHR A;  1GTH A;  4ZN0 A;  1E1K A;  1DJN A;  2YR5 A;  4K2X A;  1SEZ A;  4OPU A;  3DJJ A;  3AE4 A;  2VQB A;  3BHF A;  5KVH A;  2Z5Y A;  4H4V A;  4YSY A;  1PXC A;  3AED A;  1GSN A;  1ZK7 A;  2XFN A;  3IWA A;  3EAN A;  1FOH A;  2YLX A;  1BF3 A;  2C65 A;  2R0P A;  2R9Z A;  2XVH A;  3AXB A;  3CGE A;  2WP9 A;  1D4E A;  4ICY A;  1XDI A;  1FEC A;  3VR8 A;  2WOI A;  2BAB A;  1OJ9 A;  3UTG A;  2Z5X A;  5EB5 A;  1ONF A;  2X50 A;  2TMD A;  3EF6 A;  1GOS A;  2GR2 A;  3KA7 A;  4Z44 A;  2FJE A;  4GCM A;  2IVD A;  1QJD A;  2BS2 A;  4Z26 A;  3AE6 A;  1ZKQ A;  4GDE A;  3K30 A;  4YTP A;  2LFC A;  2WDR A;  2B76 A;  1IUV A;  2OAL A;  3H4K A;  3D8X A;  1KFY A;  2WES A;  4BK2 A;  4E0V A;  2ZBW A;  5U25 A;  2CFY A;  4YT0 A;  3DME A;  1ZMC A;  1F6M A;  3KPF A;  5ER0 A;  4FX9 A;  1EL7 A;  1S3B A;  2ZZB A;  1LJ1 A;  1O94 A;  2BCP A;  5GSN A;  2R45 A;  2WP6 A;  3UKL A;  4RG3 A;  3UOZ A;  3K7Q X;  1HYU A;  4A5L A;  4EQR A;  1CC4 A;  2R4J A;  3FPZ A;  1D4D A;  3DGH A;  4Z25 A;  2HQM A;  4GUV A;  4H4Y A;  2WPF A;  1PBD A;  4C74 A;  1H86 A;  4B67 A;  2C67 A;  3SFD A;  3VRA A;  2W0H A;  5KXJ A;  4J34 A;  1OJC A;  1BKW A;  2IID A;  3CND A;  3AE2 A;  2DKI A;  3IHG A;  3P9U A;  3ABV A;  1KSS A;  1FCD A;  1JRX A;  4H4S A;  4EQW A;  3K7T A;  4B1B A;  4EIP A;  2ZZ0 A;  1DOE A;  5HY5 A;  3F8R A;  1IUW A;  3M12 A;  2XVE A;  1P2H A;  3G5S A;  3M13 A;  4PAB A;  1CBO A;  3S61 A;  2VVM A;  2WOV A;  3O0H A;  3NH3 X;  1MO9 A;  3GYJ A;  1YY5 A;  4H4R A;  4H4U A;  1EL9 A;  1IUX A;  3DK9 A;  1N4U A;  3QFA A;  3RP7 A;  2O9Z A;  3RHA A;  3P4R A;  1H7X A;  3GYX A;  3ZYX A;  4CNJ A;  4GR1 A;  1TDO A;  1L9E A;  2C70 A;  2V3B A;  5CQF A;  4JQ9 A;  1PXA A;  4IV9 A;  2ACZ A;  4YSZ A;  2APG A;  2BK5 A;  3B3R A;  3LOV A;  3P4S A;  2X8H A;  4OVI A;  4DSG A;  5FMH A;  4JNA A;  5KWF A;  1BGJ A;  5JCN A;  3NG7 X;  3NYE A;  5BUL A;  3V3N A;  1GND A;  3NT6 A;  3KKJ A;  3UP4 A;  1JRZ A;  1PBE A;  4B65 A;  2GB0 A;  2YG5 A;  4O5U A;  3II4 A;  3AE9 A;  2V60 A;  4A6N A;  1QLB A;  2GRT A;  2QAE A;  1PDH A;  2WQY A;  3UOX A;  2XLR A;  2OA1 A;  4HA6 A;  1XHC A;  4REK A;  4CRT A;  5U63 A;  3EPT A;  3NIX A;  4EQS A;  2XFU A;  1H7W A;  4H2R A;  4BV6 A;  1Y0P A;  3AEB A;  1DNC A;  4EMI A;  2X3N A;  3NK2 X;  4U8N A;  1E6E A;  2BAC A;  2XYO A;  3ADA B;  5C2T A;  4Z43 A;  4JDR A;  5J60 A;  4BJY A;  5IQ4 A;  1Q1W A;  3GWD A;  5J7X A;  4H2P A;  2UZZ A;  1Q9I A;  3ICR A;  1LQU A;  1JU2 A;  3OC4 A;  2F5Z A;  1LQT A;  4BJZ A;  1F8S A;  3IHM A;  1NHP A;  1B5Q A;  3CPJ G;  4YTM A;  1IUT A;  2OLN A;  2WBA A;  2YVJ A;  3KD9 A;  4H4W A;  4NEV A;  4RG4 A;  1FL2 A;  1NDA A;  1NG4 A;  1ZDL A;  1PS9 A;  2Q7V A;  3VQR A;  4C3X A;  4DGK A;  3CTY A;  1VG0 A;  3T37 A;  2C7G A;  3CNT A;  2WU5 A;  3FIM B;  3ALL A;  2EQ7 A;  1LTX R;  3AEC A;  1KDG A;  2X99 A;  4A7A A;  2ARD A;  5IPY A;  2C73 A;  3DJD A;  1M64 A;  1CJC A;  1GRE A;  2GMH A;  3UTH A;  2XFO A;  4WX1 A;  2DKH A;  1GES A;  1JNR A;  3KU9 A;  2WDV A; 
#chains in the Genus database with same CATH topology
 5AQG B;  3OVU A;  2CE7 A;  2LM2 A;  3T0K A;  2WAU A;  3Q5X A;  3URH A;  3AE1 A;  4JI2 T;  4ZXL A;  1ZOY A;  4Z91 A;  4I0U A;  5IYZ E;  4EZH A;  4AKH A;  4D03 A;  1Y64 B;  3Q6J A;  3OJA A;  2XVI A;  2W4X A;  1UGO A;  2MBG A;  3ALJ A;  5DAB A;  4OPD A;  2GAH B;  3U78 A;  2OLO A;  3PV0 F;  4V1A v;  2XVF A;  4OPL A;  3K1S A;  2XTL A;  1GT8 A;  2FJA A;  2YKS A;  5KOX A;  2LE8 A;  5JCK A;  1WYB A;  3QSE A;  3EDU A;  4JLE A;  3RIU A;  3QOF A;  5CJ5 A;  2V5Z A;  3ISH A;  3CQC B;  3AEE A;  2CPT A;  4NUU A;  4FI5 A;  4IVO B;  3HKE E;  5EBK A;  2C75 A;  1G8X A;  3RIA A;  1F3P A;  3LZX A;  3DP7 A;  1PBF A;  3ONL C;  4JI8 T;  4DVD A;  2CEA A;  4DV2 T;  1O95 A;  2M6B A;  3ZCJ A;  2V61 A;  3R9U A;  4UVB B;  2J62 A;  2GQF A;  4DV7 T;  5JTG A;  2VOU A;  4TV9 E;  2BKP A;  4X9N A;  2JB3 A;  1CHU A;  4KHZ F;  4OPI A;  3AVR A;  5HCM A;  5JDN A;  4TV8 E;  4J2W A;  5CA1 E;  4IDZ A;  2E9X A;  2GR1 A;  5L3D B;  4IDO A;  1T7S A;  2YK0 A;  2I6H A;  4UR9 A;  3ATQ A;  3Q9T A;  2VQF T;  2XM1 A;  3AA7 B;  3Q5W A;  1WFD A;  2GQW A;  3UFG A;  2BS4 A;  1KF6 A;  2VVL G;  1W0A A;  5FS8 A;  1S2Q A;  1HX8 A;  3M3Z B;  2Q0L A;  1DJQ A;  4NTE A;  2BRA A;  3SQP A;  5AQK B;  3RYF E;  1XNQ T;  3SRZ A;  1JNZ A;  2IHR 1;  3S4U A;  2NVK X;  1GAL A;  2D0U A;  3ZEF B;  5KX5 E;  4FK1 A;  4ZEY A;  4FK1 C;  2OAM A;  1T72 A;  2KMF A;  1CC2 A;  2E4G A;  5EB4 A;  3ZST A;  5KDM C;  2JB1 A;  3NTD A;  2E9X C;  4ECH A;  1K0J A;  3NLC A;  4Z8X A;  1SE7 A;  1SHZ C;  5CGM A;  4USR A;  3NNE A;  4K5S A;  2K48 A;  4JN9 A;  1D1A A;  4ZHQ E;  1COY A;  2CUL A;  2XAH B;  5KRQ A;  1DOC A;  3UU5 A;  1B4V A;  1NEK A;  4LML A;  3NRN A;  2SPC A;  4DV5 T;  4H4Z A;  1B37 A;  5ABH A;  2GR0 A;  3GMC A;  5L4H A;  2ACX A;  5EK2 A;  3CNS A;  2LKH A;  3EDV A;  2KLQ A;  1GRA A;  4YLH A;  2WDQ A;  2A89 A;  5HXC A;  3P4P A;  5JDH A;  3BI2 A;  5L4E A;  2JRK A;  2J1D G;  3ESL A;  2KSR A;  2X66 A;  2PHH A;  1X9B A;  4II2 A;  4U8M A;  2B9W A;  2XAJ B;  1FEW A;  3N9N A;  2V6Y B;  2P9B A;  3TKL B;  4DNA A;  4EM3 A;  3S5W A;  2YDR A;  5JCI A;  3KV6 A;  2A3D A;  1OJA A;  1D7L A;  4X66 T;  4AT2 A;  1R8I A;  4DR1 T;  3BNU A;  5JR9 B;  2ZZC A;  3UKA A;  4WZX A;  1IUS A;  1VRQ B;  2VRM A;  5JDL A;  2ZLY A;  2DLR A;  3AD8 B;  2J47 A;  4U8P A;  2ES0 A;  3UOY A;  1OJT A;  5FP3 A;  5JR9 A;  1GER A;  3C4N A;  4I4T E;  4X1I E;  3NTA A;  2R0C A;  3EUH A;  1ELI A;  4B66 A;  4A5X A;  1VDC A;  3X1D A;  1W0B A;  5CKU A;  3PO7 A;  4GK5 E;  2D5U A;  4N78 D;  2V1D B;  1GRG A;  3FG2 P;  2BCG G;  4NTD A;  3I0Q A;  3NK0 X;  4K7Z A;  2XQ3 A;  1S3E A;  2LRK A;  3HKC E;  2CHN A;  2XLU A;  2XAS B;  1MNE A;  3ATR A;  3QFB A;  3D1C A;  4PNI A;  2E5V A;  1E1M A;  4K22 A;  3L8K A;  4CXW A;  4OYJ A;  1VG9 A;  4H4P A;  4LU6 A;  2H89 A;  1XDP A;  2WP5 A;  2IDO B;  5HXR A;  1BR1 A;  2XSB A;  3L09 A;  3HI2 A;  2UUC T;  5FXX A;  4B3M T;  5FMN A;  3LAD A;  4PAG A;  1E1L A;  3F8D A;  1YQZ A;  4JYA T;  4Z24 A;  3LXD A;  5AQJ B;  2Y8D A;  4Z44 A;  5C3J A;  3AE3 A;  2B7S A;  4QX7 B;  1ZMD A;  3UU3 A;  4A9W A;  1E7P A;  2R0G A;  4EM4 A;  1H84 A;  1LV0 A;  2CBJ A;  3ITJ A;  2NOX A;  5AQS B;  1N36 T;  5L47 A;  3PJA J;  4YSY A;  1GSN A;  2ZMA A;  1FOH A;  2R0P A;  2UXC T;  5C8Y E;  5BMV E;  3VKH A;  4H63 V;  3VR8 A;  2WOI A;  2BAB A;  1OJ9 A;  2IW5 B;  2VUR A;  3NWI A;  2GR2 A;  3TLU A;  2X0H A;  2FJE A;  2IVD A;  4Z26 A;  4CQI A;  4PK5 A;  3K30 A;  4YTP A;  2XPK A;  1IUV A;  4X62 T;  4Q25 A;  3ZLI A;  2ZBW A;  2JIW A;  1S3B A;  3ZC1 A;  4CXY A;  2BCP A;  1T8B A;  2WP6 A;  3SZW A;  3H3M A;  5HXS A;  3UUN A;  1CC4 A;  4GYS A;  1D4D A;  3SXI A;  2HQM A;  4H4Y A;  2WBL A;  2WPF A;  1H86 A;  5ADX L;  3PUY F;  1MMG A;  3SFD A;  3VRA A;  1BKW A;  2DKI A;  3CPZ A;  1FCD A;  4EQW A;  5LBM A;  2WB5 A;  4XAX B;  3GN5 B;  4QH4 A;  1IAP A;  2IAK A;  2XQ6 A;  2ZZ0 A;  1IUW A;  2XVE A;  4PAB A;  3S61 A;  4LFA T;  4JI3 T;  2QVA A;  2WOV A;  3O0H A;  3NH3 X;  4ERR A;  4H4R A;  2NW7 A;  4COF A;  2XHE B;  1N4U A;  3ZPO A;  2O9Z A;  1Z0P A;  3RKG A;  3O1H A;  5CQF A;  2VVS A;  3UUL A;  1HX1 B;  2VL8 A;  3JAF A;  3PUW F;  4OVI A;  2EHO C;  4DBQ A;  1BGJ A;  4P09 A;  4BJN A;  1UK5 A;  1VCS A;  5FXW A;  2BBJ A;  3UQ7 A;  4XBF B;  2QAE A;  2WQY A;  2XLR A;  2Y6X A;  4OYK A;  5U63 A;  2CCQ A;  4NUV A;  2KIN B;  2XFU A;  2DWK A;  2YDQ A;  3AEB A;  1DNC A;  5LHH B;  5FKY A;  1E6E A;  2XYO A;  5C2T A;  2WCA A;  5J1G A;  3GWD A;  4QX8 B;  5J7X A;  2V7I A;  3Q5D A;  3ICR A;  1JU2 A;  2W67 A;  1LQT A;  3ANW A;  3IHM A;  3FXD B;  4YJ2 E;  3F57 A;  4YTM A;  2OLN A;  4NEV A;  4RG4 A;  3BQL A;  1FL2 A;  4HFV A;  3GMI A;  1NG4 A;  4C3X A;  4DGK A;  2QRX A;  1MIY A;  2UXX B;  3L39 A;  3PUR A;  1D0Z A;  5ABE A;  4A7A A;  3PUQ A;  2VL0 A;  3ONJ A;  2BG9 A;  5J2U E;  2CWY A;  1M64 A;  2CA5 A;  2GMH A;  3ZJ1 A;  3C4Z A;  1GES A;  1JNR A;  3F2E A;  3P50 A;  3ANW B;  3I6D A;  4QH1 A;  2CLY B;  4U8J A;  3QSM A;  2A87 A;  4HWH A;  1VRB A;  4QWN B;  3H8L A;  3K7M X;  4H9N C;  1J5W A;  4TN7 B;  3ONX A;  2K3W A;  3Q5E A;  2DCF A;  3LJP A;  1PN0 A;  2Q9Q A;  2NW9 A;  1N33 T;  1E1H B;  3UKF A;  4LF6 T;  1DU2 A;  2A72 A;  4EIW A;  3NYC A;  1OED B;  2V7K A;  5AQO B;  4K0K T;  3MKD A;  3DH9 A;  4YKG A;  2YEV C;  3ZT7 A;  1BGN A;  1TYP A;  4I58 A;  2RGO A;  2OV9 A;  2QA2 A;  1J5E T;  3T31 A;  4C77 A;  4Z2T A;  4U2L A;  2VZ2 A;  4WBO A;  5LJM A;  3QB5 K;  4AQG A;  1PJ7 A;  1YKJ A;  4A56 A;  4H7U A;  2WHD A;  5HXI A;  4JY2 A;  4MAL A;  3NGC X;  2WPE A;  3T1Y T;  2WEU A;  5FXV A;  2J4G A;  4Z2R A;  4GKK T;  2CXD A;  3CPI G;  2IVE A;  4MJW A;  3AXJ B;  2BK4 A;  3AA1 B;  1HNW T;  4TLX A;  1REO A;  3AE5 A;  4P9S A;  2YLZ A;  4IE7 A;  2PYX A;  3KVE A;  1YKE B;  4TX5 A;  2YM2 A;  2W66 A;  4NXM T;  1N4V A;  2HPL A;  3RHW A;  2C76 A;  1CUN A;  1OED E;  1D7Y A;  2ZM2 A;  4CCR A;  1GPE A;  4DV4 T;  4BA9 A;  2CXF A;  2BG9 E;  3P1W A;  4TWF A;  3SY4 A;  1AOG A;  3MJX A;  2YG6 A;  5FVK A;  4C3Y A;  5KOW A;  3CIR A;  2W0G A;  3N9M A;  1H82 A;  4IL9 A;  1JRY A;  4GYR A;  2UXD T;  2BXR A;  3CNP A;  3PS9 A;  4PFP A;  2V7M A;  1IJ6 A;  3UT5 E;  3G5R A;  4JI7 T;  4IA5 A;  2BKN A;  3AB3 B;  4AKI A;  4IVM B;  4PW8 A;  3CMM A;  5IQ1 A;  1FMV A;  3UFE A;  1OJD A;  3EI0 A;  3R84 B;  3M0O A;  4IE5 A;  4U2Z A;  3PVC A;  3E08 A;  3EAO A;  3DGZ A;  4UP3 A;  4U8L A;  3F31 A;  5GRT A;  4BK3 A;  4DV1 T;  4IDP A;  3C50 A;  2CBI A;  3O4X E;  2KT9 A;  3RC3 A;  4HFI A;  2RP4 A;  1DOB A;  3AVS A;  3O1J A;  4HEA A;  2XCG A;  2W2U A;  2QGS A;  3FBZ A;  1XMQ T;  2X0L B;  1PJ6 A;  3ZMT B;  3ZSS A;  3FZK B;  3KFW X;  2C3C A;  3CQX C;  4O4L E;  2FBW A;  2Y6Q A;  2BBH A;  3PUX F;  5ABF A;  3UKP A;  1NPX A;  5CB4 E;  5LP6 E;  3C4A A;  5KVI A;  4ILA A;  4JI1 T;  2NP9 A;  3AAE B;  3CQG B;  5EK3 A;  3ZC0 A;  3SZF A;  1XAN A;  5LCY A;  1U5P A;  1P2E A;  2GR3 A;  5JDQ A;  5AQN B;  4ZS2 A;  1EZ3 A;  3SZ0 A;  2WPC A;  4DUY T;  4DV6 T;  4UEL A;  3NYF A;  3FZL B;  3MXZ A;  3FHN A;  4IT4 A;  2LHR A;  1PBB A;  3C4W A;  3WE0 A;  5J2T E;  3C4X A;  3UU4 A;  2X51 A;  1CF3 A;  3DJE A;  2V7J A;  2XDO A;  1FEA A;  1H81 A;  2X9X A;  2K5B B;  4NZH A;  4YHH T;  2RPA A;  2Y6R A;  1D5T A;  2NPX A;  4B68 A;  3Q9D A;  1IBL T;  3LZW A;  4Y4N A;  3RP8 A;  4IRE A;  4PAA A;  3QVP A;  2VB6 A;  2CVJ A;  2LKG A;  4RSL A;  3UKH A;  5FL0 A;  1YW0 A;  4EXT A;  2XY8 B;  5LHI B;  2BC0 A;  2EHO D;  4AQY T;  1RSG A;  2YR4 A;  3GWF A;  2B7R A;  3G5Q A;  2JQ9 A;  3NKS A;  4A6N B;  3G06 A;  5L3G B;  3LK4 2;  1BR0 A;  4OPT A;  4YSX A;  4HFE A;  5L2L A;  4NPP A;  4P1N A;  4HFC A;  4GAP A;  3VU7 H;  2FUP A;  1ZOV A;  2E5L T;  3C96 A;  3L1R A;  2XM2 A;  2JKC A;  4X20 E;  3RQW A;  3NVO A;  5BUK A;  3NN6 X;  2MYS A;  5EK4 A;  4H9R C;  3E22 E;  3VR9 A;  3OYZ A;  3UUM A;  3P7I A;  2K24 A;  1Q1R A;  4AXP A;  5AQV B;  3HKD E;  4DO0 A;  4OPG A;  2AAQ A;  4GRT A;  3CNJ A;  2CMR A;  4L9I A;  4DV3 T;  1Y56 B;  4I59 A;  1ZHC A;  3N9L A;  4UF0 A;  4LII A;  2GEW A;  2CLY C;  4WCT A;  1GV4 A;  4ZZC A;  2JB2 A;  3ALM A;  3PU8 A;  2V5C A;  3JSK A;  4U72 A;  5ABG A;  4BUR A;  4TM0 A;  2E1M A;  4ZCC A;  4Z2U A;  5JDG A;  4H4X A;  4Z90 A;  4GF7 A;  3LK3 B;  5LMN T;  1IUU A;  1LVL A;  3NK1 X;  4YKF A;  1OED C;  4F6R C;  1IBK T;  4U8I A;  1WCR A;  1CC6 A;  3LDQ B;  1NHR A;  1LKX A;  1E1K A;  4OPU A;  1SEZ A;  2ZM0 A;  3EHZ A;  5KVH A;  2XFN A;  1ZK7 A;  3EAN A;  2R9Z A;  3AXB A;  1D4E A;  4ICY A;  4UVC B;  3JC6 C;  3SS1 A;  1ONF A;  2X50 A;  4TZ4 C;  4HN9 A;  1MIW A;  1QJD A;  1XZY A;  3AE6 A;  1ZKQ A;  3T14 A;  2E8I A;  2WDR A;  3FBL A;  4QXH B;  2OAL A;  5AQI B;  2WES A;  4BK2 A;  5H6Q B;  1XNR T;  3NRX A;  4G6G A;  1F6M A;  5ER0 A;  2VKO A;  3SWH A;  4CN6 A;  1LJ1 A;  1O94 A;  4U2Y A;  2R45 A;  3UKL A;  3UOZ A;  1B7T A;  3K7Q X;  2R4J A;  2XAG B;  4Z25 A;  4GUV A;  4C74 A;  2LSJ A;  2E2A A;  2WM9 A;  1OJC A;  5LXT E;  1KSS A;  3M65 A;  1JRX A;  4H4S A;  1XDO A;  4PFO A;  4L5G A;  3SX6 A;  3BQI A;  2H7O A;  3ZYL A;  3K7T A;  4UF0 B;  3WAK A;  4C90 A;  2JMH A;  3UU8 A;  5FNV E;  2F4V T;  2WZH A;  1MO9 A;  2QA7 A;  1IUX A;  3DK9 A;  3RP7 A;  3NBX X;  3GYX A;  5F5W A;  4CNJ A;  4GR1 A;  1L9E A;  5JR9 C;  1Y01 A;  4JQ9 A;  4IV9 A;  3VHL A;  3NZQ A;  2BK5 A;  3H37 A;  2MAW A;  1W09 A;  4HWC A;  2WZI A;  2D9D A;  4JNA A;  5KWF A;  4A98 A;  4IL4 A;  3N9O A;  5JCN A;  1GND A;  3KKJ A;  3FZM B;  5KMQ A;  1BR2 A;  1JRZ A;  4AQF C;  4O5U A;  3JAD A;  2CM0 A;  1I94 T;  4JBW F;  5FVL A;  2OA1 A;  4HA6 A;  4REK A;  4TNV A;  1UUR A;  5CA0 E;  4BV6 A;  1Y0P A;  2X3N A;  3NK2 X;  4U8N A;  3ADA B;  3BK9 A;  4Z43 A;  5AQR B;  4BJY A;  5IQ4 A;  1IZN B;  1WYC A;  2VKH A;  2UZZ A;  1Q9I A;  3EAB A;  1UCU A;  2F5Z A;  5HEU A;  1NHP A;  2W63 A;  4H4W A;  2PFV A;  2YVJ A;  5DQW A;  2Q7V A;  4U31 A;  5KMS A;  1VG0 A;  5L3F B;  3UU6 A;  2V5D A;  5LYJ E;  4DR7 T;  1KDG A;  4JI5 T;  2X99 A;  3ZMV B;  4CI3 B;  1YD8 G;  1GRE A;  3RKO A;  2JJ9 A;  2NTY A;  4WX1 A;  4KBM B;  3KU9 A;  4U7Y A;  2WDV A;  3EAM A;  4UVA B;  3HA4 A;  4A99 A;  4GAV A;  2CWO A;  1GRT A;  3AAI A;  3CPH G;  1XPQ A;  4WNK A;  5DJQ C;  4DR4 T;  2BZB A;  3D0T A;  2L9Q A;  1K0L A;  1NHS A;  4I50 E;  4JY3 A;  5HXE A;  3SOL A;  1TDK A;  3MK7 C;  4H63 H;  4KP3 C;  4HGA A;  4AI6 A;  3LG7 A;  2YLR A;  3H8I A;  4H4T A;  3HKB E;  1K0I A;  3FXE B;  5HEO A;  3E0Z A;  3LBX B;  1CJ4 A;  4H9O C;  5AQF B;  5JCL A;  4O4H E;  4TWD A;  1XWM A;  5LA6 E;  3BQK A;  2C4C A;  4H2N A;  2GAG B;  2GV8 A;  2V26 A;  3KBU A;  2VVL A;  4YWO A;  3SFE A;  3PJA A;  2BA9 A;  1H83 A;  2LSY A;  3O9X A;  2M67 A;  1DXL A;  5LV9 A;  4AP3 A;  4DMV A;  4GK0 E;  3AYI A;  2C66 A;  4TWH A;  2NR4 A;  2RAB A;  4NIQ A;  5TR3 A;  2W61 A;  1HG5 A;  2RGH A;  2JQQ A;  3UCL A;  2C64 A;  2W62 A;  3Q2M A;  3GD4 A;  2N2N A;  1G73 A;  4IST A;  2IUB A;  2D0T A;  3CN8 A;  3OZ2 A;  3FBS A;  2BRY A;  2KWI B;  2Z6E A;  2BDE A;  2Q0K A;  3RIU C;  4EB6 E;  1AJ3 A;  4DMW A;  4MHC A;  1CJ2 A;  2RA1 A;  3PE0 A;  3GSI A;  2LT3 A;  1EBD A;  1SUM B;  2XLT A;  4P0A A;  4HFH A;  2XLS A;  3VRB A;  3RF1 A;  3MA9 A;  4HB9 A;  2C3D A;  5LGT B;  3AD9 B;  2B9X A;  4LF9 T;  3GRS A;  1I6Z A;  2TPR A;  3B5M A;  1GRF A;  1QO8 A;  1EL8 A;  5LHG B;  1TYT A;  3V5S A;  4G74 A;  2CDU A;  2YWL A;  2VAS A;  4IE4 A;  3UUB A;  4ZOL E;  2XFQ A;  1IJH A;  1E39 A;  2YG7 A;  4CZZ B;  2C72 A;  2YAU A;  3LJC A;  3PUZ F;  4DV0 T;  2VK9 A;  4EED A;  1SA0 E;  4UV9 B;  1D4C A;  4FDC B;  4G63 A;  2YLW A;  2JPF A;  3JC6 D;  4ANJ A;  4QH5 A;  2AXD S;  4OX9 T;  4ILU A;  3GYI A;  2XJ7 A;  1KNP A;  2WSS V;  4EYY R;  5FY1 A;  2GF3 A;  2HN1 A;  1EL5 A;  3DJG X;  1K4Q A;  3IC9 A;  5FS9 A;  2XFP A;  4TNW A;  2WMN A;  4O8S A;  4Y4L A;  4XXG A;  5LB7 B;  5HHF A;  1OED A;  2NWB A;  4CXX A;  3RX6 A;  1N4W A;  3KPK A;  1JEH A;  3ZMU B;  2JQK A;  2Q9Q B;  4UIG A;  3TLT A;  4U8K A;  4JNQ A;  3B13 A;  2WWU A;  2BYB A;  2JBV A;  5LNK A;  4HWF A;  5M10 A;  3OPC A;  3BNM A;  2Q6U A;  3A8Y C;  3RC8 A;  1NAF A;  2QA1 A;  1QUU A;  3RGL A;  3PU3 A;  3C51 A;  3ETU A;  3ZDN A;  5BRT A;  2I59 A;  4CY8 A;  3IHR A;  2DHR A;  3AYL A;  4ZCD A;  1FEB A;  4A65 A;  3BHK A;  2CRB A;  4K8D A;  4B69 A;  4IDQ A;  4U2T A;  2B9Y A;  2C5K T;  1UKV G;  3I3L A;  4WYV A;  4LA1 A;  5EOW A;  2R46 A;  3NRY A;  4B3R T;  4JUY A;  2X9H A;  1E2A A;  5JRC A;  1JOA A;  3UTE A;  2L3L A;  2AE9 A;  5HXH A;  2XQ5 A;  1TDE A;  3GDN A;  3QB5 A;  1NHQ A;  3RI5 A;  2LOS A;  1HFA A;  1LVK A;  4LMK A;  4YXD A;  1HCI A;  4HKA A;  2C5J A;  3KLJ A;  1O5W A;  3GA8 A;  2IC9 A;  1RYI A;  3FZF B;  5AQL B;  2FJD A;  4O4I E;  2X8G A;  2I0Z A;  2YN6 A;  3UP5 A;  2BG9 C;  4JI6 T;  1KK7 A;  1O3X A;  2WU2 A;  1UUS A;  4O5Q A;  1D0Y A;  2CXL A;  3OBV E;  4YY3 T;  4F8H A;  2BC1 A;  2V6O A;  4J57 A;  4BK1 A;  4PK6 A;  1L9D A;  1HG2 A;  4OK0 A;  4Y4M A;  4B6X A;  3L8R A;  1F8R A;  4XWR A;  5JCM A;  1T98 A;  1L0V A;  1YQ4 A;  1E1N A;  4AOS A;  4H9S E;  4DR5 T;  2VQ7 A;  4J2C A;  3V5U A;  2YVG A;  2VKJ A;  2AR8 A;  1BR4 A;  3LB8 A;  2N1G A;  4XWZ A;  2ODV A;  3P4Q A;  4CBQ A;  3GN5 A;  1S35 A;  1X31 B;  3AEF A;  4H4Q A;  5BVA A;  1CL0 A;  3H3A A;  1PJ5 A;  3NHO X;  4EQX A;  1F8W A;  5EZY E;  2LJL A;  1PHH A;  3A5X A;  3AEA A;  4U2S A;  4ADZ A;  4ILB A;  2YDS A;  2LSG A;  1Z8U A;  2JK6 A;  2XQY A;  1N32 T;  1HF8 A;  1ZV4 X;  1B8S A;  1MMD A;  5LGN B;  3R6N A;  2VQE T;  1GTH A;  1DJN A;  2YR5 A;  4WBN E;  3FB2 A;  3DJJ A;  3AE4 A;  3BHF A;  2Z5Y A;  4H4V A;  3AED A;  3PUV F;  3IWA A;  4ZS3 A;  2YLX A;  1BF3 A;  4EYU A;  2C65 A;  1MND A;  3I9Y A;  3NZP A;  3KIN B;  3T2K A;  4G2A A;  4U7I A;  3LK2 B;  1GOS A;  3CK6 A;  5HEH A;  4GCM A;  2XQA A;  2BS2 A;  1YKH B;  5IUX A;  2LFC A;  1LVF A;  2B76 A;  3H4K A;  3D8X A;  4E0V A;  5JDM A;  3DME A;  4FX9 A;  4CN4 A;  4LF7 T;  1EL7 A;  4DID B;  2R6G F;  3I9W A;  5GSN A;  3ZMZ B;  4EQR A;  2D2S A;  3RH3 A;  2YOE A;  3FPZ A;  1PBD A;  4B67 A;  2XQ8 A;  2C67 A;  1WRD A;  2W0H A;  3DJB A;  4J34 A;  5L3B B;  1FJG T;  5LG3 A;  3AE2 A;  3P9U A;  3IHG A;  3L3P A;  3ABV A;  1UX4 A;  3AA0 B;  4IE6 A;  5AQP B;  2V6X A;  3KV9 A;  2ZM6 T;  4LMJ A;  4B1B A;  4DBR A;  4CI1 B;  3F8R A;  3CX8 B;  5HY5 A;  3G5S A;  1CBO A;  5HEG A;  1YXR A;  5J0Z A;  1MMA A;  4NXN T;  1IJ5 A;  4HTE A;  3RHA A;  1H7X A;  3ZYX A;  1TDO A;  2C70 A;  3LBX A;  4LF5 T;  3I0O A;  4YSZ A;  3PUS A;  3QC9 A;  4EEB A;  2APG A;  3B3R A;  3LOV A;  2C0S A;  3P4S A;  2X8H A;  4DSG A;  5FMH A;  3HL6 A;  2UXN B;  4DR6 T;  3V3N A;  4LFB T;  3WAJ A;  3NT6 A;  4PJL A;  4B65 A;  1VOM A;  3II4 A;  4A6N A;  1WLX A;  1QLB A;  5M4Y A;  2GRT A;  4CRT A;  3UOX A;  4X5T A;  1XHC A;  2C5I T;  2X67 A;  4M1P A;  1H7W A;  4H2R A;  4ZI2 C;  2BAC A;  2WWV A;  3RYC E;  4JDR A;  3I1A A;  3PUG A;  2I0M A;  5HWX A;  4H2P A;  5LOV E;  1LQU A;  4BJZ A;  1F8S A;  1B5Q A;  3CPJ G;  2NW8 A;  3KD9 A;  3ETV A;  3U3I A;  5LMU T;  1NDA A;  1ZDL A;  4E7S A;  2DWG A;  5H6R B;  5IHY A;  4GIW A;  2KXP B;  3T1H T;  4IIJ E;  2C7G A;  3T8O A;  3CNT A;  2X9W A;  2EQ7 A;  5LG4 A;  1LTX R;  3AEC A;  2YU2 A;  2ARD A;  1UX5 A;  2L8K A;  3EVY A;  5IPY A;  2C73 A;  2X68 A;  1CJC A;  3UTH A;  4E7Z A;  2BS3 A;  3SM8 A;  5AQT B;  3TLV A;  4TM4 A;  5HCJ A;  4DSH A;  2ZM8 A;  3HR0 A;  4GOU A;  3C64 A;  4U3C A;  2BVL A;  3V76 A;  3ZMS B;  2JAE A;  4ILC A;  4EOZ B;  3KV4 A;  3GD3 A;  2Y48 B;  4KUM B;  1IBM T;  3COX A;  3AAA B;  5BR8 T;  3CKD A;  1FIO A;  1MXT A;  4TLZ A;  2ODU A;  3PDY A;  3RP6 A;  5JRE A;  4G9K A;  3UKK A;  2BKO A;  5ABF B;  1PBC A;  2UXB T;  1GRB A;  3AE8 A;  2GH5 A;  5LGU B;  1M6I A;  5E0O A;  1TRB A;  3B57 A;  3IF9 A;  4UXN B;  4KHP T;  4P0B A;  2IML A;  4QXC B;  5LJN A;  1V59 A;  2IIU A;  4OPC A;  3T2Z A;  5HYM A;  3J7Y q;  3K3Q C;  3CGC A;  3K8P C;  4PJJ A;  4YTN A;  4C91 A;  3GDP A;  2K9A A;  4B64 A;  3SZC A;  5DQV A;  4B3T T;  3F8P A;  5DBJ A;  3GMB A;  1HR0 T;  4CY6 A;  1NWM X;  3CX6 B;  2YVF A;  3IBP A;  4X1Y E;  4YSH A;  2UUA T;  5F8P A;  3KDS E;  1GXF A;  2LSK A;  5JH7 E;  5TAO A;  4C5O A;  3KV5 A;  4ISS A;  2EQ9 A;  3AWI A;  2QCU A;  5KMR A;  3LFM A;  2YG3 A;  1ZP0 A;  4U33 A;  3GWH A;  2GK9 A;  3CVR A;  5AQU B;  3ZYK A;  4H9Q C;  3BI4 A;  3CML A;  5F3J A;  3O1I A;  2VWA A;  2X8C A;  3SYI A;  1VQW A;  2E9X B;  3AE7 A;  3RYH E;  4A79 A;  5IWA T;  2YR6 A;  2PBI A;  2CHO A;  4NWZ A;  3UTF A;  2XUE A;  1KEY A;  4NEW A;  2XQ9 A;  4K0U A;  3AYJ A;  4OCG A;  1GQE A;  4AT0 A;  4YHJ A;  3ICT A;  4EMJ A;  3CGD A;  3JAE A;  2X0Y A;  1S2Y A;  3HZL A;  5U1O A;  4KX6 A;  4ZI3 D;  3E1T A;  5HEJ A;  4UEM A;  2EQ8 A;  4KMC A;  4QHO A;  1RP0 A;  2GMJ A;  3QVR A;  3AXJ A;  5AQQ B;  2PG8 A;  3AD7 B;  1NG3 A;  3HYW A;  5JDF A;  1GEU A;  2B1E A;  1BWC A;  3KVA A;  5L3C B;  1TDN A;  2Q9Q C;  4ADW A;  4B63 A;  3UQ4 A;  5FYM A;  3VKG A;  3UOV A;  4JEU B;  3B6D A;  3PUA A;  2GVC A;  4USQ A;  4U8O A;  2XLP A;  1VCT A;  1H7C A;  3AA6 B;  4UDP A;  2XQ7 A;  1KNR A;  1YQ3 A;  2V3A A;  4J56 A;  4J31 A;  1MOK A;  4I55 E;  3QNU A;  4TUY E;  4O2B E;  4TM1 A;  2X9Y A;  4X4J A;  2FJB A;  3MZK B;  4G73 A;  1TDF A;  1M62 A;  4EV6 A;  4H9P C;  1ZX9 A;  2PTF A;  2N9D A;  3TLW A;  2A8X A;  3AEG A;  3TLS A;  3ZN1 B;  1V9D A;  5A1L A;  1MMN A;  5M0Z A;  4IE0 A;  1Y56 A;  2R4E A;  3T2Y A;  2KZ7 B;  3ZT6 A;  3DK8 A;  3ZJ2 A;  4GKJ T;  4AKG A;  1WR0 A;  4DR3 T;  1BZL A;  4KPR A;  4M52 A;  4UV8 B;  4AIU A;  1GET A;  5LBQ B;  3N2K E;  3N9Q A;  1DOD A;  2LEH A;  4H2Q A;  3CWZ B;  4UDQ A;  3BI5 A;  4JI0 T;  3FMW A;  4EAH A;  2UU9 T;  2H88 A;  1GTE A;  1MIV A;  5AFU L;  2NTX A;  2BG9 B;  4AQF A;  4EZ4 A;  2XVJ A;  2WS3 A;  2XQ4 A;  1Z6L A;  3ZKR A;  4K5R A;  4JEH B;  3GRT A;  3N2G E;  2PJQ A;  2EHO A;  5AQM B;  4D04 A;  2UUB T;  3DTO A;  3ZT5 A;  2DL1 A;  1W4X A;  3RRC A;  5JQG E;  4HFD A;  4EGW A;  2BVM A;  2JQH A;  3W15 B;  2KND A;  1H6V A;  1LPF A;  3QK6 A;  1US7 B;  3P4W A;  5L3E B;  4LF4 T;  2RGJ A;  2YIN A;  1CJ3 A;  4I43 B;  3PTR B;  5JRC B;  1N1P A;  4U74 A;  3AB1 A;  3QJ4 A;  4JV5 T;  3FZH B;  3CX7 B;  4DND A;  5CFB A;  4II3 A;  5HAX A;  1L9C A;  4A97 A;  2EQ6 A;  2HH7 A;  3ZCI A;  5FY0 A;  3QUJ A;  1NEN A;  3DA1 A;  4UDR A;  2WET A;  3CGB A;  3HYX A;  4EIQ A;  3J9X 1;  4ZI2 D;  2YM1 A;  5FS6 A;  4WW0 A;  3RYI E;  3UKQ A;  4XZC A;  5KNL A;  5FXZ A;  4J36 A;  3DK4 A;  4QKN A;  3ICS A;  2XAF B;  3V3O A;  4APN A;  5KMP A;  2MOZ A;  2BK3 A;  3SGL A;  4NTC A;  5FS7 A;  2OLT A;  1GRH A;  4N9X A;  2YQU A;  4IA6 A;  5FY7 A;  4X9M A;  3LSV A;  1ZY8 A;  2OA5 A;  3ZN0 B;  1PXB A;  4CNK A;  2WMO A;  3VRD B;  3RED A;  1D1C A;  4NNJ A;  4HWD A;  2BXS A;  4AOX A;  2YLT A;  1NAA A;  4ZI7 E;  3KVB A;  2AQJ A;  4YFS A;  3QSS A;  3K3O A;  3KBT A;  4H50 A;  3RQU A;  2WOW A;  4HFB A;  2VKD A;  2J3N A;  2YLS A;  2YG4 A;  4O2A E;  4OHF A;  3ZYM A;  1KSU A;  4J33 A;  2XSA A;  4GDP A;  4AP1 A;  3NN0 X;  2VRL A;  5L46 A;  3P8C D;  4TM3 A;  3RNM A;  4EMW A;  4IHJ E;  4CI2 B;  4L0R A;  4CCQ A;  1X79 A;  4JI4 T;  4ZN0 A;  4YJ3 E;  4K2X A;  2VQB A;  4BJM A;  4X64 T;  2E9X D;  1PXC A;  4AKR B;  4LF8 T;  4OFZ A;  4IDN A;  4PJN A;  2XVH A;  5ETW A;  3CGE A;  2A9U A;  2W00 A;  2WP9 A;  3NKZ A;  1J1J A;  5AQH B;  1WR6 A;  1FEC A;  1XDI A;  3UTG A;  2Z5X A;  2MPK A;  1D0X A;  5EB5 A;  2QYW A;  2TMD A;  3EF6 A;  2HPJ A;  3KA7 A;  4GDE A;  3RPU A;  1KFY A;  2XAQ B;  5U25 A;  2CFY A;  4YT0 A;  3RLF F;  1ZMC A;  3KPF A;  3WI3 A;  3HYV A;  2ZZB A;  2DI4 A;  2YU1 A;  4RG3 A;  1HYU A;  4A5L A;  1M7K A;  4LFC T;  2V7L A;  2LOP A;  3DGH A;  3IEE A;  4AKL A;  1N34 T;  3N2O A;  1KNZ A;  2LRL A;  1FMW A;  5KXJ A;  4MFR A;  2IID A;  3CND A;  2LLY A;  2A2F X;  3UTK A;  1OXZ A;  1HNX T;  1HNZ T;  1ZEE A;  4EIP A;  1OWA A;  3OTO T;  1DOE A;  3M12 A;  1P2H A;  3M13 A;  5HWY A;  5KMG P;  2LHN A;  3RRW A;  2JMK A;  2HHH T;  2VVM A;  3MAC A;  2V8S V;  1QSD A;  3UUX B;  3GYJ A;  1YY5 A;  4H4U A;  1EL9 A;  4HWI B;  4X1K E;  5JVD E;  4B3S T;  2WY2 A;  3QFA A;  4PJM A;  3P4R A;  4O4J E;  4AIS A;  2LM9 A;  2V3B A;  4ZI3 C;  3K3N A;  2H3R A;  1PXA A;  3N5L A;  2M6I A;  2ACZ A;  5HYA A;  2VVN A;  4KI0 F;  4ZZB A;  1S94 A;  1LRZ A;  1ZKE A;  4HE8 A;  3NG7 X;  3NYE A;  2DNX A;  3OYX A;  5BUL A;  2Q9Q D;  3A7M A;  3IA3 A;  4ASK A;  3UP4 A;  1HS7 A;  1PBE A;  2GB0 A;  2YG5 A;  2IC6 A;  3AE9 A;  3RIF A;  2V60 A;  1U4Q A;  1PDH A;  4QXB B;  4MLK A;  4IGU A;  3EPT A;  3NIX A;  4EQS A;  4CN1 A;  4EMI A;  1XMO T;  4BAY B;  4X65 T;  5FL1 A;  5J60 A;  1Q1W A;  1W9R A;  1HTJ F;  3OC4 A;  2LSI A;  4MBQ A;  2H7V C;  1IUT A;  3IF8 B;  3OKQ A;  2WBA A;  3N9P A;  4FJO A;  1PS9 A;  2XZE A;  3VQR A;  3JCF A;  1D1B A;  3CTY A;  2V6Y A;  2EHO B;  2KWH A;  4G6H A;  3T37 A;  3FIM B;  2WU5 A;  3ALL A;  2G0U A;  4DUZ T;  3C98 B;  2MTQ A;  4DR2 T;  3DJD A;  2HN2 A;  4PK4 A;  5GON E;  2XFO A;  2DKH A; 
#chains in the Genus database with same CATH homology
 2BS3 A;  3SM8 A;  3T0K A;  4TM4 A;  4DSH A;  3I6D A;  3URH A;  4U8J A;  4A99 A;  3QSM A;  2A87 A;  3AE1 A;  3H8L A;  3V76 A;  4GAV A;  3K7M X;  2JAE A;  1GRT A;  3CPH G;  1XPQ A;  1ZOY A;  3LJP A;  3GD3 A;  1PN0 A;  4D03 A;  1K0L A;  1NHS A;  3UKF A;  3Q6J A;  2XVI A;  3COX A;  4JY3 A;  3NYC A;  3ALJ A;  1TDK A;  3DH9 A;  3RP6 A;  1MXT A;  4OPD A;  4TLZ A;  3UKK A;  4YKG A;  4G9K A;  1BGN A;  1TYP A;  4I58 A;  1PBC A;  2GAH B;  2RGO A;  1GRB A;  3AE8 A;  2OLO A;  2GH5 A;  2QA2 A;  2YLR A;  1M6I A;  2XVF A;  3H8I A;  4H4T A;  1TRB A;  4OPL A;  3IF9 A;  1K0I A;  3T31 A;  4C77 A;  4Z2T A;  4U2L A;  2VZ2 A;  1GT8 A;  2FJA A;  5KOX A;  1CJ4 A;  5JCK A;  1V59 A;  4OPC A;  3T2Z A;  3QSE A;  5HYM A;  1PJ7 A;  5JCL A;  1YKJ A;  3CGC A;  4H7U A;  2WHD A;  2C4C A;  4H2N A;  2GAG B;  4YTN A;  2V5Z A;  5HXI A;  4JY2 A;  3GDP A;  2GV8 A;  3ISH A;  2VVL A;  3NGC X;  3SZC A;  4YWO A;  3SFE A;  2WPE A;  4B64 A;  2WEU A;  2BA9 A;  3F8P A;  5DBJ A;  3GMB A;  4Z2R A;  1H83 A;  4CY6 A;  3AEE A;  2YVF A;  4IVO B;  3CPI G;  4YSH A;  1DXL A;  2IVE A;  5LV9 A;  4AP3 A;  5EBK A;  4MJW A;  3AYI A;  2C66 A;  2C75 A;  2RAB A;  1GXF A;  2BK4 A;  5TR3 A;  4TLX A;  1REO A;  4C5O A;  2RGH A;  1F3P A;  3AE5 A;  3LZX A;  2EQ9 A;  2C64 A;  1PBF A;  4P9S A;  3GD4 A;  2YLZ A;  2QCU A;  3AWI A;  5KMR A;  2YG3 A;  2PYX A;  3KVE A;  2YM2 A;  1ZP0 A;  1O95 A;  1N4V A;  2V61 A;  2C76 A;  3R9U A;  2GQF A;  2VOU A;  3CN8 A;  3OZ2 A;  3BI4 A;  1D7Y A;  4X9N A;  3FBS A;  2JB3 A;  2BRY A;  4CCR A;  1CHU A;  1GPE A;  3SYI A;  2X8C A;  4OPI A;  1VQW A;  3AE7 A;  4J2W A;  4A79 A;  2YR6 A;  2Q0K A;  3P1W A;  3SY4 A;  1AOG A;  2GR1 A;  4NWZ A;  1CJ2 A;  3UTF A;  3GSI A;  2YG6 A;  4NEW A;  1EBD A;  3AYJ A;  4OCG A;  4C3Y A;  3ATQ A;  5KOW A;  3CIR A;  1H82 A;  2BXR A;  1JRY A;  3DK8 A;  3ICT A;  3PS9 A;  2XLT A;  3CNP A;  3Q9T A;  4AT0 A;  4EMJ A;  2XLS A;  3CGD A;  2GQW A;  3G5R A;  1S2Y A;  4IA5 A;  3HZL A;  3VRB A;  5U1O A;  2BS4 A;  4KX6 A;  1KF6 A;  2VVL G;  5FS8 A;  1S2Q A;  2Q0L A;  1DJQ A;  4NTE A;  2BRA A;  4IVM B;  3CMM A;  3E1T A;  4HB9 A;  5IQ1 A;  3SQP A;  2C3D A;  1OJD A;  2EQ8 A;  3AD9 B;  2B9X A;  3M0O A;  1RP0 A;  2GMJ A;  2TPR A;  3GRS A;  3QVR A;  1JNZ A;  1GRF A;  1QO8 A;  3EAO A;  1EL8 A;  3DGZ A;  3PVC A;  2NVK X;  3AD7 B;  1NG3 A;  1GAL A;  3HYW A;  1TYT A;  4U8L A;  4UP3 A;  4G74 A;  2CDU A;  1GEU A;  5GRT A;  2YWL A;  4BK3 A;  1BWC A;  1TDN A;  4FK1 A;  4ADW A;  4B63 A;  4FK1 C;  2OAM A;  1IJH A;  1E39 A;  2XFQ A;  1CC2 A;  2E4G A;  5EB4 A;  2YG7 A;  1DOB A;  2C72 A;  2JB1 A;  3NTD A;  2YAU A;  3B6D A;  3UOV A;  4ECH A;  2GVC A;  2XCG A;  4USQ A;  4U8O A;  2XLP A;  1K0J A;  3NLC A;  1D4C A;  4UDP A;  4FDC B;  1KNR A;  1YQ3 A;  2V3A A;  4USR A;  1PJ6 A;  2YLW A;  4J56 A;  4J31 A;  1MOK A;  2C3C A;  3NNE A;  2FBW A;  4K5S A;  4TM1 A;  4X4J A;  2FJB A;  4JN9 A;  4G73 A;  3GYI A;  1TDF A;  2Y6Q A;  1KNP A;  1ZX9 A;  2GF3 A;  3UKP A;  1NPX A;  2A8X A;  1EL5 A;  3AEG A;  1K4Q A;  3DJG X;  3IC9 A;  5FS9 A;  2XFP A;  1COY A;  4Y4L A;  2CUL A;  4XXG A;  5HHF A;  3C4A A;  5KVI A;  5KRQ A;  1DOC A;  5M0Z A;  1B4V A;  1NEK A;  1Y56 A;  2R4E A;  3NRN A;  1N4W A;  4H4Z A;  3T2Y A;  1B37 A;  1JEH A;  3KPK A;  3SZF A;  1XAN A;  2GR0 A;  1P2E A;  3GMC A;  2GR3 A;  4KPR A;  1BZL A;  4U8K A;  4M52 A;  3CNS A;  3SZ0 A;  2WPC A;  1GET A;  4JNQ A;  2BYB A;  1GRA A;  2JBV A;  3NYF A;  5M10 A;  2WDQ A;  2A89 A;  1DOD A;  3P4P A;  2Q6U A;  3BNM A;  3BI2 A;  2QA1 A;  4H2Q A;  4UDQ A;  3BI5 A;  1PBB A;  3WE0 A;  3FMW A;  3ZDN A;  5BRT A;  2H88 A;  1CF3 A;  1GTE A;  4CY8 A;  3DJE A;  2XVJ A;  2XDO A;  1FEA A;  2WS3 A;  1H81 A;  2PHH A;  3AYL A;  1FEB A;  1Z6L A;  4ZCD A;  4A65 A;  3BHK A;  4K8D A;  4B69 A;  4II2 A;  4U8M A;  4K5R A;  2B9W A;  3GRT A;  4NZH A;  2B9Y A;  1UKV G;  3I3L A;  4LA1 A;  4U2T A;  5EOW A;  4D04 A;  2R46 A;  4DNA A;  2Y6R A;  4EM3 A;  3S5W A;  1D5T A;  5JCI A;  1OJA A;  1D7L A;  1W4X A;  2NPX A;  4AT2 A;  3BNU A;  1JOA A;  3UTE A;  4B68 A;  3LZW A;  4Y4N A;  3RP8 A;  3UCL A;  2ZZC A;  1TDE A;  3GDN A;  1NHQ A;  3QVP A;  4PAA A;  3UKA A;  2CVJ A;  1H6V A;  1IUS A;  4RSL A;  3UKH A;  1VRQ B;  2VRM A;  4YXD A;  1LPF A;  3AD8 B;  2BC0 A;  4U8P A;  3KLJ A;  3UOY A;  1O5W A;  1OJT A;  1RSG A;  2RGJ A;  1RYI A;  2YR4 A;  3GWF A;  1CJ3 A;  2B7R A;  3G5Q A;  1GER A;  1N1P A;  3AB1 A;  3C4N A;  3NKS A;  3QJ4 A;  2FJD A;  4A6N B;  3NTA A;  2X8G A;  2R0C A;  2I0Z A;  4II3 A;  3UP5 A;  1ELI A;  4OPT A;  1L9C A;  4B66 A;  4YSX A;  2EQ6 A;  1VDC A;  5CKU A;  3PO7 A;  1NEN A;  3DA1 A;  2WU2 A;  4GAP A;  4UDR A;  4O5Q A;  2WET A;  3CGB A;  3HYX A;  4EIQ A;  1ZOV A;  2YM1 A;  1GRG A;  3C96 A;  3L1R A;  3FG2 P;  5FS6 A;  2BCG G;  2JKC A;  4NTD A;  2BC1 A;  2V6O A;  4J57 A;  3UKQ A;  4BK1 A;  5KNL A;  1L9D A;  3NK0 X;  4J36 A;  5BUK A;  4Y4M A;  3DK4 A;  4K7Z A;  3NN6 X;  1S3E A;  3ICS A;  2XLU A;  4XWR A;  1F8R A;  3ATR A;  3QFB A;  3D1C A;  5JCM A;  3VR9 A;  3V3O A;  4APN A;  5KMP A;  2E5V A;  1E1M A;  2BK3 A;  1L0V A;  3SGL A;  1YQ4 A;  1E1N A;  1Q1R A;  4K22 A;  4AOS A;  3L8K A;  4NTC A;  5FS7 A;  1GRH A;  2VQ7 A;  4N9X A;  2YQU A;  1VG9 A;  4H4P A;  2YVG A;  4IA6 A;  2AR8 A;  4OPG A;  4X9M A;  1ZY8 A;  2H89 A;  4LU6 A;  2AAQ A;  4GRT A;  1PXB A;  3CNJ A;  4CNK A;  2WP5 A;  3VRD B;  3LB8 A;  1Y56 B;  4I59 A;  4XWZ A;  3P4Q A;  3RED A;  4NNJ A;  4LII A;  4CBQ A;  2GEW A;  1X31 B;  3LAD A;  1E1L A;  3F8D A;  1YQZ A;  2BXS A;  4AOX A;  3AEF A;  2YLT A;  4WCT A;  1GV4 A;  2JB2 A;  4H4Q A;  1NAA A;  3ALM A;  5BVA A;  1CL0 A;  3JSK A;  1PJ5 A;  3NHO X;  4Z24 A;  2AQJ A;  3QSS A;  4EQX A;  3LXD A;  4H50 A;  1F8W A;  4BUR A;  4TM0 A;  2E1M A;  4ZCC A;  4Z2U A;  2WOW A;  2J3N A;  2YLS A;  2YG4 A;  4H4X A;  4GF7 A;  1KSU A;  1PHH A;  4J33 A;  3AEA A;  5C3J A;  1IUU A;  4U2S A;  3AE3 A;  2B7S A;  1LVL A;  4GDP A;  3NK1 X;  4YKF A;  4AP1 A;  3NN0 X;  1ZMD A;  2VRL A;  5L46 A;  4U8I A;  2JK6 A;  4TM3 A;  4A9W A;  3RNM A;  1E7P A;  1B8S A;  2R0G A;  4EM4 A;  1H84 A;  1LV0 A;  1CC6 A;  3ITJ A;  4EMW A;  4CCQ A;  1NHR A;  1GTH A;  4ZN0 A;  1E1K A;  1DJN A;  2YR5 A;  4K2X A;  1SEZ A;  4OPU A;  3DJJ A;  3AE4 A;  2VQB A;  3BHF A;  5KVH A;  2Z5Y A;  4H4V A;  4YSY A;  1PXC A;  3AED A;  1GSN A;  1ZK7 A;  2XFN A;  3IWA A;  3EAN A;  1FOH A;  2YLX A;  1BF3 A;  2C65 A;  2R0P A;  2R9Z A;  2XVH A;  3AXB A;  3CGE A;  2WP9 A;  1D4E A;  4ICY A;  1XDI A;  1FEC A;  3VR8 A;  2WOI A;  2BAB A;  1OJ9 A;  3UTG A;  2Z5X A;  5EB5 A;  1ONF A;  2X50 A;  3T2K A;  2TMD A;  3EF6 A;  1GOS A;  2GR2 A;  3KA7 A;  4Z44 A;  2FJE A;  4GCM A;  2IVD A;  1QJD A;  2BS2 A;  4Z26 A;  3AE6 A;  1ZKQ A;  4GDE A;  3T14 A;  3K30 A;  4YTP A;  2LFC A;  2WDR A;  2B76 A;  1IUV A;  2OAL A;  3H4K A;  3D8X A;  1KFY A;  2WES A;  4BK2 A;  4E0V A;  2ZBW A;  5U25 A;  2CFY A;  4YT0 A;  3DME A;  1ZMC A;  1F6M A;  3KPF A;  4G6G A;  5ER0 A;  4FX9 A;  1EL7 A;  1S3B A;  2ZZB A;  3HYV A;  1LJ1 A;  1O94 A;  2BCP A;  5GSN A;  2R45 A;  2WP6 A;  3UKL A;  3SZW A;  4RG3 A;  3UOZ A;  3K7Q X;  1HYU A;  4A5L A;  4EQR A;  1CC4 A;  2R4J A;  3FPZ A;  1D4D A;  3DGH A;  3SXI A;  4Z25 A;  2HQM A;  4GUV A;  4H4Y A;  2WPF A;  1PBD A;  4C74 A;  1H86 A;  4B67 A;  2C67 A;  3SFD A;  3VRA A;  2W0H A;  5KXJ A;  4J34 A;  1OJC A;  1BKW A;  2IID A;  3CND A;  3AE2 A;  2DKI A;  3IHG A;  3P9U A;  3ABV A;  1KSS A;  1FCD A;  1JRX A;  4H4S A;  4EQW A;  3SX6 A;  3K7T A;  4B1B A;  4EIP A;  2ZZ0 A;  1DOE A;  5HY5 A;  3F8R A;  1IUW A;  3M12 A;  2XVE A;  1P2H A;  3G5S A;  3M13 A;  4PAB A;  1CBO A;  3S61 A;  2VVM A;  2WOV A;  3O0H A;  3NH3 X;  1MO9 A;  3GYJ A;  1YY5 A;  4H4R A;  4H4U A;  1EL9 A;  1IUX A;  3DK9 A;  1N4U A;  3QFA A;  3RP7 A;  2O9Z A;  3RHA A;  3P4R A;  1H7X A;  3GYX A;  3ZYX A;  4CNJ A;  4GR1 A;  1TDO A;  1L9E A;  2C70 A;  2V3B A;  5CQF A;  4JQ9 A;  1PXA A;  4IV9 A;  2ACZ A;  4YSZ A;  2APG A;  2BK5 A;  3B3R A;  3LOV A;  3P4S A;  2X8H A;  4OVI A;  4DSG A;  5FMH A;  4JNA A;  5KWF A;  1BGJ A;  5JCN A;  3NG7 X;  3NYE A;  5BUL A;  3V3N A;  1GND A;  3NT6 A;  3KKJ A;  3UP4 A;  5KMQ A;  1JRZ A;  1PBE A;  4B65 A;  2GB0 A;  2YG5 A;  4O5U A;  3II4 A;  3AE9 A;  2V60 A;  4A6N A;  1QLB A;  2GRT A;  2QAE A;  1PDH A;  2WQY A;  3UOX A;  2XLR A;  2OA1 A;  4HA6 A;  1XHC A;  4REK A;  4CRT A;  5U63 A;  3EPT A;  3NIX A;  4EQS A;  2XFU A;  1H7W A;  4H2R A;  4BV6 A;  1Y0P A;  3AEB A;  1DNC A;  4EMI A;  2X3N A;  3NK2 X;  4U8N A;  1E6E A;  2BAC A;  2XYO A;  3ADA B;  5C2T A;  4Z43 A;  4JDR A;  5J60 A;  4BJY A;  5IQ4 A;  1Q1W A;  3GWD A;  5J7X A;  4H2P A;  2UZZ A;  1Q9I A;  3ICR A;  1LQU A;  1JU2 A;  3OC4 A;  2F5Z A;  1LQT A;  4BJZ A;  1F8S A;  3IHM A;  1NHP A;  1B5Q A;  3CPJ G;  4YTM A;  1IUT A;  2OLN A;  2WBA A;  2YVJ A;  3KD9 A;  4H4W A;  4NEV A;  4RG4 A;  1FL2 A;  1NDA A;  1NG4 A;  1ZDL A;  1PS9 A;  2Q7V A;  3VQR A;  4C3X A;  4DGK A;  3CTY A;  5KMS A;  1VG0 A;  4G6H A;  3T37 A;  2C7G A;  3CNT A;  2WU5 A;  3FIM B;  3ALL A;  2EQ7 A;  1LTX R;  3AEC A;  1KDG A;  2X99 A;  4A7A A;  2ARD A;  5IPY A;  2C73 A;  3DJD A;  1M64 A;  1CJC A;  1GRE A;  2GMH A;  3UTH A;  2XFO A;  4WX1 A;  2DKH A;  1GES A;  1JNR A;  3KU9 A;  2WDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...