1CHUA

Structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
532
structure length
478
Chain Sequence
NTLPEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMHDISTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPSILSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of L-aspartate oxidase: implications for the succinate dehydrogenase/fumarate reductase oxidoreductase family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Flavoenzyme
molecule keywords PROTEIN (L-ASPARTATE OXIDASE)
total genus 152
structure length 478
sequence length 532
ec nomenclature ec 1.4.3.16: L-aspartate oxidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 1chuA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1chuA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1chuA02
1GESA 3CNTA 4GDEA 3M13A 1XDIA 1S2YA 1GRTA 2YR6A 4NTCA 2WU5A 1PN0A 1Y56A 2HQMA 2YG6A 4CCRA 1IJHA 5FS8A 4DSGA 4B67A 2AR8A 3RP8A 3P9UA 4I58A 2VVLA 4NTEA 4USQA 1MXTA 1ZK7A 3CNPA 2YR4A 4U8LA 1PBCA 3QFBA 1JRZA 3UOYA 5LV9A 3S61A 5KWFA 1ZKQA 4AT2A 3CNDA 2R45A 1KSUA 4OVIA 1GV4A 3UKAA 2ZZBA 3UTEA 2VOUA 4NEVA 2XLRA 1GRGA 3CGBA 1GALA 1H81A 3B3RA 1H7WA 3VRDB 1O95A 2R0GA 2C3CA 2EQ6A 4TM3A 2BCGG 3ITJA 4A79A 2Q0KA 1H86A 2C75A 3DJEA 2E4GA 1N4WA 3WE0A 2RGOA 2XVFA 3Q9TA 1NHPA 2QA1A 2C70A 4A6NA 1SEZA 1GRAA 3C4NA 1L0VA 4ZN0A 2PHHA 2XLUA 1KDGA 2Q7VA 1NG4A 2YG7A 4EMWA 4TLZA 3GYIA 4ADWA 4YWOA 2XLPA 2Y6RA 4D04A 1XANA 1GPEA 4EQWA 1N4VA 4J57A 2GQFA 2WOIA 3GRSA 3FBSA 4NTDA 4XXGA 2JKCA 1FEAA 5FS6A 4Z44A 2NVKX 4BURA 4C77A 4OPIA 5CKUA 5BULA 4H2RA 5FS9A 3HZLA 3NK0X 4I59A 2C76A 3I3LA 2QA2A 1EL8A 3QSMA 2V5ZA 1YQ3A 2GF3A 1BZLA 2C65A 4CBQA 4IA5A 3NKSA 2C72A 4K5RA 4TLXA 1KF6A 2GH5A 1ELIA 3CPIG 1N1PA 1Q1RA 1YQZA 3RP7A 3ADAB 5IQ1A 2YLRA 3URHA 1CJ4A 1Y56B 1E6EA 1KNPA 3UKFA 1LJ1A 2GAGB 2R9ZA 4BK2A 3VQRA 4Z24A 3QVRA 4H4VA 1PJ5A 3CGCA 2R4JA 3RNMA 3V3NA 4U8MA 4K7ZA 4J36A 2BC1A 1RP0A 1GNDA 2I0ZA 1OJTA 3UOXA 3K7MX 2XLTA 3AD8B 2OAMA 3UKQA 2C73A 5HHFA 3CPHG 2W0HA 3FMWA 2YLZA 1ONFA 3GRTA 2R0CA 1PBEA 5KOXA 1TDFA 2X8HA 1TDOA 3PVCA 4H4RA 1BWCA 5IPYA 2F5ZA 5M10A 4YKGA 3ATRA 2A87A 5L46A 1VQWA 3GDNA 2YLTA 2BABA 3K30A 5KVIA 2YG4A 2XFOA 2FJAA 4OPTA 4J31A 1GRHA 2YG5A 1MOKA 4NZHA 1COYA 4JNQA 1IUTA 3KKJA 2IIDA 4CNKA 1PDHA 1LPFA 4FK1A 3R9UA 3QSSA 1D4EA 4GDPA 3V3OA 4J2WA 4DSHA 3EAOA 2B7SA 4K8DA 2BS2A 2GR3A 3BI2A 1CF3A 1L9CA 2WDRA 1TYPA 2V3BA 3AYLA 4GF7A 1ZY8A 4PAAA 3ZDNA 4CY6A 2BK5A 2WBAA 4YSHA 1H83A 4PABA 3CNJA 3SFDA 2YM2A 2X50A 4MJWA 3NRNA 1F8RA 4BV6A 3AECA 3IF9A 3LZWA 4B68A 4EQXA 2GR1A 1D7LA 4KPRA 3BI5A 3NN0X 3BNMA 2OLNA 1GTHA 2OA1A 2FJEA 1CC6A 2BACA 4H4SA 1FCDA 4H2QA 2YAUA 4N9XA 2BCPA 3EF6A 1PBFA 1PS9A 3GSIA 4BJYA 2X3NA 3BNUA 3UTHA 3EANA 2V60A 4FDCB 1B37A 1PHHA 1GTEA 2BXRA 2JB2A 4H50A 2WDVA 1CHUA 3Q6JA 4GRTA 1NG3A 2WPEA 1GXFA 1P2HA 3PS9A 1EL5A 3DGHA 3KLJA 4H4ZA 4U8PA 4DGKA 3EPTA 3V76A 3K7QX 3LB8A 1DODA 3QSEA 4IVMB 5J7XA 4IVOB 2GMHA 3S5WA 4C3XA 1NHQA 1OJCA 1D4CA 3P4SA 2E1MA 4REKA 3RHAA 4U8JA 1E1LA 4RG4A 2RGHA 2OALA 5JCLA 4UDRA 3H4KA 2WPFA 1DJNA 4YSXA 3H8LA 1ZX9A 2WPCA 1RYIA 3ALJA 4Z2RA 5BVAA 2DKHA 3PO7A 2BS3A 4A6NB 3GYJA 3NYEA 2XFNA 4H4QA 4X9MA 2C3DA 1GT8A 3ISHA 1OJAA 4O5UA 2YVJA 3LXDA 3CTYA 3AE7A 2XVHA 1FOHA 4XWRA 1JEHA 2DKIA 1E1MA 3ZYXA 2Z5YA 3AD7B 3P4QA 2B9XA 1TDNA 2R4EA 3AYIA 2XLSA 2BK4A 3UP5A 3C4AA 3DH9A 3UKKA 3ABVA 3IHMA 1ZDLA 2B9YA 1E39A 2C66A 3NYFA 2VQBA 4P9SA 3FPZA 1D7YA 2GVCA 1EBDA 2J3NA 2TPRA 3F8RA 3KU9A 4RSLA 4ZCDA 3UTGA 2VVLG 1TRBA 4K5SA 3AEEA 2B9WA 3QJ4A 2WP9A 4ZCCA 3L8KA 3AYJA 3IHGA 1VG9A 2XYOA 4CY8A 1REOA 1K0LA 3AD9B 2A89A 4OPGA 4AP3A 4TM1A 4AT0A 4BK3A 2TMDA 1F8SA 2GAHB 1B5QA 2CDUA 2A8XA 1E1NA 1F6MA 2XCGA 3NGCX 3NTAA 4H4YA 2CULA 2R0PA 1M6IA 2BYBA 4Z2UA 1QLBA 2WOWA 1Z6LA 1OJDA 4JQ9A 1JNRA 1CJ3A 2YG3A 4FK1C 2C64A 1L9DA 3BHKA 4Y4NA 1LV0A 1EL7A 3AEGA 1IUXA 4E0VA 1O94A 1K0JA 5KXJA 3G5RA 1XHCA 1BGNA 2BXSA 1M64A 4H4UA 2WESA 2VRMA 4TM4A 4AP1A 3SM8A 1KNRA 4BK1A 2WOVA 3FG2P 2PYXA 4OPUA 1H7XA 1ZOYA 4J33A 4OCGA 5BUKA 2YM1A 4YSYA 3LADA 4YXDA 4IA6A 1CBOA 1FECA 4OPLA 3DK4A 3KVEA 3DMEA 4U8IA 4A5LA 2YLSA 3QFAA 2BA9A 2XFPA 4Y4LA 4EQSA 1HYUA 2WETA 3AWIA 4YT0A 2JK6A 3ICSA 1K4QA 3NLCA 2GR0A 1VDCA 2YVFA 2GR2A 4EM3A 5HYMA 4U8OA 2ARDA 2GRTA 4J34A 3UKLA 2V61A 1CC2A 3AEBA 3II4A 4WCTA 2WHDA 3D8XA 5EB4A 5FS7A 3NN6X 2LFCA 4A9WA 4X9NA 4YTPA 3DGZA 3VRBA 2WP5A 1UKVG 4RG3A 2WS3A 1TDEA 4H4WA 3KA7A 1GRBA 2WQYA 4J56A 1JNZA 1IUWA 1E7PA 1LQTA 1DJQA 1JOAA 3F8DA 4FX9A 1CJCA 3AE6A 2X8CA 3UOZA 4ICYA 3AE3A 4GR1A 1PJ6A 1ZP0A 1MO9A 3UTFA 3CNSA 5U25A 1IUVA 4A7AA 4U2SA 1K0IA 2GQWA 1FEBA 3REDA 3I6DA 4B1BA 5ER0A 4C74A 1S3BA 3AE5A 4U2TA 1QJDA 3G5QA 4H2PA 2XDOA 4B65A 2VRLA 4EM4A 3VRAA 2GEWA 2WEUA 2B7RA 3CN8A 3NH3X 3GWFA 3KD9A 3SFEA 1S2QA 1NDAA 1B8SA 2VQ7A 3DK9A 5JCIA 3UKPA 5TR3A 5HXIA 3NK2X 3T37A 3AE4A 4KX6A 4H4TA 1Q9IA 2H89A 1QO8A 1NEKA 4HB9A 2XFUA 4O5QA 3NTDA 3DJDA 5EOWA 1TYTA 1H82A 4IV9A 2OLOA 2GMJA 3M12A 1OJ9A 2C7GA 1W4XA 1PBBA 3CPJG 5J60A 4YSZA 1XPQA 2BS4A 1FL2A 1X31B 2WP6A 2X8GA 4A65A 4CNJA 3AXBA 4B64A 5IQ4A 3NIXA 4U8KA 4Y4MA 3NT6A 3ICTA 4YTMA 1Q1WA 1GRFA 5JCMA 4EIPA 3IC9A 1VG0A 2FBWA 1DNCA 3GYXA 1KSSA 1CL0A 4Z2TA 3AEFA 4HA6A 4JNAA 3B6DA 4JN9A 4M52A 4B63A 1GOSA 3LZXA 4C3YA 1PJ7A 4XWZA 3VR9A 2C67A 4GUVA 3CGEA 2ZZ0A 3IWAA 1BGJA 1BKWA 4EMJA 2EQ7A 1CJ2A 2XVEA 2YWLA 2YR5A 2ZZCA 1H84A 1N4UA 5M0ZA 4B66A 3P4PA 2GB0A 4H7UA 3ALMA 3GD3A 1D4DA 2IVEA 3BHFA 2R46A 3LJPA 4EIQA 2QCUA 2JB1A 1YY5A 3P4RA 1PXCA 1TDKA 1O5WA 3CIRA 3NK1X 3DA1A 1NAAA 3NNEA 5KRQA 1GSNA 4U8NA 1NHRA 4USRA 4CCQA 1D5TA 2Q6UA 5EB5A 2YLWA 5DBJA 3G5SA 2JAEA 5GRTA 5FMHA 1V59A 4NEWA 3M0OA 2V3AA 1AOGA 3AEDA 1JRYA 5JCKA 2AQJA 4Z26A 2ACZA 1F8WA 4OPDA 2IVDA 3UOVA 5C3JA 1H6VA 3NG7X 2XVIA 4X4JA 3GMCA 3GDPA 4Z43A 5BRTA 3AE8A 3ICRA 1NPXA 3DK8A 3QVPA 4CRTA 5U63A 4JY3A 2BK3A 1F3PA 4AOXA 1GERA 3ALLA 3AEAA 3DJGX 4K2XA 1VRQB 2EQ9A 2NPXA 3AB1A 3AE1A 3DJJA 5U1OA 3GMBA 3COXA 3KPFA 1JRXA 2Y6QA 5EBKA 3UKHA 5C2TA 3BI4A 2E5VA 2GV8A 1Y0PA 2V6OA 4U2LA 1LQUA 3JSKA 3ATQA 1CC4A 3UP4A 4H2NA 1P2EA 2X99A 4BJZA 4DNAA 3AE2A 1RSGA 2H88A 2RGJA 3D1CA 1ZMCA 3NYCA 2RABA 3F8PA 2FJDA 2B76A 1JU2A 4GCMA 2YLXA 2CFYA 4LU6A 1LVLA 1GREA 3C96A 4H4PA 4A99A 1IUUA 3K7TA 4B69A 2CVJA 1NHSA 4C5OA 1LTXR 4UDQA 3SGLA 2JBVA 2O9ZA 2YQUA 3E1TA 2YVGA 4JDRA 3RP6A 3GD4A 3UCLA 1PXAA 4UP3A 5KVHA 3VR8A 1PBDA 4TM0A 4EQRA 1IUSA 4LA1A 4OPCA 4H4XA 2AAQA 2Z5XA 2ZBWA 1DOEA 2XFQA 4LIIA 3AE9A 1YQ4A 4YKFA 4Z25A 3SQPA 2FJBA 4D03A 1GEUA 2JB3A 3FIMB 3OZ2A 2Q0LA 5CQFA 2APGA 4K22A 4EMIA 4WX1A 4UDPA 1GETA 3P1WA 3L1RA 5GSNA 1L9EA 2BC0A 3CGDA 2WU2A 1NENA 1BF3A 1ZOVA 3O0HA 5HY5A 4ECHA 5JCNA 3H8IA 3OC4A 2UZZA 2QAEA 1B4VA 2EQ8A 2WDQA 1EL9A 1YKJA 3LOVA 5KOWA 4YTNA 1KFYA 4AOSA 2VVMA 4JY2A 1PXBA 1DOBA 3NHOX 1S3EA 1DOCA 1ZMDA 3GWDA 2XVJA 4APNA 1DXLA 1E1KA 2VZ2A
chains in the Genus database with same CATH superfamily
1GESA 3CNTA 4BJNA 1J5WA 4P1NA 3HYXA 2DLRA 3NZPA 1IJHA 4DSGA 2AR8A 4I58A 2D0TA 4NTEA 5J1GA 1PBCA 4AKRB 1UURA 1XZYA 3TLTA 4EV6A 3CNDA 4AT2A 3UKAA 1GALA 1H81A 3B3RA 2LSYA 3VRDB 4IDZA 2EQ6A 3H3MA 3ITJA 1H86A 3AA6B 2Q9QC 4AISA 2ZM2A 4U3CA 2L9QA 1N4WA 2CRBA 2X9WA 3MJXA 2XQYA 2C70A 4A6NA 1WLXA 2CHOA 4DR4T 1NG4A 4EMWA 1HFAA 2C0SA 3IBPA 3Q2MA 3O1JA 2DNXA 4D04A 4TUYE 5HAXA 4XXGA 2JKCA 4OPIA 3HZLA 2PJQA 2C76A 3KINB 4UELA 5HXHA 1YQ3A 4HFCA 3SS1A 4CBQA 1X9BA 4TLXA 2K9AA 2GH5A 1ELIA 3CPIG 5IQ1A 2YLRA 2X9YA 3KVBA 1PJ5A 3I0OA 2R4JA 4HN9A 4J36A 3N9OA 3UKQA 3CPHG 2W0HA 1D0ZA 3GRTA 5KOXA 4DNDA 3PVCA 4H4RA 2F5ZA 3PTRB 4YKGA 2J4GA 3TLSA 2FJAA 4OPTA 3PU8A 2ACXA 1MOKA 4NZHA 4DR2T 5AQOB 2IIDA 4FK1A 3AXJB 2ODVA 2V7KA 1XNRT 2B7SA 4K8DA 2BS2A 4YY3T 3BI2A 5ETWA 3AYLA 4GF7A 2BK5A 2WBAA 3W15B 1H83A 4NUVA 2CXDA 4KUMB 2JRKA 5IYZE 4MJWA 3NRNA 1F8RA 4B68A 3IF9A 3LZWA 2GR1A 4FI5A 3D0TA 3BI5A 3NN0X 2CLYC 2OLNA 2YAUA 5HXSA 3UTHA 4JYAT 4FDCB 1XDOA 3ZYLA 2BXRA 2WDVA 4IHJE 2H7OA 3V5UA 2KZ7B 4U8PA 2LOSA 4CXYA 3V76A 4H63H 5J7XA 2CPTA 1XMOT 3ZT6A 2LLYA 2E1MA 4U8JA 5HEOA 4OX9T 1HG2A 1FMVA 1E1LA 2RGHA 5JCLA 2VKJA 4DV6T 4QX8B 2W0GA 4COFA 3RGLA 3B5MA 3Q9DA 2WPFA 4YSXA 1ZX9A 5JVDE 3BQLA 3ALJA 5BVAA 2W2UA 2BS3A 2ES0A 3SXIA 2H3RA 4LMJA 3NYEA 5LJMA 3ISHA 3HA4A 3LXDA 4ZXLA 4B3MT 3O9XA 4ANJA 1E1MA 2Z5YA 2B9XA 4WW0A 4EYUA 3RIUC 2XHEB 4P0BA 3UP5A 4C91A 3ABVA 3IHMA 2B9YA 1E39A 5CGMA 3NYFA 4C3XA 1D7YA 3KU9A 3RIFA 3F8RA 2IDOB 3P7IA 2VVLG 4CN1A 1TRBA 4ZI2C 4K5SA 2B9WA 2WP9A 4ZCCA 3L8KA 3JAFA 4NNJA 4JI8T 4OPGA 4O4JE 3PE0A 3NTAA 3CK6A 2V7IA 4H4YA 2JQQA 3P50A 1G8XA 4PW8A 2A2FX 2ODUA 4IGUA 2VKHA 2BYBA 4Z2UA 2WY2A 3WAKA 1OJDA 1CJ3A 2YG3A 2C64A 5TAOA 4Y4NA 2BG9E 1EL7A 1K0JA 1XHCA 2BXSA 3BQIA 2GK9A 3ZT5A 4TM4A 4NIQA 3CX8B 2WOVA 3FG2P 2WZIA 3QOFA 2KT9A 4LF7T 2X0LB 2LRLA 3AAEB 3JC6C 4IA6A 4ZI3C 3OKQA 4A5LA 3QFAA 4TWHA 4EB6E 4H9NC 2EHOD 4PK5A 3AWIA 2JK6A 1K4QA 2YVFA 4EM3A 3SZWA 5IHYA 1VCTA 2ARDA 4U8OA 2V61A 3M65A 4L5GA 3C98B 2WHDA 2HH7A 2Z6EA 5FS7A 3NN6X 2PBIA 1T7SA 3MACA 3VRBA 4RG3A 5HCJA 4IDNA 4J56A 1JOAA 3F8DA 1CJCA 5JDQA 3CPZA 3AE6A 4ICYA 4II2A 1PJ6A 1ZP0A 4EIWA 3C51A 1N32T 4EAHA 4UEMA 4C74A 3AE5A 1QJDA 4PJNA 3FBLA 2VASA 3UFGA 5F8PA 2GEWA 2I6HA 4ZS3A 3UKPA 5TR3A 3AE4A 4UVCB 1YKEB 3L39A 1WR6A 4IV9A 3ZKRA 2LT3A 1W4XA 5AQVB 4YSZA 3ZSSA 4CNJA 4TWFA 5IQ4A 3RIAA 3NIXA 4Y4MA 4PJJA 3ICTA 2XUEA 1WCRA 4X1IE 5LG4A 3GYXA 4HA6A 4B3TT 4JNAA 4A98A 3N9QA 5J2UE 5FNVE 3T2KA 4QKNA 4EZ4A 1HNWT 4XWZA 3CGEA 2ZZ0A 3V5SA 4B66A 4DR3T 4H7UA 1D4DA 3A7MA 4EIQA 2W00A 1TDKA 3PJAA 2IC9A 4O4IE 1OEDA 1NHRA 1D5TA 4JI1T 5FMHA 3PDYA 3A5XA 1AJ3A 2V3AA 4OYJA 1F8WA 4HFEA 3FZFB 3NG7X 5EZYE 3KDSE 5LGNB 4Z43A 3GDPA 3AE8A 3DK8A 4CRTA 2JQHA 2W62A 4TZ4C 4K2XA 3AEAA 2NPXA 3DJJA 3AE1A 1IBLT 2NTYA 5U1OA 2V6XA 4BA9A 2P9BA 3KVAA 3BI4A 3ATQA 1DU2A 3UP4A 4H2NA 5LHHB 4BJZA 1RSGA 5HCMA 1MMGA 4H9SE 1ZMCA 4U72A 3ZCJA 1JU2A 4QH4A 2W63A 2CXFA 1GREA 4H4PA 5AQGB 4B69A 3RLFF 2N1GA 3SGLA 1MNDA 4JDRA 3RP6A 1WFDA 2BZBA 3SZCA 4HFHA 1IUSA 2XQ7A 4OPCA 4H4XA 4H63V 4IDQA 2V26A 3PUGA 4O8SA 4DV1T 2XFQA 1OWAA 1YQ4A 4Z25A 2EHOA 4AQGA 2FJBA 1GEUA 3OZ2A 5CQFA 2APGA 3I0QA 2K5BB 1NENA 3T14A 3O0HA 5JCNA 5FMNA 1B4VA 1NWMX 2EQ8A 2WDQA 3AXJA 1EL9A 4YTNA 3SYIA 5FXXA 3K8PC 5LHIB 4ERRA 3PURA 1DXLA 1FEWA 4DVDA 3M13A 3AA1B 4WBOA 5C8YE 4M1PA 3J7Yq 5LCYA 2YR6A 2WU5A 2YG6A 4CCRA 2X67A 3LBXA 3K3QC 4QXCB 1W0AA 4U74A 1S94A 4JEUB 3CNPA 1ZK7A 3OYXA 4U8LA 3QFBA 3UOYA 4DV0T 5H6RB 1KSUA 3CMMA 3SOLA 1GV4A 2YDSA 3T31A 3HYWA 3I9YA 1GRGA 3CGBA 4U7IA 2IAKA 2R0GA 5FL1A 4O2BE 3MZKB 4C90A 2Y48B 2JQ9A 1SEZA 2PHHA 2QRXA 2LSKA 2I0MA 4QX7B 2Q7VA 2YG7A 4TLZA 5L3DB 1XANA 4EQWA 4J57A 2BRAA 3UUBA 1KNZA 3UUNA 4ZI2D 3GRSA 3FBSA 1FEAA 5FS6A 4Z44A 4BURA 1MIYA 3T8OA 2X9HA 4X62T 4H2RA 3L3PA 3NK0X 4KBMB 5AQHB 5LOVE 3ZYKA 2QA2A 3QSMA 1ZV4X 2GF3A 4HWFA 3RI5A 4IA5A 3NKSA 4OFZA 3HI2A 1KEYA 1Q1RA 3ADAB 3URHA 1Y56B 3UKFA 1KNPA 4G2AA 3FZHB 1LJ1A 2R9ZA 4BK2A 3VQRA 2M67A 2L3LA 4H4VA 3ZMZB 5H6QB 3V3NA 4G63A 4U8MA 4K7ZA 4HFVA 2OAMA 4JI4T 2YLZA 1YKHB 3OBVE 1ONFA 1TDOA 3F2EA 2A87A 5L46A 3GDNA 2YLTA 4DR5T 4DBRA 2Y8DA 2W66A 3LDQB 2Y6XA 3NVOA 1COYA 1IUTA 4CNKA 1IZNB 1PDHA 1XNQT 1D4EA 3ZMTB 3LK3B 3V3OA 5FY7A 1Z0PA 4J2WA 2LHRA 4WBNE 2VKOA 3LFMA 2GR3A 4GYSA 4XBFB 1CF3A 3ZDNA 2V3BA 1Y01A 1ZY8A 2JIWA 3SFDA 2YM2A 4PJLA 3Q5DA 2JJ9A 4NPPA 4PAGA 4BV6A 3TLWA 3AECA 3QB5K 2IHR1 1D7LA 4EQXA 3Q5XA 2OA1A 3K3NA 4H2QA 5F5WA 1ZKEA 2XSBA 1PS9A 4BJYA 2QA7A 3E0ZA 5DQVA 4LF6T 3I1AA 3QB5A 2IW5B 3UU4A 2JB2A 5IUXA 2MOZA 2RP4A 1NG3A 2WPEA 3PS9A 3DGHA 3KLJA 4H4ZA 2KWIB 4ZEYA 3LB8A 2D0UA 5LYJE 1DODA 1QSDA 3C50A 4GIWA 1D1BA 2VWAA 4K0UA 3RF1A 1D4CA 1OJCA 3RHAA 4JV5T 5L3BB 4RG4A 2OALA 4UDRA 2A72A 4CI3B 3UQ4A 2MAWA 3LG7A 3RPUA 3UU6A 1VRBA 2KWHA 4A6NB 1HS7A 2CA5A 4X9MA 2YVJA 3AE7A 2XVHA 2ZLYA 3F31A 3IA3A 3C4AA 3KV9A 1ZDLA 2C66A 2J3NA 2TPRA 4ZCDA 3B57A 4WNKA 5EK2A 1N36T 1UGOA 3EUHA 3PUXF 2CXLA 1VG9A 2XYOA 4H9RC 1REOA 4AP3A 4AT0A 4BK3A 2TMDA 1F8SA 2GAHB 4YLHA 5JTGA 1B5QA 2CDUA 1BR2A 2QYWA 2UUBT 1M6IA 2WOWA 1JNRA 4N78D 5AQMB 3BHKA 4YJ2E 1IUXA 4DV4T 1O94A 1I6ZA 2NW7A 2WMOA 2F4VT 3RX6A 4BK1A 3M3ZB 5AQRB 1H7XA 1ZOYA 4KHZF 4J33A 4OCGA 4YSYA 4UF0B 4YXDA 1FECA 3EAMA 2BKPA 5FXZA 2YEVC 4U8IA 2YLSA 2XFPA 5L2LA 1HCIA 1D0XA 2VVSA 3ONXA 4UVAB 1UCUA 4YT0A 4I55E 2GR0A 1VDCA 5HYMA 2GR2A 2PG8A 2VKDA 2MYSA 4X20E 3II4A 4ZI3D 3RYIE 3ETUA 3CQCB 3D8XA 4U33A 2LFCA 2D9DA 4HWCA 4DR7T 4X9NA 3DGZA 3CVRA 3ZC1A 3N2KE 1JNZA 5HWYA 4OHFA 4KHPT 1DJQA 1LQTA 5FVLA 4FX9A 4ZOLE 3AE3A 2BG9C 3UTFA 3UUMA 5U25A 1IUVA 2AXDS 2XPKA 1FEBA 4O4HE 3I6DA 2X66A 2WB5A 5ER0A 2BBJA 3SZ0A 4B1BA 4E7ZA 3N2OA 4EM4A 4JI3T 4GK5E 3CN8A 3NH3X 1UX4A 3SFEA 4DR6T 2VQ7A 3HKEE 4EYYR 1B8SA 3DK9A 5HXIA 2D2SA 2HPJA 5FY0A 2WM9A 4H9QC 2DWGA 1MMDA 3DJBA 1QO8A 1NEKA 2DL1A 3PUYF 4A97A 4ILAA 3M12A 3VHLA 1VOMA 4YFSA 5AQTB 3CQGB 5LBMA 2WP6A 4G73A 4A65A 3PU3A 4B64A 5KMRA 3UU3A 3QUJA 4YTMA 5LXTE 4TN7B 1GRFA 5JH7E 1UX5A 1VG0A 2FBWA 3FHNA 1CL0A 5FXWA 4A5XA 5JQGE 4B63A 3R84B 2XJ7A 3SY4A 1GOSA 4X65T 1PJ7A 4GUVA 3LBXB 3OTOT 3IWAA 1BGJA 4K0KT 1BKWA 4EMJA 4FJOA 2XVEA 5AQUB 1M7KA 2YWLA 3ZC0A 1H84A 4I43B 2IUBA 2B1EA 3BHFA 2QCUA 1YY5A 3P4RA 3FXDB 3CIRA 3C4ZA 3DA1A 4IE5A 1NAAA 2LRKA 1GSNA 4USRA 3EHZA 2X9XA 1HG5A 2BRYA 2W4XA 2YKSA 2CM0A 5CB4E 2KSRA 3M0OA 4IREA 3P8CD 1AOGA 1JRYA 5JCKA 4ADZA 4WYVA 4II3A 1LVFA 5AQKB 1H6VA 4X4JA 3QVPA 2ZM6T 4GKKT 3DP7A 1GERA 4H9OC 2EQ9A 1E2AA 3S4UA 2LM9A 3E22E 4PJMA 3COXA 1CUNA 3KPFA 2XAFB 3UKHA 3ZSTA 2V5CA 5AQSB 2E5VA 5HEHA 4U2LA 3T0KA 3EDUA 2X99A 3AE2A 1Z8UA 2PTFA 2H88A 2M6BA 5HXEA 1SUMB 3QNUA 4JI0T 3NYCA 3FZKB 3F8PA 1Y64B 2CFYA 4UV8B 3T2YA 3C96A 2CVJA 1NHSA 1LTXR 2YQUA 3E1TA 2OA5A 3UCLA 1PXAA 2CLYB 5KMPA 5JREA 4EQRA 2AAQA 2ZBWA 1D1CA 3ZMVB 4YKFA 3SQPA 4D03A 2JB3A 3C4WA 3FIMB 3PUWF 1HNXT 2Q0LA 2XQ3A 2G0UA 4K22A 2MTQA 4ZI7E 5ABEA 2KMFA 1YW0A 1BF3A 1ZOVA 5HY5A 3OC4A 4CXXA 3A8YC 4LF5T 5JRCB 5KOWA 2VVMA 2PFVA 3NHOX 4QH5A 1ZMDA 2XVJA 3GMIA 2E9XD 3T1YT 3OVUA 1E1KA 3AVRA 3RKGA 1B7TA 2XASB 2CE7A 4NTCA 1D0YA 1Y56A 2HQMA 2RA1A 1VCSA 2WWVA 4B67A 1OXZA 3SRZA 2LHNA 3P9UA 3EDVA 4DBQA 1MXTA 4F6RC 1QUUA 4ZHQE 2XAGB 3S61A 1ZKQA 3VKHA 2R45A 5LA6E 3HL6A 2ZZBA 3ETVA 4DUYT 2X0HA 1N34T 4NEVA 3UU5A 1H7WA 1O95A 5HEGA 2C3CA 3EI0A 4I50E 4TM3A 4ILCA 2E4GA 3AAAB 2BKNA 1NAFA 1HF8A 1U4QA 2RGOA 2XVFA 3Q9TA 2QA1A 1L0VA 4ZN0A 2XLUA 2LSGA 2L8KA 1IJ6A 4JEHB 4YWOA 3N9NA 3MKDA 2W61A 2LOPA 2GQFA 3IHRA 4NTDA 2DI4A 2NVKX 4C77A 3IEEA 5CKUA 5KDMC 3RRWA 4I59A 1W9RA 1EL8A 2LE8A 2FUPA 4TV9E 2WAUA 5M4YA 3ZJ2A 4DV5T 2C72A 2E9XC 3WI3A 4MHCA 1YQZA 1IJ5A 4QXHB 3DTOA 1CJ4A 4IE0A 2DWKA 5HYAA 3CX6B 1BR1A 4Z24A 1XMQT 2XQAA 3CGCA 3UOXA 2CEAA 3QC9A 1RP0A 1OJTA 3K7MX 3AD8B 2C73A 1MMAA 5HHFA 3UU8A 2BG9B 1US7B 1BWCA 3UFEA 5IPYA 3MA9A 1VQWA 4UF0A 2BABA 2D5UA 2YG4A 2XFOA 3PUSA 4AI6A 1X79A 3P4WA 3KKJA 3AA0B 2VB6A 3R9UA 4GDPA 4PK6A 3ZMUB 4DSHA 3EAOA 4L0RA 3PUAA 3SWHA 4B3ST 4EEBA 2WDRA 4PAAA 4CY6A 2YN6A 1HX1B 3ANWB 2X50A 4X64T 5L3EB 4OK0A 1GQEA 4PK4A 1GTHA 2FJEA 4ISTA 2Q9QA 2BACA 2BCPA 2MBGA 3EF6A 3NBXX 2NWBA 2X3NA 3EANA 4LMKA 5DQWA 4H50A 2CBIA 3Q6JA 2HPLA 3N9PA 2M6IA 3LK2B 4GRTA 1P2HA 2V7JA 1EL5A 4DGKA 4NUUA 3EPTA 3K7QX 4ZZCA 3QSEA 1D1AA 4Z91A 3ZJ1A 3S5WA 1NHQA 4REKA 4H9PC 2VVNA 5JR9B 4ILBA 3U78A 1M62A 4IE7A 3OPCA 5KX5E 5J0ZA 1RYIA 1SHZC 2DKHA 3PO7A 2Q9QD 2E9XA 3GYJA 2XFNA 1IAPA 2C3DA 4O5UA 2UUCT 3CTYA 3H3AA 4B3RT 3BQKA 1JEHA 2DKIA 3AD7B 3P4QA 1TDNA 2R4EA 4TNVA 2BK4A 4KI0F 3DH9A 3UKKA 2YDRA 3PUZF 4P9SA 3FPZA 5AFUL 3UTGA 1SA0E 2RPAA 3MXZA 2K48A 3QJ4A 5L3FB 1T8BA 4DIDB 3IHGA 3Q5WA 4CY8A 1K0LA 3AD9B 3HR0A 2A89A 1MNEA 5LG3A 1I94T 5DJQC 4NXMT 3NGCX 3WAJA 2V8SV 2R0PA 3N2GE 4QH1A 1Z6LA 2OV9A 4FK1C 1L9DA 1T98A 3GWHA 4E0VA 4JI6T 3G5RA 3TKLB 2HHHT 1BGNA 2XAJB 4EGWA 1FJGT 4H4UA 2VL8A 2WESA 2YOEA 4AP1A 1KNRA 2UXDT 2PYXA 2WSSV 2YM1A 3KFWX 3LADA 4AXPA 1CBOA 3JADA 4OPLA 4LFCT 4Y4LA 5A1LA 3HKCE 1HYUA 2BKOA 3NLCA 5JDNA 3UKLA 4J34A 1OEDC 5CA0E 3NRYA 4X1YE 4AQFA 3AEBA 2N9DA 4G9KA 4WCTA 4OYKA 5EB4A 3ONLC 4CN6A 3CQXC 4A9WA 4YJ3E 1UKVG 3ZEFB 4DV2T 3KA7A 1GRBA 2WQYA 2XQ4A 2VL0A 5FXVA 1E7PA 1IUWA 2YK0A 3UOZA 2WMNA 1R8IA 4PFPA 1KK7A 4GR1A 1O3XA 1MO9A 3CNSA 4A7AA 1K0IA 2BVMA 3ZT7A 1S3BA 4U2TA 3G5QA 4H2PA 4TV8E 5LP6E 3NRXA 3VRAA 5FL0A 5ABFB 2WEUA 3ONJA 4X1KE 3GWFA 4LFBT 5LMUT 4GKJT 1NDAA 1MMNA 5JCIA 3UTKA 4LFAT 2UU9T 5ABGA 4HGAA 4KX6A 4X66T 2XTLA 2XFUA 5EOWA 3N9LA 2NOXA 4UVBB 1TYTA 2W67A 3DJDA 1YD8G 1SE7A 2GMJA 1OJ9A 2C7GA 3I9WA 3CPJG 1FIOA 1PBBA 2CMRA 1XPQA 1FL2A 5FKYA 4HTEA 2UUAT 4U8KA 2J1DG 3NT6A 4HE8A 5HXCA 4G74A 5JCMA 3RC8A 1DNCA 4MBQA 5GONE 2CWOA 3B6DA 4M52A 2EHOC 4IDPA 4U2ZA 4UR9A 4GAVA 4IE6A 2LSJA 3VR9A 2C67A 3JAEA 2EQ7A 1CJ2A 4UIGA 2ZZCA 1N4UA 2V5DA 1G73A 3P4PA 2GB0A 5L3CB 4XAXB 3LJPA 3T1HT 3G06A 3NZQA 4ILUA 4MFRA 2E8IA 5GRTA 3G5SA 4NEWA 2XAQB 3AEDA 2AQJA 4Z26A 2ACZA 4OPDA 3FXEB 3UOVA 5C3JA 2AE9A 5LJNA 2KINB 3GMCA 1LKXA 2A9UA 4X5TA 2NW9A 4PNIA 5FP3A 2JPFA 1E1HB 3IF8B 4AOXA 5AQNB 2ZM0A 3ALLA 4E7SA 2XZEA 4U31A 2K24A 1IBKT 4CXWA 3K1SA 5FY1A 2UXBT 4Z8XA 3HKBE 5AQLB 4HEAA 5DABA 1BR0A 2CWYA 3L8RA 4EZHA 1JRXA 5C2TA 2SPCA 2GV8A 2XAHB 2V6OA 3JSKA 2A3DA 1CC4A 3PUQA 4MALA 1P2EA 3ZCIA 3C4XA 2RGJA 3D1CA 5CJ5A 2RABA 5BMVE 3O1IA 3O1HA 4GCMA 2YU1A 4BJMA 4ZZBA 4WZXA 2LEHA 3E08A 2KLQA 5EK3A 4UDQA 4C5OA 2K3WA 2JBVA 4HFBA 2YVGA 1MIWA 2N2NA 4LF8T 2BBHA 4CI1B 3VR8A 4TM0A 2UXXB 1LVKA 4LA1A 3LJCA 1DOEA 4CN4A 3F57A 3RKOA 1IBMT 4EOZB 4UXNB 4EMIA 5JDHA 3T2ZA 4UDPA 1GETA 3L1RA 5JDFA 5GSNA 2XQ9A 1L9EA 1WYBA 2WU2A 2VQFT 2UZZA 5ABFA 1HTJF 3NKZA 4AQFC 1YKJA 2IIUA 1KFYA 3RYFE 1U5PA 2J47A 1DOBA 1S3EA 1DOCA 3GWDA 4XZCA 3ZN1B 2C5IT 4APNA 1HNZT 2VZ2A 3OYZA 4TNWA 3C64A 3RRCA 4GDEA 2BG9A 3GN5A 3ZMSB 3RYHE 5BR8T 1GRTA 1S2YA 1XDIA 1PN0A 2MPKA 5FS8A 3RYCE 4LF4T 3RP8A 2VVLA 4IIJE 4USQA 2YR4A 2QGSA 1JRZA 5LV9A 5KWFA 2LM2A 4OVIA 3PV0F 3UTEA 2VOUA 4PFOA 3AB3B 2XLRA 3UULA 2LKHA 5CA1E 5AQJB 2BVLA 2DCFA 2BCGG 4A79A 1HX8A 4U2YA 2Q0KA 2C75A 3DJEA 3WE0A 4QHOA 1HR0T 1NHPA 3ZN0B 2E9XB 2BDEA 3C4NA 1GRAA 3SX6A 4YHJA 1KDGA 4O2AE 3GA8A 3GYIA 4ADWA 2XLPA 2Y6RA 3ANWA 5AQIB 1GPEA 3L09A 4DR1T 1N4VA 4CI2B 2WOIA 5JRCA 3UQ7A 5BULA 5FS9A 5JR9A 2I59A 3I3LA 3RQUA 2V5ZA 1BZLA 2C65A 4K5RA 2LJLA 3N5LA 1KF6A 4JI5T 1N1PA 3RP7A 3KBUA 1E6EA 2GAGB 3QVRA 1WYCA 3RNMA 5CFBA 4KMCA 3K3OA 2BC1A 2I0ZA 1GNDA 2XLTA 2VK9A 3FMWA 5L47A 1BR4A 2R0CA 1PBEA 4B6XA 1TDFA 2X8HA 4IL9A 5M10A 5HEJA 3ATRA 4AIUA 5KVIA 3K30A 4J31A 1GRHA 2YG5A 4P09A 4A56A 2HN2A 2ZM8A 4JNQA 5LGTB 5KMSA 3KPKA 2NTXA 1LPFA 5HEUA 3QSSA 2XQ5A 3PUVF 3EVYA 3AAIA 3NWIA 2V7MA 2H7VC 3JC6D 1L9CA 1TYPA 4YSHA 4PABA 3CNJA 5HWXA 2XQ6A 1V9DA 5L4HA 4KPRA 3BNMA 1T72A 1CC6A 3VKGA 4H4SA 5EK4A 3RH3A 1FCDA 4N9XA 2NR4A 3U3IA 1MIVA 1PBFA 3GSIA 3BNUA 2V6YA 2V60A 1B37A 1PHHA 1WR0A 1GTEA 1CHUA 5E0OA 3UT5E 4HKAA 5J2TE 1GXFA 4AKGA 2XM1A 3RQWA 2C4CA 5ADXL 3GN5B 4IVMB 4IVOB 2GMHA 5LGUB 4O4LE 3KV5A 2C5KT 3P4SA 4LMLA 1EZ3A 5AQFB 3H4KA 2WCAA 2KXPB 2QVAA 3HYVA 4CZZB 1DJNA 3H8LA 4DMVA 4HFIA 3RC3A 4UV9B 2WPCA 4Z2RA 3KBTA 4AKHA 4U7YA 5FVKA 1YXRA 4H4QA 1GT8A 1OJAA 4XWRA 2IMLA 1FOHA 4QXBB 3ZYXA 2LSIA 2UXCT 4IT4A 3AYIA 2XLSA 4NWZA 3KV4A 2ZMAA 3AA7B 3JCFA 3UUXB 2X68A 2VQBA 4IL4A 2GVCA 4AKLA 1EBDA 4RSLA 4V1Av 2XSAA 3AEEA 4CQIA 3AYJA 5L3GB 4TM1A 2A8XA 2XCGA 1F6MA 3HKDE 2XY8B 1E1NA 2CULA 2NP9A 4J2CA 2V1DB 1QLBA 1J5ET 1N33T 4JQ9A 3O4XE 1XWMA 5AQQB 1LV0A 3AEGA 4G6GA 1WRDA 5KXJA 1OEDB 4EEDA 4EXTA 1M64A 4MLKA 3QK6A 1UUSA 2E2AA 3R6NA 4LF9T 2VRMA 4NXNT 1ZEEA 4IE4A 3SM8A 3SZFA 4OPUA 2JQKA 2Q9QB 5BUKA 3KV6A 4P0AA 4KP3C 2X51A 3DK4A 3KVEA 3DMEA 2BA9A 4EQSA 2WETA 4GK0E 4I4TE 2VURA 3ICSA 5KMQA 3J9X1 5JDGA 2KNDA 3CWZB 2GRTA 1CC2A 3CMLA 3X1DA 3CX7B 2NW8A 1ZHCA 4YTPA 4JLEA 2WP5A 2WS3A 3ZYMA 1TDEA 3Q5EA 4GYRA 4H4WA 2YU2A 5ABHA 5LHGB 2XQ8A 2X8CA 1UK5A 3H37A 2GQWA 3REDA 4DUZT 4ZS2A 2XDOA 4B65A 2VRLA 2B7RA 3KD9A 2WZHA 1S2QA 5F3JA 2LKGA 2EHOB 3NK2X 1S35A 5FYMA 3T37A 2CBJA 2V6YB 3CKDA 4H4TA 1Q9IA 2H89A 4HB9A 4O5QA 3NTDA 1H82A 2OLOA 3B13A 2C5JA 4HWDA 3RHWA 5J60A 3N9MA 2BS4A 1OEDE 1X31B 2X8GA 3AXBA 1H7CA 5KMGP 1Q1WA 4QWNB 4EIPA 3IC9A 2CCQA 4I0UA 1KSSA 4Z2TA 3AEFA 4JN9A 5LNKA 4DMWA 3LZXA 4C3YA 4JI2T 3MK7C 4GAPA 3TLVA 1W09A 2YR5A 5M0ZA 4Z90A 3BK9A 3ALMA 3GD3A 2IVEA 2R46A 2V7LA 2JB1A 4BAYB 3FZLB 3OJAA 4YHHT 1PXCA 3NK1X 1O5WA 4ISSA 2DHRA 2YINA 3NNEA 5KRQA 4JUYA 2R6GF 4U8NA 3EABA 5LMNT 4ASKA 2XM2A 4CCQA 4IDOA 4HFDA 3ZLIA 2Q6UA 2YLWA 5DBJA 2JAEA 5EB5A 1V59A 4HWHA 2IVDA 2HN1A 1J1JA 3AVSA 4JI7T 5JDMA 5BRTA 2XVIA 4DV3T 3ICRA 1LRZA 1NPXA 5U63A 4JY3A 5HXRA 2BK3A 3TLUA 1F3PA 3DJGX 1W0BA 4AQYT 1VRQB 3AB1A 2WBLA 4TWDA 4JBWF 3GMBA 3FB2A 4Q25A 2Y6QA 5EBKA 3ZPOA 1Y0PA 1LQUA 5LBQB 4DNAA 2VQET 5AQPB 2FJDA 2B76A 4LU6A 2YLXA 1LVLA 2UXNB 1XDPA 4A99A 2WWUA 1IUUA 3K7TA 2O9ZA 5IWAT 4HWIB 3GD4A 4TX5A 3LK42 5KVHA 4UP3A 1PBDA 4GOUA 2OLTA 2J62A 2Z5XA 5JR9C 4LIIA 3AE9A 2JMKA 5L4EA 4WX1A 3VU7H 3ESLA 3P1WA 2X0YA 4AKIA 2BC0A 2E5LT 2CHNA 3CGDA 2IC6A 4DV7T 1FMWA 3PJAJ 5LB7B 3LSVA 5JDLA 4ECHA 3H8IA 2QAEA 4F8HA 3FBZA 3LOVA 4G6HA 4AOSA 3FZMB 4JY2A 1PXBA 5KNLA 2JMHA 4DO0A 4L9IA 4U2SA 2YDQA 3RIUA
chains in the Genus database with same CATH topology
1GESA 3CNTA 4GDEA 3M13A 1XDIA 1S2YA 1GRTA 2YR6A 4NTCA 2WU5A 1PN0A 1Y56A 2HQMA 2YG6A 3HYXA 4CCRA 1IJHA 5FS8A 4DSGA 4B67A 2AR8A 3RP8A 3P9UA 4I58A 2VVLA 4NTEA 4USQA 1MXTA 1ZK7A 3CNPA 2YR4A 4U8LA 1PBCA 3QFBA 1JRZA 3UOYA 5LV9A 3S61A 5KWFA 1ZKQA 4AT2A 3CNDA 2R45A 1KSUA 4OVIA 3CMMA 1GV4A 3UKAA 2ZZBA 3T31A 3HYWA 3UTEA 2VOUA 4NEVA 2XLRA 1GRGA 3CGBA 1GALA 1H81A 3B3RA 1H7WA 3VRDB 1O95A 2R0GA 2C3CA 2EQ6A 4TM3A 2BCGG 3ITJA 4A79A 2Q0KA 1H86A 2C75A 3DJEA 2E4GA 1N4WA 3WE0A 2RGOA 2XVFA 3Q9TA 1NHPA 2QA1A 2C70A 4A6NA 1SEZA 1GRAA 3C4NA 1L0VA 3SX6A 4ZN0A 2PHHA 2XLUA 1KDGA 2Q7VA 1NG4A 2YG7A 4EMWA 4TLZA 3GYIA 4ADWA 4YWOA 2XLPA 2Y6RA 4D04A 1XANA 1GPEA 4EQWA 1N4VA 4J57A 2BRAA 2GQFA 2WOIA 3GRSA 3FBSA 4NTDA 4XXGA 2JKCA 1FEAA 5FS6A 4Z44A 2NVKX 4BURA 4C77A 4OPIA 5CKUA 5BULA 4H2RA 5FS9A 3HZLA 3NK0X 4I59A 2C76A 3I3LA 2QA2A 1EL8A 3QSMA 2V5ZA 1YQ3A 2GF3A 1BZLA 2C65A 4CBQA 4IA5A 3NKSA 2C72A 4K5RA 4TLXA 1KF6A 2GH5A 1ELIA 3CPIG 1N1PA 1Q1RA 1YQZA 3RP7A 3ADAB 5IQ1A 2YLRA 3URHA 1CJ4A 1Y56B 1E6EA 1KNPA 3UKFA 1LJ1A 2GAGB 2R9ZA 4BK2A 3VQRA 4Z24A 3QVRA 4H4VA 1PJ5A 3CGCA 2R4JA 3RNMA 3V3NA 4U8MA 4K7ZA 4J36A 2BC1A 1RP0A 1GNDA 2I0ZA 1OJTA 3UOXA 3K7MX 2XLTA 3AD8B 2OAMA 3UKQA 2C73A 5HHFA 3CPHG 2W0HA 3FMWA 2YLZA 1ONFA 3GRTA 2R0CA 1PBEA 5KOXA 1TDFA 2X8HA 1TDOA 3PVCA 4H4RA 1BWCA 5IPYA 2F5ZA 5M10A 4YKGA 3ATRA 2A87A 5L46A 1VQWA 3GDNA 2YLTA 2BABA 3K30A 5KVIA 2YG4A 2XFOA 2FJAA 4OPTA 4J31A 1GRHA 2YG5A 1MOKA 4NZHA 1COYA 4JNQA 5KMSA 1IUTA 3KKJA 2IIDA 3KPKA 4CNKA 1PDHA 1LPFA 4FK1A 3R9UA 3QSSA 1D4EA 4GDPA 3V3OA 4J2WA 4DSHA 3EAOA 2B7SA 4K8DA 2BS2A 2GR3A 3BI2A 1CF3A 1L9CA 2WDRA 1TYPA 2V3BA 3AYLA 4GF7A 1ZY8A 4PAAA 3ZDNA 4CY6A 2BK5A 2WBAA 4YSHA 1H83A 4PABA 3CNJA 3SFDA 2YM2A 2X50A 4MJWA 3NRNA 1F8RA 4BV6A 3AECA 3IF9A 3LZWA 4B68A 4EQXA 2GR1A 1D7LA 4KPRA 3BI5A 3NN0X 3BNMA 2OLNA 1GTHA 2OA1A 2FJEA 1CC6A 2BACA 4H4SA 1FCDA 4H2QA 2YAUA 4N9XA 2BCPA 3EF6A 1PBFA 1PS9A 3GSIA 4BJYA 2X3NA 3BNUA 3UTHA 3EANA 2V60A 4FDCB 1B37A 1PHHA 1GTEA 2BXRA 2JB2A 4H50A 2WDVA 1CHUA 3Q6JA 4GRTA 1NG3A 2WPEA 1GXFA 1P2HA 3PS9A 1EL5A 3DGHA 3KLJA 4H4ZA 4U8PA 4DGKA 2C4CA 3EPTA 3V76A 3K7QX 3LB8A 1DODA 3QSEA 4IVMB 5J7XA 4IVOB 2GMHA 3S5WA 4C3XA 1NHQA 1OJCA 1D4CA 3P4SA 2E1MA 4REKA 3RHAA 4U8JA 1E1LA 4RG4A 2RGHA 2OALA 5JCLA 4UDRA 3H4KA 3HYVA 2WPFA 1DJNA 4YSXA 3H8LA 1ZX9A 2WPCA 1RYIA 3ALJA 4Z2RA 5BVAA 2DKHA 3PO7A 2BS3A 4A6NB 3GYJA 3NYEA 2XFNA 4H4QA 4X9MA 3SXIA 2C3DA 1GT8A 3ISHA 1OJAA 4O5UA 2YVJA 3LXDA 3CTYA 3AE7A 2XVHA 1FOHA 4XWRA 1JEHA 2DKIA 1E1MA 3ZYXA 2Z5YA 3AD7B 3P4QA 2B9XA 1TDNA 2R4EA 3AYIA 2XLSA 2BK4A 4NWZA 3UP5A 3C4AA 3DH9A 3UKKA 3ABVA 3IHMA 1ZDLA 2B9YA 1E39A 2C66A 3NYFA 2VQBA 4P9SA 3FPZA 1D7YA 2GVCA 1EBDA 2J3NA 2TPRA 3F8RA 3KU9A 4RSLA 4ZCDA 3UTGA 2VVLG 1TRBA 4K5SA 3AEEA 2B9WA 3QJ4A 2WP9A 4ZCCA 3L8KA 3AYJA 3IHGA 4NNJA 1VG9A 2XYOA 4CY8A 1REOA 1K0LA 3AD9B 2A89A 4OPGA 4AP3A 4TM1A 4AT0A 4BK3A 2TMDA 1F8SA 2GAHB 1B5QA 2CDUA 2A8XA 1E1NA 1F6MA 2XCGA 3NGCX 3NTAA 4H4YA 2CULA 2R0PA 1M6IA 2BYBA 4Z2UA 1QLBA 2WOWA 1Z6LA 1OJDA 4JQ9A 1JNRA 1CJ3A 2YG3A 4FK1C 2C64A 1L9DA 3BHKA 4Y4NA 1LV0A 1EL7A 3AEGA 1IUXA 4G6GA 4E0VA 1O94A 1K0JA 5KXJA 3G5RA 1XHCA 1BGNA 2BXSA 1M64A 4H4UA 2WESA 2VRMA 4TM4A 4AP1A 3SM8A 1KNRA 4BK1A 2WOVA 3FG2P 3SZFA 2PYXA 4OPUA 1H7XA 1ZOYA 4J33A 4OCGA 5BUKA 2YM1A 4YSYA 3LADA 4YXDA 4IA6A 1CBOA 1FECA 4OPLA 3DK4A 3KVEA 3DMEA 4U8IA 4A5LA 2YLSA 3QFAA 2BA9A 2XFPA 4Y4LA 4EQSA 1HYUA 2WETA 5KMQA 3AWIA 4YT0A 2JK6A 3ICSA 1K4QA 3NLCA 2GR0A 1VDCA 2YVFA 2GR2A 4EM3A 5HYMA 3SZWA 4U8OA 2ARDA 2GRTA 4J34A 3UKLA 2V61A 1CC2A 3AEBA 3II4A 4G9KA 4WCTA 2WHDA 3D8XA 5EB4A 5FS7A 3NN6X 2LFCA 4A9WA 4X9NA 4YTPA 3DGZA 3VRBA 2WP5A 1UKVG 4RG3A 2WS3A 1TDEA 4H4WA 3KA7A 1GRBA 2WQYA 4J56A 1JNZA 1IUWA 1E7PA 1LQTA 1DJQA 1JOAA 3F8DA 4FX9A 1CJCA 3AE6A 2X8CA 3UOZA 4ICYA 4II2A 3AE3A 4GR1A 1PJ6A 1ZP0A 1MO9A 3UTFA 3CNSA 5U25A 1IUVA 4A7AA 4U2SA 1K0IA 2GQWA 1FEBA 3REDA 3I6DA 4B1BA 5ER0A 3SZ0A 4C74A 1S3BA 3AE5A 4U2TA 1QJDA 3G5QA 4H2PA 2XDOA 4B65A 2VRLA 4EM4A 3VRAA 2GEWA 2WEUA 2B7RA 3CN8A 3NH3X 3GWFA 3KD9A 3SFEA 1S2QA 1NDAA 1B8SA 2VQ7A 3DK9A 5JCIA 3UKPA 5TR3A 5HXIA 3NK2X 3T37A 3AE4A 4KX6A 4H4TA 1Q9IA 2H89A 1QO8A 1NEKA 4HB9A 2XFUA 4O5QA 3NTDA 3DJDA 5EOWA 1TYTA 1H82A 4IV9A 2OLOA 2GMJA 3M12A 1OJ9A 2C7GA 1W4XA 1PBBA 3CPJG 5J60A 4YSZA 1XPQA 2BS4A 1FL2A 1X31B 2WP6A 2X8GA 4G73A 4A65A 4CNJA 3AXBA 4B64A 5IQ4A 5KMRA 3NIXA 4U8KA 4Y4MA 3NT6A 3ICTA 4G74A 4YTMA 1Q1WA 1GRFA 5JCMA 4EIPA 3IC9A 1VG0A 2FBWA 1DNCA 3GYXA 1KSSA 1CL0A 4Z2TA 3AEFA 4HA6A 4JNAA 3B6DA 4JN9A 4M52A 4B63A 3SY4A 3T2KA 1GOSA 3LZXA 4GAVA 4C3YA 1PJ7A 4XWZA 3VR9A 2C67A 4GUVA 3CGEA 2ZZ0A 3IWAA 1BGJA 4GAPA 1BKWA 4EMJA 2EQ7A 1CJ2A 2XVEA 2YWLA 2YR5A 2ZZCA 1H84A 1N4UA 5M0ZA 4B66A 3P4PA 2GB0A 4H7UA 3ALMA 3GD3A 1D4DA 2IVEA 3BHFA 2R46A 3LJPA 4EIQA 2QCUA 2JB1A 1YY5A 3P4RA 1PXCA 1TDKA 1O5WA 3CIRA 3NK1X 3DA1A 1NAAA 3NNEA 5KRQA 1GSNA 4U8NA 1NHRA 4USRA 4CCQA 1D5TA 2BRYA 2Q6UA 2YLWA 5DBJA 3G5SA 2JAEA 5EB5A 5GRTA 5FMHA 1V59A 4NEWA 3M0OA 2V3AA 1AOGA 3AEDA 1JRYA 5JCKA 2AQJA 4Z26A 2ACZA 1F8WA 4OPDA 2IVDA 4II3A 3UOVA 5C3JA 1H6VA 3NG7X 2XVIA 4X4JA 3GMCA 3GDPA 4Z43A 5BRTA 3AE8A 3ICRA 1NPXA 3DK8A 3QVPA 4CRTA 5U63A 4JY3A 2BK3A 1F3PA 4AOXA 1GERA 3ALLA 3AEAA 3DJGX 4K2XA 1VRQB 2EQ9A 2NPXA 3AB1A 3AE1A 3DJJA 5U1OA 3GMBA 3COXA 3KPFA 1JRXA 2Y6QA 5EBKA 3UKHA 5C2TA 3BI4A 2E5VA 2GV8A 1Y0PA 2V6OA 4U2LA 1LQUA 3JSKA 3T0KA 3ATQA 1CC4A 3UP4A 4H2NA 1P2EA 2X99A 4BJZA 4DNAA 3AE2A 1RSGA 2H88A 2RGJA 3D1CA 1ZMCA 3NYCA 2RABA 3F8PA 2FJDA 2B76A 1JU2A 4GCMA 2YLXA 2CFYA 4LU6A 1LVLA 3T2YA 1GREA 3C96A 4H4PA 4A99A 1IUUA 3K7TA 4B69A 2CVJA 1NHSA 4C5OA 1LTXR 4UDQA 3SGLA 2JBVA 2O9ZA 2YQUA 3E1TA 2YVGA 4JDRA 3RP6A 3GD4A 3UCLA 1PXAA 4UP3A 5KMPA 5KVHA 3VR8A 1PBDA 4TM0A 3SZCA 4EQRA 1IUSA 4LA1A 4OPCA 4H4XA 2AAQA 2Z5XA 2ZBWA 1DOEA 2XFQA 4LIIA 3AE9A 1YQ4A 4YKFA 4Z25A 3SQPA 2FJBA 4D03A 1GEUA 2JB3A 3FIMB 3OZ2A 2Q0LA 5CQFA 2APGA 4K22A 4EMIA 4WX1A 3T2ZA 4UDPA 1GETA 3P1WA 3L1RA 5GSNA 1L9EA 2BC0A 3CGDA 2WU2A 1NENA 1BF3A 1ZOVA 3O0HA 3T14A 4ECHA 5HY5A 3H8IA 5JCNA 3OC4A 2UZZA 2QAEA 1B4VA 2EQ8A 2WDQA 1EL9A 1YKJA 3LOVA 4G6HA 5KOWA 4YTNA 1KFYA 3SYIA 4AOSA 2VVMA 4JY2A 1PXBA 1DOBA 3NHOX 5KNLA 1S3EA 1DOCA 1ZMDA 3GWDA 2XVJA 4APNA 1DXLA 1E1KA 2VZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GES A;  3CNT A;  4GDE A;  3M13 A;  1XDI A;  1S2Y A;  1GRT A;  2YR6 A;  4NTC A;  2WU5 A;  1PN0 A;  1Y56 A;  2HQM A;  2YG6 A;  4CCR A;  1IJH A;  5FS8 A;  4DSG A;  4B67 A;  2AR8 A;  3RP8 A;  3P9U A;  4I58 A;  2VVL A;  4NTE A;  4USQ A;  1MXT A;  1ZK7 A;  3CNP A;  2YR4 A;  4U8L A;  1PBC A;  3QFB A;  1JRZ A;  3UOY A;  5LV9 A;  3S61 A;  5KWF A;  1ZKQ A;  4AT2 A;  3CND A;  2R45 A;  1KSU A;  4OVI A;  1GV4 A;  3UKA A;  2ZZB A;  3UTE A;  2VOU A;  4NEV A;  2XLR A;  1GRG A;  3CGB A;  1GAL A;  1H81 A;  3B3R A;  1H7W A;  3VRD B;  1O95 A;  2R0G A;  2C3C A;  2EQ6 A;  4TM3 A;  2BCG G;  3ITJ A;  4A79 A;  2Q0K A;  1H86 A;  2C75 A;  3DJE A;  2E4G A;  1N4W A;  3WE0 A;  2RGO A;  2XVF A;  3Q9T A;  1NHP A;  2QA1 A;  2C70 A;  4A6N A;  1SEZ A;  1GRA A;  3C4N A;  1L0V A;  4ZN0 A;  2PHH A;  2XLU A;  1KDG A;  2Q7V A;  1NG4 A;  2YG7 A;  4EMW A;  4TLZ A;  3GYI A;  4ADW A;  4YWO A;  2XLP A;  2Y6R A;  4D04 A;  1XAN A;  1GPE A;  4EQW A;  1N4V A;  4J57 A;  2GQF A;  2WOI A;  3GRS A;  3FBS A;  4NTD A;  4XXG A;  2JKC A;  1FEA A;  5FS6 A;  4Z44 A;  2NVK X;  4BUR A;  4C77 A;  4OPI A;  5CKU A;  5BUL A;  4H2R A;  5FS9 A;  3HZL A;  3NK0 X;  4I59 A;  2C76 A;  3I3L A;  2QA2 A;  1EL8 A;  3QSM A;  2V5Z A;  1YQ3 A;  2GF3 A;  1BZL A;  2C65 A;  4CBQ A;  4IA5 A;  3NKS A;  2C72 A;  4K5R A;  4TLX A;  1KF6 A;  2GH5 A;  1ELI A;  3CPI G;  1N1P A;  1Q1R A;  1YQZ A;  3RP7 A;  3ADA B;  5IQ1 A;  2YLR A;  3URH A;  1CJ4 A;  1Y56 B;  1E6E A;  1KNP A;  3UKF A;  1LJ1 A;  2GAG B;  2R9Z A;  4BK2 A;  3VQR A;  4Z24 A;  3QVR A;  4H4V A;  1PJ5 A;  3CGC A;  2R4J A;  3RNM A;  3V3N A;  4U8M A;  4K7Z A;  4J36 A;  2BC1 A;  1RP0 A;  1GND A;  2I0Z A;  1OJT A;  3UOX A;  3K7M X;  2XLT A;  3AD8 B;  2OAM A;  3UKQ A;  2C73 A;  5HHF A;  3CPH G;  2W0H A;  3FMW A;  2YLZ A;  1ONF A;  3GRT A;  2R0C A;  1PBE A;  5KOX A;  1TDF A;  2X8H A;  1TDO A;  3PVC A;  4H4R A;  1BWC A;  5IPY A;  2F5Z A;  5M10 A;  4YKG A;  3ATR A;  2A87 A;  5L46 A;  1VQW A;  3GDN A;  2YLT A;  2BAB A;  3K30 A;  5KVI A;  2YG4 A;  2XFO A;  2FJA A;  4OPT A;  4J31 A;  1GRH A;  2YG5 A;  1MOK A;  4NZH A;  1COY A;  4JNQ A;  1IUT A;  3KKJ A;  2IID A;  4CNK A;  1PDH A;  1LPF A;  4FK1 A;  3R9U A;  3QSS A;  1D4E A;  4GDP A;  3V3O A;  4J2W A;  4DSH A;  3EAO A;  2B7S A;  4K8D A;  2BS2 A;  2GR3 A;  3BI2 A;  1CF3 A;  1L9C A;  2WDR A;  1TYP A;  2V3B A;  3AYL A;  4GF7 A;  1ZY8 A;  4PAA A;  3ZDN A;  4CY6 A;  2BK5 A;  2WBA A;  4YSH A;  1H83 A;  4PAB A;  3CNJ A;  3SFD A;  2YM2 A;  2X50 A;  4MJW A;  3NRN A;  1F8R A;  4BV6 A;  3AEC A;  3IF9 A;  3LZW A;  4B68 A;  4EQX A;  2GR1 A;  1D7L A;  4KPR A;  3BI5 A;  3NN0 X;  3BNM A;  2OLN A;  1GTH A;  2OA1 A;  2FJE A;  1CC6 A;  2BAC A;  4H4S A;  1FCD A;  4H2Q A;  2YAU A;  4N9X A;  2BCP A;  3EF6 A;  1PBF A;  1PS9 A;  3GSI A;  4BJY A;  2X3N A;  3BNU A;  3UTH A;  3EAN A;  2V60 A;  4FDC B;  1B37 A;  1PHH A;  1GTE A;  2BXR A;  2JB2 A;  4H50 A;  2WDV A;  1CHU A;  3Q6J A;  4GRT A;  1NG3 A;  2WPE A;  1GXF A;  1P2H A;  3PS9 A;  1EL5 A;  3DGH A;  3KLJ A;  4H4Z A;  4U8P A;  4DGK A;  3EPT A;  3V76 A;  3K7Q X;  3LB8 A;  1DOD A;  3QSE A;  4IVM B;  5J7X A;  4IVO B;  2GMH A;  3S5W A;  4C3X A;  1NHQ A;  1OJC A;  1D4C A;  3P4S A;  2E1M A;  4REK A;  3RHA A;  4U8J A;  1E1L A;  4RG4 A;  2RGH A;  2OAL A;  5JCL A;  4UDR A;  3H4K A;  2WPF A;  1DJN A;  4YSX A;  3H8L A;  1ZX9 A;  2WPC A;  1RYI A;  3ALJ A;  4Z2R A;  5BVA A;  2DKH A;  3PO7 A;  2BS3 A;  4A6N B;  3GYJ A;  3NYE A;  2XFN A;  4H4Q A;  4X9M A;  2C3D A;  1GT8 A;  3ISH A;  1OJA A;  4O5U A;  2YVJ A;  3LXD A;  3CTY A;  3AE7 A;  2XVH A;  1FOH A;  4XWR A;  1JEH A;  2DKI A;  1E1M A;  3ZYX A;  2Z5Y A;  3AD7 B;  3P4Q A;  2B9X A;  1TDN A;  2R4E A;  3AYI A;  2XLS A;  2BK4 A;  3UP5 A;  3C4A A;  3DH9 A;  3UKK A;  3ABV A;  3IHM A;  1ZDL A;  2B9Y A;  1E39 A;  2C66 A;  3NYF A;  2VQB A;  4P9S A;  3FPZ A;  1D7Y A;  2GVC A;  1EBD A;  2J3N A;  2TPR A;  3F8R A;  3KU9 A;  4RSL A;  4ZCD A;  3UTG A;  2VVL G;  1TRB A;  4K5S A;  3AEE A;  2B9W A;  3QJ4 A;  2WP9 A;  4ZCC A;  3L8K A;  3AYJ A;  3IHG A;  1VG9 A;  2XYO A;  4CY8 A;  1REO A;  1K0L A;  3AD9 B;  2A89 A;  4OPG A;  4AP3 A;  4TM1 A;  4AT0 A;  4BK3 A;  2TMD A;  1F8S A;  2GAH B;  1B5Q A;  2CDU A;  2A8X A;  1E1N A;  1F6M A;  2XCG A;  3NGC X;  3NTA A;  4H4Y A;  2CUL A;  2R0P A;  1M6I A;  2BYB A;  4Z2U A;  1QLB A;  2WOW A;  1Z6L A;  1OJD A;  4JQ9 A;  1JNR A;  1CJ3 A;  2YG3 A;  4FK1 C;  2C64 A;  1L9D A;  3BHK A;  4Y4N A;  1LV0 A;  1EL7 A;  3AEG A;  1IUX A;  4E0V A;  1O94 A;  1K0J A;  5KXJ A;  3G5R A;  1XHC A;  1BGN A;  2BXS A;  1M64 A;  4H4U A;  2WES A;  2VRM A;  4TM4 A;  4AP1 A;  3SM8 A;  1KNR A;  4BK1 A;  2WOV A;  3FG2 P;  2PYX A;  4OPU A;  1H7X A;  1ZOY A;  4J33 A;  4OCG A;  5BUK A;  2YM1 A;  4YSY A;  3LAD A;  4YXD A;  4IA6 A;  1CBO A;  1FEC A;  4OPL A;  3DK4 A;  3KVE A;  3DME A;  4U8I A;  4A5L A;  2YLS A;  3QFA A;  2BA9 A;  2XFP A;  4Y4L A;  4EQS A;  1HYU A;  2WET A;  3AWI A;  4YT0 A;  2JK6 A;  3ICS A;  1K4Q A;  3NLC A;  2GR0 A;  1VDC A;  2YVF A;  2GR2 A;  4EM3 A;  5HYM A;  4U8O A;  2ARD A;  2GRT A;  4J34 A;  3UKL A;  2V61 A;  1CC2 A;  3AEB A;  3II4 A;  4WCT A;  2WHD A;  3D8X A;  5EB4 A;  5FS7 A;  3NN6 X;  2LFC A;  4A9W A;  4X9N A;  4YTP A;  3DGZ A;  3VRB A;  2WP5 A;  1UKV G;  4RG3 A;  2WS3 A;  1TDE A;  4H4W A;  3KA7 A;  1GRB A;  2WQY A;  4J56 A;  1JNZ A;  1IUW A;  1E7P A;  1LQT A;  1DJQ A;  1JOA A;  3F8D A;  4FX9 A;  1CJC A;  3AE6 A;  2X8C A;  3UOZ A;  4ICY A;  3AE3 A;  4GR1 A;  1PJ6 A;  1ZP0 A;  1MO9 A;  3UTF A;  3CNS A;  5U25 A;  1IUV A;  4A7A A;  4U2S A;  1K0I A;  2GQW A;  1FEB A;  3RED A;  3I6D A;  4B1B A;  5ER0 A;  4C74 A;  1S3B A;  3AE5 A;  4U2T A;  1QJD A;  3G5Q A;  4H2P A;  2XDO A;  4B65 A;  2VRL A;  4EM4 A;  3VRA A;  2GEW A;  2WEU A;  2B7R A;  3CN8 A;  3NH3 X;  3GWF A;  3KD9 A;  3SFE A;  1S2Q A;  1NDA A;  1B8S A;  2VQ7 A;  3DK9 A;  5JCI A;  3UKP A;  5TR3 A;  5HXI A;  3NK2 X;  3T37 A;  3AE4 A;  4KX6 A;  4H4T A;  1Q9I A;  2H89 A;  1QO8 A;  1NEK A;  4HB9 A;  2XFU A;  4O5Q A;  3NTD A;  3DJD A;  5EOW A;  1TYT A;  1H82 A;  4IV9 A;  2OLO A;  2GMJ A;  3M12 A;  1OJ9 A;  2C7G A;  1W4X A;  1PBB A;  3CPJ G;  5J60 A;  4YSZ A;  1XPQ A;  2BS4 A;  1FL2 A;  1X31 B;  2WP6 A;  2X8G A;  4A65 A;  4CNJ A;  3AXB A;  4B64 A;  5IQ4 A;  3NIX A;  4U8K A;  4Y4M A;  3NT6 A;  3ICT A;  4YTM A;  1Q1W A;  1GRF A;  5JCM A;  4EIP A;  3IC9 A;  1VG0 A;  2FBW A;  1DNC A;  3GYX A;  1KSS A;  1CL0 A;  4Z2T A;  3AEF A;  4HA6 A;  4JNA A;  3B6D A;  4JN9 A;  4M52 A;  4B63 A;  1GOS A;  3LZX A;  4C3Y A;  1PJ7 A;  4XWZ A;  3VR9 A;  2C67 A;  4GUV A;  3CGE A;  2ZZ0 A;  3IWA A;  1BGJ A;  1BKW A;  4EMJ A;  2EQ7 A;  1CJ2 A;  2XVE A;  2YWL A;  2YR5 A;  2ZZC A;  1H84 A;  1N4U A;  5M0Z A;  4B66 A;  3P4P A;  2GB0 A;  4H7U A;  3ALM A;  3GD3 A;  1D4D A;  2IVE A;  3BHF A;  2R46 A;  3LJP A;  4EIQ A;  2QCU A;  2JB1 A;  1YY5 A;  3P4R A;  1PXC A;  1TDK A;  1O5W A;  3CIR A;  3NK1 X;  3DA1 A;  1NAA A;  3NNE A;  5KRQ A;  1GSN A;  4U8N A;  1NHR A;  4USR A;  4CCQ A;  1D5T A;  2Q6U A;  5EB5 A;  2YLW A;  5DBJ A;  3G5S A;  2JAE A;  5GRT A;  5FMH A;  1V59 A;  4NEW A;  3M0O A;  2V3A A;  1AOG A;  3AED A;  1JRY A;  5JCK A;  2AQJ A;  4Z26 A;  2ACZ A;  1F8W A;  4OPD A;  2IVD A;  3UOV A;  5C3J A;  1H6V A;  3NG7 X;  2XVI A;  4X4J A;  3GMC A;  3GDP A;  4Z43 A;  5BRT A;  3AE8 A;  3ICR A;  1NPX A;  3DK8 A;  3QVP A;  4CRT A;  5U63 A;  4JY3 A;  2BK3 A;  1F3P A;  4AOX A;  1GER A;  3ALL A;  3AEA A;  3DJG X;  4K2X A;  1VRQ B;  2EQ9 A;  2NPX A;  3AB1 A;  3AE1 A;  3DJJ A;  5U1O A;  3GMB A;  3COX A;  3KPF A;  1JRX A;  2Y6Q A;  5EBK A;  3UKH A;  5C2T A;  3BI4 A;  2E5V A;  2GV8 A;  1Y0P A;  2V6O A;  4U2L A;  1LQU A;  3JSK A;  3ATQ A;  1CC4 A;  3UP4 A;  4H2N A;  1P2E A;  2X99 A;  4BJZ A;  4DNA A;  3AE2 A;  1RSG A;  2H88 A;  2RGJ A;  3D1C A;  1ZMC A;  3NYC A;  2RAB A;  3F8P A;  2FJD A;  2B76 A;  1JU2 A;  4GCM A;  2YLX A;  2CFY A;  4LU6 A;  1LVL A;  1GRE A;  3C96 A;  4H4P A;  4A99 A;  1IUU A;  3K7T A;  4B69 A;  2CVJ A;  1NHS A;  4C5O A;  1LTX R;  4UDQ A;  3SGL A;  2JBV A;  2O9Z A;  2YQU A;  3E1T A;  2YVG A;  4JDR A;  3RP6 A;  3GD4 A;  3UCL A;  1PXA A;  4UP3 A;  5KVH A;  3VR8 A;  1PBD A;  4TM0 A;  4EQR A;  1IUS A;  4LA1 A;  4OPC A;  4H4X A;  2AAQ A;  2Z5X A;  2ZBW A;  1DOE A;  2XFQ A;  4LII A;  3AE9 A;  1YQ4 A;  4YKF A;  4Z25 A;  3SQP A;  2FJB A;  4D03 A;  1GEU A;  2JB3 A;  3FIM B;  3OZ2 A;  2Q0L A;  5CQF A;  2APG A;  4K22 A;  4EMI A;  4WX1 A;  4UDP A;  1GET A;  3P1W A;  3L1R A;  5GSN A;  1L9E A;  2BC0 A;  3CGD A;  2WU2 A;  1NEN A;  1BF3 A;  1ZOV A;  3O0H A;  5HY5 A;  4ECH A;  5JCN A;  3H8I A;  3OC4 A;  2UZZ A;  2QAE A;  1B4V A;  2EQ8 A;  2WDQ A;  1EL9 A;  1YKJ A;  3LOV A;  5KOW A;  4YTN A;  1KFY A;  4AOS A;  2VVM A;  4JY2 A;  1PXB A;  1DOB A;  3NHO X;  1S3E A;  1DOC A;  1ZMD A;  3GWD A;  2XVJ A;  4APN A;  1DXL A;  1E1K A;  2VZ2 A; 
#chains in the Genus database with same CATH topology
 1GES A;  3CNT A;  4BJN A;  1J5W A;  4P1N A;  3HYX A;  2DLR A;  3NZP A;  1IJH A;  4DSG A;  2AR8 A;  4I58 A;  2D0T A;  4NTE A;  5J1G A;  1PBC A;  4AKR B;  1UUR A;  1XZY A;  3TLT A;  4EV6 A;  3CND A;  4AT2 A;  3UKA A;  1GAL A;  1H81 A;  3B3R A;  2LSY A;  3VRD B;  4IDZ A;  2EQ6 A;  3H3M A;  3ITJ A;  1H86 A;  3AA6 B;  2Q9Q C;  4AIS A;  2ZM2 A;  4U3C A;  2L9Q A;  1N4W A;  2CRB A;  2X9W A;  3MJX A;  2XQY A;  2C70 A;  4A6N A;  1WLX A;  2CHO A;  4DR4 T;  1NG4 A;  4EMW A;  1HFA A;  2C0S A;  3IBP A;  3Q2M A;  3O1J A;  2DNX A;  4D04 A;  4TUY E;  5HAX A;  4XXG A;  2JKC A;  4OPI A;  3HZL A;  2PJQ A;  2C76 A;  3KIN B;  4UEL A;  5HXH A;  1YQ3 A;  4HFC A;  3SS1 A;  4CBQ A;  1X9B A;  4TLX A;  2K9A A;  2GH5 A;  1ELI A;  3CPI G;  5IQ1 A;  2YLR A;  2X9Y A;  3KVB A;  1PJ5 A;  3I0O A;  2R4J A;  4HN9 A;  4J36 A;  3N9O A;  3UKQ A;  3CPH G;  2W0H A;  1D0Z A;  3GRT A;  5KOX A;  4DND A;  3PVC A;  4H4R A;  2F5Z A;  3PTR B;  4YKG A;  2J4G A;  3TLS A;  2FJA A;  4OPT A;  3PU8 A;  2ACX A;  1MOK A;  4NZH A;  4DR2 T;  5AQO B;  2IID A;  4FK1 A;  3AXJ B;  2ODV A;  2V7K A;  1XNR T;  2B7S A;  4K8D A;  2BS2 A;  4YY3 T;  3BI2 A;  5ETW A;  3AYL A;  4GF7 A;  2BK5 A;  2WBA A;  3W15 B;  1H83 A;  4NUV A;  2CXD A;  4KUM B;  2JRK A;  5IYZ E;  4MJW A;  3NRN A;  1F8R A;  4B68 A;  3IF9 A;  3LZW A;  2GR1 A;  4FI5 A;  3D0T A;  3BI5 A;  3NN0 X;  2CLY C;  2OLN A;  2YAU A;  5HXS A;  3UTH A;  4JYA T;  4FDC B;  1XDO A;  3ZYL A;  2BXR A;  2WDV A;  4IHJ E;  2H7O A;  3V5U A;  2KZ7 B;  4U8P A;  2LOS A;  4CXY A;  3V76 A;  4H63 H;  5J7X A;  2CPT A;  1XMO T;  3ZT6 A;  2LLY A;  2E1M A;  4U8J A;  5HEO A;  4OX9 T;  1HG2 A;  1FMV A;  1E1L A;  2RGH A;  5JCL A;  2VKJ A;  4DV6 T;  4QX8 B;  2W0G A;  4COF A;  3RGL A;  3B5M A;  3Q9D A;  2WPF A;  4YSX A;  1ZX9 A;  5JVD E;  3BQL A;  3ALJ A;  5BVA A;  2W2U A;  2BS3 A;  2ES0 A;  3SXI A;  2H3R A;  4LMJ A;  3NYE A;  5LJM A;  3ISH A;  3HA4 A;  3LXD A;  4ZXL A;  4B3M T;  3O9X A;  4ANJ A;  1E1M A;  2Z5Y A;  2B9X A;  4WW0 A;  4EYU A;  3RIU C;  2XHE B;  4P0B A;  3UP5 A;  4C91 A;  3ABV A;  3IHM A;  2B9Y A;  1E39 A;  5CGM A;  3NYF A;  4C3X A;  1D7Y A;  3KU9 A;  3RIF A;  3F8R A;  2IDO B;  3P7I A;  2VVL G;  4CN1 A;  1TRB A;  4ZI2 C;  4K5S A;  2B9W A;  2WP9 A;  4ZCC A;  3L8K A;  3JAF A;  4NNJ A;  4JI8 T;  4OPG A;  4O4J E;  3PE0 A;  3NTA A;  3CK6 A;  2V7I A;  4H4Y A;  2JQQ A;  3P50 A;  1G8X A;  4PW8 A;  2A2F X;  2ODU A;  4IGU A;  2VKH A;  2BYB A;  4Z2U A;  2WY2 A;  3WAK A;  1OJD A;  1CJ3 A;  2YG3 A;  2C64 A;  5TAO A;  4Y4N A;  2BG9 E;  1EL7 A;  1K0J A;  1XHC A;  2BXS A;  3BQI A;  2GK9 A;  3ZT5 A;  4TM4 A;  4NIQ A;  3CX8 B;  2WOV A;  3FG2 P;  2WZI A;  3QOF A;  2KT9 A;  4LF7 T;  2X0L B;  2LRL A;  3AAE B;  3JC6 C;  4IA6 A;  4ZI3 C;  3OKQ A;  4A5L A;  3QFA A;  4TWH A;  4EB6 E;  4H9N C;  2EHO D;  4PK5 A;  3AWI A;  2JK6 A;  1K4Q A;  2YVF A;  4EM3 A;  3SZW A;  5IHY A;  1VCT A;  2ARD A;  4U8O A;  2V61 A;  3M65 A;  4L5G A;  3C98 B;  2WHD A;  2HH7 A;  2Z6E A;  5FS7 A;  3NN6 X;  2PBI A;  1T7S A;  3MAC A;  3VRB A;  4RG3 A;  5HCJ A;  4IDN A;  4J56 A;  1JOA A;  3F8D A;  1CJC A;  5JDQ A;  3CPZ A;  3AE6 A;  4ICY A;  4II2 A;  1PJ6 A;  1ZP0 A;  4EIW A;  3C51 A;  1N32 T;  4EAH A;  4UEM A;  4C74 A;  3AE5 A;  1QJD A;  4PJN A;  3FBL A;  2VAS A;  3UFG A;  5F8P A;  2GEW A;  2I6H A;  4ZS3 A;  3UKP A;  5TR3 A;  3AE4 A;  4UVC B;  1YKE B;  3L39 A;  1WR6 A;  4IV9 A;  3ZKR A;  2LT3 A;  1W4X A;  5AQV B;  4YSZ A;  3ZSS A;  4CNJ A;  4TWF A;  5IQ4 A;  3RIA A;  3NIX A;  4Y4M A;  4PJJ A;  3ICT A;  2XUE A;  1WCR A;  4X1I E;  5LG4 A;  3GYX A;  4HA6 A;  4B3T T;  4JNA A;  4A98 A;  3N9Q A;  5J2U E;  5FNV E;  3T2K A;  4QKN A;  4EZ4 A;  1HNW T;  4XWZ A;  3CGE A;  2ZZ0 A;  3V5S A;  4B66 A;  4DR3 T;  4H7U A;  1D4D A;  3A7M A;  4EIQ A;  2W00 A;  1TDK A;  3PJA A;  2IC9 A;  4O4I E;  1OED A;  1NHR A;  1D5T A;  4JI1 T;  5FMH A;  3PDY A;  3A5X A;  1AJ3 A;  2V3A A;  4OYJ A;  1F8W A;  4HFE A;  3FZF B;  3NG7 X;  5EZY E;  3KDS E;  5LGN B;  4Z43 A;  3GDP A;  3AE8 A;  3DK8 A;  4CRT A;  2JQH A;  2W62 A;  4TZ4 C;  4K2X A;  3AEA A;  2NPX A;  3DJJ A;  3AE1 A;  1IBL T;  2NTY A;  5U1O A;  2V6X A;  4BA9 A;  2P9B A;  3KVA A;  3BI4 A;  3ATQ A;  1DU2 A;  3UP4 A;  4H2N A;  5LHH B;  4BJZ A;  1RSG A;  5HCM A;  1MMG A;  4H9S E;  1ZMC A;  4U72 A;  3ZCJ A;  1JU2 A;  4QH4 A;  2W63 A;  2CXF A;  1GRE A;  4H4P A;  5AQG B;  4B69 A;  3RLF F;  2N1G A;  3SGL A;  1MND A;  4JDR A;  3RP6 A;  1WFD A;  2BZB A;  3SZC A;  4HFH A;  1IUS A;  2XQ7 A;  4OPC A;  4H4X A;  4H63 V;  4IDQ A;  2V26 A;  3PUG A;  4O8S A;  4DV1 T;  2XFQ A;  1OWA A;  1YQ4 A;  4Z25 A;  2EHO A;  4AQG A;  2FJB A;  1GEU A;  3OZ2 A;  5CQF A;  2APG A;  3I0Q A;  2K5B B;  1NEN A;  3T14 A;  3O0H A;  5JCN A;  5FMN A;  1B4V A;  1NWM X;  2EQ8 A;  2WDQ A;  3AXJ A;  1EL9 A;  4YTN A;  3SYI A;  5FXX A;  3K8P C;  5LHI B;  4ERR A;  3PUR A;  1DXL A;  1FEW A;  4DVD A;  3M13 A;  3AA1 B;  4WBO A;  5C8Y E;  4M1P A;  3J7Y q;  5LCY A;  2YR6 A;  2WU5 A;  2YG6 A;  4CCR A;  2X67 A;  3LBX A;  3K3Q C;  4QXC B;  1W0A A;  4U74 A;  1S94 A;  4JEU B;  3CNP A;  1ZK7 A;  3OYX A;  4U8L A;  3QFB A;  3UOY A;  4DV0 T;  5H6R B;  1KSU A;  3CMM A;  3SOL A;  1GV4 A;  2YDS A;  3T31 A;  3HYW A;  3I9Y A;  1GRG A;  3CGB A;  4U7I A;  2IAK A;  2R0G A;  5FL1 A;  4O2B E;  3MZK B;  4C90 A;  2Y48 B;  2JQ9 A;  1SEZ A;  2PHH A;  2QRX A;  2LSK A;  2I0M A;  4QX7 B;  2Q7V A;  2YG7 A;  4TLZ A;  5L3D B;  1XAN A;  4EQW A;  4J57 A;  2BRA A;  3UUB A;  1KNZ A;  3UUN A;  4ZI2 D;  3GRS A;  3FBS A;  1FEA A;  5FS6 A;  4Z44 A;  4BUR A;  1MIY A;  3T8O A;  2X9H A;  4X62 T;  4H2R A;  3L3P A;  3NK0 X;  4KBM B;  5AQH B;  5LOV E;  3ZYK A;  2QA2 A;  3QSM A;  1ZV4 X;  2GF3 A;  4HWF A;  3RI5 A;  4IA5 A;  3NKS A;  4OFZ A;  3HI2 A;  1KEY A;  1Q1R A;  3ADA B;  3URH A;  1Y56 B;  3UKF A;  1KNP A;  4G2A A;  3FZH B;  1LJ1 A;  2R9Z A;  4BK2 A;  3VQR A;  2M67 A;  2L3L A;  4H4V A;  3ZMZ B;  5H6Q B;  3V3N A;  4G63 A;  4U8M A;  4K7Z A;  4HFV A;  2OAM A;  4JI4 T;  2YLZ A;  1YKH B;  3OBV E;  1ONF A;  1TDO A;  3F2E A;  2A87 A;  5L46 A;  3GDN A;  2YLT A;  4DR5 T;  4DBR A;  2Y8D A;  2W66 A;  3LDQ B;  2Y6X A;  3NVO A;  1COY A;  1IUT A;  4CNK A;  1IZN B;  1PDH A;  1XNQ T;  1D4E A;  3ZMT B;  3LK3 B;  3V3O A;  5FY7 A;  1Z0P A;  4J2W A;  2LHR A;  4WBN E;  2VKO A;  3LFM A;  2GR3 A;  4GYS A;  4XBF B;  1CF3 A;  3ZDN A;  2V3B A;  1Y01 A;  1ZY8 A;  2JIW A;  3SFD A;  2YM2 A;  4PJL A;  3Q5D A;  2JJ9 A;  4NPP A;  4PAG A;  4BV6 A;  3TLW A;  3AEC A;  3QB5 K;  2IHR 1;  1D7L A;  4EQX A;  3Q5X A;  2OA1 A;  3K3N A;  4H2Q A;  5F5W A;  1ZKE A;  2XSB A;  1PS9 A;  4BJY A;  2QA7 A;  3E0Z A;  5DQV A;  4LF6 T;  3I1A A;  3QB5 A;  2IW5 B;  3UU4 A;  2JB2 A;  5IUX A;  2MOZ A;  2RP4 A;  1NG3 A;  2WPE A;  3PS9 A;  3DGH A;  3KLJ A;  4H4Z A;  2KWI B;  4ZEY A;  3LB8 A;  2D0U A;  5LYJ E;  1DOD A;  1QSD A;  3C50 A;  4GIW A;  1D1B A;  2VWA A;  4K0U A;  3RF1 A;  1D4C A;  1OJC A;  3RHA A;  4JV5 T;  5L3B B;  4RG4 A;  2OAL A;  4UDR A;  2A72 A;  4CI3 B;  3UQ4 A;  2MAW A;  3LG7 A;  3RPU A;  3UU6 A;  1VRB A;  2KWH A;  4A6N B;  1HS7 A;  2CA5 A;  4X9M A;  2YVJ A;  3AE7 A;  2XVH A;  2ZLY A;  3F31 A;  3IA3 A;  3C4A A;  3KV9 A;  1ZDL A;  2C66 A;  2J3N A;  2TPR A;  4ZCD A;  3B57 A;  4WNK A;  5EK2 A;  1N36 T;  1UGO A;  3EUH A;  3PUX F;  2CXL A;  1VG9 A;  2XYO A;  4H9R C;  1REO A;  4AP3 A;  4AT0 A;  4BK3 A;  2TMD A;  1F8S A;  2GAH B;  4YLH A;  5JTG A;  1B5Q A;  2CDU A;  1BR2 A;  2QYW A;  2UUB T;  1M6I A;  2WOW A;  1JNR A;  4N78 D;  5AQM B;  3BHK A;  4YJ2 E;  1IUX A;  4DV4 T;  1O94 A;  1I6Z A;  2NW7 A;  2WMO A;  2F4V T;  3RX6 A;  4BK1 A;  3M3Z B;  5AQR B;  1H7X A;  1ZOY A;  4KHZ F;  4J33 A;  4OCG A;  4YSY A;  4UF0 B;  4YXD A;  1FEC A;  3EAM A;  2BKP A;  5FXZ A;  2YEV C;  4U8I A;  2YLS A;  2XFP A;  5L2L A;  1HCI A;  1D0X A;  2VVS A;  3ONX A;  4UVA B;  1UCU A;  4YT0 A;  4I55 E;  2GR0 A;  1VDC A;  5HYM A;  2GR2 A;  2PG8 A;  2VKD A;  2MYS A;  4X20 E;  3II4 A;  4ZI3 D;  3RYI E;  3ETU A;  3CQC B;  3D8X A;  4U33 A;  2LFC A;  2D9D A;  4HWC A;  4DR7 T;  4X9N A;  3DGZ A;  3CVR A;  3ZC1 A;  3N2K E;  1JNZ A;  5HWY A;  4OHF A;  4KHP T;  1DJQ A;  1LQT A;  5FVL A;  4FX9 A;  4ZOL E;  3AE3 A;  2BG9 C;  3UTF A;  3UUM A;  5U25 A;  1IUV A;  2AXD S;  2XPK A;  1FEB A;  4O4H E;  3I6D A;  2X66 A;  2WB5 A;  5ER0 A;  2BBJ A;  3SZ0 A;  4B1B A;  4E7Z A;  3N2O A;  4EM4 A;  4JI3 T;  4GK5 E;  3CN8 A;  3NH3 X;  1UX4 A;  3SFE A;  4DR6 T;  2VQ7 A;  3HKE E;  4EYY R;  1B8S A;  3DK9 A;  5HXI A;  2D2S A;  2HPJ A;  5FY0 A;  2WM9 A;  4H9Q C;  2DWG A;  1MMD A;  3DJB A;  1QO8 A;  1NEK A;  2DL1 A;  3PUY F;  4A97 A;  4ILA A;  3M12 A;  3VHL A;  1VOM A;  4YFS A;  5AQT B;  3CQG B;  5LBM A;  2WP6 A;  4G73 A;  4A65 A;  3PU3 A;  4B64 A;  5KMR A;  3UU3 A;  3QUJ A;  4YTM A;  5LXT E;  4TN7 B;  1GRF A;  5JH7 E;  1UX5 A;  1VG0 A;  2FBW A;  3FHN A;  1CL0 A;  5FXW A;  4A5X A;  5JQG E;  4B63 A;  3R84 B;  2XJ7 A;  3SY4 A;  1GOS A;  4X65 T;  1PJ7 A;  4GUV A;  3LBX B;  3OTO T;  3IWA A;  1BGJ A;  4K0K T;  1BKW A;  4EMJ A;  4FJO A;  2XVE A;  5AQU B;  1M7K A;  2YWL A;  3ZC0 A;  1H84 A;  4I43 B;  2IUB A;  2B1E A;  3BHF A;  2QCU A;  1YY5 A;  3P4R A;  3FXD B;  3CIR A;  3C4Z A;  3DA1 A;  4IE5 A;  1NAA A;  2LRK A;  1GSN A;  4USR A;  3EHZ A;  2X9X A;  1HG5 A;  2BRY A;  2W4X A;  2YKS A;  2CM0 A;  5CB4 E;  2KSR A;  3M0O A;  4IRE A;  3P8C D;  1AOG A;  1JRY A;  5JCK A;  4ADZ A;  4WYV A;  4II3 A;  1LVF A;  5AQK B;  1H6V A;  4X4J A;  3QVP A;  2ZM6 T;  4GKK T;  3DP7 A;  1GER A;  4H9O C;  2EQ9 A;  1E2A A;  3S4U A;  2LM9 A;  3E22 E;  4PJM A;  3COX A;  1CUN A;  3KPF A;  2XAF B;  3UKH A;  3ZST A;  2V5C A;  5AQS B;  2E5V A;  5HEH A;  4U2L A;  3T0K A;  3EDU A;  2X99 A;  3AE2 A;  1Z8U A;  2PTF A;  2H88 A;  2M6B A;  5HXE A;  1SUM B;  3QNU A;  4JI0 T;  3NYC A;  3FZK B;  3F8P A;  1Y64 B;  2CFY A;  4UV8 B;  3T2Y A;  3C96 A;  2CVJ A;  1NHS A;  1LTX R;  2YQU A;  3E1T A;  2OA5 A;  3UCL A;  1PXA A;  2CLY B;  5KMP A;  5JRE A;  4EQR A;  2AAQ A;  2ZBW A;  1D1C A;  3ZMV B;  4YKF A;  3SQP A;  4D03 A;  2JB3 A;  3C4W A;  3FIM B;  3PUW F;  1HNX T;  2Q0L A;  2XQ3 A;  2G0U A;  4K22 A;  2MTQ A;  4ZI7 E;  5ABE A;  2KMF A;  1YW0 A;  1BF3 A;  1ZOV A;  5HY5 A;  3OC4 A;  4CXX A;  3A8Y C;  4LF5 T;  5JRC B;  5KOW A;  2VVM A;  2PFV A;  3NHO X;  4QH5 A;  1ZMD A;  2XVJ A;  3GMI A;  2E9X D;  3T1Y T;  3OVU A;  1E1K A;  3AVR A;  3RKG A;  1B7T A;  2XAS B;  2CE7 A;  4NTC A;  1D0Y A;  1Y56 A;  2HQM A;  2RA1 A;  1VCS A;  2WWV A;  4B67 A;  1OXZ A;  3SRZ A;  2LHN A;  3P9U A;  3EDV A;  4DBQ A;  1MXT A;  4F6R C;  1QUU A;  4ZHQ E;  2XAG B;  3S61 A;  1ZKQ A;  3VKH A;  2R45 A;  5LA6 E;  3HL6 A;  2ZZB A;  3ETV A;  4DUY T;  2X0H A;  1N34 T;  4NEV A;  3UU5 A;  1H7W A;  1O95 A;  5HEG A;  2C3C A;  3EI0 A;  4I50 E;  4TM3 A;  4ILC A;  2E4G A;  3AAA B;  2BKN A;  1NAF A;  1HF8 A;  1U4Q A;  2RGO A;  2XVF A;  3Q9T A;  2QA1 A;  1L0V A;  4ZN0 A;  2XLU A;  2LSG A;  2L8K A;  1IJ6 A;  4JEH B;  4YWO A;  3N9N A;  3MKD A;  2W61 A;  2LOP A;  2GQF A;  3IHR A;  4NTD A;  2DI4 A;  2NVK X;  4C77 A;  3IEE A;  5CKU A;  5KDM C;  3RRW A;  4I59 A;  1W9R A;  1EL8 A;  2LE8 A;  2FUP A;  4TV9 E;  2WAU A;  5M4Y A;  3ZJ2 A;  4DV5 T;  2C72 A;  2E9X C;  3WI3 A;  4MHC A;  1YQZ A;  1IJ5 A;  4QXH B;  3DTO A;  1CJ4 A;  4IE0 A;  2DWK A;  5HYA A;  3CX6 B;  1BR1 A;  4Z24 A;  1XMQ T;  2XQA A;  3CGC A;  3UOX A;  2CEA A;  3QC9 A;  1RP0 A;  1OJT A;  3K7M X;  3AD8 B;  2C73 A;  1MMA A;  5HHF A;  3UU8 A;  2BG9 B;  1US7 B;  1BWC A;  3UFE A;  5IPY A;  3MA9 A;  1VQW A;  4UF0 A;  2BAB A;  2D5U A;  2YG4 A;  2XFO A;  3PUS A;  4AI6 A;  1X79 A;  3P4W A;  3KKJ A;  3AA0 B;  2VB6 A;  3R9U A;  4GDP A;  4PK6 A;  3ZMU B;  4DSH A;  3EAO A;  4L0R A;  3PUA A;  3SWH A;  4B3S T;  4EEB A;  2WDR A;  4PAA A;  4CY6 A;  2YN6 A;  1HX1 B;  3ANW B;  2X50 A;  4X64 T;  5L3E B;  4OK0 A;  1GQE A;  4PK4 A;  1GTH A;  2FJE A;  4IST A;  2Q9Q A;  2BAC A;  2BCP A;  2MBG A;  3EF6 A;  3NBX X;  2NWB A;  2X3N A;  3EAN A;  4LMK A;  5DQW A;  4H50 A;  2CBI A;  3Q6J A;  2HPL A;  3N9P A;  2M6I A;  3LK2 B;  4GRT A;  1P2H A;  2V7J A;  1EL5 A;  4DGK A;  4NUU A;  3EPT A;  3K7Q X;  4ZZC A;  3QSE A;  1D1A A;  4Z91 A;  3ZJ1 A;  3S5W A;  1NHQ A;  4REK A;  4H9P C;  2VVN A;  5JR9 B;  4ILB A;  3U78 A;  1M62 A;  4IE7 A;  3OPC A;  5KX5 E;  5J0Z A;  1RYI A;  1SHZ C;  2DKH A;  3PO7 A;  2Q9Q D;  2E9X A;  3GYJ A;  2XFN A;  1IAP A;  2C3D A;  4O5U A;  2UUC T;  3CTY A;  3H3A A;  4B3R T;  3BQK A;  1JEH A;  2DKI A;  3AD7 B;  3P4Q A;  1TDN A;  2R4E A;  4TNV A;  2BK4 A;  4KI0 F;  3DH9 A;  3UKK A;  2YDR A;  3PUZ F;  4P9S A;  3FPZ A;  5AFU L;  3UTG A;  1SA0 E;  2RPA A;  3MXZ A;  2K48 A;  3QJ4 A;  5L3F B;  1T8B A;  4DID B;  3IHG A;  3Q5W A;  4CY8 A;  1K0L A;  3AD9 B;  3HR0 A;  2A89 A;  1MNE A;  5LG3 A;  1I94 T;  5DJQ C;  4NXM T;  3NGC X;  3WAJ A;  2V8S V;  2R0P A;  3N2G E;  4QH1 A;  1Z6L A;  2OV9 A;  4FK1 C;  1L9D A;  1T98 A;  3GWH A;  4E0V A;  4JI6 T;  3G5R A;  3TKL B;  2HHH T;  1BGN A;  2XAJ B;  4EGW A;  1FJG T;  4H4U A;  2VL8 A;  2WES A;  2YOE A;  4AP1 A;  1KNR A;  2UXD T;  2PYX A;  2WSS V;  2YM1 A;  3KFW X;  3LAD A;  4AXP A;  1CBO A;  3JAD A;  4OPL A;  4LFC T;  4Y4L A;  5A1L A;  3HKC E;  1HYU A;  2BKO A;  3NLC A;  5JDN A;  3UKL A;  4J34 A;  1OED C;  5CA0 E;  3NRY A;  4X1Y E;  4AQF A;  3AEB A;  2N9D A;  4G9K A;  4WCT A;  4OYK A;  5EB4 A;  3ONL C;  4CN6 A;  3CQX C;  4A9W A;  4YJ3 E;  1UKV G;  3ZEF B;  4DV2 T;  3KA7 A;  1GRB A;  2WQY A;  2XQ4 A;  2VL0 A;  5FXV A;  1E7P A;  1IUW A;  2YK0 A;  3UOZ A;  2WMN A;  1R8I A;  4PFP A;  1KK7 A;  4GR1 A;  1O3X A;  1MO9 A;  3CNS A;  4A7A A;  1K0I A;  2BVM A;  3ZT7 A;  1S3B A;  4U2T A;  3G5Q A;  4H2P A;  4TV8 E;  5LP6 E;  3NRX A;  3VRA A;  5FL0 A;  5ABF B;  2WEU A;  3ONJ A;  4X1K E;  3GWF A;  4LFB T;  5LMU T;  4GKJ T;  1NDA A;  1MMN A;  5JCI A;  3UTK A;  4LFA T;  2UU9 T;  5ABG A;  4HGA A;  4KX6 A;  4X66 T;  2XTL A;  2XFU A;  5EOW A;  3N9L A;  2NOX A;  4UVB B;  1TYT A;  2W67 A;  3DJD A;  1YD8 G;  1SE7 A;  2GMJ A;  1OJ9 A;  2C7G A;  3I9W A;  3CPJ G;  1FIO A;  1PBB A;  2CMR A;  1XPQ A;  1FL2 A;  5FKY A;  4HTE A;  2UUA T;  4U8K A;  2J1D G;  3NT6 A;  4HE8 A;  5HXC A;  4G74 A;  5JCM A;  3RC8 A;  1DNC A;  4MBQ A;  5GON E;  2CWO A;  3B6D A;  4M52 A;  2EHO C;  4IDP A;  4U2Z A;  4UR9 A;  4GAV A;  4IE6 A;  2LSJ A;  3VR9 A;  2C67 A;  3JAE A;  2EQ7 A;  1CJ2 A;  4UIG A;  2ZZC A;  1N4U A;  2V5D A;  1G73 A;  3P4P A;  2GB0 A;  5L3C B;  4XAX B;  3LJP A;  3T1H T;  3G06 A;  3NZQ A;  4ILU A;  4MFR A;  2E8I A;  5GRT A;  3G5S A;  4NEW A;  2XAQ B;  3AED A;  2AQJ A;  4Z26 A;  2ACZ A;  4OPD A;  3FXE B;  3UOV A;  5C3J A;  2AE9 A;  5LJN A;  2KIN B;  3GMC A;  1LKX A;  2A9U A;  4X5T A;  2NW9 A;  4PNI A;  5FP3 A;  2JPF A;  1E1H B;  3IF8 B;  4AOX A;  5AQN B;  2ZM0 A;  3ALL A;  4E7S A;  2XZE A;  4U31 A;  2K24 A;  1IBK T;  4CXW A;  3K1S A;  5FY1 A;  2UXB T;  4Z8X A;  3HKB E;  5AQL B;  4HEA A;  5DAB A;  1BR0 A;  2CWY A;  3L8R A;  4EZH A;  1JRX A;  5C2T A;  2SPC A;  2GV8 A;  2XAH B;  2V6O A;  3JSK A;  2A3D A;  1CC4 A;  3PUQ A;  4MAL A;  1P2E A;  3ZCI A;  3C4X A;  2RGJ A;  3D1C A;  5CJ5 A;  2RAB A;  5BMV E;  3O1I A;  3O1H A;  4GCM A;  2YU1 A;  4BJM A;  4ZZB A;  4WZX A;  2LEH A;  3E08 A;  2KLQ A;  5EK3 A;  4UDQ A;  4C5O A;  2K3W A;  2JBV A;  4HFB A;  2YVG A;  1MIW A;  2N2N A;  4LF8 T;  2BBH A;  4CI1 B;  3VR8 A;  4TM0 A;  2UXX B;  1LVK A;  4LA1 A;  3LJC A;  1DOE A;  4CN4 A;  3F57 A;  3RKO A;  1IBM T;  4EOZ B;  4UXN B;  4EMI A;  5JDH A;  3T2Z A;  4UDP A;  1GET A;  3L1R A;  5JDF A;  5GSN A;  2XQ9 A;  1L9E A;  1WYB A;  2WU2 A;  2VQF T;  2UZZ A;  5ABF A;  1HTJ F;  3NKZ A;  4AQF C;  1YKJ A;  2IIU A;  1KFY A;  3RYF E;  1U5P A;  2J47 A;  1DOB A;  1S3E A;  1DOC A;  3GWD A;  4XZC A;  3ZN1 B;  2C5I T;  4APN A;  1HNZ T;  2VZ2 A;  3OYZ A;  4TNW A;  3C64 A;  3RRC A;  4GDE A;  2BG9 A;  3GN5 A;  3ZMS B;  3RYH E;  5BR8 T;  1GRT A;  1S2Y A;  1XDI A;  1PN0 A;  2MPK A;  5FS8 A;  3RYC E;  4LF4 T;  3RP8 A;  2VVL A;  4IIJ E;  4USQ A;  2YR4 A;  2QGS A;  1JRZ A;  5LV9 A;  5KWF A;  2LM2 A;  4OVI A;  3PV0 F;  3UTE A;  2VOU A;  4PFO A;  3AB3 B;  2XLR A;  3UUL A;  2LKH A;  5CA1 E;  5AQJ B;  2BVL A;  2DCF A;  2BCG G;  4A79 A;  1HX8 A;  4U2Y A;  2Q0K A;  2C75 A;  3DJE A;  3WE0 A;  4QHO A;  1HR0 T;  1NHP A;  3ZN0 B;  2E9X B;  2BDE A;  3C4N A;  1GRA A;  3SX6 A;  4YHJ A;  1KDG A;  4O2A E;  3GA8 A;  3GYI A;  4ADW A;  2XLP A;  2Y6R A;  3ANW A;  5AQI B;  1GPE A;  3L09 A;  4DR1 T;  1N4V A;  4CI2 B;  2WOI A;  5JRC A;  3UQ7 A;  5BUL A;  5FS9 A;  5JR9 A;  2I59 A;  3I3L A;  3RQU A;  2V5Z A;  1BZL A;  2C65 A;  4K5R A;  2LJL A;  3N5L A;  1KF6 A;  4JI5 T;  1N1P A;  3RP7 A;  3KBU A;  1E6E A;  2GAG B;  3QVR A;  1WYC A;  3RNM A;  5CFB A;  4KMC A;  3K3O A;  2BC1 A;  2I0Z A;  1GND A;  2XLT A;  2VK9 A;  3FMW A;  5L47 A;  1BR4 A;  2R0C A;  1PBE A;  4B6X A;  1TDF A;  2X8H A;  4IL9 A;  5M10 A;  5HEJ A;  3ATR A;  4AIU A;  5KVI A;  3K30 A;  4J31 A;  1GRH A;  2YG5 A;  4P09 A;  4A56 A;  2HN2 A;  2ZM8 A;  4JNQ A;  5LGT B;  5KMS A;  3KPK A;  2NTX A;  1LPF A;  5HEU A;  3QSS A;  2XQ5 A;  3PUV F;  3EVY A;  3AAI A;  3NWI A;  2V7M A;  2H7V C;  3JC6 D;  1L9C A;  1TYP A;  4YSH A;  4PAB A;  3CNJ A;  5HWX A;  2XQ6 A;  1V9D A;  5L4H A;  4KPR A;  3BNM A;  1T72 A;  1CC6 A;  3VKG A;  4H4S A;  5EK4 A;  3RH3 A;  1FCD A;  4N9X A;  2NR4 A;  3U3I A;  1MIV A;  1PBF A;  3GSI A;  3BNU A;  2V6Y A;  2V60 A;  1B37 A;  1PHH A;  1WR0 A;  1GTE A;  1CHU A;  5E0O A;  3UT5 E;  4HKA A;  5J2T E;  1GXF A;  4AKG A;  2XM1 A;  3RQW A;  2C4C A;  5ADX L;  3GN5 B;  4IVM B;  4IVO B;  2GMH A;  5LGU B;  4O4L E;  3KV5 A;  2C5K T;  3P4S A;  4LML A;  1EZ3 A;  5AQF B;  3H4K A;  2WCA A;  2KXP B;  2QVA A;  3HYV A;  4CZZ B;  1DJN A;  3H8L A;  4DMV A;  4HFI A;  3RC3 A;  4UV9 B;  2WPC A;  4Z2R A;  3KBT A;  4AKH A;  4U7Y A;  5FVK A;  1YXR A;  4H4Q A;  1GT8 A;  1OJA A;  4XWR A;  2IML A;  1FOH A;  4QXB B;  3ZYX A;  2LSI A;  2UXC T;  4IT4 A;  3AYI A;  2XLS A;  4NWZ A;  3KV4 A;  2ZMA A;  3AA7 B;  3JCF A;  3UUX B;  2X68 A;  2VQB A;  4IL4 A;  2GVC A;  4AKL A;  1EBD A;  4RSL A;  4V1A v;  2XSA A;  3AEE A;  4CQI A;  3AYJ A;  5L3G B;  4TM1 A;  2A8X A;  2XCG A;  1F6M A;  3HKD E;  2XY8 B;  1E1N A;  2CUL A;  2NP9 A;  4J2C A;  2V1D B;  1QLB A;  1J5E T;  1N33 T;  4JQ9 A;  3O4X E;  1XWM A;  5AQQ B;  1LV0 A;  3AEG A;  4G6G A;  1WRD A;  5KXJ A;  1OED B;  4EED A;  4EXT A;  1M64 A;  4MLK A;  3QK6 A;  1UUS A;  2E2A A;  3R6N A;  4LF9 T;  2VRM A;  4NXN T;  1ZEE A;  4IE4 A;  3SM8 A;  3SZF A;  4OPU A;  2JQK A;  2Q9Q B;  5BUK A;  3KV6 A;  4P0A A;  4KP3 C;  2X51 A;  3DK4 A;  3KVE A;  3DME A;  2BA9 A;  4EQS A;  2WET A;  4GK0 E;  4I4T E;  2VUR A;  3ICS A;  5KMQ A;  3J9X 1;  5JDG A;  2KND A;  3CWZ B;  2GRT A;  1CC2 A;  3CML A;  3X1D A;  3CX7 B;  2NW8 A;  1ZHC A;  4YTP A;  4JLE A;  2WP5 A;  2WS3 A;  3ZYM A;  1TDE A;  3Q5E A;  4GYR A;  4H4W A;  2YU2 A;  5ABH A;  5LHG B;  2XQ8 A;  2X8C A;  1UK5 A;  3H37 A;  2GQW A;  3RED A;  4DUZ T;  4ZS2 A;  2XDO A;  4B65 A;  2VRL A;  2B7R A;  3KD9 A;  2WZH A;  1S2Q A;  5F3J A;  2LKG A;  2EHO B;  3NK2 X;  1S35 A;  5FYM A;  3T37 A;  2CBJ A;  2V6Y B;  3CKD A;  4H4T A;  1Q9I A;  2H89 A;  4HB9 A;  4O5Q A;  3NTD A;  1H82 A;  2OLO A;  3B13 A;  2C5J A;  4HWD A;  3RHW A;  5J60 A;  3N9M A;  2BS4 A;  1OED E;  1X31 B;  2X8G A;  3AXB A;  1H7C A;  5KMG P;  1Q1W A;  4QWN B;  4EIP A;  3IC9 A;  2CCQ A;  4I0U A;  1KSS A;  4Z2T A;  3AEF A;  4JN9 A;  5LNK A;  4DMW A;  3LZX A;  4C3Y A;  4JI2 T;  3MK7 C;  4GAP A;  3TLV A;  1W09 A;  2YR5 A;  5M0Z A;  4Z90 A;  3BK9 A;  3ALM A;  3GD3 A;  2IVE A;  2R46 A;  2V7L A;  2JB1 A;  4BAY B;  3FZL B;  3OJA A;  4YHH T;  1PXC A;  3NK1 X;  1O5W A;  4ISS A;  2DHR A;  2YIN A;  3NNE A;  5KRQ A;  4JUY A;  2R6G F;  4U8N A;  3EAB A;  5LMN T;  4ASK A;  2XM2 A;  4CCQ A;  4IDO A;  4HFD A;  3ZLI A;  2Q6U A;  2YLW A;  5DBJ A;  2JAE A;  5EB5 A;  1V59 A;  4HWH A;  2IVD A;  2HN1 A;  1J1J A;  3AVS A;  4JI7 T;  5JDM A;  5BRT A;  2XVI A;  4DV3 T;  3ICR A;  1LRZ A;  1NPX A;  5U63 A;  4JY3 A;  5HXR A;  2BK3 A;  3TLU A;  1F3P A;  3DJG X;  1W0B A;  4AQY T;  1VRQ B;  3AB1 A;  2WBL A;  4TWD A;  4JBW F;  3GMB A;  3FB2 A;  4Q25 A;  2Y6Q A;  5EBK A;  3ZPO A;  1Y0P A;  1LQU A;  5LBQ B;  4DNA A;  2VQE T;  5AQP B;  2FJD A;  2B76 A;  4LU6 A;  2YLX A;  1LVL A;  2UXN B;  1XDP A;  4A99 A;  2WWU A;  1IUU A;  3K7T A;  2O9Z A;  5IWA T;  4HWI B;  3GD4 A;  4TX5 A;  3LK4 2;  5KVH A;  4UP3 A;  1PBD A;  4GOU A;  2OLT A;  2J62 A;  2Z5X A;  5JR9 C;  4LII A;  3AE9 A;  2JMK A;  5L4E A;  4WX1 A;  3VU7 H;  3ESL A;  3P1W A;  2X0Y A;  4AKI A;  2BC0 A;  2E5L T;  2CHN A;  3CGD A;  2IC6 A;  4DV7 T;  1FMW A;  3PJA J;  5LB7 B;  3LSV A;  5JDL A;  4ECH A;  3H8I A;  2QAE A;  4F8H A;  3FBZ A;  3LOV A;  4G6H A;  4AOS A;  3FZM B;  4JY2 A;  1PXB A;  5KNL A;  2JMH A;  4DO0 A;  4L9I A;  4U2S A;  2YDQ A;  3RIU A; 
#chains in the Genus database with same CATH homology
 1GES A;  3CNT A;  4GDE A;  3M13 A;  1XDI A;  1S2Y A;  1GRT A;  2YR6 A;  4NTC A;  2WU5 A;  1PN0 A;  1Y56 A;  2HQM A;  2YG6 A;  3HYX A;  4CCR A;  1IJH A;  5FS8 A;  4DSG A;  4B67 A;  2AR8 A;  3RP8 A;  3P9U A;  4I58 A;  2VVL A;  4NTE A;  4USQ A;  1MXT A;  1ZK7 A;  3CNP A;  2YR4 A;  4U8L A;  1PBC A;  3QFB A;  1JRZ A;  3UOY A;  5LV9 A;  3S61 A;  5KWF A;  1ZKQ A;  4AT2 A;  3CND A;  2R45 A;  1KSU A;  4OVI A;  3CMM A;  1GV4 A;  3UKA A;  2ZZB A;  3T31 A;  3HYW A;  3UTE A;  2VOU A;  4NEV A;  2XLR A;  1GRG A;  3CGB A;  1GAL A;  1H81 A;  3B3R A;  1H7W A;  3VRD B;  1O95 A;  2R0G A;  2C3C A;  2EQ6 A;  4TM3 A;  2BCG G;  3ITJ A;  4A79 A;  2Q0K A;  1H86 A;  2C75 A;  3DJE A;  2E4G A;  1N4W A;  3WE0 A;  2RGO A;  2XVF A;  3Q9T A;  1NHP A;  2QA1 A;  2C70 A;  4A6N A;  1SEZ A;  1GRA A;  3C4N A;  1L0V A;  3SX6 A;  4ZN0 A;  2PHH A;  2XLU A;  1KDG A;  2Q7V A;  1NG4 A;  2YG7 A;  4EMW A;  4TLZ A;  3GYI A;  4ADW A;  4YWO A;  2XLP A;  2Y6R A;  4D04 A;  1XAN A;  1GPE A;  4EQW A;  1N4V A;  4J57 A;  2BRA A;  2GQF A;  2WOI A;  3GRS A;  3FBS A;  4NTD A;  4XXG A;  2JKC A;  1FEA A;  5FS6 A;  4Z44 A;  2NVK X;  4BUR A;  4C77 A;  4OPI A;  5CKU A;  5BUL A;  4H2R A;  5FS9 A;  3HZL A;  3NK0 X;  4I59 A;  2C76 A;  3I3L A;  2QA2 A;  1EL8 A;  3QSM A;  2V5Z A;  1YQ3 A;  2GF3 A;  1BZL A;  2C65 A;  4CBQ A;  4IA5 A;  3NKS A;  2C72 A;  4K5R A;  4TLX A;  1KF6 A;  2GH5 A;  1ELI A;  3CPI G;  1N1P A;  1Q1R A;  1YQZ A;  3RP7 A;  3ADA B;  5IQ1 A;  2YLR A;  3URH A;  1CJ4 A;  1Y56 B;  1E6E A;  1KNP A;  3UKF A;  1LJ1 A;  2GAG B;  2R9Z A;  4BK2 A;  3VQR A;  4Z24 A;  3QVR A;  4H4V A;  1PJ5 A;  3CGC A;  2R4J A;  3RNM A;  3V3N A;  4U8M A;  4K7Z A;  4J36 A;  2BC1 A;  1RP0 A;  1GND A;  2I0Z A;  1OJT A;  3UOX A;  3K7M X;  2XLT A;  3AD8 B;  2OAM A;  3UKQ A;  2C73 A;  5HHF A;  3CPH G;  2W0H A;  3FMW A;  2YLZ A;  1ONF A;  3GRT A;  2R0C A;  1PBE A;  5KOX A;  1TDF A;  2X8H A;  1TDO A;  3PVC A;  4H4R A;  1BWC A;  5IPY A;  2F5Z A;  5M10 A;  4YKG A;  3ATR A;  2A87 A;  5L46 A;  1VQW A;  3GDN A;  2YLT A;  2BAB A;  3K30 A;  5KVI A;  2YG4 A;  2XFO A;  2FJA A;  4OPT A;  4J31 A;  1GRH A;  2YG5 A;  1MOK A;  4NZH A;  1COY A;  4JNQ A;  5KMS A;  1IUT A;  3KKJ A;  2IID A;  3KPK A;  4CNK A;  1PDH A;  1LPF A;  4FK1 A;  3R9U A;  3QSS A;  1D4E A;  4GDP A;  3V3O A;  4J2W A;  4DSH A;  3EAO A;  2B7S A;  4K8D A;  2BS2 A;  2GR3 A;  3BI2 A;  1CF3 A;  1L9C A;  2WDR A;  1TYP A;  2V3B A;  3AYL A;  4GF7 A;  1ZY8 A;  4PAA A;  3ZDN A;  4CY6 A;  2BK5 A;  2WBA A;  4YSH A;  1H83 A;  4PAB A;  3CNJ A;  3SFD A;  2YM2 A;  2X50 A;  4MJW A;  3NRN A;  1F8R A;  4BV6 A;  3AEC A;  3IF9 A;  3LZW A;  4B68 A;  4EQX A;  2GR1 A;  1D7L A;  4KPR A;  3BI5 A;  3NN0 X;  3BNM A;  2OLN A;  1GTH A;  2OA1 A;  2FJE A;  1CC6 A;  2BAC A;  4H4S A;  1FCD A;  4H2Q A;  2YAU A;  4N9X A;  2BCP A;  3EF6 A;  1PBF A;  1PS9 A;  3GSI A;  4BJY A;  2X3N A;  3BNU A;  3UTH A;  3EAN A;  2V60 A;  4FDC B;  1B37 A;  1PHH A;  1GTE A;  2BXR A;  2JB2 A;  4H50 A;  2WDV A;  1CHU A;  3Q6J A;  4GRT A;  1NG3 A;  2WPE A;  1GXF A;  1P2H A;  3PS9 A;  1EL5 A;  3DGH A;  3KLJ A;  4H4Z A;  4U8P A;  4DGK A;  2C4C A;  3EPT A;  3V76 A;  3K7Q X;  3LB8 A;  1DOD A;  3QSE A;  4IVM B;  5J7X A;  4IVO B;  2GMH A;  3S5W A;  4C3X A;  1NHQ A;  1OJC A;  1D4C A;  3P4S A;  2E1M A;  4REK A;  3RHA A;  4U8J A;  1E1L A;  4RG4 A;  2RGH A;  2OAL A;  5JCL A;  4UDR A;  3H4K A;  3HYV A;  2WPF A;  1DJN A;  4YSX A;  3H8L A;  1ZX9 A;  2WPC A;  1RYI A;  3ALJ A;  4Z2R A;  5BVA A;  2DKH A;  3PO7 A;  2BS3 A;  4A6N B;  3GYJ A;  3NYE A;  2XFN A;  4H4Q A;  4X9M A;  3SXI A;  2C3D A;  1GT8 A;  3ISH A;  1OJA A;  4O5U A;  2YVJ A;  3LXD A;  3CTY A;  3AE7 A;  2XVH A;  1FOH A;  4XWR A;  1JEH A;  2DKI A;  1E1M A;  3ZYX A;  2Z5Y A;  3AD7 B;  3P4Q A;  2B9X A;  1TDN A;  2R4E A;  3AYI A;  2XLS A;  2BK4 A;  4NWZ A;  3UP5 A;  3C4A A;  3DH9 A;  3UKK A;  3ABV A;  3IHM A;  1ZDL A;  2B9Y A;  1E39 A;  2C66 A;  3NYF A;  2VQB A;  4P9S A;  3FPZ A;  1D7Y A;  2GVC A;  1EBD A;  2J3N A;  2TPR A;  3F8R A;  3KU9 A;  4RSL A;  4ZCD A;  3UTG A;  2VVL G;  1TRB A;  4K5S A;  3AEE A;  2B9W A;  3QJ4 A;  2WP9 A;  4ZCC A;  3L8K A;  3AYJ A;  3IHG A;  4NNJ A;  1VG9 A;  2XYO A;  4CY8 A;  1REO A;  1K0L A;  3AD9 B;  2A89 A;  4OPG A;  4AP3 A;  4TM1 A;  4AT0 A;  4BK3 A;  2TMD A;  1F8S A;  2GAH B;  1B5Q A;  2CDU A;  2A8X A;  1E1N A;  1F6M A;  2XCG A;  3NGC X;  3NTA A;  4H4Y A;  2CUL A;  2R0P A;  1M6I A;  2BYB A;  4Z2U A;  1QLB A;  2WOW A;  1Z6L A;  1OJD A;  4JQ9 A;  1JNR A;  1CJ3 A;  2YG3 A;  4FK1 C;  2C64 A;  1L9D A;  3BHK A;  4Y4N A;  1LV0 A;  1EL7 A;  3AEG A;  1IUX A;  4G6G A;  4E0V A;  1O94 A;  1K0J A;  5KXJ A;  3G5R A;  1XHC A;  1BGN A;  2BXS A;  1M64 A;  4H4U A;  2WES A;  2VRM A;  4TM4 A;  4AP1 A;  3SM8 A;  1KNR A;  4BK1 A;  2WOV A;  3FG2 P;  3SZF A;  2PYX A;  4OPU A;  1H7X A;  1ZOY A;  4J33 A;  4OCG A;  5BUK A;  2YM1 A;  4YSY A;  3LAD A;  4YXD A;  4IA6 A;  1CBO A;  1FEC A;  4OPL A;  3DK4 A;  3KVE A;  3DME A;  4U8I A;  4A5L A;  2YLS A;  3QFA A;  2BA9 A;  2XFP A;  4Y4L A;  4EQS A;  1HYU A;  2WET A;  5KMQ A;  3AWI A;  4YT0 A;  2JK6 A;  3ICS A;  1K4Q A;  3NLC A;  2GR0 A;  1VDC A;  2YVF A;  2GR2 A;  4EM3 A;  5HYM A;  3SZW A;  4U8O A;  2ARD A;  2GRT A;  4J34 A;  3UKL A;  2V61 A;  1CC2 A;  3AEB A;  3II4 A;  4G9K A;  4WCT A;  2WHD A;  3D8X A;  5EB4 A;  5FS7 A;  3NN6 X;  2LFC A;  4A9W A;  4X9N A;  4YTP A;  3DGZ A;  3VRB A;  2WP5 A;  1UKV G;  4RG3 A;  2WS3 A;  1TDE A;  4H4W A;  3KA7 A;  1GRB A;  2WQY A;  4J56 A;  1JNZ A;  1IUW A;  1E7P A;  1LQT A;  1DJQ A;  1JOA A;  3F8D A;  4FX9 A;  1CJC A;  3AE6 A;  2X8C A;  3UOZ A;  4ICY A;  4II2 A;  3AE3 A;  4GR1 A;  1PJ6 A;  1ZP0 A;  1MO9 A;  3UTF A;  3CNS A;  5U25 A;  1IUV A;  4A7A A;  4U2S A;  1K0I A;  2GQW A;  1FEB A;  3RED A;  3I6D A;  4B1B A;  5ER0 A;  3SZ0 A;  4C74 A;  1S3B A;  3AE5 A;  4U2T A;  1QJD A;  3G5Q A;  4H2P A;  2XDO A;  4B65 A;  2VRL A;  4EM4 A;  3VRA A;  2GEW A;  2WEU A;  2B7R A;  3CN8 A;  3NH3 X;  3GWF A;  3KD9 A;  3SFE A;  1S2Q A;  1NDA A;  1B8S A;  2VQ7 A;  3DK9 A;  5JCI A;  3UKP A;  5TR3 A;  5HXI A;  3NK2 X;  3T37 A;  3AE4 A;  4KX6 A;  4H4T A;  1Q9I A;  2H89 A;  1QO8 A;  1NEK A;  4HB9 A;  2XFU A;  4O5Q A;  3NTD A;  3DJD A;  5EOW A;  1TYT A;  1H82 A;  4IV9 A;  2OLO A;  2GMJ A;  3M12 A;  1OJ9 A;  2C7G A;  1W4X A;  1PBB A;  3CPJ G;  5J60 A;  4YSZ A;  1XPQ A;  2BS4 A;  1FL2 A;  1X31 B;  2WP6 A;  2X8G A;  4G73 A;  4A65 A;  4CNJ A;  3AXB A;  4B64 A;  5IQ4 A;  5KMR A;  3NIX A;  4U8K A;  4Y4M A;  3NT6 A;  3ICT A;  4G74 A;  4YTM A;  1Q1W A;  1GRF A;  5JCM A;  4EIP A;  3IC9 A;  1VG0 A;  2FBW A;  1DNC A;  3GYX A;  1KSS A;  1CL0 A;  4Z2T A;  3AEF A;  4HA6 A;  4JNA A;  3B6D A;  4JN9 A;  4M52 A;  4B63 A;  3SY4 A;  3T2K A;  1GOS A;  3LZX A;  4GAV A;  4C3Y A;  1PJ7 A;  4XWZ A;  3VR9 A;  2C67 A;  4GUV A;  3CGE A;  2ZZ0 A;  3IWA A;  1BGJ A;  4GAP A;  1BKW A;  4EMJ A;  2EQ7 A;  1CJ2 A;  2XVE A;  2YWL A;  2YR5 A;  2ZZC A;  1H84 A;  1N4U A;  5M0Z A;  4B66 A;  3P4P A;  2GB0 A;  4H7U A;  3ALM A;  3GD3 A;  1D4D A;  2IVE A;  3BHF A;  2R46 A;  3LJP A;  4EIQ A;  2QCU A;  2JB1 A;  1YY5 A;  3P4R A;  1PXC A;  1TDK A;  1O5W A;  3CIR A;  3NK1 X;  3DA1 A;  1NAA A;  3NNE A;  5KRQ A;  1GSN A;  4U8N A;  1NHR A;  4USR A;  4CCQ A;  1D5T A;  2BRY A;  2Q6U A;  2YLW A;  5DBJ A;  3G5S A;  2JAE A;  5EB5 A;  5GRT A;  5FMH A;  1V59 A;  4NEW A;  3M0O A;  2V3A A;  1AOG A;  3AED A;  1JRY A;  5JCK A;  2AQJ A;  4Z26 A;  2ACZ A;  1F8W A;  4OPD A;  2IVD A;  4II3 A;  3UOV A;  5C3J A;  1H6V A;  3NG7 X;  2XVI A;  4X4J A;  3GMC A;  3GDP A;  4Z43 A;  5BRT A;  3AE8 A;  3ICR A;  1NPX A;  3DK8 A;  3QVP A;  4CRT A;  5U63 A;  4JY3 A;  2BK3 A;  1F3P A;  4AOX A;  1GER A;  3ALL A;  3AEA A;  3DJG X;  4K2X A;  1VRQ B;  2EQ9 A;  2NPX A;  3AB1 A;  3AE1 A;  3DJJ A;  5U1O A;  3GMB A;  3COX A;  3KPF A;  1JRX A;  2Y6Q A;  5EBK A;  3UKH A;  5C2T A;  3BI4 A;  2E5V A;  2GV8 A;  1Y0P A;  2V6O A;  4U2L A;  1LQU A;  3JSK A;  3T0K A;  3ATQ A;  1CC4 A;  3UP4 A;  4H2N A;  1P2E A;  2X99 A;  4BJZ A;  4DNA A;  3AE2 A;  1RSG A;  2H88 A;  2RGJ A;  3D1C A;  1ZMC A;  3NYC A;  2RAB A;  3F8P A;  2FJD A;  2B76 A;  1JU2 A;  4GCM A;  2YLX A;  2CFY A;  4LU6 A;  1LVL A;  3T2Y A;  1GRE A;  3C96 A;  4H4P A;  4A99 A;  1IUU A;  3K7T A;  4B69 A;  2CVJ A;  1NHS A;  4C5O A;  1LTX R;  4UDQ A;  3SGL A;  2JBV A;  2O9Z A;  2YQU A;  3E1T A;  2YVG A;  4JDR A;  3RP6 A;  3GD4 A;  3UCL A;  1PXA A;  4UP3 A;  5KMP A;  5KVH A;  3VR8 A;  1PBD A;  4TM0 A;  3SZC A;  4EQR A;  1IUS A;  4LA1 A;  4OPC A;  4H4X A;  2AAQ A;  2Z5X A;  2ZBW A;  1DOE A;  2XFQ A;  4LII A;  3AE9 A;  1YQ4 A;  4YKF A;  4Z25 A;  3SQP A;  2FJB A;  4D03 A;  1GEU A;  2JB3 A;  3FIM B;  3OZ2 A;  2Q0L A;  5CQF A;  2APG A;  4K22 A;  4EMI A;  4WX1 A;  3T2Z A;  4UDP A;  1GET A;  3P1W A;  3L1R A;  5GSN A;  1L9E A;  2BC0 A;  3CGD A;  2WU2 A;  1NEN A;  1BF3 A;  1ZOV A;  3O0H A;  3T14 A;  4ECH A;  5HY5 A;  3H8I A;  5JCN A;  3OC4 A;  2UZZ A;  2QAE A;  1B4V A;  2EQ8 A;  2WDQ A;  1EL9 A;  1YKJ A;  3LOV A;  4G6H A;  5KOW A;  4YTN A;  1KFY A;  3SYI A;  4AOS A;  2VVM A;  4JY2 A;  1PXB A;  1DOB A;  3NHO X;  5KNL A;  1S3E A;  1DOC A;  1ZMD A;  3GWD A;  2XVJ A;  4APN A;  1DXL A;  1E1K A;  2VZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...