1CHUA

Structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
532
structure length
478
Chain Sequence
NTLPEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMHDISTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPSILSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoenzyme
molecule keywords PROTEIN (L-ASPARTATE OXIDASE)
publication title Structure of L-aspartate oxidase: implications for the succinate dehydrogenase/fumarate reductase oxidoreductase family.
pubmed doi rcsb
source organism Escherichia coli
total genus 152
structure length 478
sequence length 532
ec nomenclature ec 1.4.3.16: L-aspartate oxidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 1chuA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1chuA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1chuA02
1GSNA 1TDFA 3CGEA 1PBEA 4U8MA 2VVMA 1DOBA 3FPZA 1LJ1A 1S3EA 3II4A 1PXBA 2F5ZA 4CCRA 4DSHA 1DOCA 2IVDA 3K30A 2XCGA 2BXRA 3ICRA 2YLWA 4EIQA 3AD7B 1NHSA 3UKHA 1Q1RA 1CHUA 3H4KA 1VG0A 3ATQA 2YLRA 3ICSA 5HY5A 2XFQA 3C4NA 2R4JA 3NHOX 3EAOA 4O5QA 4OPDA 2QA1A 4LIIA 1NEKA 1LQTA 4AP3A 1GPEA 4B67A 2YAUA 3KKJA 2XLTA 3GRSA 3AXBA 2FJEA 2GAGB 1JNRA 2GR2A 4FK1A 1QLBA 2WHDA 3DK4A 1JNZA 1NHRA 4A7AA 3NH3X 1ZKQA 2BABA 4D03A 4XWRA 3CN8A 3P1WA 3KLJA 2WPCA 4K8DA 4CCQA 3C96A 4EMIA 2WPEA 2H89A 1TDEA 3DGZA 5U25A 4BK3A 1E6EA 1L9EA 4AOXA 5IQ4A 4H2QA 3BI4A 4B65A 5KRQA 4U8NA 1H6VA 1JOAA 5JCIA 1B5QA 2YLXA 1GETA 1YQ3A 5IPYA 4AOSA 4X9NA 4YSXA 4YTMA 4Y4LA 2WPFA 5HYMA 3NK1X 3AEEA 2PHHA 3ICTA 4Z2UA 1F8WA 4B68A 2VQBA 4NZHA 5EB5A 4KPRA 2DKIA 4IA6A 2NVKX 3AECA 2YG7A 4EIPA 2V3AA 3QSEA 5EBKA 1PS9A 1RP0A 1PJ7A 3AWIA 4H4UA 2C67A 5TR3A 4IVOB 3DGHA 3NT6A 1H81A 3VRAA 3BNUA 4RSLA 3E1TA 3GD4A 2Z5YA 3S61A 4JY2A 3UTGA 3AD8B 2BC1A 2ZZ0A 2APGA 3NRNA 1PXAA 2V3BA 4FK1C 4H4QA 1FCDA 2Z5XA 1VRQB 3KVEA 1D7LA 3GSIA 3CIRA 4GCMA 3UTEA 3QJ4A 1PDHA 3NTDA 1GRGA 4H4ZA 4A6NA 1PJ5A 2B9XA 1RYIA 1KNRA 3I6DA 2R9ZA 1XANA 4J34A 3RP6A 3UCLA 2GR3A 4A79A 1CJCA 4CY6A 3AYLA 1NG3A 3P4SA 1TRBA 2XVIA 1BF3A 2TMDA 3UP4A 5LV9A 3L8KA 2ACZA 2WOIA 2YLSA 2YVFA 2X99A 1NG4A 4PAAA 1D5TA 1UKVG 4OCGA 1DJQA 4USQA 3IHMA 3NN6X 2WDRA 4GRTA 4C5OA 5L46A 3IC9A 4K7ZA 5BUKA 1GEUA 4OPCA 3QVRA 4YKGA 2VOUA 1M64A 3ALJA 2BK3A 2W0HA 2FJDA 5CQFA 1PBBA 3AB1A 1E7PA 2TPRA 3GDNA 3RP8A 2YG3A 1KNPA 1AOGA 3CPJG 5ER0A 4NEVA 5DBJA 3V76A 3CPIG 3ISHA 4UDQA 3AD9B 4I59A 4J36A 2CULA 3L1RA 3ZYXA 2BYBA 4U8IA 4U8LA 1Z6LA 3NYFA 2XLUA 3D8XA 2C75A 2X8CA 3AEAA 3B3RA 5J7XA 1TDKA 1BZLA 1GALA 3AE9A 4HB9A 1ELIA 3GMBA 3AYJA 4K5SA 3GWDA 2R0CA 2PYXA 4A65A 2WEUA 4YTPA 4OPGA 4N9XA 3FBSA 3IWAA 2A87A 1B37A 4CNJA 3COXA 2OLOA 1CC2A 4RG4A 1GOSA 1ZOVA 1KF6A 1IUTA 3GDPA 1TDNA 4H4WA 2XFOA 2C66A 3NKSA 4CBQA 4YSHA 1JRXA 1ZP0A 3AEGA 2YM1A 2XVFA 3PVCA 3REDA 4EM3A 4B69A 4JY3A 3G5RA 4Y4MA 1CBOA 1BGNA 2XLSA 5GRTA 3GMCA 5U1OA 3NK2X 4DNAA 3LZWA 4O5UA 3GWFA 1H7XA 2WP6A 4GDPA 3LZXA 1JU2A 3BI2A 3QVPA 2Q6UA 2QAEA 4J31A 4EQRA 3BI5A 3DH9A 3NLCA 1YQZA 4ZCCA 1KSUA 4APNA 1EL5A 2YR5A 2DKHA 2XDOA 4GUVA 3ALLA 5EB4A 3RP7A 3OC4A 2O9ZA 5HXIA 1DOEA 2XVHA 3LADA 2YVGA 3WE0A 1OJAA 1YQ4A 4K2XA 1CL0A 4XWZA 2JB2A 4AT0A 4YKFA 5M0ZA 2WQYA 1W4XA 1F8RA 2YWLA 2YR4A 2BCPA 4TLZA 1QJDA 1S2QA 4YTNA 1Y0PA 3OZ2A 3Q6JA 3BNMA 1DODA 3QFBA 2FJBA 4C3XA 4GF7A 4ICYA 3H8IA 3LB8A 1JRYA 3P4PA 1IUUA 1EL8A 3CGDA 2Y6QA 3GYXA 3V3OA 3VQRA 1E1LA 1LTXR 1KFYA 3NG7X 1D4CA 1S3BA 1F6MA 3VRBA 1ZMCA 3V3NA 1K0JA 1MOKA 4H2RA 1CC6A 1GRFA 3QFAA 2OLNA 1ZOYA 5EOWA 4J56A 2WOVA 1GRAA 5GSNA 4DSGA 2Y6RA 1CJ3A 4H50A 3UKQA 1MO9A 1E1MA 1ZMDA 3RNMA 1GTEA 1GV4A 4BJZA 1PBFA 1P2EA 4JN9A 2C64A 4C3YA 2Q7VA 4REKA 3UTHA 2C70A 4GDEA 5KXJA 3UKFA 4A6NB 4CNKA 3G5SA 1FEAA 4OPUA 2B9YA 4U8KA 1NHPA 4J2WA 5FS6A 3PO7A 1M6IA 3HZLA 4UP3A 1COYA 1MXTA 1GESA 3M12A 1CJ4A 4D04A 1ZK7A 2VQ7A 3LOVA 3SFEA 3GYIA 3P4RA 3CPHG 4GR1A 4H4RA 4NTEA 3M0OA 3CGBA 2GRTA 2YVJA 3CNJA 4U2SA 1FEBA 2RGOA 1NPXA 3NYEA 1GRTA 2GV8A 1FL2A 3F8PA 3AE4A 1OJTA 2BK4A 3AE7A 1FOHA 2WBAA 2JB3A 3ALMA 2FJAA 1H83A 3KPFA 4H4PA 5JCKA 3EPTA 2B7SA 1GREA 3BHKA 5FS8A 1IUVA 2RGJA 3UTFA 4EM4A 2WU2A 2WS3A 2VZ2A 4Z25A 1BWCA 1KSSA 1NHQA 3NN0X 2ARDA 2CDUA 4YSYA 2C65A 4H7UA 1REOA 4C74A 2B7RA 4BK1A 4ADWA 1L9DA 4BJYA 2X50A 4LA1A 4YSZA 1B4VA 4AP1A 3O0HA 4X4JA 4Z2TA 2H88A 1D7YA 4OPTA 2RGHA 4DGKA 1EL9A 4FX9A 1PBCA 1D4EA 1N4WA 4ZCDA 3DK8A 1XHCA 5JCNA 2C73A 4TLXA 5KOXA 4B66A 3C4AA 4I58A 1H86A 1S2YA 5IQ1A 2XVEA 3NTAA 3T37A 3I3LA 3EANA 5FS9A 2HQMA 2V61A 3ATRA 4H4YA 1F3PA 4IA5A 3DMEA 4OPLA 4U8PA 1GXFA 2IVEA 2EQ9A 4FDCB 4YXDA 1F8SA 1HYUA 3P9UA 4OPIA 3FMWA 4H2PA 3AE8A 4TM1A 1XPQA 2E4GA 3DJDA 5C2TA 2ZZCA 4JDRA 3K7MX 4P9SA 2VVLG 2OA1A 1K0IA 2GEWA 4TM3A 2GR0A 1NDAA 4U8OA 1GRHA 3CNDA 4B1BA 1O94A 1ZDLA 2OAMA 3CGCA 2YQUA 3RHAA 4RG3A 3QSMA 2GAHB 3EF6A 2JAEA 4H4XA 2V5ZA 2I0ZA 3AE1A 3JSKA 3SFDA 2GB0A 2XFPA 2QA2A 3DJEA 3UKAA 4AT2A 4LU6A 3UOYA 2GMJA 3CTYA 3F8DA 5C3JA 3NNEA 2A89A 5BVAA 3AE5A 4TM0A 2BACA 3AYIA 4EQXA 4U8JA 1EBDA 1IUSA 3DK9A 5M10A 1VG9A 3P4QA 3UKLA 2XFNA 4OVIA 3PS9A 1H7WA 2C3CA 2WOWA 3ZDNA 4E0VA 2AAQA 4CY8A 2R46A 2WP5A 4EQSA 1EL7A 1BKWA 4BK2A 1TYTA 1TYPA 2YR6A 4B64A 1K0LA 1D4DA 4A5LA 4X9MA 4Z43A 1B8SA 2E1MA 3DJGX 2BS4A 2VRLA 3AEDA 2AQJA 3CNTA 4ECHA 2X8HA 5J60A 1SEZA 4Z44A 2GVCA 1O95A 2JK6A 4YT0A 1Y56A 2B9WA 1IUWA 3UP5A 1L9CA 1GRBA 4K5RA 1X31B 2R0PA 3NIXA 4NEWA 5KVHA 1XDIA 4JNAA 1CJ2A 1Q9IA 4H2NA 1YKJA 2WDQA 2WETA 1LV0A 2J3NA 3IF9A 2V60A 2XLPA 1LQUA 4Z26A 5JCMA 4IVMB 4BV6A 1N4VA 1GTHA 2YM2A 4JNQA 2ZZBA 4J33A 3ITJA 2X8GA 2YLTA 2GH5A 2C76A 3SQPA 2BXSA 3Q9TA 1DJNA 3FIMB 1E1NA 4EMJA 3ABVA 4B63A 4PABA 4A99A 2X3NA 5KWFA 1L0VA 1CC4A 1O5WA 2GQFA 3DA1A 5KOWA 1JRZA 2BK5A 3D1CA 2WESA 4Y4NA 1V59A 3KU9A 4YWOA 2WP9A 5U63A 3GRTA 2EQ8A 2WDVA 1TDOA 4NTCA 1PJ6A 4HA6A 1DXLA 4IV9A 3ADAB 3VR8A 4WCTA 1P2HA 3GYJA 2A8XA 1LVLA 1NENA 1PN0A 1OJCA 1PHHA 2JBVA 5FMHA 3R9UA 1K4QA 3VRDB 3NGCX 1NAAA 3K7QX 1OJDA 4NTDA 2CVJA 3UOVA 2ZBWA 1RSGA 3CNSA 3H8LA 4UDRA 1E39A 3IHGA 4H4SA 4M52A 2GMHA 2EQ6A 2Q0KA 2BS3A 1DNCA 1IJHA 4TM4A 1BGJA 1QO8A 4Z2RA 2UZZA 3GD3A 3LJPA 5HHFA 4XXGA 4EMWA 4U2TA 3B6DA 2B76A 3F8RA 3AEFA 4WX1A 1JEHA 2VRMA 3NK0X 2LFCA 1Q1WA 2C7GA 2XYOA 2YLZA 4J57A 5KVIA 3SGLA 1KDGA 5CKUA 2C3DA 3K7TA 2E5VA 2BC0A 3BHFA 3G5QA 4JQ9A 3M13A 2JB1A 4ZN0A 2WU5A 3AEBA 3NYCA 2JKCA 2YG6A 2R4EA 3DJJA 4USRA 2CFYA 3S5WA 2R0GA 1H82A 2YG4A 3AE2A 2NPXA 2BA9A 2GR1A 2RABA 3SM8A 3UKKA 3VR9A 2XFUA 4H4VA 3AE6A 2QCUA 1ZX9A 4BURA 4K22A 2V6OA 4EQWA 4KX6A 1VDCA 5BULA 3AE3A 4C77A 2C72A 5JCLA 1ONFA 2YG5A 4MJWA 1CF3A 3FG2P 4A9WA 3QSSA 1IUXA 1PBDA 1PXCA 3LXDA 3UOXA 2GF3A 3KD9A 2FBWA 1ZY8A 3CNPA 3KA7A 1H84A 2AR8A 1GNDA 4Z24A 4CRTA 1E1KA 3UKPA 2BS2A 2IIDA 2EQ7A 1YY5A 1GT8A 2Q0LA 2OALA 2BCGG 2XLRA 3UOZA 5BRTA 3URHA 1FECA 2R45A 2XVJA 4H4TA 1N4UA 1VQWA 1OJ9A 2GQWA 2VVLA 4U2LA 1LPFA 4UDPA 1Y56B 5FS7A 1GERA 1N1PA
chains in the Genus database with same CATH superfamily
3T1YT 3ZJ2A 3MK7C 1LJ1A 1S3EA 2A9UA 4LMLA 1HR0T 3AD7B 3EVYA 1NHSA 3A7MA 5EZYE 1KNZA 3H4KA 3ICSA 2YLRA 5HY5A 1FMVA 4DUZT 4OPDA 4LIIA 1LQTA 2W61A 4AP3A 5HWXA 4B67A 3RYCE 2CLYB 2YAUA 4JI1T 3KKJA 2XLTA 5L47A 4FK1A 2PG8A 2XUEA 2EHOB 5JREA 2BABA 4D03A 3N9LA 4XWRA 4A98A 2VQFT 3SZ0A 3C96A 4TV9E 4ZI2C 1TDEA 4AOXA 1SA0E 5IPYA 3AA6B 2WPFA 3NK1X 3AEEA 4Z2UA 2H7VC 1F8WA 5LJMA 5EB5A 3VKGA 2YG7A 1Y01A 1PS9A 1RP0A 1PJ7A 5TR3A 4C91A 5FVKA 3VRAA 4RSLA 2D0TA 3JC6D 5DQWA 1PXAA 4PFOA 3GMIA 1D7LA 3GSIA 1T7SA 3UTEA 4H63V 2V26A 5LNKA 4II2A 4A6NA 5L3FB 1PJ5A 2CXFA 5LMNT 2F4VT 2B9XA 3I6DA 4A79A 5M10A 5ETWA 1CJCA 2ZMAA 2WZIA 3AYLA 4UEMA 4JYAT 2L3LA 4CY6A 1BF3A 5LV9A 4UV8B 4HTEA 5AQGB 4JI2T 1NG4A 4IDOA 2X9HA 3RRCA 2VQET 3RYFE 4K7ZA 5L46A 1GEUA 3CQGB 5J0ZA 3JC6C 3NRYA 2W66A 2W0HA 3AB1A 3CPJG 5ER0A 4IDNA 2V5DA 2XQYA 2BYBA 4U8LA 5H6RB 1T98A 3D8XA 5CGMA 5J7XA 2XAJB 2W63A 1BZLA 4K5SA 2X9WA 5AQUB 1LRZA 2VL8A 2PYXA 2R0CA 5AQVB 1G8XA 3E22E 2QGSA 1B37A 4CNJA 1US7B 4CXXA 4ILAA 1GOSA 2I59A 3N9MA 5CJ5A 2WMNA 2YK0A 4QXCB 2MBGA 5JH7E 5JDFA 1JRXA 3OJAA 3ANWB 2L8KA 3O1HA 2XVFA 4B69A 4PW8A 4Y4MA 4IE7A 3PUYF 2VL0A 3NK2X 1UGOA 4DNAA 2WWVA 4V1Av 3RQWA 4XZCA 1WCRA 4O2BE 3ZMVB 3ALLA 3OC4A 3I1AA 5CA1E 5ABFB 3PU3A 3KFWX 3UT5E 5M0ZA 2WQYA 1W4XA 4CQIA 4TLZA 1QJDA 3NZPA 1S2QA 3PURA 3NWIA 2ODUA 2IIUA 5HEHA 1D1AA 3NG7X 4FJOA 1MOKA 3PV0F 2XM2A 1ZOYA 5EOWA 4J56A 3AAAB 1CJ3A 4UVBB 5AQIB 2C0SA 1E1MA 1ZMDA 4BJZA 5FY1A 1QUUA 1WYBA 3UQ4A 5L3EB 3AVRA 5AQFB 3SZFA 1B7TA 2P9BA 4JV5T 4LF7T 2C70A 4GDEA 3UKFA 4A6NB 1NAFA 4QX7B 4J2WA 3HZLA 1MXTA 1GESA 2LEHA 3S4UA 4NTEA 4IE5A 3ZPOA 3VHLA 4IREA 4AIUA 4PK4A 3AE4A 3ALMA 5LGUB 3S61A 4H4PA 2JB3A 4X62T 1H83A 3KVAA 4JI3T 3EPTA 2E9XB 2VZ2A 2JRKA 2WBLA 4CI3B 4C74A 5LB7B 4BK1A 3EAMA 4KP3C 1L9DA 4LA1A 2C5JA 3L3PA 4HFBA 4YSZA 3IA3A 2X67A 1FMWA 3CWZB 3O0HA 4X4JA 2H88A 2K48A 2LT3A 4G63A 4HFDA 1D0ZA 2XM1A 2J47A 2DLRA 4GAPA 2JPFA 1S2YA 5A1LA 5EK2A 5IQ1A 4HWHA 4EEBA 1YXRA 5FS9A 4H4YA 4IA5A 1ZKEA 2IVEA 5KMGP 1D1BA 5F3JA 5ABGA 2LRKA 1F8SA 4L0RA 2HHHT 2X68A 2YINA 1XPQA 4P09A 2BVLA 2ZZCA 2VVLG 1K0IA 2V6YA 4U8OA 2I0MA 4PJMA 1GRHA 4B1BA 1HTJF 1XWMA 3AA7B 3I0QA 3EF6A 3LJCA 2I0ZA 2D9DA 3SFDA 4ZS3A 2QA2A 2XFPA 3TLSA 2CBIA 2RP4A 2BACA 4IL9A 4DIDB 2CBJA 4ZEYA 4EQXA 3M3ZB 1XDOA 3QK6A 2C3CA 2WOWA 3HKEE 2JJ9A 2R46A 1T72A 4BK2A 1BKWA 2AE9A 3ZYLA 1TYPA 4B64A 2BG9C 1D4DA 3ZC1A 2E1MA 3AEDA 4ECHA 2X8HA 2W0GA 2CM0A 5J60A 1SEZA 4AI6A 3UP5A 5AQHB 3HL6A 4B3ST 2E2AA 4ZS2A 3N2GE 5KVHA 2W67A 4JNAA 1CJ2A 3RIAA 2WDQA 1LV0A 3T2KA 1QSDA 5LBQB 4O8SA 4BJMA 3ZC0A 1N4VA 2NTYA 4J33A 2PBIA 4I0UA 2BVMA 2C76A 2MTQA 3Q9TA 1E1NA 4EMJA 3ABVA 4B63A 2BRAA 2X3NA 3Q2MA 3DA1A 4OYKA 5KOWA 2CWOA 2WESA 3MKDA 5LHIB 2YDSA 4F8HA 4NTCA 3ADAB 2A8XA 3PUGA 1LVLA 1NENA 3R9UA 5FMHA 1K4QA 4DMVA 1UX4A 3PUWF 4ERRA 4HFVA 3UOVA 3H8LA 3CNSA 4UDRA 1E39A 1VCTA 3IHGA 2BS3A 1IJHA 4TM4A 3HI2A 5EK4A 4UVAB 4QHOA 3B6DA 3AEFA 4DR7T 5JDMA 1JEHA 2YKSA 3NK0X 3T31A 4J57A 4B3RT 2ODVA 3QNUA 2UXCT 2ZLYA 3VKHA 3G5QA 2WU5A 3DJJA 3H37A 3N2KE 1IBKT 2DL1A 3L09A 1H82A 2NPXA 4ADZA 1XDPA 5M4YA 2XFUA 2QCUA 2W4XA 1ZX9A 2XQ5A 4L9IA 1WLXA 2J62A 5LG4A 4KX6A 4XAXB 4C77A 2C72A 3CX7B 4WZXA 1CF3A 4QH4A 2CXLA 5AQTB 3KD9A 5HXEA 3OBVE 3N9OA 3KA7A 3LK42 4Z24A 3UKPA 3T8OA 3T1HT 1IAPA 2EQ7A 1BR1A 4A5XA 1GT8A 2WMOA 2OALA 4NUVA 4ILUA 3UOZA 3CPZA 3UFGA 3RGLA 1OJ9A 2VVLA 5FS7A 3OYXA 1SHZC 3CGEA 2VVMA 3FPZA 4DSHA 3PUQA 5LP6E 2F5ZA 2LSGA 2LSIA 4DV6T 4EIQA 2YLWA 2KWIB 5BMVE 2VURA 2IW5B 2MAWA 3F31A 3ONXA 1Q1RA 1VG0A 3ATQA 4I55E 4H9RC 2XFQA 2VKOA 2QA1A 4K0KT 3K3NA 3FZKB 3KBTA 3P8CD 3FHNA 3GRSA 3AXBA 2FJEA 2GAGB 2GR2A 3C4WA 3BQIA 1GQEA 3DK4A 3U3IA 3AXJA 2M6BA 2ZM8A 2XSBA 3CN8A 4HKAA 4B6XA 4DR4T 4WBNE 2WPEA 1E6EA 1L9EA 2XHEB 2XTLA 3KBUA 1H6VA 1YQ3A 4AOSA 4X9NA 4YSXA 3ONLC 4YTMA 2X0YA 3N9NA 3SRZA 2VQBA 4KPRA 2YDQA 4IA6A 2VASA 2DWKA 2NVKX 4EIPA 3QSEA 3LSVA 4IDQA 3AWIA 2C67A 2N1GA 1D0XA 2Y6XA 4IVOB 2MYSA 3E1TA 3GD4A 3AD8B 4OFZA 2V3BA 1FCDA 2MOZA 3TLUA 4AKRB 4DVDA 2LJLA 5HWYA 3QJ4A 4HWCA 4NUUA 3RIUA 1GRGA 4NNJA 1RYIA 2BRYA 3UCLA 2XY8B 3I9YA 1NG3A 2XVIA 3JAEA 3UP4A 3CQXC 3L8KA 2ACZA 1FIOA 4X66T 2Q9QC 4X64T 3IC9A 2OLTA 5BUKA 3QVRA 4YKGA 3PTRB 4QH1A 2N2NA 3EDVA 1PBBA 2ZM6T 2XAGB 2X9YA 2YG3A 4YHHT 4CXWA 3ZN1B 4QXHB 4YLHA 3CPIG 4UDQA 4DMWA 4NIQA 2KT9A 3AVSA 2LOSA 3DJBA 3B3RA 4AQFC 1TDKA 2CHNA 5JR9B 2DHRA 2W00A 5E0OA 1GALA 1UURA 3AE9A 4HB9A 4P0AA 4MLKA 3AYJA 2VK9A 4AXPA 4JI6T 4AQYT 5LGNB 4N9XA 2VVNA 3IWAA 1OWAA 4FI5A 1CC2A 2OLOA 2KMFA 2X9XA 1IUTA 1TDNA 2KLQA 4H4WA 4PK6A 5ABEA 4CBQA 4YSHA 2HN2A 4CI1B 3REDA 4ZI2D 1D0YA 4GYRA 1CBOA 3HKCE 1BGNA 5U1OA 3GMCA 3LZWA 2XAFB 3GWFA 3CMLA 1OEDC 5HCJA 3Q5EA 4ZZBA 2QAEA 3QVPA 4J31A 5LA6E 4UIGA 3WI3A 2YR5A 2DKHA 3HKDE 2XDOA 3RP7A 1DOEA 2XVHA 2V7KA 5L2LA 4K2XA 3HA4A 2JB2A 1HFAA 3A8YC 4UR9A 4CN4A 5FP3A 3O4XE 4YTNA 4LF6T 3PU8A 3BNMA 3Q6JA 3UU8A 2JMKA 1AJ3A 3MACA 3LB8A 1JRYA 1J1JA 2LSYA 4NXMT 2PJQA 1E1LA 3FZHB 1LTXR 4JI4T 1ZMCA 3GN5A 5LG3A 3ONJA 1UUSA 3V3NA 3EHZA 2OLNA 5GSNA 3KPKA 3VU7H 1MO9A 1GTEA 3T14A 3ZT6A 3JADA 3FZFB 4REKA 1ZV4X 3LFMA 1MIVA 2B9YA 3UUXB 1NHPA 5FS6A 1MMGA 2UXXB 4KBMB 1M6IA 3PUXF 5HAXA 3PUSA 3SFEA 3P4RA 3CPHG 4H4RA 3M0OA 3CGBA 2GRTA 3T0KA 3CNJA 2EHOD 3NRXA 2CWYA 2J4GA 2IHR1 4IT4A 2B7SA 2WCAA 4K0UA 5FS8A 2RGJA 2NP9A 2X51A 4Z25A 1BWCA 3KVBA 4U72A 1UCUA 4H7UA 2C65A 4O4IE 4HFCA 4NPPA 5LHHB 2Y8DA 4H63H 5L4HA 4Z2TA 4PJNA 4TNWA 4DGKA 2CLYC 5AFUL 2XZEA 1N4WA 4ZCDA 5JCNA 2C73A 4TLXA 4GAVA 2EHOC 4YHJA 1R8IA 4I58A 2WY2A 2WB5A 1O3XA 5KX5E 3I3LA 3ZMUB 2NR4A 4U8PA 5KMQA 1D1CA 4OPLA 4FDCB 3P9UA 4OPIA 3FMWA 4DV5T 4IHJE 2M67A 2BG9A 2A72A 1M62A 4PJLA 1VOMA 3PUAA 4JDRA 5H6QB 5AQLB 1NDAA 1O94A 2OAMA 3QSMA 3DP7A 3ETVA 2V8SV 3JSKA 4IDZA 4JLEA 1W09A 2GB0A 4AT2A 3IEEA 2GMJA 4ZXLA 2A89A 3ZT5A 4TWFA 2KINB 5BVAA 4TM0A 2D5UA 3AYIA 4U8JA 2CXDA 4EGWA 3KV6A 3ZMZB 1FJGT 3UKLA 2V7LA 2NTXA 3ZDNA 2AAQA 4MBQA 4TUYE 1TYTA 2YR6A 5FMNA 1K0LA 3C98B 4X9MA 4Z43A 2BS4A 5DJQC 1DU2A 4IE0A 5JDLA 3QB5A 4TX5A 4Z44A 4EAHA 2GVCA 2JK6A 1IUWA 5LXTE 5HXCA 2R6GF 4Z90A 1MNEA 1GRBA 1X31B 3NIXA 1BR2A 4E7ZA 3A5XA 5AQMB 4PJJA 4IVMB 4GKJT 4BV6A 4ILBA 2YM2A 5AQSB 1UX5A 4JNQA 2ZZBA 4ZI7E 2IC6A 4IGUA 1DJNA 3FIMB 4G6GA 5DQVA 4PABA 1L0VA 1O5WA 2LHNA 2BK5A 4AQGA 4Y4NA 3F57A 3KU9A 4YWOA 5U63A 1BR0A 5LMUT 3AAIA 1XMOT 4KHZF 1UK5A 4DV4T 1PJ6A 4HA6A 2IC9A 1DXLA 4IV9A 3V5UA 3GYJA 4AKHA 3O9XA 2MPKA 4ZI3C 1OJCA 4I50E 3RKOA 2DWGA 3ZCJA 3LK2B 3PJAJ 3ZKRA 4AKLA 4LFCT 3RI5A 2ZBWA 3K8PC 4H4SA 2AXDS 4M52A 4OHFA 2EQ6A 4LF4T 3CQCB 1QO8A 4Z2RA 3H3MA 2CMRA 4U2TA 2XQ7A 3IBPA 3WAKA 3F8RA 3B13A 2LFCA 3SGLA 2XYOA 5KVIA 2LM2A 1KDGA 4GK0E 1E1HB 2E5VA 3BHFA 4JQ9A 5JVDE 3M13A 3UU6A 4USRA 3GWHA 2CFYA 4X1YE 4AKGA 2R0GA 3UKKA 4DV2T 5CFBA 3AE3A 5JCLA 1ONFA 3TLVA 1PBDA 2GF3A 4Q25A 3IF8B 2FBWA 1ZY8A 3CNPA 5JDNA 1H84A 2AR8A 2X0LB 3EI0A 2RA1A 3LBXA 1YY5A 4YJ2E 3KV5A 2XVJA 2NW9A 1VQWA 2GQWA 2DNXA 3HYXA 1LVKA 1N1PA 1PBEA 2E9XC 1DOBA 2K3WA 4WBOA 1DOCA 2ACXA 3K30A 3OKQA 2BXRA 4I4TE 5FL0A 3OVUA 3Q5WA 5AQRB 4DUYT 3UKHA 2JQQA 2G0UA 4M1PA 4P1NA 2R4JA 4KUMB 3NHOX 1NEKA 1HS7A 4QX8B 3SOLA 1OXZA 4OK0A 5DABA 5JDGA 2WHDA 4F6RC 1N36T 1JNZA 1NHRA 3NH3X 4YY3T 3P1WA 4JUYA 2H7OA 2UUAT 4CCQA 2H89A 4BK3A 4U33A 5IQ4A 4B65A 4U8NA 4X1KE 2XQ4A 1GETA 2YLXA 2WM9A 1IJ5A 3TKLB 1N32T 2PHHA 5LGTB 2HPJA 3ICTA 4DR3T 4B68A 5GONE 4NXNT 2Q9QA 2JQKA 2V3AA 2CE7A 5C8YE 3DGHA 3P4WA 3PE0A 1HG2A 3BNUA 3ZCIA 2Z5YA 2ZZ0A 1HG5A 2APGA 4IE4A 2Z5XA 4TWDA 4ANJA 3CIRA 4TV8E 2D2SA 4BA9A 2J1DG 3OPCA 4EZ4A 3RYIE 4DBQA 4J2CA 2YDRA 5KMSA 4AQFA 4B3MT 4J34A 1KNRA 3RP6A 2R9ZA 2NWBA 4OYJA 3RC3A 3P4SA 1WR0A 1TRBA 3UFEA 2WOIA 2YLSA 2YVFA 5LOVE 1IJ6A 4PAAA 4C5OA 4OCGA 3IHMA 2BZBA 5L4EA 2V6YB 2VOUA 1M64A 3O1IA 3C51A 2BK3A 5CQFA 1E7PA 2TPRA 3RP8A 2KNDA 1AOGA 3V76A 5DBJA 1I94T 1WYCA 4CXYA 3LBXB 3AD9B 3C4XA 4JEHB 3Q9DA 4J36A 4U8IA 3NYFA 4AISA 2C75A 2X8CA 1OEDA 1G73A 3LK3B 3PJAA 3GWDA 4A65A 5KNLA 3L8RA 4OPGA 5J1GA 1Y64B 3K3OA 3COXA 4RG4A 3QOFA 3D0TA 1ZOVA 3UULA 2UXNB 2BKPA 3RPUA 2XFOA 2C66A 4XBFB 3NBXX 4G6HA 5JRCA 4IDPA 1ZP0A 3AEGA 5HEUA 3E08A 2YM1A 4IL4A 2UXDT 3PVCA 1MNDA 2XAQB 3SYIA 3L39A 4GOUA 1T8BA 4ZOLE 2XLSA 5GRTA 3PUVF 1KK7A 4IIJE 1LVFA 3IHRA 1H7XA 2WP6A 4GDPA 2K9AA 5FNVE 4EQRA 2W2UA 2XPKA 3ZYMA 5JTGA 3BI5A 1YQZA 4APNA 5FVLA 3RH3A 2UU9T 1EL5A 2QVAA 4GUVA 2V7IA 2VVSA 5HXIA 2LSJA 2YVGA 1LKXA 1MIWA 4XWZA 4HWIB 3RIFA 4YKFA 1F8RA 2YR4A 2BCPA 1S94A 3N9PA 3OZ2A 3ZMTB 4ICYA 4HE8A 2LRLA 1IUUA 1EL8A 2Y6QA 3GYXA 3V3OA 1KFYA 4HGAA 1S3BA 2BBHA 3VRBA 3QUJA 2OA5A 2LKHA 1N33T 1J5WA 1GRFA 1K0JA 3ZLIA 2W62A 4DSGA 4EYUA 4HWDA 2VKHA 2BBJA 2CHOA 2Q9QD 1GV4A 1PBFA 1P2EA 2M6IA 2C64A 4UF0A 2YOEA 4C3YA 2Q7VA 3BK9A 3UTHA 4CNKA 5KXJA 4OPUA 5AQQB 4LF5T 4U8KA 5HYAA 4U7IA 3FXEB 3PO7A 3SY4A 4UP3A 3TLTA 3CX8B 3M12A 1CJ4A 2LOPA 2IMLA 4KHPT 1ZK7A 3GYIA 5HXRA 2BKNA 2EHOA 1HNWT 2YVJA 4U2SA 1NPXA 3NYEA 4ILCA 4ISSA 2GV8A 4L5GA 2BK4A 2WBAA 3KPFA 2NW8A 2FJAA 5JCKA 2ZM0A 1GREA 3BHKA 3UTFA 4EM4A 3GA8A 3FBLA 5AQNB 3KV9A 3NVOA 2ARDA 3G06A 2CDUA 2XAHB 2Z6EA 4YFSA 2QA7A 4ADWA 4BJYA 4GIWA 2X50A 5HEGA 3PDYA 1B4VA 1W0AA 2RGHA 1EL9A 3J7Yq 5EK3A 5KOXA 5L3GB 2RPAA 3ZYKA 3C4AA 2QRXA 3R84B 2CA5A 1H86A 1FEWA 4PAGA 3EANA 2LSKA 2HQMA 5JRCB 2V61A 4DO0A 1F3PA 1N34T 5HXSA 1MIYA 4U7YA 1GXFA 1YD8G 2EQ9A 1W0BA 1HYUA 3ZEFB 5IUXA 4TM1A 3AE8A 3FB2A 1XNQT 2V5CA 3FBZA 4P9SA 5C2TA 3K7MX 2BG9E 4TM3A 3AAEB 4B3TT 3R6NA 3CNDA 1ZDLA 3CGCA 3RHAA 2GAHB 3AA1B 2JAEA 4H4XA 2V5ZA 5LHGB 5FXWA 4LU6A 3BQKA 2D0UA 3CTYA 3F8DA 5C3JA 3NNEA 3AXJB 3ZT7A 5FY7A 5ABHA 3DK9A 3UUNA 2HPLA 4OVIA 4NWZA 1H7WA 3KDSE 1EL7A 4MFRA 4C90A 4GK5E 4PFPA 1KEYA 1B8SA 3DJGX 2PFVA 5TAOA 2VRLA 3CNTA 2AQJA 4YT0A 2B9WA 4UF0B 1WRDA 4ZHQE 2V7MA 3ANWA 3EABA 4K5RA 2R0PA 1XDIA 1Q9IA 2DCFA 3N5LA 4MALA 3JAFA 3IF9A 2V60A 1SUMB 4LFBT 5JR9C 3RKGA 4TN7B 1GTHA 3ETUA 2BDEA 3FZLB 2X8GA 2YLTA 5FKYA 3SQPA 1Z0PA 1Z8UA 4A99A 5ABFA 1CC4A 1S35A 3D1CA 5AQKB 2EQ8A 2WDVA 4E7SA 5JDHA 3HKBE 2JMHA 4UVCB 5BR8T 4DV1T 3VR8A 4WW0A 4WCTA 4DV3T 2I6HA 1PHHA 2JBVA 4EV6A 3NGCX 2X0HA 2UUCT 4IE6A 3K7QX 4HEAA 4NTDA 2CVJA 3RF1A 4HN9A 1DNCA 1BGJA 3GD3A 3LJPA 2XQ3A 5HHFA 4EMWA 3C4ZA 5AQPB 4DNDA 5HXHA 5L3CB 4KMCA 2VRMA 3CK6A 1Q1WA 2C7GA 4YJ3E 1XMQT 2C3DA 3CMMA 2BC0A 2K5BB 3ZSSA 3NYCA 5IYZE 2R4EA 4COFA 3N9QA 2YG4A 2A3DA 3AE2A 2RABA 3VR9A 1VRBA 4H4VA 5LJNA 2VWAA 2E9XA 3M65A 3N2OA 3KV4A 2V6OA 4K22A 4EQWA 4CN1A 5BULA 2A2FX 3RIUC 3HYVA 3FG2P 5FXZA 1PXCA 3LXDA 2GK9A 1IBMT 4DR5T 4CRTA 1XZYA 4WNKA 3HYWA 4LF8T 4PK5A 2Q0LA 2YU2A 1IBLT 3URHA 5F5WA 1X9BA 2R45A 1N4UA 4HFIA 3WAJA 4U2LA 1LPFA 2VB6A 2CRBA 5U25A 1GSNA 1TDFA 1U5PA 4U8MA 2CPTA 4H9OC 3NKZA 3GN5B 3II4A 1PXBA 4CCRA 4EEDA 2IVDA 2XCGA 3UU3A 3ICRA 4DR6T 3V5SA 4X5TA 4JI0T 3I9WA 1CHUA 2JQHA 3C4NA 4O5QA 3EAOA 1EZ3A 1GPEA 5LYJE 4ZI3D 2XQ6A 4G73A 1JNRA 3RRWA 4CZZB 2ZM2A 1QLBA 4QKNA 4A97A 4A7AA 4TWHA 4U31A 2LHRA 1ZKQA 3MXZA 4X65T 3KLJA 2WPCA 4K8DA 4EMIA 3DGZA 1I6ZA 3BI4A 4H2QA 5KRQA 5JCIA 2WWUA 1JOAA 1B5QA 4Y4LA 2SPCA 5HYMA 2FUPA 4N78D 4P0BA 4NZHA 2DKIA 3AECA 4H9QC 2N9DA 5EBKA 4JI5T 4H4UA 2LLYA 3BQLA 1CUNA 3NT6A 3LG7A 3ZJ1A 3SX6A 4Z91A 1H81A 4JY2A 3UTGA 2BC1A 3NRNA 4WYVA 1YKEB 4FK1C 4H4QA 5FYMA 4A56A 3SZWA 1VRQB 3KVEA 1WR6A 4GCMA 4HFHA 3RC8A 3QC9A 4TNVA 1PDHA 3NTDA 4H4ZA 2QYWA 1XANA 5FY0A 2GR3A 2UUBT 4JBWF 2K24A 2TMDA 5AQOB 2BG9B 2X99A 1D5TA 1UKVG 4USQA 1DJQA 2E5LT 2WDRA 3NN6X 4GRTA 5F8PA 4OPCA 4PNIA 2XQ9A 3RQUA 4U74A 3ALJA 4AKIA 2FJDA 3GDNA 1KNPA 1HX8A 2CCQA 4NEVA 2E9XD 1YKHB 2HN1A 4JI8T 3ISHA 3E0ZA 3T2ZA 4I59A 1MMAA 4BAYB 1HCIA 2CULA 3L1RA 3ZYXA 3LDQB 1Z6LA 2XLUA 3Q5XA 3AEAA 4EIWA 5CA0E 1ELIA 4DV0T 3GMBA 2XQ8A 1OEDE 5HCMA 4G9KA 2WEUA 4YTPA 2UXBT 3FBSA 2YN6A 3T2YA 5CB4E 2A87A 4KI0F 2WZHA 4EYYR 1KF6A 5FXVA 3GDPA 5KMRA 1VCSA 3UU5A 2L9QA 3NKSA 2V1DB 3ZMSB 2IDOB 4O4LE 4ISTA 1J5ET 4EM3A 4JY3A 4X1IE 3G5RA 1NWMX 3J9X1 1MMNA 4O5UA 3ESLA 3LZXA 1JU2A 3BI2A 4ZZCA 2KZ7B 2Q6UA 3SXIA 3DH9A 3NLCA 4ZCCA 4I43B 1KSUA 4O4JE 5EB4A 2E8IA 2O9ZA 2WSSV 3LADA 3WE0A 1OJAA 1YQ4A 1CL0A 4AT0A 2VKJA 3C50A 4DR1T 2BKOA 2YWLA 4H9SE 5J2UE 3QFBA 1Y0PA 1DODA 2FJBA 5L3DB 4GF7A 4C3XA 3H8IA 2YU1A 3P4PA 3H3AA 3CGDA 3VQRA 1D4CA 1F6MA 4H2RA 1CC6A 3QFAA 2V7JA 1SE7A 2WOVA 1GRAA 2Y6RA 4H50A 3UKQA 2C4CA 4EOZB 3RNMA 4EB6E 3F2EA 3MA9A 4JN9A 5JDQA 3G5SA 2CEAA 1FEAA 2ES0A 5AQJB 1COYA 4D04A 2VQ7A 3LOVA 4CN6A 4GR1A 3U78A 1W9RA 1FEBA 2RGOA 2LE8A 3EUHA 1GRTA 5ADXL 3SZCA 2B1EA 1FL2A 3F8PA 1OJTA 4HWFA 3AE7A 1FOHA 4JEUB 4H9NC 3PUZF 1IUVA 4CI2B 3B57A 2WU2A 2WS3A 3UUMA 5KDMC 1KSSA 1NHQA 3NN0X 1X79A 2DI4A 4YSYA 1U4QA 5FXXA 1REOA 3K3QC 2B7RA 3QB5K 3K1SA 4AP1A 4EZHA 3MJXA 5IWAT 1D7YA 4OPTA 3RHWA 4FX9A 1BR4A 2Y48B 1PBCA 1D4EA 3DK8A 5LBMA 1XHCA 3O1JA 4B66A 2H3RA 3UTKA 1V9DA 2XVEA 3NTAA 3X1DA 3T37A 3RYHE 2YEVC 3ATRA 3DMEA 3SWHA 2IUBA 4YXDA 4LF9T 4QH5A 4H2PA 2C5KT 4O4HE 2X66A 3CVRA 2E4GA 3DJDA 2IAKA 2VKDA 4X20E 2OA1A 2GEWA 1MMDA 2GR0A 2YQUA 3CX6B 4QXBB 4RG3A 2NOXA 4UV9B 4BJNA 3AE1A 3DJEA 3UKAA 4UELA 3UOYA 3AE5A 3NZQA 3P7IA 3RLFF 2WAUA 1EBDA 1IUSA 5JR9A 1VG9A 3P4QA 1ZEEA 2XFNA 3PS9A 4E0VA 2LKGA 2XASB 3DTOA 4CY8A 2WP5A 4EQSA 4LMKA 4A5LA 3UQ7A 4U2YA 1M7KA 3JCFA 3UUBA 2Q9QB 1E2AA 3UU4A 4HFEA 1O95A 1Y56A 5IHYA 1L9CA 3TLWA 4G2AA 3MZKB 4LMJA 3C64A 5J2TE 4NEWA 4H2NA 1YKJA 2WETA 3AA0B 2J3NA 5JQGE 3FXDB 2XLPA 1LQUA 4Z26A 5JCMA 3P50A 4QWNB 3ITJA 2GH5A 3ZSTA 4LFAT 2BXSA 5HEOA 5FL1A 4OX9T 2XQAA 2HH7A 3AB3B 5KWFA 1HX1B 2GQFA 1JRZA 1HNXT 1V59A 2JQ9A 2WP9A 3EDUA 4GYSA 3W15B 3GRTA 1TDOA 5HEJA 1P2HA 3Q5DA 4JI7T 1PN0A 4U3CA 4DV7T 2OV9A 3VRDB 3ZN0B 4ASKA 1NAAA 3B5MA 1OJDA 5LCYA 1WFDA 1RSGA 1HF8A 4II3A 1OEDB 2GMHA 2Q0KA 2XJ7A 5L3BB 4GKKT 2UZZA 4XXGA 2B76A 4DBRA 4WX1A 2LM9A 1XNRT 4O2AE 2C5IT 2YLZA 2PTFA 3CKDA 5CKUA 3K7TA 4ZN0A 2JB1A 3AEBA 2JIWA 2JKCA 3SS1A 2YG6A 3OYZA 4MHCA 4U2ZA 4H9PC 3S5WA 3HR0A 2KWHA 2BA9A 2GR1A 3SM8A 4G74A 1H7CA 4TZ4C 3AE6A 4BURA 5KMPA 1HNZT 1VDCA 3I0OA 4UXNB 2XSAA 1IZNB 2NW7A 3OTOT 2YG5A 4MJWA 4A9WA 3QSSA 3KINB 1IUXA 3UOXA 3FZMB 1ZHCA 4DR2T 1GNDA 2KXPB 1E1KA 2BS2A 2IIDA 2V6XA 4Z8XA 2BCGG 3RX6A 2XLRA 2KSRA 5BRTA 1FECA 4H4TA 4EXTA 4UDPA 1Y56B 1GERA 1YW0A
chains in the Genus database with same CATH topology
1GSNA 1TDFA 3CGEA 1PBEA 4U8MA 2VVMA 1DOBA 3FPZA 1LJ1A 1S3EA 3II4A 1PXBA 2F5ZA 4CCRA 4DSHA 1DOCA 2IVDA 3K30A 2XCGA 2BXRA 3ICRA 2YLWA 4EIQA 3AD7B 1NHSA 3UKHA 1Q1RA 1CHUA 3H4KA 1VG0A 3ATQA 2YLRA 3ICSA 5HY5A 2XFQA 3C4NA 2R4JA 3NHOX 3EAOA 4O5QA 4OPDA 2QA1A 4LIIA 1NEKA 1LQTA 4AP3A 1GPEA 4B67A 2YAUA 3KKJA 2XLTA 3GRSA 3AXBA 2FJEA 2GAGB 4G73A 1JNRA 2GR2A 4FK1A 1QLBA 2WHDA 3DK4A 1JNZA 1NHRA 4A7AA 3NH3X 1ZKQA 2BABA 4D03A 4XWRA 3CN8A 3P1WA 3KLJA 2WPCA 4K8DA 4CCQA 3SZ0A 3C96A 4EMIA 2WPEA 2H89A 1TDEA 3DGZA 5U25A 4BK3A 1E6EA 1L9EA 4AOXA 5IQ4A 4H2QA 3BI4A 4B65A 5KRQA 4U8NA 1H6VA 1JOAA 5JCIA 1B5QA 2YLXA 1GETA 1YQ3A 5IPYA 4AOSA 4X9NA 4YSXA 4YTMA 4Y4LA 2WPFA 5HYMA 3NK1X 3AEEA 2PHHA 3ICTA 4Z2UA 1F8WA 4B68A 2VQBA 4NZHA 5EB5A 4KPRA 2DKIA 4IA6A 2NVKX 3AECA 2YG7A 4EIPA 2V3AA 3QSEA 5EBKA 1PS9A 1RP0A 1PJ7A 3AWIA 4H4UA 2C67A 5TR3A 4IVOB 3DGHA 3NT6A 3SX6A 1H81A 3VRAA 3BNUA 4RSLA 3E1TA 3GD4A 2Z5YA 3S61A 4JY2A 3UTGA 3AD8B 2BC1A 2ZZ0A 2APGA 3NRNA 1PXAA 2V3BA 4FK1C 4H4QA 1FCDA 2Z5XA 3SZWA 1VRQB 3KVEA 1D7LA 3GSIA 3CIRA 4GCMA 3UTEA 3QJ4A 1PDHA 3NTDA 1GRGA 4II2A 4H4ZA 4A6NA 5KMSA 4NNJA 1PJ5A 2B9XA 1RYIA 1KNRA 2BRYA 2R9ZA 1XANA 3I6DA 4J34A 3RP6A 2GR3A 3UCLA 4A79A 1CJCA 4CY6A 3AYLA 1NG3A 3P4SA 1TRBA 2XVIA 1BF3A 2TMDA 3UP4A 5LV9A 3L8KA 2ACZA 2WOIA 2YLSA 2YVFA 2X99A 1NG4A 4PAAA 1D5TA 1UKVG 4OCGA 1DJQA 4USQA 3IHMA 3NN6X 2WDRA 4GRTA 4C5OA 5L46A 3IC9A 4K7ZA 5BUKA 1GEUA 4OPCA 3QVRA 4YKGA 2VOUA 1M64A 3ALJA 2BK3A 2W0HA 2FJDA 5CQFA 1PBBA 3AB1A 1E7PA 2TPRA 3GDNA 3RP8A 2YG3A 1KNPA 1AOGA 3CPJG 5ER0A 4NEVA 5DBJA 3V76A 3CPIG 3T2ZA 3ISHA 4UDQA 3AD9B 4I59A 4J36A 2CULA 3L1RA 3ZYXA 2BYBA 4U8IA 4U8LA 1Z6LA 3NYFA 2XLUA 3D8XA 2C75A 2X8CA 3AEAA 3B3RA 5J7XA 1TDKA 1BZLA 1GALA 3AE9A 4HB9A 1ELIA 3GMBA 3AYJA 4K5SA 4G9KA 3GWDA 2R0CA 2PYXA 4A65A 5KNLA 2WEUA 4YTPA 4OPGA 4N9XA 3FBSA 3T2YA 3IWAA 2A87A 1B37A 4CNJA 3COXA 2OLOA 1CC2A 4RG4A 1GOSA 1ZOVA 1KF6A 1IUTA 3GDPA 1TDNA 4H4WA 5KMRA 2XFOA 2C66A 3NKSA 4G6HA 4CBQA 4YSHA 1JRXA 1ZP0A 3AEGA 2YM1A 2XVFA 3PVCA 3REDA 4EM3A 4B69A 4JY3A 3G5RA 4Y4MA 3SYIA 1CBOA 1BGNA 2XLSA 5GRTA 3GMCA 5U1OA 3NK2X 4DNAA 3LZWA 4O5UA 3GWFA 1H7XA 2WP6A 4GDPA 3LZXA 1JU2A 3BI2A 3QVPA 2Q6UA 2QAEA 4J31A 3SXIA 4EQRA 3BI5A 3DH9A 3NLCA 1YQZA 4ZCCA 1KSUA 4APNA 1EL5A 2YR5A 2DKHA 2XDOA 4GUVA 3ALLA 5EB4A 3RP7A 3OC4A 2O9ZA 5HXIA 1DOEA 2XVHA 3LADA 2YVGA 3WE0A 1OJAA 1YQ4A 4K2XA 1CL0A 4XWZA 2JB2A 4AT0A 4YKFA 5M0ZA 2WQYA 1W4XA 1F8RA 2YWLA 2YR4A 2BCPA 4TLZA 1QJDA 1S2QA 4YTNA 1Y0PA 3OZ2A 3Q6JA 3BNMA 1DODA 3QFBA 2FJBA 4C3XA 4GF7A 4ICYA 3H8IA 3LB8A 1JRYA 3P4PA 1IUUA 1EL8A 3CGDA 2Y6QA 3GYXA 3V3OA 3VQRA 1E1LA 1LTXR 1KFYA 3NG7X 1D4CA 1S3BA 1F6MA 3VRBA 1ZMCA 3V3NA 1K0JA 1MOKA 4H2RA 1CC6A 1GRFA 3QFAA 2OLNA 1ZOYA 5EOWA 4J56A 2WOVA 1GRAA 5GSNA 4DSGA 2Y6RA 3KPKA 1CJ3A 4H50A 3UKQA 2C4CA 1MO9A 1E1MA 1ZMDA 3RNMA 1GTEA 1GV4A 4BJZA 1PBFA 1P2EA 4JN9A 3T14A 2C64A 4C3YA 3SZFA 2Q7VA 4REKA 3UTHA 2C70A 4GDEA 5KXJA 3UKFA 4A6NB 4CNKA 3G5SA 1FEAA 4OPUA 2B9YA 4U8KA 1NHPA 4J2WA 5FS6A 3PO7A 1M6IA 3HZLA 4UP3A 1COYA 3SY4A 1MXTA 1GESA 3M12A 1CJ4A 4D04A 1ZK7A 2VQ7A 3LOVA 3SFEA 3GYIA 3P4RA 3CPHG 4GR1A 4H4RA 4NTEA 3M0OA 3CGBA 2GRTA 2YVJA 3T0KA 3CNJA 4U2SA 1FEBA 2RGOA 1NPXA 3NYEA 1GRTA 3SZCA 2GV8A 1FL2A 3F8PA 3AE4A 1OJTA 2BK4A 3AE7A 1FOHA 2WBAA 2JB3A 3ALMA 2FJAA 1H83A 3KPFA 4H4PA 5JCKA 3EPTA 2B7SA 1GREA 3BHKA 5FS8A 1IUVA 2RGJA 3UTFA 4EM4A 2WU2A 2WS3A 2VZ2A 4Z25A 1BWCA 1KSSA 1NHQA 3NN0X 2ARDA 2CDUA 4YSYA 2C65A 4H7UA 1REOA 4C74A 2B7RA 4BK1A 4ADWA 1L9DA 4BJYA 2X50A 4LA1A 4YSZA 1B4VA 4AP1A 3O0HA 4X4JA 4Z2TA 3HYXA 2H88A 1D7YA 4OPTA 2RGHA 4DGKA 1EL9A 4FX9A 1PBCA 1D4EA 1N4WA 4ZCDA 3DK8A 1XHCA 5JCNA 2C73A 4TLXA 5KOXA 4GAVA 4GAPA 4B66A 3C4AA 4I58A 1H86A 1S2YA 5IQ1A 2XVEA 3NTAA 3T37A 3I3LA 3EANA 5FS9A 2HQMA 2V61A 3ATRA 4H4YA 1F3PA 4IA5A 3DMEA 4OPLA 4U8PA 1GXFA 5KMQA 2IVEA 2EQ9A 4FDCB 4YXDA 1F8SA 1HYUA 3P9UA 4OPIA 3FMWA 4H2PA 3AE8A 4TM1A 1XPQA 2E4GA 3DJDA 5C2TA 2ZZCA 4JDRA 3K7MX 4P9SA 2VVLG 2OA1A 1K0IA 2GEWA 4TM3A 2GR0A 1NDAA 4U8OA 1GRHA 3CNDA 4B1BA 1O94A 1ZDLA 2OAMA 3CGCA 2YQUA 3RHAA 4RG3A 3QSMA 2GAHB 3EF6A 2JAEA 4H4XA 2V5ZA 2I0ZA 3AE1A 3JSKA 3SFDA 2GB0A 2XFPA 2QA2A 3DJEA 3UKAA 4AT2A 4LU6A 3UOYA 2GMJA 3CTYA 3F8DA 5C3JA 3NNEA 2A89A 5BVAA 3AE5A 4TM0A 2BACA 3AYIA 4EQXA 4U8JA 1EBDA 1IUSA 3DK9A 5M10A 1VG9A 3P4QA 3UKLA 2XFNA 4OVIA 3PS9A 4NWZA 1H7WA 2C3CA 2WOWA 3ZDNA 4E0VA 2AAQA 4CY8A 2R46A 2WP5A 4EQSA 1EL7A 1BKWA 4BK2A 1TYTA 1TYPA 2YR6A 4B64A 1K0LA 1D4DA 4A5LA 4X9MA 4Z43A 1B8SA 2E1MA 3DJGX 2BS4A 2VRLA 3AEDA 2AQJA 3CNTA 4ECHA 2X8HA 5J60A 1SEZA 4Z44A 2GVCA 1O95A 2JK6A 4YT0A 1Y56A 2B9WA 1IUWA 3UP5A 1L9CA 1GRBA 4K5RA 1X31B 2R0PA 3NIXA 4NEWA 5KVHA 1XDIA 4JNAA 1CJ2A 1Q9IA 4H2NA 1YKJA 2WDQA 2WETA 1LV0A 2J3NA 3T2KA 3IF9A 2V60A 2XLPA 1LQUA 4Z26A 5JCMA 4IVMB 4BV6A 1N4VA 1GTHA 2YM2A 4JNQA 2ZZBA 4J33A 3ITJA 2X8GA 2YLTA 2GH5A 2C76A 3SQPA 2BXSA 3Q9TA 1DJNA 3FIMB 4G6GA 1E1NA 4EMJA 3ABVA 4B63A 4PABA 2BRAA 4A99A 2X3NA 5KWFA 1L0VA 1CC4A 1O5WA 2GQFA 3DA1A 5KOWA 1JRZA 2BK5A 3D1CA 2WESA 4Y4NA 1V59A 3KU9A 4YWOA 2WP9A 5U63A 3GRTA 2EQ8A 2WDVA 1TDOA 4NTCA 1PJ6A 4HA6A 1DXLA 4IV9A 3ADAB 3VR8A 4WCTA 1P2HA 3GYJA 2A8XA 1LVLA 1NENA 1PN0A 1OJCA 1PHHA 2JBVA 5FMHA 3R9UA 1K4QA 3VRDB 3NGCX 1NAAA 3K7QX 1OJDA 4NTDA 2CVJA 3UOVA 2ZBWA 1RSGA 3CNSA 3H8LA 4UDRA 4II3A 1E39A 3IHGA 4H4SA 4M52A 2GMHA 2EQ6A 2Q0KA 2BS3A 1DNCA 1IJHA 4TM4A 1BGJA 1QO8A 4Z2RA 2UZZA 3GD3A 3LJPA 5HHFA 4XXGA 4EMWA 4U2TA 3B6DA 2B76A 3F8RA 3AEFA 4WX1A 1JEHA 2VRMA 3NK0X 3T31A 1Q1WA 2C7GA 2XYOA 2YLZA 4J57A 5KVIA 3SGLA 2LFCA 1KDGA 5CKUA 2C3DA 3CMMA 3K7TA 2E5VA 2BC0A 3BHFA 3G5QA 4JQ9A 3M13A 2JB1A 4ZN0A 2WU5A 3AEBA 3NYCA 2JKCA 2YG6A 2R4EA 3DJJA 4USRA 2CFYA 3S5WA 2R0GA 1H82A 2YG4A 3AE2A 2NPXA 2BA9A 2GR1A 2RABA 4G74A 3SM8A 3UKKA 3VR9A 2XFUA 4H4VA 3AE6A 2QCUA 1ZX9A 4BURA 5KMPA 4K22A 2V6OA 4EQWA 4KX6A 1VDCA 5BULA 3AE3A 4C77A 2C72A 5JCLA 1ONFA 2YG5A 3HYVA 4MJWA 1CF3A 3FG2P 4A9WA 3QSSA 1IUXA 1PBDA 1PXCA 3LXDA 3UOXA 2GF3A 3KD9A 2FBWA 1ZY8A 3CNPA 3KA7A 1H84A 2AR8A 1GNDA 4Z24A 4CRTA 3HYWA 1E1KA 3UKPA 2BS2A 2IIDA 2EQ7A 1YY5A 1GT8A 2Q0LA 2OALA 2BCGG 2XLRA 3UOZA 5BRTA 3URHA 1FECA 2R45A 2XVJA 4H4TA 1N4UA 1VQWA 1OJ9A 2GQWA 2VVLA 4U2LA 1LPFA 4UDPA 1Y56B 5FS7A 1GERA 1N1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSN A;  1TDF A;  3CGE A;  1PBE A;  4U8M A;  2VVM A;  1DOB A;  3FPZ A;  1LJ1 A;  1S3E A;  3II4 A;  1PXB A;  2F5Z A;  4CCR A;  4DSH A;  1DOC A;  2IVD A;  3K30 A;  2XCG A;  2BXR A;  3ICR A;  2YLW A;  4EIQ A;  3AD7 B;  1NHS A;  3UKH A;  1Q1R A;  1CHU A;  3H4K A;  1VG0 A;  3ATQ A;  2YLR A;  3ICS A;  5HY5 A;  2XFQ A;  3C4N A;  2R4J A;  3NHO X;  3EAO A;  4O5Q A;  4OPD A;  2QA1 A;  4LII A;  1NEK A;  1LQT A;  4AP3 A;  1GPE A;  4B67 A;  2YAU A;  3KKJ A;  2XLT A;  3GRS A;  3AXB A;  2FJE A;  2GAG B;  1JNR A;  2GR2 A;  4FK1 A;  1QLB A;  2WHD A;  3DK4 A;  1JNZ A;  1NHR A;  4A7A A;  3NH3 X;  1ZKQ A;  2BAB A;  4D03 A;  4XWR A;  3CN8 A;  3P1W A;  3KLJ A;  2WPC A;  4K8D A;  4CCQ A;  3C96 A;  4EMI A;  2WPE A;  2H89 A;  1TDE A;  3DGZ A;  5U25 A;  4BK3 A;  1E6E A;  1L9E A;  4AOX A;  5IQ4 A;  4H2Q A;  3BI4 A;  4B65 A;  5KRQ A;  4U8N A;  1H6V A;  1JOA A;  5JCI A;  1B5Q A;  2YLX A;  1GET A;  1YQ3 A;  5IPY A;  4AOS A;  4X9N A;  4YSX A;  4YTM A;  4Y4L A;  2WPF A;  5HYM A;  3NK1 X;  3AEE A;  2PHH A;  3ICT A;  4Z2U A;  1F8W A;  4B68 A;  2VQB A;  4NZH A;  5EB5 A;  4KPR A;  2DKI A;  4IA6 A;  2NVK X;  3AEC A;  2YG7 A;  4EIP A;  2V3A A;  3QSE A;  5EBK A;  1PS9 A;  1RP0 A;  1PJ7 A;  3AWI A;  4H4U A;  2C67 A;  5TR3 A;  4IVO B;  3DGH A;  3NT6 A;  1H81 A;  3VRA A;  3BNU A;  4RSL A;  3E1T A;  3GD4 A;  2Z5Y A;  3S61 A;  4JY2 A;  3UTG A;  3AD8 B;  2BC1 A;  2ZZ0 A;  2APG A;  3NRN A;  1PXA A;  2V3B A;  4FK1 C;  4H4Q A;  1FCD A;  2Z5X A;  1VRQ B;  3KVE A;  1D7L A;  3GSI A;  3CIR A;  4GCM A;  3UTE A;  3QJ4 A;  1PDH A;  3NTD A;  1GRG A;  4H4Z A;  4A6N A;  1PJ5 A;  2B9X A;  1RYI A;  1KNR A;  3I6D A;  2R9Z A;  1XAN A;  4J34 A;  3RP6 A;  3UCL A;  2GR3 A;  4A79 A;  1CJC A;  4CY6 A;  3AYL A;  1NG3 A;  3P4S A;  1TRB A;  2XVI A;  1BF3 A;  2TMD A;  3UP4 A;  5LV9 A;  3L8K A;  2ACZ A;  2WOI A;  2YLS A;  2YVF A;  2X99 A;  1NG4 A;  4PAA A;  1D5T A;  1UKV G;  4OCG A;  1DJQ A;  4USQ A;  3IHM A;  3NN6 X;  2WDR A;  4GRT A;  4C5O A;  5L46 A;  3IC9 A;  4K7Z A;  5BUK A;  1GEU A;  4OPC A;  3QVR A;  4YKG A;  2VOU A;  1M64 A;  3ALJ A;  2BK3 A;  2W0H A;  2FJD A;  5CQF A;  1PBB A;  3AB1 A;  1E7P A;  2TPR A;  3GDN A;  3RP8 A;  2YG3 A;  1KNP A;  1AOG A;  3CPJ G;  5ER0 A;  4NEV A;  5DBJ A;  3V76 A;  3CPI G;  3ISH A;  4UDQ A;  3AD9 B;  4I59 A;  4J36 A;  2CUL A;  3L1R A;  3ZYX A;  2BYB A;  4U8I A;  4U8L A;  1Z6L A;  3NYF A;  2XLU A;  3D8X A;  2C75 A;  2X8C A;  3AEA A;  3B3R A;  5J7X A;  1TDK A;  1BZL A;  1GAL A;  3AE9 A;  4HB9 A;  1ELI A;  3GMB A;  3AYJ A;  4K5S A;  3GWD A;  2R0C A;  2PYX A;  4A65 A;  2WEU A;  4YTP A;  4OPG A;  4N9X A;  3FBS A;  3IWA A;  2A87 A;  1B37 A;  4CNJ A;  3COX A;  2OLO A;  1CC2 A;  4RG4 A;  1GOS A;  1ZOV A;  1KF6 A;  1IUT A;  3GDP A;  1TDN A;  4H4W A;  2XFO A;  2C66 A;  3NKS A;  4CBQ A;  4YSH A;  1JRX A;  1ZP0 A;  3AEG A;  2YM1 A;  2XVF A;  3PVC A;  3RED A;  4EM3 A;  4B69 A;  4JY3 A;  3G5R A;  4Y4M A;  1CBO A;  1BGN A;  2XLS A;  5GRT A;  3GMC A;  5U1O A;  3NK2 X;  4DNA A;  3LZW A;  4O5U A;  3GWF A;  1H7X A;  2WP6 A;  4GDP A;  3LZX A;  1JU2 A;  3BI2 A;  3QVP A;  2Q6U A;  2QAE A;  4J31 A;  4EQR A;  3BI5 A;  3DH9 A;  3NLC A;  1YQZ A;  4ZCC A;  1KSU A;  4APN A;  1EL5 A;  2YR5 A;  2DKH A;  2XDO A;  4GUV A;  3ALL A;  5EB4 A;  3RP7 A;  3OC4 A;  2O9Z A;  5HXI A;  1DOE A;  2XVH A;  3LAD A;  2YVG A;  3WE0 A;  1OJA A;  1YQ4 A;  4K2X A;  1CL0 A;  4XWZ A;  2JB2 A;  4AT0 A;  4YKF A;  5M0Z A;  2WQY A;  1W4X A;  1F8R A;  2YWL A;  2YR4 A;  2BCP A;  4TLZ A;  1QJD A;  1S2Q A;  4YTN A;  1Y0P A;  3OZ2 A;  3Q6J A;  3BNM A;  1DOD A;  3QFB A;  2FJB A;  4C3X A;  4GF7 A;  4ICY A;  3H8I A;  3LB8 A;  1JRY A;  3P4P A;  1IUU A;  1EL8 A;  3CGD A;  2Y6Q A;  3GYX A;  3V3O A;  3VQR A;  1E1L A;  1LTX R;  1KFY A;  3NG7 X;  1D4C A;  1S3B A;  1F6M A;  3VRB A;  1ZMC A;  3V3N A;  1K0J A;  1MOK A;  4H2R A;  1CC6 A;  1GRF A;  3QFA A;  2OLN A;  1ZOY A;  5EOW A;  4J56 A;  2WOV A;  1GRA A;  5GSN A;  4DSG A;  2Y6R A;  1CJ3 A;  4H50 A;  3UKQ A;  1MO9 A;  1E1M A;  1ZMD A;  3RNM A;  1GTE A;  1GV4 A;  4BJZ A;  1PBF A;  1P2E A;  4JN9 A;  2C64 A;  4C3Y A;  2Q7V A;  4REK A;  3UTH A;  2C70 A;  4GDE A;  5KXJ A;  3UKF A;  4A6N B;  4CNK A;  3G5S A;  1FEA A;  4OPU A;  2B9Y A;  4U8K A;  1NHP A;  4J2W A;  5FS6 A;  3PO7 A;  1M6I A;  3HZL A;  4UP3 A;  1COY A;  1MXT A;  1GES A;  3M12 A;  1CJ4 A;  4D04 A;  1ZK7 A;  2VQ7 A;  3LOV A;  3SFE A;  3GYI A;  3P4R A;  3CPH G;  4GR1 A;  4H4R A;  4NTE A;  3M0O A;  3CGB A;  2GRT A;  2YVJ A;  3CNJ A;  4U2S A;  1FEB A;  2RGO A;  1NPX A;  3NYE A;  1GRT A;  2GV8 A;  1FL2 A;  3F8P A;  3AE4 A;  1OJT A;  2BK4 A;  3AE7 A;  1FOH A;  2WBA A;  2JB3 A;  3ALM A;  2FJA A;  1H83 A;  3KPF A;  4H4P A;  5JCK A;  3EPT A;  2B7S A;  1GRE A;  3BHK A;  5FS8 A;  1IUV A;  2RGJ A;  3UTF A;  4EM4 A;  2WU2 A;  2WS3 A;  2VZ2 A;  4Z25 A;  1BWC A;  1KSS A;  1NHQ A;  3NN0 X;  2ARD A;  2CDU A;  4YSY A;  2C65 A;  4H7U A;  1REO A;  4C74 A;  2B7R A;  4BK1 A;  4ADW A;  1L9D A;  4BJY A;  2X50 A;  4LA1 A;  4YSZ A;  1B4V A;  4AP1 A;  3O0H A;  4X4J A;  4Z2T A;  2H88 A;  1D7Y A;  4OPT A;  2RGH A;  4DGK A;  1EL9 A;  4FX9 A;  1PBC A;  1D4E A;  1N4W A;  4ZCD A;  3DK8 A;  1XHC A;  5JCN A;  2C73 A;  4TLX A;  5KOX A;  4B66 A;  3C4A A;  4I58 A;  1H86 A;  1S2Y A;  5IQ1 A;  2XVE A;  3NTA A;  3T37 A;  3I3L A;  3EAN A;  5FS9 A;  2HQM A;  2V61 A;  3ATR A;  4H4Y A;  1F3P A;  4IA5 A;  3DME A;  4OPL A;  4U8P A;  1GXF A;  2IVE A;  2EQ9 A;  4FDC B;  4YXD A;  1F8S A;  1HYU A;  3P9U A;  4OPI A;  3FMW A;  4H2P A;  3AE8 A;  4TM1 A;  1XPQ A;  2E4G A;  3DJD A;  5C2T A;  2ZZC A;  4JDR A;  3K7M X;  4P9S A;  2VVL G;  2OA1 A;  1K0I A;  2GEW A;  4TM3 A;  2GR0 A;  1NDA A;  4U8O A;  1GRH A;  3CND A;  4B1B A;  1O94 A;  1ZDL A;  2OAM A;  3CGC A;  2YQU A;  3RHA A;  4RG3 A;  3QSM A;  2GAH B;  3EF6 A;  2JAE A;  4H4X A;  2V5Z A;  2I0Z A;  3AE1 A;  3JSK A;  3SFD A;  2GB0 A;  2XFP A;  2QA2 A;  3DJE A;  3UKA A;  4AT2 A;  4LU6 A;  3UOY A;  2GMJ A;  3CTY A;  3F8D A;  5C3J A;  3NNE A;  2A89 A;  5BVA A;  3AE5 A;  4TM0 A;  2BAC A;  3AYI A;  4EQX A;  4U8J A;  1EBD A;  1IUS A;  3DK9 A;  5M10 A;  1VG9 A;  3P4Q A;  3UKL A;  2XFN A;  4OVI A;  3PS9 A;  1H7W A;  2C3C A;  2WOW A;  3ZDN A;  4E0V A;  2AAQ A;  4CY8 A;  2R46 A;  2WP5 A;  4EQS A;  1EL7 A;  1BKW A;  4BK2 A;  1TYT A;  1TYP A;  2YR6 A;  4B64 A;  1K0L A;  1D4D A;  4A5L A;  4X9M A;  4Z43 A;  1B8S A;  2E1M A;  3DJG X;  2BS4 A;  2VRL A;  3AED A;  2AQJ A;  3CNT A;  4ECH A;  2X8H A;  5J60 A;  1SEZ A;  4Z44 A;  2GVC A;  1O95 A;  2JK6 A;  4YT0 A;  1Y56 A;  2B9W A;  1IUW A;  3UP5 A;  1L9C A;  1GRB A;  4K5R A;  1X31 B;  2R0P A;  3NIX A;  4NEW A;  5KVH A;  1XDI A;  4JNA A;  1CJ2 A;  1Q9I A;  4H2N A;  1YKJ A;  2WDQ A;  2WET A;  1LV0 A;  2J3N A;  3IF9 A;  2V60 A;  2XLP A;  1LQU A;  4Z26 A;  5JCM A;  4IVM B;  4BV6 A;  1N4V A;  1GTH A;  2YM2 A;  4JNQ A;  2ZZB A;  4J33 A;  3ITJ A;  2X8G A;  2YLT A;  2GH5 A;  2C76 A;  3SQP A;  2BXS A;  3Q9T A;  1DJN A;  3FIM B;  1E1N A;  4EMJ A;  3ABV A;  4B63 A;  4PAB A;  4A99 A;  2X3N A;  5KWF A;  1L0V A;  1CC4 A;  1O5W A;  2GQF A;  3DA1 A;  5KOW A;  1JRZ A;  2BK5 A;  3D1C A;  2WES A;  4Y4N A;  1V59 A;  3KU9 A;  4YWO A;  2WP9 A;  5U63 A;  3GRT A;  2EQ8 A;  2WDV A;  1TDO A;  4NTC A;  1PJ6 A;  4HA6 A;  1DXL A;  4IV9 A;  3ADA B;  3VR8 A;  4WCT A;  1P2H A;  3GYJ A;  2A8X A;  1LVL A;  1NEN A;  1PN0 A;  1OJC A;  1PHH A;  2JBV A;  5FMH A;  3R9U A;  1K4Q A;  3VRD B;  3NGC X;  1NAA A;  3K7Q X;  1OJD A;  4NTD A;  2CVJ A;  3UOV A;  2ZBW A;  1RSG A;  3CNS A;  3H8L A;  4UDR A;  1E39 A;  3IHG A;  4H4S A;  4M52 A;  2GMH A;  2EQ6 A;  2Q0K A;  2BS3 A;  1DNC A;  1IJH A;  4TM4 A;  1BGJ A;  1QO8 A;  4Z2R A;  2UZZ A;  3GD3 A;  3LJP A;  5HHF A;  4XXG A;  4EMW A;  4U2T A;  3B6D A;  2B76 A;  3F8R A;  3AEF A;  4WX1 A;  1JEH A;  2VRM A;  3NK0 X;  2LFC A;  1Q1W A;  2C7G A;  2XYO A;  2YLZ A;  4J57 A;  5KVI A;  3SGL A;  1KDG A;  5CKU A;  2C3D A;  3K7T A;  2E5V A;  2BC0 A;  3BHF A;  3G5Q A;  4JQ9 A;  3M13 A;  2JB1 A;  4ZN0 A;  2WU5 A;  3AEB A;  3NYC A;  2JKC A;  2YG6 A;  2R4E A;  3DJJ A;  4USR A;  2CFY A;  3S5W A;  2R0G A;  1H82 A;  2YG4 A;  3AE2 A;  2NPX A;  2BA9 A;  2GR1 A;  2RAB A;  3SM8 A;  3UKK A;  3VR9 A;  2XFU A;  4H4V A;  3AE6 A;  2QCU A;  1ZX9 A;  4BUR A;  4K22 A;  2V6O A;  4EQW A;  4KX6 A;  1VDC A;  5BUL A;  3AE3 A;  4C77 A;  2C72 A;  5JCL A;  1ONF A;  2YG5 A;  4MJW A;  1CF3 A;  3FG2 P;  4A9W A;  3QSS A;  1IUX A;  1PBD A;  1PXC A;  3LXD A;  3UOX A;  2GF3 A;  3KD9 A;  2FBW A;  1ZY8 A;  3CNP A;  3KA7 A;  1H84 A;  2AR8 A;  1GND A;  4Z24 A;  4CRT A;  1E1K A;  3UKP A;  2BS2 A;  2IID A;  2EQ7 A;  1YY5 A;  1GT8 A;  2Q0L A;  2OAL A;  2BCG G;  2XLR A;  3UOZ A;  5BRT A;  3URH A;  1FEC A;  2R45 A;  2XVJ A;  4H4T A;  1N4U A;  1VQW A;  1OJ9 A;  2GQW A;  2VVL A;  4U2L A;  1LPF A;  4UDP A;  1Y56 B;  5FS7 A;  1GER A;  1N1P A; 
#chains in the Genus database with same CATH topology
 3T1Y T;  3ZJ2 A;  3MK7 C;  1LJ1 A;  1S3E A;  2A9U A;  4LML A;  1HR0 T;  3AD7 B;  3EVY A;  1NHS A;  3A7M A;  5EZY E;  1KNZ A;  3H4K A;  3ICS A;  2YLR A;  5HY5 A;  1FMV A;  4DUZ T;  4OPD A;  4LII A;  1LQT A;  2W61 A;  4AP3 A;  5HWX A;  4B67 A;  3RYC E;  2CLY B;  2YAU A;  4JI1 T;  3KKJ A;  2XLT A;  5L47 A;  4FK1 A;  2PG8 A;  2XUE A;  2EHO B;  5JRE A;  2BAB A;  4D03 A;  3N9L A;  4XWR A;  4A98 A;  2VQF T;  3SZ0 A;  3C96 A;  4TV9 E;  4ZI2 C;  1TDE A;  4AOX A;  1SA0 E;  5IPY A;  3AA6 B;  2WPF A;  3NK1 X;  3AEE A;  4Z2U A;  2H7V C;  1F8W A;  5LJM A;  5EB5 A;  3VKG A;  2YG7 A;  1Y01 A;  1PS9 A;  1RP0 A;  1PJ7 A;  5TR3 A;  4C91 A;  5FVK A;  3VRA A;  4RSL A;  2D0T A;  3JC6 D;  5DQW A;  1PXA A;  4PFO A;  3GMI A;  1D7L A;  3GSI A;  1T7S A;  3UTE A;  4H63 V;  2V26 A;  5LNK A;  4II2 A;  4A6N A;  5L3F B;  1PJ5 A;  2CXF A;  5LMN T;  2F4V T;  2B9X A;  3I6D A;  4A79 A;  5M10 A;  5ETW A;  1CJC A;  2ZMA A;  2WZI A;  3AYL A;  4UEM A;  4JYA T;  2L3L A;  4CY6 A;  1BF3 A;  5LV9 A;  4UV8 B;  4HTE A;  5AQG B;  4JI2 T;  1NG4 A;  4IDO A;  2X9H A;  3RRC A;  2VQE T;  3RYF E;  4K7Z A;  5L46 A;  1GEU A;  3CQG B;  5J0Z A;  3JC6 C;  3NRY A;  2W66 A;  2W0H A;  3AB1 A;  3CPJ G;  5ER0 A;  4IDN A;  2V5D A;  2XQY A;  2BYB A;  4U8L A;  5H6R B;  1T98 A;  3D8X A;  5CGM A;  5J7X A;  2XAJ B;  2W63 A;  1BZL A;  4K5S A;  2X9W A;  5AQU B;  1LRZ A;  2VL8 A;  2PYX A;  2R0C A;  5AQV B;  1G8X A;  3E22 E;  2QGS A;  1B37 A;  4CNJ A;  1US7 B;  4CXX A;  4ILA A;  1GOS A;  2I59 A;  3N9M A;  5CJ5 A;  2WMN A;  2YK0 A;  4QXC B;  2MBG A;  5JH7 E;  5JDF A;  1JRX A;  3OJA A;  3ANW B;  2L8K A;  3O1H A;  2XVF A;  4B69 A;  4PW8 A;  4Y4M A;  4IE7 A;  3PUY F;  2VL0 A;  3NK2 X;  1UGO A;  4DNA A;  2WWV A;  4V1A v;  3RQW A;  4XZC A;  1WCR A;  4O2B E;  3ZMV B;  3ALL A;  3OC4 A;  3I1A A;  5CA1 E;  5ABF B;  3PU3 A;  3KFW X;  3UT5 E;  5M0Z A;  2WQY A;  1W4X A;  4CQI A;  4TLZ A;  1QJD A;  3NZP A;  1S2Q A;  3PUR A;  3NWI A;  2ODU A;  2IIU A;  5HEH A;  1D1A A;  3NG7 X;  4FJO A;  1MOK A;  3PV0 F;  2XM2 A;  1ZOY A;  5EOW A;  4J56 A;  3AAA B;  1CJ3 A;  4UVB B;  5AQI B;  2C0S A;  1E1M A;  1ZMD A;  4BJZ A;  5FY1 A;  1QUU A;  1WYB A;  3UQ4 A;  5L3E B;  3AVR A;  5AQF B;  3SZF A;  1B7T A;  2P9B A;  4JV5 T;  4LF7 T;  2C70 A;  4GDE A;  3UKF A;  4A6N B;  1NAF A;  4QX7 B;  4J2W A;  3HZL A;  1MXT A;  1GES A;  2LEH A;  3S4U A;  4NTE A;  4IE5 A;  3ZPO A;  3VHL A;  4IRE A;  4AIU A;  4PK4 A;  3AE4 A;  3ALM A;  5LGU B;  3S61 A;  4H4P A;  2JB3 A;  4X62 T;  1H83 A;  3KVA A;  4JI3 T;  3EPT A;  2E9X B;  2VZ2 A;  2JRK A;  2WBL A;  4CI3 B;  4C74 A;  5LB7 B;  4BK1 A;  3EAM A;  4KP3 C;  1L9D A;  4LA1 A;  2C5J A;  3L3P A;  4HFB A;  4YSZ A;  3IA3 A;  2X67 A;  1FMW A;  3CWZ B;  3O0H A;  4X4J A;  2H88 A;  2K48 A;  2LT3 A;  4G63 A;  4HFD A;  1D0Z A;  2XM1 A;  2J47 A;  2DLR A;  4GAP A;  2JPF A;  1S2Y A;  5A1L A;  5EK2 A;  5IQ1 A;  4HWH A;  4EEB A;  1YXR A;  5FS9 A;  4H4Y A;  4IA5 A;  1ZKE A;  2IVE A;  5KMG P;  1D1B A;  5F3J A;  5ABG A;  2LRK A;  1F8S A;  4L0R A;  2HHH T;  2X68 A;  2YIN A;  1XPQ A;  4P09 A;  2BVL A;  2ZZC A;  2VVL G;  1K0I A;  2V6Y A;  4U8O A;  2I0M A;  4PJM A;  1GRH A;  4B1B A;  1HTJ F;  1XWM A;  3AA7 B;  3I0Q A;  3EF6 A;  3LJC A;  2I0Z A;  2D9D A;  3SFD A;  4ZS3 A;  2QA2 A;  2XFP A;  3TLS A;  2CBI A;  2RP4 A;  2BAC A;  4IL9 A;  4DID B;  2CBJ A;  4ZEY A;  4EQX A;  3M3Z B;  1XDO A;  3QK6 A;  2C3C A;  2WOW A;  3HKE E;  2JJ9 A;  2R46 A;  1T72 A;  4BK2 A;  1BKW A;  2AE9 A;  3ZYL A;  1TYP A;  4B64 A;  2BG9 C;  1D4D A;  3ZC1 A;  2E1M A;  3AED A;  4ECH A;  2X8H A;  2W0G A;  2CM0 A;  5J60 A;  1SEZ A;  4AI6 A;  3UP5 A;  5AQH B;  3HL6 A;  4B3S T;  2E2A A;  4ZS2 A;  3N2G E;  5KVH A;  2W67 A;  4JNA A;  1CJ2 A;  3RIA A;  2WDQ A;  1LV0 A;  3T2K A;  1QSD A;  5LBQ B;  4O8S A;  4BJM A;  3ZC0 A;  1N4V A;  2NTY A;  4J33 A;  2PBI A;  4I0U A;  2BVM A;  2C76 A;  2MTQ A;  3Q9T A;  1E1N A;  4EMJ A;  3ABV A;  4B63 A;  2BRA A;  2X3N A;  3Q2M A;  3DA1 A;  4OYK A;  5KOW A;  2CWO A;  2WES A;  3MKD A;  5LHI B;  2YDS A;  4F8H A;  4NTC A;  3ADA B;  2A8X A;  3PUG A;  1LVL A;  1NEN A;  3R9U A;  5FMH A;  1K4Q A;  4DMV A;  1UX4 A;  3PUW F;  4ERR A;  4HFV A;  3UOV A;  3H8L A;  3CNS A;  4UDR A;  1E39 A;  1VCT A;  3IHG A;  2BS3 A;  1IJH A;  4TM4 A;  3HI2 A;  5EK4 A;  4UVA B;  4QHO A;  3B6D A;  3AEF A;  4DR7 T;  5JDM A;  1JEH A;  2YKS A;  3NK0 X;  3T31 A;  4J57 A;  4B3R T;  2ODV A;  3QNU A;  2UXC T;  2ZLY A;  3VKH A;  3G5Q A;  2WU5 A;  3DJJ A;  3H37 A;  3N2K E;  1IBK T;  2DL1 A;  3L09 A;  1H82 A;  2NPX A;  4ADZ A;  1XDP A;  5M4Y A;  2XFU A;  2QCU A;  2W4X A;  1ZX9 A;  2XQ5 A;  4L9I A;  1WLX A;  2J62 A;  5LG4 A;  4KX6 A;  4XAX B;  4C77 A;  2C72 A;  3CX7 B;  4WZX A;  1CF3 A;  4QH4 A;  2CXL A;  5AQT B;  3KD9 A;  5HXE A;  3OBV E;  3N9O A;  3KA7 A;  3LK4 2;  4Z24 A;  3UKP A;  3T8O A;  3T1H T;  1IAP A;  2EQ7 A;  1BR1 A;  4A5X A;  1GT8 A;  2WMO A;  2OAL A;  4NUV A;  4ILU A;  3UOZ A;  3CPZ A;  3UFG A;  3RGL A;  1OJ9 A;  2VVL A;  5FS7 A;  3OYX A;  1SHZ C;  3CGE A;  2VVM A;  3FPZ A;  4DSH A;  3PUQ A;  5LP6 E;  2F5Z A;  2LSG A;  2LSI A;  4DV6 T;  4EIQ A;  2YLW A;  2KWI B;  5BMV E;  2VUR A;  2IW5 B;  2MAW A;  3F31 A;  3ONX A;  1Q1R A;  1VG0 A;  3ATQ A;  4I55 E;  4H9R C;  2XFQ A;  2VKO A;  2QA1 A;  4K0K T;  3K3N A;  3FZK B;  3KBT A;  3P8C D;  3FHN A;  3GRS A;  3AXB A;  2FJE A;  2GAG B;  2GR2 A;  3C4W A;  3BQI A;  1GQE A;  3DK4 A;  3U3I A;  3AXJ A;  2M6B A;  2ZM8 A;  2XSB A;  3CN8 A;  4HKA A;  4B6X A;  4DR4 T;  4WBN E;  2WPE A;  1E6E A;  1L9E A;  2XHE B;  2XTL A;  3KBU A;  1H6V A;  1YQ3 A;  4AOS A;  4X9N A;  4YSX A;  3ONL C;  4YTM A;  2X0Y A;  3N9N A;  3SRZ A;  2VQB A;  4KPR A;  2YDQ A;  4IA6 A;  2VAS A;  2DWK A;  2NVK X;  4EIP A;  3QSE A;  3LSV A;  4IDQ A;  3AWI A;  2C67 A;  2N1G A;  1D0X A;  2Y6X A;  4IVO B;  2MYS A;  3E1T A;  3GD4 A;  3AD8 B;  4OFZ A;  2V3B A;  1FCD A;  2MOZ A;  3TLU A;  4AKR B;  4DVD A;  2LJL A;  5HWY A;  3QJ4 A;  4HWC A;  4NUU A;  3RIU A;  1GRG A;  4NNJ A;  1RYI A;  2BRY A;  3UCL A;  2XY8 B;  3I9Y A;  1NG3 A;  2XVI A;  3JAE A;  3UP4 A;  3CQX C;  3L8K A;  2ACZ A;  1FIO A;  4X66 T;  2Q9Q C;  4X64 T;  3IC9 A;  2OLT A;  5BUK A;  3QVR A;  4YKG A;  3PTR B;  4QH1 A;  2N2N A;  3EDV A;  1PBB A;  2ZM6 T;  2XAG B;  2X9Y A;  2YG3 A;  4YHH T;  4CXW A;  3ZN1 B;  4QXH B;  4YLH A;  3CPI G;  4UDQ A;  4DMW A;  4NIQ A;  2KT9 A;  3AVS A;  2LOS A;  3DJB A;  3B3R A;  4AQF C;  1TDK A;  2CHN A;  5JR9 B;  2DHR A;  2W00 A;  5E0O A;  1GAL A;  1UUR A;  3AE9 A;  4HB9 A;  4P0A A;  4MLK A;  3AYJ A;  2VK9 A;  4AXP A;  4JI6 T;  4AQY T;  5LGN B;  4N9X A;  2VVN A;  3IWA A;  1OWA A;  4FI5 A;  1CC2 A;  2OLO A;  2KMF A;  2X9X A;  1IUT A;  1TDN A;  2KLQ A;  4H4W A;  4PK6 A;  5ABE A;  4CBQ A;  4YSH A;  2HN2 A;  4CI1 B;  3RED A;  4ZI2 D;  1D0Y A;  4GYR A;  1CBO A;  3HKC E;  1BGN A;  5U1O A;  3GMC A;  3LZW A;  2XAF B;  3GWF A;  3CML A;  1OED C;  5HCJ A;  3Q5E A;  4ZZB A;  2QAE A;  3QVP A;  4J31 A;  5LA6 E;  4UIG A;  3WI3 A;  2YR5 A;  2DKH A;  3HKD E;  2XDO A;  3RP7 A;  1DOE A;  2XVH A;  2V7K A;  5L2L A;  4K2X A;  3HA4 A;  2JB2 A;  1HFA A;  3A8Y C;  4UR9 A;  4CN4 A;  5FP3 A;  3O4X E;  4YTN A;  4LF6 T;  3PU8 A;  3BNM A;  3Q6J A;  3UU8 A;  2JMK A;  1AJ3 A;  3MAC A;  3LB8 A;  1JRY A;  1J1J A;  2LSY A;  4NXM T;  2PJQ A;  1E1L A;  3FZH B;  1LTX R;  4JI4 T;  1ZMC A;  3GN5 A;  5LG3 A;  3ONJ A;  1UUS A;  3V3N A;  3EHZ A;  2OLN A;  5GSN A;  3KPK A;  3VU7 H;  1MO9 A;  1GTE A;  3T14 A;  3ZT6 A;  3JAD A;  3FZF B;  4REK A;  1ZV4 X;  3LFM A;  1MIV A;  2B9Y A;  3UUX B;  1NHP A;  5FS6 A;  1MMG A;  2UXX B;  4KBM B;  1M6I A;  3PUX F;  5HAX A;  3PUS A;  3SFE A;  3P4R A;  3CPH G;  4H4R A;  3M0O A;  3CGB A;  2GRT A;  3T0K A;  3CNJ A;  2EHO D;  3NRX A;  2CWY A;  2J4G A;  2IHR 1;  4IT4 A;  2B7S A;  2WCA A;  4K0U A;  5FS8 A;  2RGJ A;  2NP9 A;  2X51 A;  4Z25 A;  1BWC A;  3KVB A;  4U72 A;  1UCU A;  4H7U A;  2C65 A;  4O4I E;  4HFC A;  4NPP A;  5LHH B;  2Y8D A;  4H63 H;  5L4H A;  4Z2T A;  4PJN A;  4TNW A;  4DGK A;  2CLY C;  5AFU L;  2XZE A;  1N4W A;  4ZCD A;  5JCN A;  2C73 A;  4TLX A;  4GAV A;  2EHO C;  4YHJ A;  1R8I A;  4I58 A;  2WY2 A;  2WB5 A;  1O3X A;  5KX5 E;  3I3L A;  3ZMU B;  2NR4 A;  4U8P A;  5KMQ A;  1D1C A;  4OPL A;  4FDC B;  3P9U A;  4OPI A;  3FMW A;  4DV5 T;  4IHJ E;  2M67 A;  2BG9 A;  2A72 A;  1M62 A;  4PJL A;  1VOM A;  3PUA A;  4JDR A;  5H6Q B;  5AQL B;  1NDA A;  1O94 A;  2OAM A;  3QSM A;  3DP7 A;  3ETV A;  2V8S V;  3JSK A;  4IDZ A;  4JLE A;  1W09 A;  2GB0 A;  4AT2 A;  3IEE A;  2GMJ A;  4ZXL A;  2A89 A;  3ZT5 A;  4TWF A;  2KIN B;  5BVA A;  4TM0 A;  2D5U A;  3AYI A;  4U8J A;  2CXD A;  4EGW A;  3KV6 A;  3ZMZ B;  1FJG T;  3UKL A;  2V7L A;  2NTX A;  3ZDN A;  2AAQ A;  4MBQ A;  4TUY E;  1TYT A;  2YR6 A;  5FMN A;  1K0L A;  3C98 B;  4X9M A;  4Z43 A;  2BS4 A;  5DJQ C;  1DU2 A;  4IE0 A;  5JDL A;  3QB5 A;  4TX5 A;  4Z44 A;  4EAH A;  2GVC A;  2JK6 A;  1IUW A;  5LXT E;  5HXC A;  2R6G F;  4Z90 A;  1MNE A;  1GRB A;  1X31 B;  3NIX A;  1BR2 A;  4E7Z A;  3A5X A;  5AQM B;  4PJJ A;  4IVM B;  4GKJ T;  4BV6 A;  4ILB A;  2YM2 A;  5AQS B;  1UX5 A;  4JNQ A;  2ZZB A;  4ZI7 E;  2IC6 A;  4IGU A;  1DJN A;  3FIM B;  4G6G A;  5DQV A;  4PAB A;  1L0V A;  1O5W A;  2LHN A;  2BK5 A;  4AQG A;  4Y4N A;  3F57 A;  3KU9 A;  4YWO A;  5U63 A;  1BR0 A;  5LMU T;  3AAI A;  1XMO T;  4KHZ F;  1UK5 A;  4DV4 T;  1PJ6 A;  4HA6 A;  2IC9 A;  1DXL A;  4IV9 A;  3V5U A;  3GYJ A;  4AKH A;  3O9X A;  2MPK A;  4ZI3 C;  1OJC A;  4I50 E;  3RKO A;  2DWG A;  3ZCJ A;  3LK2 B;  3PJA J;  3ZKR A;  4AKL A;  4LFC T;  3RI5 A;  2ZBW A;  3K8P C;  4H4S A;  2AXD S;  4M52 A;  4OHF A;  2EQ6 A;  4LF4 T;  3CQC B;  1QO8 A;  4Z2R A;  3H3M A;  2CMR A;  4U2T A;  2XQ7 A;  3IBP A;  3WAK A;  3F8R A;  3B13 A;  2LFC A;  3SGL A;  2XYO A;  5KVI A;  2LM2 A;  1KDG A;  4GK0 E;  1E1H B;  2E5V A;  3BHF A;  4JQ9 A;  5JVD E;  3M13 A;  3UU6 A;  4USR A;  3GWH A;  2CFY A;  4X1Y E;  4AKG A;  2R0G A;  3UKK A;  4DV2 T;  5CFB A;  3AE3 A;  5JCL A;  1ONF A;  3TLV A;  1PBD A;  2GF3 A;  4Q25 A;  3IF8 B;  2FBW A;  1ZY8 A;  3CNP A;  5JDN A;  1H84 A;  2AR8 A;  2X0L B;  3EI0 A;  2RA1 A;  3LBX A;  1YY5 A;  4YJ2 E;  3KV5 A;  2XVJ A;  2NW9 A;  1VQW A;  2GQW A;  2DNX A;  3HYX A;  1LVK A;  1N1P A;  1PBE A;  2E9X C;  1DOB A;  2K3W A;  4WBO A;  1DOC A;  2ACX A;  3K30 A;  3OKQ A;  2BXR A;  4I4T E;  5FL0 A;  3OVU A;  3Q5W A;  5AQR B;  4DUY T;  3UKH A;  2JQQ A;  2G0U A;  4M1P A;  4P1N A;  2R4J A;  4KUM B;  3NHO X;  1NEK A;  1HS7 A;  4QX8 B;  3SOL A;  1OXZ A;  4OK0 A;  5DAB A;  5JDG A;  2WHD A;  4F6R C;  1N36 T;  1JNZ A;  1NHR A;  3NH3 X;  4YY3 T;  3P1W A;  4JUY A;  2H7O A;  2UUA T;  4CCQ A;  2H89 A;  4BK3 A;  4U33 A;  5IQ4 A;  4B65 A;  4U8N A;  4X1K E;  2XQ4 A;  1GET A;  2YLX A;  2WM9 A;  1IJ5 A;  3TKL B;  1N32 T;  2PHH A;  5LGT B;  2HPJ A;  3ICT A;  4DR3 T;  4B68 A;  5GON E;  4NXN T;  2Q9Q A;  2JQK A;  2V3A A;  2CE7 A;  5C8Y E;  3DGH A;  3P4W A;  3PE0 A;  1HG2 A;  3BNU A;  3ZCI A;  2Z5Y A;  2ZZ0 A;  1HG5 A;  2APG A;  4IE4 A;  2Z5X A;  4TWD A;  4ANJ A;  3CIR A;  4TV8 E;  2D2S A;  4BA9 A;  2J1D G;  3OPC A;  4EZ4 A;  3RYI E;  4DBQ A;  4J2C A;  2YDR A;  5KMS A;  4AQF A;  4B3M T;  4J34 A;  1KNR A;  3RP6 A;  2R9Z A;  2NWB A;  4OYJ A;  3RC3 A;  3P4S A;  1WR0 A;  1TRB A;  3UFE A;  2WOI A;  2YLS A;  2YVF A;  5LOV E;  1IJ6 A;  4PAA A;  4C5O A;  4OCG A;  3IHM A;  2BZB A;  5L4E A;  2V6Y B;  2VOU A;  1M64 A;  3O1I A;  3C51 A;  2BK3 A;  5CQF A;  1E7P A;  2TPR A;  3RP8 A;  2KND A;  1AOG A;  3V76 A;  5DBJ A;  1I94 T;  1WYC A;  4CXY A;  3LBX B;  3AD9 B;  3C4X A;  4JEH B;  3Q9D A;  4J36 A;  4U8I A;  3NYF A;  4AIS A;  2C75 A;  2X8C A;  1OED A;  1G73 A;  3LK3 B;  3PJA A;  3GWD A;  4A65 A;  5KNL A;  3L8R A;  4OPG A;  5J1G A;  1Y64 B;  3K3O A;  3COX A;  4RG4 A;  3QOF A;  3D0T A;  1ZOV A;  3UUL A;  2UXN B;  2BKP A;  3RPU A;  2XFO A;  2C66 A;  4XBF B;  3NBX X;  4G6H A;  5JRC A;  4IDP A;  1ZP0 A;  3AEG A;  5HEU A;  3E08 A;  2YM1 A;  4IL4 A;  2UXD T;  3PVC A;  1MND A;  2XAQ B;  3SYI A;  3L39 A;  4GOU A;  1T8B A;  4ZOL E;  2XLS A;  5GRT A;  3PUV F;  1KK7 A;  4IIJ E;  1LVF A;  3IHR A;  1H7X A;  2WP6 A;  4GDP A;  2K9A A;  5FNV E;  4EQR A;  2W2U A;  2XPK A;  3ZYM A;  5JTG A;  3BI5 A;  1YQZ A;  4APN A;  5FVL A;  3RH3 A;  2UU9 T;  1EL5 A;  2QVA A;  4GUV A;  2V7I A;  2VVS A;  5HXI A;  2LSJ A;  2YVG A;  1LKX A;  1MIW A;  4XWZ A;  4HWI B;  3RIF A;  4YKF A;  1F8R A;  2YR4 A;  2BCP A;  1S94 A;  3N9P A;  3OZ2 A;  3ZMT B;  4ICY A;  4HE8 A;  2LRL A;  1IUU A;  1EL8 A;  2Y6Q A;  3GYX A;  3V3O A;  1KFY A;  4HGA A;  1S3B A;  2BBH A;  3VRB A;  3QUJ A;  2OA5 A;  2LKH A;  1N33 T;  1J5W A;  1GRF A;  1K0J A;  3ZLI A;  2W62 A;  4DSG A;  4EYU A;  4HWD A;  2VKH A;  2BBJ A;  2CHO A;  2Q9Q D;  1GV4 A;  1PBF A;  1P2E A;  2M6I A;  2C64 A;  4UF0 A;  2YOE A;  4C3Y A;  2Q7V A;  3BK9 A;  3UTH A;  4CNK A;  5KXJ A;  4OPU A;  5AQQ B;  4LF5 T;  4U8K A;  5HYA A;  4U7I A;  3FXE B;  3PO7 A;  3SY4 A;  4UP3 A;  3TLT A;  3CX8 B;  3M12 A;  1CJ4 A;  2LOP A;  2IML A;  4KHP T;  1ZK7 A;  3GYI A;  5HXR A;  2BKN A;  2EHO A;  1HNW T;  2YVJ A;  4U2S A;  1NPX A;  3NYE A;  4ILC A;  4ISS A;  2GV8 A;  4L5G A;  2BK4 A;  2WBA A;  3KPF A;  2NW8 A;  2FJA A;  5JCK A;  2ZM0 A;  1GRE A;  3BHK A;  3UTF A;  4EM4 A;  3GA8 A;  3FBL A;  5AQN B;  3KV9 A;  3NVO A;  2ARD A;  3G06 A;  2CDU A;  2XAH B;  2Z6E A;  4YFS A;  2QA7 A;  4ADW A;  4BJY A;  4GIW A;  2X50 A;  5HEG A;  3PDY A;  1B4V A;  1W0A A;  2RGH A;  1EL9 A;  3J7Y q;  5EK3 A;  5KOX A;  5L3G B;  2RPA A;  3ZYK A;  3C4A A;  2QRX A;  3R84 B;  2CA5 A;  1H86 A;  1FEW A;  4PAG A;  3EAN A;  2LSK A;  2HQM A;  5JRC B;  2V61 A;  4DO0 A;  1F3P A;  1N34 T;  5HXS A;  1MIY A;  4U7Y A;  1GXF A;  1YD8 G;  2EQ9 A;  1W0B A;  1HYU A;  3ZEF B;  5IUX A;  4TM1 A;  3AE8 A;  3FB2 A;  1XNQ T;  2V5C A;  3FBZ A;  4P9S A;  5C2T A;  3K7M X;  2BG9 E;  4TM3 A;  3AAE B;  4B3T T;  3R6N A;  3CND A;  1ZDL A;  3CGC A;  3RHA A;  2GAH B;  3AA1 B;  2JAE A;  4H4X A;  2V5Z A;  5LHG B;  5FXW A;  4LU6 A;  3BQK A;  2D0U A;  3CTY A;  3F8D A;  5C3J A;  3NNE A;  3AXJ B;  3ZT7 A;  5FY7 A;  5ABH A;  3DK9 A;  3UUN A;  2HPL A;  4OVI A;  4NWZ A;  1H7W A;  3KDS E;  1EL7 A;  4MFR A;  4C90 A;  4GK5 E;  4PFP A;  1KEY A;  1B8S A;  3DJG X;  2PFV A;  5TAO A;  2VRL A;  3CNT A;  2AQJ A;  4YT0 A;  2B9W A;  4UF0 B;  1WRD A;  4ZHQ E;  2V7M A;  3ANW A;  3EAB A;  4K5R A;  2R0P A;  1XDI A;  1Q9I A;  2DCF A;  3N5L A;  4MAL A;  3JAF A;  3IF9 A;  2V60 A;  1SUM B;  4LFB T;  5JR9 C;  3RKG A;  4TN7 B;  1GTH A;  3ETU A;  2BDE A;  3FZL B;  2X8G A;  2YLT A;  5FKY A;  3SQP A;  1Z0P A;  1Z8U A;  4A99 A;  5ABF A;  1CC4 A;  1S35 A;  3D1C A;  5AQK B;  2EQ8 A;  2WDV A;  4E7S A;  5JDH A;  3HKB E;  2JMH A;  4UVC B;  5BR8 T;  4DV1 T;  3VR8 A;  4WW0 A;  4WCT A;  4DV3 T;  2I6H A;  1PHH A;  2JBV A;  4EV6 A;  3NGC X;  2X0H A;  2UUC T;  4IE6 A;  3K7Q X;  4HEA A;  4NTD A;  2CVJ A;  3RF1 A;  4HN9 A;  1DNC A;  1BGJ A;  3GD3 A;  3LJP A;  2XQ3 A;  5HHF A;  4EMW A;  3C4Z A;  5AQP B;  4DND A;  5HXH A;  5L3C B;  4KMC A;  2VRM A;  3CK6 A;  1Q1W A;  2C7G A;  4YJ3 E;  1XMQ T;  2C3D A;  3CMM A;  2BC0 A;  2K5B B;  3ZSS A;  3NYC A;  5IYZ E;  2R4E A;  4COF A;  3N9Q A;  2YG4 A;  2A3D A;  3AE2 A;  2RAB A;  3VR9 A;  1VRB A;  4H4V A;  5LJN A;  2VWA A;  2E9X A;  3M65 A;  3N2O A;  3KV4 A;  2V6O A;  4K22 A;  4EQW A;  4CN1 A;  5BUL A;  2A2F X;  3RIU C;  3HYV A;  3FG2 P;  5FXZ A;  1PXC A;  3LXD A;  2GK9 A;  1IBM T;  4DR5 T;  4CRT A;  1XZY A;  4WNK A;  3HYW A;  4LF8 T;  4PK5 A;  2Q0L A;  2YU2 A;  1IBL T;  3URH A;  5F5W A;  1X9B A;  2R45 A;  1N4U A;  4HFI A;  3WAJ A;  4U2L A;  1LPF A;  2VB6 A;  2CRB A;  5U25 A;  1GSN A;  1TDF A;  1U5P A;  4U8M A;  2CPT A;  4H9O C;  3NKZ A;  3GN5 B;  3II4 A;  1PXB A;  4CCR A;  4EED A;  2IVD A;  2XCG A;  3UU3 A;  3ICR A;  4DR6 T;  3V5S A;  4X5T A;  4JI0 T;  3I9W A;  1CHU A;  2JQH A;  3C4N A;  4O5Q A;  3EAO A;  1EZ3 A;  1GPE A;  5LYJ E;  4ZI3 D;  2XQ6 A;  4G73 A;  1JNR A;  3RRW A;  4CZZ B;  2ZM2 A;  1QLB A;  4QKN A;  4A97 A;  4A7A A;  4TWH A;  4U31 A;  2LHR A;  1ZKQ A;  3MXZ A;  4X65 T;  3KLJ A;  2WPC A;  4K8D A;  4EMI A;  3DGZ A;  1I6Z A;  3BI4 A;  4H2Q A;  5KRQ A;  5JCI A;  2WWU A;  1JOA A;  1B5Q A;  4Y4L A;  2SPC A;  5HYM A;  2FUP A;  4N78 D;  4P0B A;  4NZH A;  2DKI A;  3AEC A;  4H9Q C;  2N9D A;  5EBK A;  4JI5 T;  4H4U A;  2LLY A;  3BQL A;  1CUN A;  3NT6 A;  3LG7 A;  3ZJ1 A;  3SX6 A;  4Z91 A;  1H81 A;  4JY2 A;  3UTG A;  2BC1 A;  3NRN A;  4WYV A;  1YKE B;  4FK1 C;  4H4Q A;  5FYM A;  4A56 A;  3SZW A;  1VRQ B;  3KVE A;  1WR6 A;  4GCM A;  4HFH A;  3RC8 A;  3QC9 A;  4TNV A;  1PDH A;  3NTD A;  4H4Z A;  2QYW A;  1XAN A;  5FY0 A;  2GR3 A;  2UUB T;  4JBW F;  2K24 A;  2TMD A;  5AQO B;  2BG9 B;  2X99 A;  1D5T A;  1UKV G;  4USQ A;  1DJQ A;  2E5L T;  2WDR A;  3NN6 X;  4GRT A;  5F8P A;  4OPC A;  4PNI A;  2XQ9 A;  3RQU A;  4U74 A;  3ALJ A;  4AKI A;  2FJD A;  3GDN A;  1KNP A;  1HX8 A;  2CCQ A;  4NEV A;  2E9X D;  1YKH B;  2HN1 A;  4JI8 T;  3ISH A;  3E0Z A;  3T2Z A;  4I59 A;  1MMA A;  4BAY B;  1HCI A;  2CUL A;  3L1R A;  3ZYX A;  3LDQ B;  1Z6L A;  2XLU A;  3Q5X A;  3AEA A;  4EIW A;  5CA0 E;  1ELI A;  4DV0 T;  3GMB A;  2XQ8 A;  1OED E;  5HCM A;  4G9K A;  2WEU A;  4YTP A;  2UXB T;  3FBS A;  2YN6 A;  3T2Y A;  5CB4 E;  2A87 A;  4KI0 F;  2WZH A;  4EYY R;  1KF6 A;  5FXV A;  3GDP A;  5KMR A;  1VCS A;  3UU5 A;  2L9Q A;  3NKS A;  2V1D B;  3ZMS B;  2IDO B;  4O4L E;  4IST A;  1J5E T;  4EM3 A;  4JY3 A;  4X1I E;  3G5R A;  1NWM X;  3J9X 1;  1MMN A;  4O5U A;  3ESL A;  3LZX A;  1JU2 A;  3BI2 A;  4ZZC A;  2KZ7 B;  2Q6U A;  3SXI A;  3DH9 A;  3NLC A;  4ZCC A;  4I43 B;  1KSU A;  4O4J E;  5EB4 A;  2E8I A;  2O9Z A;  2WSS V;  3LAD A;  3WE0 A;  1OJA A;  1YQ4 A;  1CL0 A;  4AT0 A;  2VKJ A;  3C50 A;  4DR1 T;  2BKO A;  2YWL A;  4H9S E;  5J2U E;  3QFB A;  1Y0P A;  1DOD A;  2FJB A;  5L3D B;  4GF7 A;  4C3X A;  3H8I A;  2YU1 A;  3P4P A;  3H3A A;  3CGD A;  3VQR A;  1D4C A;  1F6M A;  4H2R A;  1CC6 A;  3QFA A;  2V7J A;  1SE7 A;  2WOV A;  1GRA A;  2Y6R A;  4H50 A;  3UKQ A;  2C4C A;  4EOZ B;  3RNM A;  4EB6 E;  3F2E A;  3MA9 A;  4JN9 A;  5JDQ A;  3G5S A;  2CEA A;  1FEA A;  2ES0 A;  5AQJ B;  1COY A;  4D04 A;  2VQ7 A;  3LOV A;  4CN6 A;  4GR1 A;  3U78 A;  1W9R A;  1FEB A;  2RGO A;  2LE8 A;  3EUH A;  1GRT A;  5ADX L;  3SZC A;  2B1E A;  1FL2 A;  3F8P A;  1OJT A;  4HWF A;  3AE7 A;  1FOH A;  4JEU B;  4H9N C;  3PUZ F;  1IUV A;  4CI2 B;  3B57 A;  2WU2 A;  2WS3 A;  3UUM A;  5KDM C;  1KSS A;  1NHQ A;  3NN0 X;  1X79 A;  2DI4 A;  4YSY A;  1U4Q A;  5FXX A;  1REO A;  3K3Q C;  2B7R A;  3QB5 K;  3K1S A;  4AP1 A;  4EZH A;  3MJX A;  5IWA T;  1D7Y A;  4OPT A;  3RHW A;  4FX9 A;  1BR4 A;  2Y48 B;  1PBC A;  1D4E A;  3DK8 A;  5LBM A;  1XHC A;  3O1J A;  4B66 A;  2H3R A;  3UTK A;  1V9D A;  2XVE A;  3NTA A;  3X1D A;  3T37 A;  3RYH E;  2YEV C;  3ATR A;  3DME A;  3SWH A;  2IUB A;  4YXD A;  4LF9 T;  4QH5 A;  4H2P A;  2C5K T;  4O4H E;  2X66 A;  3CVR A;  2E4G A;  3DJD A;  2IAK A;  2VKD A;  4X20 E;  2OA1 A;  2GEW A;  1MMD A;  2GR0 A;  2YQU A;  3CX6 B;  4QXB B;  4RG3 A;  2NOX A;  4UV9 B;  4BJN A;  3AE1 A;  3DJE A;  3UKA A;  4UEL A;  3UOY A;  3AE5 A;  3NZQ A;  3P7I A;  3RLF F;  2WAU A;  1EBD A;  1IUS A;  5JR9 A;  1VG9 A;  3P4Q A;  1ZEE A;  2XFN A;  3PS9 A;  4E0V A;  2LKG A;  2XAS B;  3DTO A;  4CY8 A;  2WP5 A;  4EQS A;  4LMK A;  4A5L A;  3UQ7 A;  4U2Y A;  1M7K A;  3JCF A;  3UUB A;  2Q9Q B;  1E2A A;  3UU4 A;  4HFE A;  1O95 A;  1Y56 A;  5IHY A;  1L9C A;  3TLW A;  4G2A A;  3MZK B;  4LMJ A;  3C64 A;  5J2T E;  4NEW A;  4H2N A;  1YKJ A;  2WET A;  3AA0 B;  2J3N A;  5JQG E;  3FXD B;  2XLP A;  1LQU A;  4Z26 A;  5JCM A;  3P50 A;  4QWN B;  3ITJ A;  2GH5 A;  3ZST A;  4LFA T;  2BXS A;  5HEO A;  5FL1 A;  4OX9 T;  2XQA A;  2HH7 A;  3AB3 B;  5KWF A;  1HX1 B;  2GQF A;  1JRZ A;  1HNX T;  1V59 A;  2JQ9 A;  2WP9 A;  3EDU A;  4GYS A;  3W15 B;  3GRT A;  1TDO A;  5HEJ A;  1P2H A;  3Q5D A;  4JI7 T;  1PN0 A;  4U3C A;  4DV7 T;  2OV9 A;  3VRD B;  3ZN0 B;  4ASK A;  1NAA A;  3B5M A;  1OJD A;  5LCY A;  1WFD A;  1RSG A;  1HF8 A;  4II3 A;  1OED B;  2GMH A;  2Q0K A;  2XJ7 A;  5L3B B;  4GKK T;  2UZZ A;  4XXG A;  2B76 A;  4DBR A;  4WX1 A;  2LM9 A;  1XNR T;  4O2A E;  2C5I T;  2YLZ A;  2PTF A;  3CKD A;  5CKU A;  3K7T A;  4ZN0 A;  2JB1 A;  3AEB A;  2JIW A;  2JKC A;  3SS1 A;  2YG6 A;  3OYZ A;  4MHC A;  4U2Z A;  4H9P C;  3S5W A;  3HR0 A;  2KWH A;  2BA9 A;  2GR1 A;  3SM8 A;  4G74 A;  1H7C A;  4TZ4 C;  3AE6 A;  4BUR A;  5KMP A;  1HNZ T;  1VDC A;  3I0O A;  4UXN B;  2XSA A;  1IZN B;  2NW7 A;  3OTO T;  2YG5 A;  4MJW A;  4A9W A;  3QSS A;  3KIN B;  1IUX A;  3UOX A;  3FZM B;  1ZHC A;  4DR2 T;  1GND A;  2KXP B;  1E1K A;  2BS2 A;  2IID A;  2V6X A;  4Z8X A;  2BCG G;  3RX6 A;  2XLR A;  2KSR A;  5BRT A;  1FEC A;  4H4T A;  4EXT A;  4UDP A;  1Y56 B;  1GER A;  1YW0 A; 
#chains in the Genus database with same CATH homology
 1GSN A;  1TDF A;  3CGE A;  1PBE A;  4U8M A;  2VVM A;  1DOB A;  3FPZ A;  1LJ1 A;  1S3E A;  3II4 A;  1PXB A;  2F5Z A;  4CCR A;  4DSH A;  1DOC A;  2IVD A;  3K30 A;  2XCG A;  2BXR A;  3ICR A;  2YLW A;  4EIQ A;  3AD7 B;  1NHS A;  3UKH A;  1Q1R A;  1CHU A;  3H4K A;  1VG0 A;  3ATQ A;  2YLR A;  3ICS A;  5HY5 A;  2XFQ A;  3C4N A;  2R4J A;  3NHO X;  3EAO A;  4O5Q A;  4OPD A;  2QA1 A;  4LII A;  1NEK A;  1LQT A;  4AP3 A;  1GPE A;  4B67 A;  2YAU A;  3KKJ A;  2XLT A;  3GRS A;  3AXB A;  2FJE A;  2GAG B;  4G73 A;  1JNR A;  2GR2 A;  4FK1 A;  1QLB A;  2WHD A;  3DK4 A;  1JNZ A;  1NHR A;  4A7A A;  3NH3 X;  1ZKQ A;  2BAB A;  4D03 A;  4XWR A;  3CN8 A;  3P1W A;  3KLJ A;  2WPC A;  4K8D A;  4CCQ A;  3SZ0 A;  3C96 A;  4EMI A;  2WPE A;  2H89 A;  1TDE A;  3DGZ A;  5U25 A;  4BK3 A;  1E6E A;  1L9E A;  4AOX A;  5IQ4 A;  4H2Q A;  3BI4 A;  4B65 A;  5KRQ A;  4U8N A;  1H6V A;  1JOA A;  5JCI A;  1B5Q A;  2YLX A;  1GET A;  1YQ3 A;  5IPY A;  4AOS A;  4X9N A;  4YSX A;  4YTM A;  4Y4L A;  2WPF A;  5HYM A;  3NK1 X;  3AEE A;  2PHH A;  3ICT A;  4Z2U A;  1F8W A;  4B68 A;  2VQB A;  4NZH A;  5EB5 A;  4KPR A;  2DKI A;  4IA6 A;  2NVK X;  3AEC A;  2YG7 A;  4EIP A;  2V3A A;  3QSE A;  5EBK A;  1PS9 A;  1RP0 A;  1PJ7 A;  3AWI A;  4H4U A;  2C67 A;  5TR3 A;  4IVO B;  3DGH A;  3NT6 A;  3SX6 A;  1H81 A;  3VRA A;  3BNU A;  4RSL A;  3E1T A;  3GD4 A;  2Z5Y A;  3S61 A;  4JY2 A;  3UTG A;  3AD8 B;  2BC1 A;  2ZZ0 A;  2APG A;  3NRN A;  1PXA A;  2V3B A;  4FK1 C;  4H4Q A;  1FCD A;  2Z5X A;  3SZW A;  1VRQ B;  3KVE A;  1D7L A;  3GSI A;  3CIR A;  4GCM A;  3UTE A;  3QJ4 A;  1PDH A;  3NTD A;  1GRG A;  4II2 A;  4H4Z A;  4A6N A;  5KMS A;  4NNJ A;  1PJ5 A;  2B9X A;  1RYI A;  1KNR A;  2BRY A;  2R9Z A;  1XAN A;  3I6D A;  4J34 A;  3RP6 A;  2GR3 A;  3UCL A;  4A79 A;  1CJC A;  4CY6 A;  3AYL A;  1NG3 A;  3P4S A;  1TRB A;  2XVI A;  1BF3 A;  2TMD A;  3UP4 A;  5LV9 A;  3L8K A;  2ACZ A;  2WOI A;  2YLS A;  2YVF A;  2X99 A;  1NG4 A;  4PAA A;  1D5T A;  1UKV G;  4OCG A;  1DJQ A;  4USQ A;  3IHM A;  3NN6 X;  2WDR A;  4GRT A;  4C5O A;  5L46 A;  3IC9 A;  4K7Z A;  5BUK A;  1GEU A;  4OPC A;  3QVR A;  4YKG A;  2VOU A;  1M64 A;  3ALJ A;  2BK3 A;  2W0H A;  2FJD A;  5CQF A;  1PBB A;  3AB1 A;  1E7P A;  2TPR A;  3GDN A;  3RP8 A;  2YG3 A;  1KNP A;  1AOG A;  3CPJ G;  5ER0 A;  4NEV A;  5DBJ A;  3V76 A;  3CPI G;  3T2Z A;  3ISH A;  4UDQ A;  3AD9 B;  4I59 A;  4J36 A;  2CUL A;  3L1R A;  3ZYX A;  2BYB A;  4U8I A;  4U8L A;  1Z6L A;  3NYF A;  2XLU A;  3D8X A;  2C75 A;  2X8C A;  3AEA A;  3B3R A;  5J7X A;  1TDK A;  1BZL A;  1GAL A;  3AE9 A;  4HB9 A;  1ELI A;  3GMB A;  3AYJ A;  4K5S A;  4G9K A;  3GWD A;  2R0C A;  2PYX A;  4A65 A;  5KNL A;  2WEU A;  4YTP A;  4OPG A;  4N9X A;  3FBS A;  3T2Y A;  3IWA A;  2A87 A;  1B37 A;  4CNJ A;  3COX A;  2OLO A;  1CC2 A;  4RG4 A;  1GOS A;  1ZOV A;  1KF6 A;  1IUT A;  3GDP A;  1TDN A;  4H4W A;  5KMR A;  2XFO A;  2C66 A;  3NKS A;  4G6H A;  4CBQ A;  4YSH A;  1JRX A;  1ZP0 A;  3AEG A;  2YM1 A;  2XVF A;  3PVC A;  3RED A;  4EM3 A;  4B69 A;  4JY3 A;  3G5R A;  4Y4M A;  3SYI A;  1CBO A;  1BGN A;  2XLS A;  5GRT A;  3GMC A;  5U1O A;  3NK2 X;  4DNA A;  3LZW A;  4O5U A;  3GWF A;  1H7X A;  2WP6 A;  4GDP A;  3LZX A;  1JU2 A;  3BI2 A;  3QVP A;  2Q6U A;  2QAE A;  4J31 A;  3SXI A;  4EQR A;  3BI5 A;  3DH9 A;  3NLC A;  1YQZ A;  4ZCC A;  1KSU A;  4APN A;  1EL5 A;  2YR5 A;  2DKH A;  2XDO A;  4GUV A;  3ALL A;  5EB4 A;  3RP7 A;  3OC4 A;  2O9Z A;  5HXI A;  1DOE A;  2XVH A;  3LAD A;  2YVG A;  3WE0 A;  1OJA A;  1YQ4 A;  4K2X A;  1CL0 A;  4XWZ A;  2JB2 A;  4AT0 A;  4YKF A;  5M0Z A;  2WQY A;  1W4X A;  1F8R A;  2YWL A;  2YR4 A;  2BCP A;  4TLZ A;  1QJD A;  1S2Q A;  4YTN A;  1Y0P A;  3OZ2 A;  3Q6J A;  3BNM A;  1DOD A;  3QFB A;  2FJB A;  4C3X A;  4GF7 A;  4ICY A;  3H8I A;  3LB8 A;  1JRY A;  3P4P A;  1IUU A;  1EL8 A;  3CGD A;  2Y6Q A;  3GYX A;  3V3O A;  3VQR A;  1E1L A;  1LTX R;  1KFY A;  3NG7 X;  1D4C A;  1S3B A;  1F6M A;  3VRB A;  1ZMC A;  3V3N A;  1K0J A;  1MOK A;  4H2R A;  1CC6 A;  1GRF A;  3QFA A;  2OLN A;  1ZOY A;  5EOW A;  4J56 A;  2WOV A;  1GRA A;  5GSN A;  4DSG A;  2Y6R A;  3KPK A;  1CJ3 A;  4H50 A;  3UKQ A;  2C4C A;  1MO9 A;  1E1M A;  1ZMD A;  3RNM A;  1GTE A;  1GV4 A;  4BJZ A;  1PBF A;  1P2E A;  4JN9 A;  3T14 A;  2C64 A;  4C3Y A;  3SZF A;  2Q7V A;  4REK A;  3UTH A;  2C70 A;  4GDE A;  5KXJ A;  3UKF A;  4A6N B;  4CNK A;  3G5S A;  1FEA A;  4OPU A;  2B9Y A;  4U8K A;  1NHP A;  4J2W A;  5FS6 A;  3PO7 A;  1M6I A;  3HZL A;  4UP3 A;  1COY A;  3SY4 A;  1MXT A;  1GES A;  3M12 A;  1CJ4 A;  4D04 A;  1ZK7 A;  2VQ7 A;  3LOV A;  3SFE A;  3GYI A;  3P4R A;  3CPH G;  4GR1 A;  4H4R A;  4NTE A;  3M0O A;  3CGB A;  2GRT A;  2YVJ A;  3T0K A;  3CNJ A;  4U2S A;  1FEB A;  2RGO A;  1NPX A;  3NYE A;  1GRT A;  3SZC A;  2GV8 A;  1FL2 A;  3F8P A;  3AE4 A;  1OJT A;  2BK4 A;  3AE7 A;  1FOH A;  2WBA A;  2JB3 A;  3ALM A;  2FJA A;  1H83 A;  3KPF A;  4H4P A;  5JCK A;  3EPT A;  2B7S A;  1GRE A;  3BHK A;  5FS8 A;  1IUV A;  2RGJ A;  3UTF A;  4EM4 A;  2WU2 A;  2WS3 A;  2VZ2 A;  4Z25 A;  1BWC A;  1KSS A;  1NHQ A;  3NN0 X;  2ARD A;  2CDU A;  4YSY A;  2C65 A;  4H7U A;  1REO A;  4C74 A;  2B7R A;  4BK1 A;  4ADW A;  1L9D A;  4BJY A;  2X50 A;  4LA1 A;  4YSZ A;  1B4V A;  4AP1 A;  3O0H A;  4X4J A;  4Z2T A;  3HYX A;  2H88 A;  1D7Y A;  4OPT A;  2RGH A;  4DGK A;  1EL9 A;  4FX9 A;  1PBC A;  1D4E A;  1N4W A;  4ZCD A;  3DK8 A;  1XHC A;  5JCN A;  2C73 A;  4TLX A;  5KOX A;  4GAV A;  4GAP A;  4B66 A;  3C4A A;  4I58 A;  1H86 A;  1S2Y A;  5IQ1 A;  2XVE A;  3NTA A;  3T37 A;  3I3L A;  3EAN A;  5FS9 A;  2HQM A;  2V61 A;  3ATR A;  4H4Y A;  1F3P A;  4IA5 A;  3DME A;  4OPL A;  4U8P A;  1GXF A;  5KMQ A;  2IVE A;  2EQ9 A;  4FDC B;  4YXD A;  1F8S A;  1HYU A;  3P9U A;  4OPI A;  3FMW A;  4H2P A;  3AE8 A;  4TM1 A;  1XPQ A;  2E4G A;  3DJD A;  5C2T A;  2ZZC A;  4JDR A;  3K7M X;  4P9S A;  2VVL G;  2OA1 A;  1K0I A;  2GEW A;  4TM3 A;  2GR0 A;  1NDA A;  4U8O A;  1GRH A;  3CND A;  4B1B A;  1O94 A;  1ZDL A;  2OAM A;  3CGC A;  2YQU A;  3RHA A;  4RG3 A;  3QSM A;  2GAH B;  3EF6 A;  2JAE A;  4H4X A;  2V5Z A;  2I0Z A;  3AE1 A;  3JSK A;  3SFD A;  2GB0 A;  2XFP A;  2QA2 A;  3DJE A;  3UKA A;  4AT2 A;  4LU6 A;  3UOY A;  2GMJ A;  3CTY A;  3F8D A;  5C3J A;  3NNE A;  2A89 A;  5BVA A;  3AE5 A;  4TM0 A;  2BAC A;  3AYI A;  4EQX A;  4U8J A;  1EBD A;  1IUS A;  3DK9 A;  5M10 A;  1VG9 A;  3P4Q A;  3UKL A;  2XFN A;  4OVI A;  3PS9 A;  4NWZ A;  1H7W A;  2C3C A;  2WOW A;  3ZDN A;  4E0V A;  2AAQ A;  4CY8 A;  2R46 A;  2WP5 A;  4EQS A;  1EL7 A;  1BKW A;  4BK2 A;  1TYT A;  1TYP A;  2YR6 A;  4B64 A;  1K0L A;  1D4D A;  4A5L A;  4X9M A;  4Z43 A;  1B8S A;  2E1M A;  3DJG X;  2BS4 A;  2VRL A;  3AED A;  2AQJ A;  3CNT A;  4ECH A;  2X8H A;  5J60 A;  1SEZ A;  4Z44 A;  2GVC A;  1O95 A;  2JK6 A;  4YT0 A;  1Y56 A;  2B9W A;  1IUW A;  3UP5 A;  1L9C A;  1GRB A;  4K5R A;  1X31 B;  2R0P A;  3NIX A;  4NEW A;  5KVH A;  1XDI A;  4JNA A;  1CJ2 A;  1Q9I A;  4H2N A;  1YKJ A;  2WDQ A;  2WET A;  1LV0 A;  2J3N A;  3T2K A;  3IF9 A;  2V60 A;  2XLP A;  1LQU A;  4Z26 A;  5JCM A;  4IVM B;  4BV6 A;  1N4V A;  1GTH A;  2YM2 A;  4JNQ A;  2ZZB A;  4J33 A;  3ITJ A;  2X8G A;  2YLT A;  2GH5 A;  2C76 A;  3SQP A;  2BXS A;  3Q9T A;  1DJN A;  3FIM B;  4G6G A;  1E1N A;  4EMJ A;  3ABV A;  4B63 A;  4PAB A;  2BRA A;  4A99 A;  2X3N A;  5KWF A;  1L0V A;  1CC4 A;  1O5W A;  2GQF A;  3DA1 A;  5KOW A;  1JRZ A;  2BK5 A;  3D1C A;  2WES A;  4Y4N A;  1V59 A;  3KU9 A;  4YWO A;  2WP9 A;  5U63 A;  3GRT A;  2EQ8 A;  2WDV A;  1TDO A;  4NTC A;  1PJ6 A;  4HA6 A;  1DXL A;  4IV9 A;  3ADA B;  3VR8 A;  4WCT A;  1P2H A;  3GYJ A;  2A8X A;  1LVL A;  1NEN A;  1PN0 A;  1OJC A;  1PHH A;  2JBV A;  5FMH A;  3R9U A;  1K4Q A;  3VRD B;  3NGC X;  1NAA A;  3K7Q X;  1OJD A;  4NTD A;  2CVJ A;  3UOV A;  2ZBW A;  1RSG A;  3CNS A;  3H8L A;  4UDR A;  4II3 A;  1E39 A;  3IHG A;  4H4S A;  4M52 A;  2GMH A;  2EQ6 A;  2Q0K A;  2BS3 A;  1DNC A;  1IJH A;  4TM4 A;  1BGJ A;  1QO8 A;  4Z2R A;  2UZZ A;  3GD3 A;  3LJP A;  5HHF A;  4XXG A;  4EMW A;  4U2T A;  3B6D A;  2B76 A;  3F8R A;  3AEF A;  4WX1 A;  1JEH A;  2VRM A;  3NK0 X;  3T31 A;  1Q1W A;  2C7G A;  2XYO A;  2YLZ A;  4J57 A;  5KVI A;  3SGL A;  2LFC A;  1KDG A;  5CKU A;  2C3D A;  3CMM A;  3K7T A;  2E5V A;  2BC0 A;  3BHF A;  3G5Q A;  4JQ9 A;  3M13 A;  2JB1 A;  4ZN0 A;  2WU5 A;  3AEB A;  3NYC A;  2JKC A;  2YG6 A;  2R4E A;  3DJJ A;  4USR A;  2CFY A;  3S5W A;  2R0G A;  1H82 A;  2YG4 A;  3AE2 A;  2NPX A;  2BA9 A;  2GR1 A;  2RAB A;  4G74 A;  3SM8 A;  3UKK A;  3VR9 A;  2XFU A;  4H4V A;  3AE6 A;  2QCU A;  1ZX9 A;  4BUR A;  5KMP A;  4K22 A;  2V6O A;  4EQW A;  4KX6 A;  1VDC A;  5BUL A;  3AE3 A;  4C77 A;  2C72 A;  5JCL A;  1ONF A;  2YG5 A;  3HYV A;  4MJW A;  1CF3 A;  3FG2 P;  4A9W A;  3QSS A;  1IUX A;  1PBD A;  1PXC A;  3LXD A;  3UOX A;  2GF3 A;  3KD9 A;  2FBW A;  1ZY8 A;  3CNP A;  3KA7 A;  1H84 A;  2AR8 A;  1GND A;  4Z24 A;  4CRT A;  3HYW A;  1E1K A;  3UKP A;  2BS2 A;  2IID A;  2EQ7 A;  1YY5 A;  1GT8 A;  2Q0L A;  2OAL A;  2BCG G;  2XLR A;  3UOZ A;  5BRT A;  3URH A;  1FEC A;  2R45 A;  2XVJ A;  4H4T A;  1N4U A;  1VQW A;  1OJ9 A;  2GQW A;  2VVL A;  4U2L A;  1LPF A;  4UDP A;  1Y56 B;  5FS7 A;  1GER A;  1N1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...