1CHUA

Structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
532
structure length
478
Chain Sequence
b'NTLPEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMHDISTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPSILSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-ASPARTATE OXIDASE)
publication title Structure of L-aspartate oxidase: implications for the succinate dehydrogenase/fumarate reductase oxidoreductase family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Flavoenzyme
total genus 152
structure length 478
sequence length 532
ec nomenclature ec 1.4.3.16: L-aspartate oxidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 1chuA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1chuA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1chuA02
2BK5A 3LJPA 1PXCA 2YQUA 4GDEA 2JB2A 1BWCA 3BHFA 3CPIG 3IC9A 4WX1A 2F5ZA 1ZMCA 1YQ3A 2RGJA 5C2TA 3P9UA 3SQPA 3VRBA 4YTMA 5M0ZA 3K7MX 2FJBA 2FJEA 1PBFA 3ISHA 2WOIA 3ZDNA 1D7YA 3GRTA 2UZZA 2XVJA 3Q6JA 3ITJA 3G5QA 1EL5A 4O5QA 1E6EA 4D04A 3ICTA 3B3RA 2Q6UA 1GRFA 5C3JA 3BI5A 3EPTA 1K4QA 3CGEA 3GYJA 2GAHB 1E1KA 1GERA 2OALA 2VQ7A 1Y56A 1IUVA 1H81A 3NT6A 2BC1A 3UKPA 2YLRA 4GF7A 5KOXA 4U8JA 1NHRA 3AYLA 2YM1A 2YVJA 2YLSA 3OC4A 4DGKA 1LJ1A 1PBBA 1OJ9A 3VQRA 3QSMA 2C7GA 4A65A 2ZZ0A 5FS7A 1DOEA 1DNCA 4IA6A 1PXBA 4FX9A 1KNRA 1FECA 4EM4A 1E39A 3CNJA 3NIXA 4U8IA 2XYOA 4H2RA 1BKWA 2WBAA 4PABA 3S61A 1H7XA 3AEBA 4CCQA 5IQ4A 1OJDA 3AE9A 3NYCA 3FBSA 2EQ9A 4NEWA 2YG6A 2LFCA 2ARDA 3REDA 2WHDA 3CNTA 1QO8A 2RABA 4U2SA 3QFAA 3ZYXA 4D03A 3S5WA 1CJ2A 5JCLA 4Y4LA 1NAAA 4TM3A 2A87A 2BK3A 4CNKA 2C70A 3CIRA 2IVDA 3GD4A 4A99A 5L46A 4H4QA 5GSNA 2O9ZA 3DGHA 3AEEA 2XLRA 2WOVA 2GR0A 3H4KA 3F8DA 4Z44A 4O5UA 1H82A 1GTEA 2BK4A 3LZXA 3UOZA 3CTYA 1TYTA 3AE1A 1E1LA 1XDIA 4TLZA 2WEUA 2FJAA 4ADWA 2Y6QA 1GESA 3DJGX 2X50A 1M64A 5KXJA 4H4WA 4J34A 1D4CA 4K22A 3P1WA 3I3LA 5KRQA 2GAGB 4B65A 2H88A 2GMJA 4U8OA 2BYBA 3QVRA 3UTFA 2C75A 1B37A 1O94A 3AEDA 1D4DA 3II4A 3ATQA 5IPYA 4K5RA 1S2QA 1GRBA 1GOSA 1NDAA 3QFBA 4A5LA 1IUWA 4PAAA 3UKHA 4AOXA 4JN9A 1JU2A 2YR4A 1D5TA 3L1RA 3CNSA 3KVEA 2JKCA 3UKQA 4RG4A 3V3OA 1REOA 2Q0LA 1VQWA 1JRZA 1UKVG 2NVKX 1HYUA 2C65A 4ICYA 4EMWA 1CC2A 1GV4A 2B7SA 2OA1A 2Z5XA 4U8MA 1GALA 3NG7X 2R0PA 3BHKA 4Z24A 3LB8A 1RP0A 1PHHA 3GWDA 4ECHA 3WE0A 3KD9A 2R4EA 3URHA 5HXIA 2DKIA 1KF6A 1OJAA 1Y0PA 4JQ9A 4EQSA 3IWAA 2B76A 1DODA 4OVIA 3NK0X 2GF3A 4B63A 1CL0A 3RHAA 4X4JA 2BS2A 1VDCA 1OJCA 3AE2A 1L9DA 1X31B 3AXBA 3D1CA 4GDPA 4RSLA 4XXGA 3C96A 5JCNA 2OAMA 1BGNA 3IHMA 3PO7A 1ONFA 2V3BA 1NHQA 1YQ4A 3AE6A 2QA1A 4U8PA 1F8RA 1VRQB 5M10A 2RGHA 3VR8A 3UOXA 2XVFA 3GSIA 2YLTA 4B64A 4AOSA 3LOVA 4OPLA 1P2HA 1QJDA 2XDOA 3H8LA 3VR9A 2C73A 4UDQA 5U63A 4AP1A 1K0IA 4XWRA 3CNDA 3E1TA 4WCTA 3AYJA 4EQXA 4H4YA 3P4SA 4JDRA 4KX6A 2VOUA 3QSEA 2C67A 2ACZA 1PJ6A 3ICSA 4KPRA 1BF3A 2YR6A 1CBOA 2NPXA 2E1MA 2VZ2A 2GVCA 4OCGA 2W0HA 3UTHA 2V5ZA 4E0VA 3AB1A 3F8PA 4Y4NA 3AE5A 4J33A 4NEVA 2OLNA 4APNA 4TM1A 2RGOA 2I0ZA 1ZMDA 1MOKA 1LQTA 2GH5A 3P4QA 1BGJA 2YVGA 3NTAA 4AT0A 2A8XA 4YXDA 1PS9A 1S3BA 3ADAB 4AP3A 4EIPA 2C64A 3UKAA 4CY6A 4UP3A 3G5SA 4Z2TA 1EL7A 4H4XA 3BNMA 1NEKA 2XLUA 2Y6RA 3QSSA 3C4AA 1JNZA 1VG0A 2YG5A 3DJJA 3EAOA 5HYMA 4LU6A 3VRAA 5BULA 2ZZBA 2X8GA 3O0HA 4B68A 1GXFA 4GR1A 3UP5A 4YKFA 3NYFA 1H83A 3AD8B 4NTCA 4H2NA 2VRLA 1YKJA 2C3DA 3AEGA 4RG3A 4H2QA 1ZK7A 4YSXA 2JB1A 3NH3X 4B1BA 2ZBWA 1B4VA 5BRTA 2XFNA 5FS9A 4M52A 5HY5A 4GRTA 3UOVA 2VVLG 1EBDA 1S3EA 5JCKA 1LVLA 5U1OA 3KLJA 5JCIA 2Q0KA 4JY2A 4LIIA 1F3PA 3HZLA 4CRTA 2BACA 4XWZA 1MXTA 2R45A 3GWFA 2E4GA 4YT0A 4JNAA 4K8DA 3FG2P 3H8IA 3ALLA 1JOAA 3CGBA 2JBVA 3GYIA 4B66A 1D7LA 1H84A 3RP6A 1L9CA 3PS9A 5J7XA 5CQFA 1GEUA 1ELIA 1PN0A 2WDVA 2IVEA 2H89A 1PBEA 2B7RA 3DK4A 2HQMA 3CGCA 4H2PA 2CULA 4MJWA 2OLOA 4EM3A 4JY3A 2Q7VA 3GMBA 3KKJA 3AECA 3DJEA 3AE7A 3AEAA 3NTDA 4OPIA 4OPGA 4FK1A 1GNDA 5KVHA 4NTDA 2YLWA 2B9XA 1XHCA 4Z43A 5BUKA 3GMCA 1F8SA 1V59A 2WPEA 1GETA 4K5SA 4J56A 4OPCA 4CNJA 4NTEA 4BK2A 4CBQA 4H50A 4BK3A 4GCMA 2GMHA 2WS3A 1EL8A 2WP6A 4U2LA 1PBDA 4H4RA 2BXRA 4OPDA 4H4ZA 3UP4A 3AD7B 3DA1A 3NKSA 4HB9A 5KVIA 1KSSA 1LPFA 2GR3A 1EL9A 1XPQA 4J31A 4X9NA 3AE4A 4OPUA 5TR3A 4DNAA 1GSNA 1MO9A 4EMIA 1ZY8A 2V6OA 2B9YA 4AT2A 1IUTA 3DJDA 2FJDA 3LADA 2WU2A 5CKUA 1B5QA 1NENA 2CFYA 5BVAA 2TPRA 1RSGA 1E1NA 2QAEA 1CF3A 4A79A 3UKFA 3CPHG 2VVLA 3DK9A 1H86A 5FMHA 2V61A 4B67A 4ZN0A 2JK6A 3ATRA 3UOYA 1NHSA 2APGA 1E1MA 1NG4A 4YSHA 3SFEA 3GDNA 3Q9TA 1TRBA 2XFQA 4K7ZA 1O95A 5JCMA 3UKLA 1FEBA 1CC4A 5EB4A 4U8KA 3NLCA 3DH9A 1KFYA 3QJ4A 1JNRA 2WDRA 3M13A 4YWOA 3V3NA 4YTPA 4C3YA 1ZOYA 2PHHA 1VG9A 2BCPA 1LQUA 2XLPA 4CY8A 1FCDA 5ER0A 3BI4A 2WDQA 2B9WA 3NNEA 1CJCA 1K0LA 5EOWA 2X8CA 3ICRA 5EB5A 1O5WA 4IVOB 2GEWA 3NGCX 5IQ1A 2GRTA 1FOHA 4BJYA 1JEHA 4DSHA 1PBCA 4J2WA 4H4UA 3AEFA 1L9EA 1TYPA 2WETA 2XFOA 3B6DA 4U2TA 1GREA 4USQA 5DBJA 4REKA 4USRA 2XVEA 3SFDA 1Z6LA 3GRSA 3KA7A 3M12A 2WPFA 1GRAA 4H4TA 2JB3A 2BA9A 3ALMA 3QVPA 4EIQA 3KPFA 1N1PA 1KNPA 1RYIA 4Z25A 4J57A 3F8RA 1GT8A 4FDCB 4C5OA 3UTEA 4BK1A 4LA1A 3R9UA 1K0JA 1B8SA 3SGLA 4EQRA 4JNQA 4IVMB 3UCLA 2BS4A 2WOWA 3C4NA 3L8KA 3RP8A 3CNPA 1Q9IA 1YQZA 1NHPA 2EQ6A 3NHOX 2BXSA 5FS6A 3DMEA 3K30A 1GRHA 2VQBA 2J3NA 2R0CA 3EANA 3KU9A 1TDEA 2E5VA 2BCGG 4UDPA 5EBKA 4J36A 1N4UA 1IUXA 3GDPA 1IUSA 2TMDA 1F6MA 1ZDLA 2EQ7A 4EMJA 4ZCDA 1ZKQA 4YSZA 3COXA 3SM8A 3AD9B 3FMWA 2A89A 2WU5A 1PJ7A 1ZX9A 2YG4A 4UDRA 4Z2RA 1OJTA 5LV9A 4Y4MA 1COYA 2DKHA 2C72A 2GQFA 1F8WA 2XVIA 3CN8A 2YWLA 3AE8A 3V76A 3P4PA 3AYIA 1DJQA 1GRTA 2PYXA 3GYXA 3D8XA 4H7UA 3M0OA 2R46A 3DGZA 3T37A 3ALJA 1H7WA 3DK8A 4OPTA 4C74A 2JAEA 4YTNA 1YY5A 2X3NA 2XFPA 3NK2X 4K2XA 2YAUA 1KSUA 4P9SA 5FS8A 4A7AA 4BJZA 1DJNA 2WPCA 3I6DA 2IIDA 2QA2A 1W4XA 3AE3A 3BNUA 2GR1A 4H4SA 1DXLA 4Z2UA 3RP7A 1M6IA 2WESA 2C76A 4H4PA 1D4EA 1PXAA 1JRYA 3EF6A 4ZCCA 2CDUA 4TLXA 3NN0X 3IHGA 4TM0A 3UKKA 5KWFA 1TDKA 1Q1RA 3RNMA 1NG3A 2YG3A 1N4VA 1FEAA 3AWIA 5J60A 5U25A 4A6NB 2GR2A 1FL2A 2BS3A 1LV0A 5HHFA 2WP9A 3G5RA 2C66A 1CHUA 2ZZCA 1Y56B 4HA6A 2BABA 2XVHA 3NK1X 1Q1WA 2AAQA 3NYEA 3VRDB 4YKGA 2AQJA 4CCRA 4C77A 3GD3A 1E7PA 2XCGA 1CJ3A 1N4WA 3UTGA 2XLSA 2R4JA 3NN6X 1IUUA 4NZHA 2AR8A 3FPZA 4U8LA 4BV6A 4IA5A 1ZP0A 4YSYA 4X9MA 4FK1C 4DSGA 1PJ5A 1S2YA 2X8HA 2WP5A 2V3AA 2YVFA 1DOCA 3BI2A 3JSKA 1LTXR 4N9XA 4GUVA 5KOWA 2R0GA 4H4VA 2YLZA 1QLBA 2XFUA 2FBWA 1L0VA 4TM4A 1BZLA 3K7QX 4A9WA 1PDHA 2GB0A 3FIMB 2XLTA 5GRTA 2YLXA 4EQWA 1KDGA 1GTHA 3NRNA 4Z26A 1GRGA 3ABVA 1NPXA 4IV9A 4C3XA 2YM2A 2YR5A 1JRXA 3CPJG 2R9ZA 4BURA 3LXDA 2QCUA 1CJ4A 1TDOA 1SEZA 2BC0A 2YG7A 3CGDA 3OZ2A 4I58A 1AOGA 2VRMA 1DOBA 2WQYA 1TDNA 2GQWA 2X99A 3K7TA 1IJHA 1GPEA 2Z5YA 4B69A 1ZOVA 1XANA 2EQ8A 2V60A 1CC6A 1TDFA 4A6NA 3IF9A 1H6VA 2GV8A 3LZWA 3PVCA 1P2EA 4U8NA 2VVMA 3P4RA 4I59A 2C3CA 2CVJA
chains in the Genus database with same CATH superfamily
2BVLA 2BK5A 1OWAA 3CPIG 3IC9A 2WCAA 1ZMCA 3PUGA 1OEDB 1D0ZA 4JUYA 5M0ZA 1PBFA 5JDMA 4PK4A 1D7YA 2UZZA 3ITJA 3G5QA 4QH4A 4IL9A 2Q6UA 3I9WA 4OX9T 3JADA 3SY4A 2LKHA 2JQ9A 4U8JA 3EUHA 1NHRA 2YVJA 4WBNE 3OC4A 3VQRA 1T72A 4P0AA 1Y01A 4EZHA 5FS7A 1DOEA 5LBQB 2KLQA 3PUSA 4IA6A 4FX9A 1FMWA 4EM4A 3NIXA 4U8IA 2V7KA 2WBAA 3ZKRA 5BMVE 4NEWA 1NWMX 4EIWA 5JRCA 4YJ2E 2WHDA 2VKHA 1QO8A 3SZWA 4U2SA 3A5XA 3S5WA 4DNDA 1CJ2A 4GYRA 4TM3A 2XAGB 2Q9QB 4U3CA 2X0LB 4CNKA 3S4UA 2ES0A 4N78D 2NW7A 4CXXA 4JEUB 2BVMA 4JLEA 2O9ZA 4X64T 2XLRA 2WOVA 2F4VT 3ZMZB 4IE4A 2BK4A 3CTYA 5LMNT 5ADXL 3AE1A 1I94T 5HCJA 2CM0A 3PUWF 3ZPOA 2FJAA 2W67A 1GESA 2X50A 5DABA 4K22A 3P1WA 3I3LA 4TWDA 2H88A 2GMJA 3ZYKA 4U7YA 1O3XA 2XQ5A 5JR9B 3UTFA 1B37A 2KWHA 3II4A 5JDQA 1GRBA 1GOSA 3UKHA 4AOXA 1IBMT 3L1RA 2BG9A 3UKQA 3MACA 1REOA 2XJ7A 1JRZA 2WY2A 1HYUA 3I1AA 4ICYA 4MALA 5FXVA 2KWIB 4WYVA 1GV4A 1GALA 3I0QA 3JC6C 4COFA 3GWDA 3F31A 4HE8A 4TNVA 4ECHA 3T2ZA 3KD9A 4B3MT 2DKIA 1OJAA 2DNXA 3RHAA 3RKGA 2BRYA 4X4JA 1X31B 4RSLA 3C96A 5EZYE 3U3IA 2BG9E 1BGNA 4LF9T 3LG7A 2V3BA 1NHQA 3RC8A 3KFWX 5ABHA 2RGHA 3VR8A 2WZIA 2ZM0A 2YU1A 4O4JE 4ISTA 2QGSA 2XVFA 1BR4A 4OYJA 1E1HB 2UXBT 3RIUC 3H8LA 2WAUA 5FNVE 4HN9A 3CNDA 4EXTA 3ICSA 2YK0A 1PJ6A 3ZN1B 2UXDT 4XAXB 2NPXA 2JJ9A 2W0HA 2V5ZA 5HXSA 3AB1A 2FUPA 3RRWA 2OLNA 4APNA 4TM1A 2E9XA 4H9SE 3HL6A 1ZMDA 1FIOA 3FZLB 5L4EA 4DR6T 5JVDE 1SA0E 5AQOB 2C64A 3H37A 4UP3A 3BNMA 4UVAB 2LKGA 4ZI3D 3C4AA 4WW0A 2JQKA 4OYKA 2CXDA 3EDVA 3ZJ2A 4B68A 4GR1A 5H6QB 1FMVA 3NYFA 1H83A 1N33T 4H2QA 1ZK7A 4YSXA 4B1BA 2ZBWA 4GOUA 2XFNA 5HY5A 4GRTA 2VVLG 2IHR1 1EBDA 1S3EA 2D5UA 2V6YB 4GK5E 3F57A 5LGUB 3B13A 4LMKA 4PW8A 3C98B 4XZCA 2X67A 2VQFT 3H8IA 3CGBA 5FVKA 1D7LA 1L9CA 1N34T 1GEUA 3KBTA 1OEDA 4EM3A 1VCSA 2W0GA 5LBMA 3OVUA 4FK1A 1GNDA 2L3LA 3T1HT 5FY7A 5AQHB 3FZFB 2N9DA 3ZCIA 4Z43A 5BUKA 4H63H 3PU8A 3RF1A 4OPCA 2XQ7A 2X66A 4NTEA 2X9YA 4H50A 4GCMA 5EK3A 1EL8A 2IIUA 2BXRA 2MPKA 1S94A 1OEDE 5HXEA 5LJMA 1NAFA 4J31A 4X9NA 1ZV4X 5TR3A 4DNAA 1MO9A 4EMIA 2NW9A 2V6OA 1XZYA 2VURA 3DJDA 3ZT6A 5LHIB 1NENA 3SX6A 1E1NA 1CF3A 4FI5A 3CPHG 2Q9QA 3CVRA 2VVLA 2JK6A 5AQKB 3ATRA 5J2TE 3UU3A 3EHZA 3ZN0B 3SFEA 3GDNA 3Q9TA 4YSHA 1TRBA 3FBLA 3R84B 3ZLIA 3LK3B 5EB4A 2HPLA 1MIWA 3AAIA 4YWOA 1JNRA 2WDRA 4YTPA 2Z6EA 1LQUA 2XLPA 1FCDA 3BI4A 4EOZB 4HFEA 2B9WA 3NNEA 1LVKA 2X8CA 1X9BA 2K24A 3ZMSB 1D1BA 2QYWA 4HGAA 2GRTA 5JR9A 2LRKA 1JEHA 3AAEB 3KPKA 4DSHA 4G2AA 2WETA 2E2AA 3CKDA 4WBOA 5ABFB 3M12A 5HYAA 2X0YA 2C4CA 4BJMA 3QVPA 3QB5K 4UF0A 5JDHA 1RYIA 4JI1T 2R6GF 3T0KA 3T2KA 4EYUA 3NVOA 4LMJA 4BK1A 4C5OA 3ZSTA 1K0JA 4EQRA 2C5KT 4JNQA 5HXCA 3P7IA 2LSJA 1Q9IA 3AA1B 3N2KE 2EQ6A 5JREA 3NHOX 1GRHA 2VQBA 3H3MA 2R0CA 2XAQB 3EANA 3KU9A 1TDEA 2E5VA 1HNXT 4UDPA 5EBKA 4ZCDA 2W63A 3COXA 3SM8A 3AD9B 3FMWA 2K9AA 1ZX9A 2WZHA 4UDRA 2LSGA 2KT9A 2DKHA 4HWCA 4ILAA 3CN8A 4UVBB 3GYXA 3LFMA 2PYXA 3M0OA 2R46A 3DK8A 3HYWA 3DTOA 1YY5A 2EHOB 1KSUA 4TUYE 4G74A 1ZEEA 4ZZBA 2UUCT 3I6DA 3B5MA 3ZCJA 3BNUA 2GR1A 1DXLA 4IDZA 4H4PA 1J1JA 2V7LA 5KWFA 1Q1RA 3RNMA 5FL0A 1FEAA 3V5UA 4IDNA 1LV0A 3NZPA 4HA6A 2XAFB 1LKXA 4YKGA 4C77A 3GD3A 1OEDC 3G06A 1CJ3A 5LG3A 2CEAA 1IUUA 1D1CA 4F8HA 1ZP0A 2V7IA 4YSYA 4ZHQE 4FK1C 4CQIA 3HYVA 4DSGA 1LTXR 4H4VA 1QLBA 3NRXA 2M6IA 1L0VA 1BZLA 4A9WA 1XWMA 1PDHA 5JRCB 2XLTA 4EQWA 2BBJA 4Z26A 2V6YA 1GRGA 1U5PA 3ABVA 2J4GA 2LE8A 2ZM6T 4PK5A 1TDOA 2DCFA 3ZEFB 3R6NA 1MMNA 2YG7A 3CGDA 4LMLA 2VRMA 2WQYA 4KHPT 1TDNA 2X99A 3K7TA 2Z5YA 2BZBA 1TDFA 2V60A 2GV8A 5HXRA 1P2EA 3P4RA 3JCFA 4DUYT 2C3CA 2YQUA 3BHFA 3UU8A 2I0MA 5HEHA 2Q9QC 3P9UA 3SQPA 4YTMA 2DHRA 5HEUA 2FJBA 2BKPA 4FJOA 4ASKA 2K3WA 1EL5A 4D04A 2UXXB 5AQMB 3Q5XA 3B3RA 4JV5T 1IJ5A 1HG5A 2LT3A 3GYJA 2NW8A 4F6RC 3NT6A 2UXNB 3ETUA 5KOXA 5ETWA 3T14A 4UV9B 4Q25A 1WFDA 2AXDS 3UULA 2YM1A 3AB3B 3SRZA 1UGOA 2WBLA 4DV4T 3Q2MA 3QSMA 2C7GA 4CZZB 4A65A 4AKIA 2ZZ0A 3NZQA 2E9XD 4Z90A 5JR9C 4LF7T 3CNJA 2G0UA 2W62A 4H2RA 1BKWA 2CCQA 2LEHA 3E0ZA 2BDEA 2ARDA 3P4WA 4E7SA 4LFCT 1NAAA 2A87A 3CIRA 3RH3A 4IDPA 3O4XE 3GWHA 4A5XA 3C4XA 5L46A 5GSNA 3DGHA 3VKHA 4C90A 2IW5B 3L3PA 4B3RT 2GR0A 2JPFA 2W2UA 4HTEA 3F8DA 4L5GA 3LZXA 2XY8B 2CRBA 4EZ4A 5LG4A 4ADWA 3DJGX 4YHHT 5KRQA 4B65A 5ABFA 4ZXLA 3AVRA 4AKLA 5LXTE 2QVAA 2SPCA 3PUXF 5HAXA 4K5RA 1S2QA 1WRDA 2L9QA 1NDAA 1JU2A 2YR4A 1D5TA 3CNSA 3KVEA 2XASB 5LJNA 3RC3A 4RG4A 5AQLB 3V5SA 1UKVG 4K0UA 1N32T 4L9IA 4CN4A 5FL1A 2B7SA 1MNEA 4WNKA 2R0PA 4DV3T 3ANWB 4AKGA 1T98A 3BK9A 4O4HE 2WM9A 5LGNB 1D0XA 4B63A 1HNZT 3RLFF 2BS2A 1VDCA 4QKNA 1W9RA 1Z8UA 2NWBA 5JDGA 1CUNA 2Q9QD 3IHMA 1WR0A 1HTJF 3PE0A 3PU3A 2EHOA 2QA1A 1V9DA 1VRQB 2IUBA 2JQQA 4C91A 2NTXA 5DQVA 2BKNA 4B64A 3LOVA 1QJDA 2XDOA 4UDQA 5FKYA 3AYJA 4H4YA 2CWOA 3UUNA 4JDRA 4Z91A 3K3QC 1DU2A 4HFIA 4EB6E 2ACZA 1H7CA 5LYJE 4DUZT 2VZ2A 4OCGA 1UX4A 1YKEB 3IEEA 3UTHA 5IHYA 4E0VA 4GIWA 3N9QA 3N9NA 1MOKA 2GH5A 3NTAA 2A8XA 4DO0A 3TLUA 1PS9A 3ADAB 3HYXA 3QUJA 2WWVA 3G5SA 2KINB 2XLUA 2Y6RA 1JNZA 5AQPB 2E5LT 1VG0A 3N2GE 1GXFA 1VOMA 3O1HA 2AE9A 3UP5A 4NTCA 2C3DA 4J2CA 1YKHB 1B4VA 5FS9A 4UXNB 3UOVA 1LVLA 3CX7B 3KLJA 3HZLA 4YY3T 1MXTA 4YT0A 4JNAA 4DR4T 2JBVA 4TWFA 3RP6A 1Z0PA 4B66A 3E08A 2IC6A 4IGUA 1ELIA 1PN0A 4U33A 2IVEA 4H2PA 3DK4A 3CGCA 4JY3A 4A97A 3KKJA 5KVHA 4CI1B 2YLWA 2B9XA 5AFUL 3GMCA 3IA3A 4JI7T 1F8SA 5L3CB 1V59A 4J56A 4DMVA 4BK2A 4CBQA 2A2FX 4IIJE 3EAMA 4UF0B 3TLVA 2DL1A 3OTOT 3DA1A 1WR6A 4P09A 5GONE 3AE4A 3EABA 5F5WA 2XQ4A 1MIYA 4ZS3A 3LK42 1WYBA 2FJDA 3HKEE 3N9OA 1B5QA 4JBWF 2CFYA 4KMCA 2X68A 4DBQA 1RSGA 2CMRA 4KHZF 4A79A 4IL4A 3DK9A 1H86A 3ETVA 4I55E 1T7SA 5KMRA 4JI6T 4UVCB 2APGA 1NG4A 4DV7T 4K7ZA 5L2LA 3AA6B 2UUBT 4U8KA 3BQLA 4C3YA 2LSIA 5HWXA 1ZOYA 3PUZF 1VG9A 4CY8A 2XUEA 2LHNA 4E7ZA 3ICRA 1O5WA 5IQ1A 2GK9A 4TX5A 3C50A 4QX8B 4BAYB 4J2WA 4U2TA 5DBJA 4USQA 2EHOC 2XVEA 3GRSA 4DBRA 2WPFA 3MK7C 3ALMA 4B3ST 2BA9A 3KPFA 1GT8A 1B8SA 4IVMB 3UCLA 2CLYC 2WOWA 1N36T 3C4NA 1HCIA 1HF8A 3I0OA 3L8KA 4BJNA 1WYCA 4ILUA 2CHNA 2K48A 3K30A 3ANWA 5FS6A 3HI2A 3PUYF 1IUXA 3GDPA 4KP3C 1IUSA 2TMDA 1ZDLA 5F8PA 3MA9A 5KMSA 4IREA 3I9YA 4H9PC 2PG8A 2A89A 4PJLA 4HFVA 4HWDA 4Z2RA 1OJTA 2KSRA 4Y4MA 3VHLA 1F8WA 2XVIA 4X66T 2JMKA 3V76A 2DWGA 2V5DA 3PJAA 4O8SA 5F3JA 2H7VC 4ZI2C 4IE5A 2JRKA 4YTNA 3NK2X 2X3NA 4K2XA 2YAUA 4P9SA 5FS8A 1WLXA 3FBZA 1W4XA 3AAAB 4Z2UA 4TWHA 2LOPA 3RP7A 1XMOT 3FZKB 2WESA 2C76A 1PXAA 5A1LA 1JRYA 3EF6A 4ZCCA 1Y64B 4TLXA 3NN0X 3UKKA 3O1IA 4ILCA 3JC6D 4KUMB 4AXPA 5J2UE 2YINA 3UUBA 2XVHA 3NYEA 3UTKA 3PV0F 4B3TT 3UT5E 4PJMA 4NNJA 2XLSA 2R4JA 2HN1A 2AR8A 4PJNA 4X9MA 3ZJ1A 4ZI7E 2YVFA 1DOCA 3BI2A 3JSKA 1BR1A 4PFPA 4QX7B 4GUVA 5KOWA 4I4TE 5IYZE 2MTQA 3C64A 2ZM2A 4X20E 3X1DA 4X1YE 4JEHB 3FIMB 1WCRA 5LHGB 2YLXA 4MFRA 3CWZB 5CJ5A 2V6XA 4IV9A 1JRXA 3SYIA 2BKOA 2I59A 3QC9A 1CJ4A 3T8OA 1SEZA 3GN5B 5JH7E 3UUMA 5CGMA 3KVAA 2RPAA 3KV6A 2GQWA 4B69A 1XANA 4CI3B 3IF9A 3Q9DA 4DMWA 4I59A 3LJPA 3H3AA 1PXCA 4WX1A 4GDEA 5AQRB 1HR0T 4ZZCA 1YQ3A 5C2TA 5FVLA 4QXBB 2IMLA 3K7MX 3ISHA 4HWHA 3GRTA 2XVJA 1MMAA 1KNZA 1E6EA 2M67A 2YOEA 3RKOA 3ICTA 5AQJB 2V8SV 5C3JA 1GRFA 2YKSA 3EPTA 1K4QA 3CGEA 4PJJA 2GAHB 4HFDA 3KVBA 4CN1A 1E1KA 1GERA 2VQ7A 1Y56A 1IUVA 3PURA 2YLRA 4GF7A 2YLSA 4DGKA 1LJ1A 1PBBA 2LHRA 3Q5WA 1OJ9A 2I6HA 4O4LE 4X5TA 2DLRA 3VU7H 3HKBE 4DR2T 3FHNA 4A98A 1DNCA 1S35A 1PXBA 1KNRA 1FECA 3QOFA 4TNWA 5IQ4A 2L8KA 1ZKEA 3AE9A 3NYCA 3FBSA 2EQ9A 2YG6A 2LFCA 4I0UA 4G6GA 2XQ6A 3CNTA 3EI0A 3QFAA 3PDYA 5JCLA 4Y4LA 3AA0B 4NUVA 2BK3A 2C70A 2J62A 4JI8T 1R8IA 4A99A 2XAHB 4U2ZA 2B1EA 3SXIA 2V7JA 3FXDB 4Z44A 4O5UA 1H82A 1GTEA 1FEWA 2KNDA 2LRLA 3IHRA 5AQNB 5LNKA 4QH5A 3RI5A 1E1LA 1XDIA 3CMMA 1MMGA 2CLYB 2WEUA 4I43B 4IDQA 2Y6QA 4H4WA 1M64A 5KXJA 4J34A 1D4CA 3UU5A 4ZEYA 4NPPA 4JI4T 2GAGB 4HWFA 5JDNA 3QVRA 2BBHA 2CHOA 3ATQA 2XSAA 2V5CA 3A8YC 1IBLT 4G73A 4DR7T 3QFBA 1IUWA 4A5LA 3RYHE 1BR0A 2JKCA 1HX1B 2MYSA 3EDUA 2VKOA 2IDOB 4HWIB 3BQKA 1UCUA 1FJGT 2DI4A 2OA1A 2Z5XA 3TLSA 4Z24A 1ZHCA 1RP0A 4II3A 4TN7B 4PK6A 4IE6A 3WE0A 5HCMA 3HR0A 2R4EA 2PJQA 3URHA 5HXIA 1M62A 1KK7A 3KDSE 5EK2A 3LDQB 2RP4A 2GF3A 2J47A 3AE2A 1L9DA 3D1CA 4XXGA 3CQCB 4OK0A 1ONFA 1YQ4A 4PNIA 2JIWA 5M10A 2M6BA 4NXNT 5LMUT 5L4HA 5HXHA 3GSIA 4OPLA 1P2HA 2C73A 3L39A 1YXRA 3RHWA 1XDOA 2Y8DA 3N9PA 1K0IA 4XWRA 5IWAT 4O4IE 4PAGA 4K0KT 2LM2A 2XZEA 4OFZA 4WCTA 4EQXA 3P4SA 4U7IA 4KX6A 2WMOA 2VOUA 3QSEA 4KPRA 4ISSA 2E8IA 1BF3A 2YR6A 5LCYA 2GVCA 4UIGA 3ZC0A 5KDMC 4P1NA 3F8PA 2ACXA 2PTFA 4J33A 2LLYA 1IJ6A 2RGOA 4LFAT 2I0ZA 3F2EA 4AT0A 2YVGA 1S3BA 4EIPA 4Z2TA 5HEOA 1W0BA 3QSSA 3QNUA 2UUAT 5CA1E 4AQFA 2YG5A 3EAOA 5HYMA 4EEBA 3KV9A 5LA6E 3O0HA 2LM9A 2QRXA 3RGLA 4YKFA 3AD8B 2CXFA 4H2NA 5AQFB 1YKJA 3FZMB 3AEGA 4RG3A 4DV2T 4WZXA 5AQSB 3WI3A 4M52A 2XQYA 3GN5A 5JCKA 5U1OA 5JCIA 2Q0KA 4LIIA 4XWZA 2NTYA 4CXYA 1G73A 3ALLA 1JOAA 2WB5A 3GYIA 4BA9A 5CQFA 3ESLA 2WDVA 5L3DB 2B7RA 1VCTA 2CULA 2X9WA 3GMBA 3AE7A 3AEAA 3NTDA 5EK4A 4OPIA 4QXHB 4OPGA 1EZ3A 4CNJA 5E0OA 2WP6A 3QK6A 1PBDA 4H4RA 4NUUA 4OPDA 4H4ZA 3NKSA 4HB9A 4G63A 1KSSA 2VL0A 1LPFA 1EL9A 3KV4A 2V1DB 1GSNA 4X1IE 2X9XA 3M3ZB 1ZY8A 4IE0A 3RYFE 4AT2A 4I50E 4ERRA 1J5ET 3JAFA 3LADA 2WU2A 4HKAA 3T31A 4AKRB 2TPRA 2QAEA 4JI3T 4YHJA 3UKFA 5FMHA 2NOXA 2V61A 4ZN0A 1NHSA 2LJLA 3RX6A 1E1MA 2D0TA 2Y48B 5J1GA 2XFQA 5LB7B 1FEBA 1CC4A 3NLCA 1KFYA 3QJ4A 3PJAJ 4L0RA 2BCPA 1G8XA 4B6XA 2WDQA 5EOWA 3CK6A 1UX5A 5FXXA 4IVOB 3CPZA 5HEGA 2V26A 1PBCA 5ABEA 4AISA 3AEFA 5AQGB 3RYCE 1L9EA 1HX8A 4UEMA 3B6DA 4JI0T 4USRA 2XM1A 2X51A 3SFDA 1Z6LA 3KA7A 3UQ7A 4LF8T 4HFCA 3WAJA 2JB3A 4EIQA 1U4QA 2LOSA 5L3GB 3SZCA 3NBXX 1N1PA 1KNPA 2XAJB 4FDCB 3SZFA 5DQWA 3R9UA 3SGLA 5JQGE 4H9OC 3ZT7A 3ZMTB 5L3BB 1HS7A 1YQZA 4EGWA 1UK5A 2BXSA 3DMEA 3C4ZA 2J3NA 3SWHA 2BCGG 4U72A 4CXWA 1F6MA 3AVSA 4YSZA 4LFBT 3K1SA 4G6HA 2WU5A 1PJ7A 2YG4A 4H63V 5LV9A 2C5IT 3CQGB 3WAKA 1XMQT 2C72A 3U78A 3AE8A 3C51A 1E2AA 3P4PA 3RIAA 4H7UA 4ZI3C 3QB5A 5L3FB 1H7WA 3ALJA 4OPTA 4AQFC 2XFPA 2P9BA 2VVNA 3HKCE 5LGTB 4BJZA 2WPCA 2IIDA 2QA2A 4ILBA 2QA7A 1XDPA 2XSBA 1M6IA 4IDOA 3D0TA 1D4EA 3NRYA 1T8BA 2A72A 5FY0A 3IHGA 4TM0A 2UXCT 1TDKA 3PUAA 2YG3A 4HFHA 1N4VA 1GQEA 2N1GA 4QWNB 3AWIA 5U25A 2C0SA 3O9XA 2XQ3A 2WP9A 1CHUA 2ZZCA 1Y56B 2AAQA 2N2NA 3VRDB 4IHJE 2CBJA 4CCRA 4UR9A 1E7PA 1US7B 4YFSA 5LHHB 3NN6X 5JDLA 3FPZA 3ONXA 4BV6A 4TV8E 2WP5A 1X79A 4U31A 2VWAA 2CWYA 2YDRA 2YLZA 2FBWA 4TM4A 3K7QX 2OV9A 4V1Av 2HN2A 2XPKA 3LBXB 3NRNA 3UU4A 2YM2A 3GA8A 5JDFA 2MOZA 2R9ZA 2X0HA 2QCUA 1YD8G 2YEVC 5KMQA 1UUSA 2BC0A 3OZ2A 4JI2T 4I58A 2CBIA 4AQYT 1IJHA 1GPEA 3ZYMA 1CC6A 1H6VA 4U8NA 1W0AA 3RPUA 4KBMB 3ZMVB 3PUVF 4DV1T 2CE7A 2VVSA 1SHZC 5AQTB 2YDSA 1BWCA 2JB2A 4OHFA 2F5ZA 2XTLA 3ONJA 2RGJA 3VRBA 3TLWA 2FJEA 3UFGA 2WOIA 2W66A 3ZDNA 3Q6JA 5KMPA 4O5QA 2XQAA 3UFEA 2BRAA 3K3NA 3BI5A 4AQGA 3CQXC 1B7TA 2OALA 1H81A 2BC1A 3UKPA 3ZC1A 4QHOA 3AYLA 5CB4E 2VASA 3RIFA 3DJBA 2W4XA 5L3EB 2XM2A 3J9X1 1E39A 2XYOA 4PABA 3S61A 1H7XA 3AEBA 4CCQA 1OJDA 5AQIB 2VKJA 2C5JA 3MXZA 1LRZA 3REDA 5KX5E 5FY1A 2RABA 3ZYXA 4D03A 2D2SA 1QSDA 4UV8B 4II2A 2ZM8A 2IVDA 3GD4A 4DR5T 4H4QA 3AEEA 3N5LA 3H4KA 2OA5A 4EYYR 4HEAA 3UOZA 4JYAT 1TYTA 2DWKA 2YN6A 3N9LA 4TLZA 4AIUA 1VRBA 3BQIA 3LJCA 2CA5A 1AJ3A 4U8OA 2BYBA 3PTRB 1HFAA 2C75A 2CXLA 2WWUA 3AEDA 1D4DA 1O94A 5IPYA 3E22E 4PAAA 4JN9A 3UQ4A 4MHCA 3VKGA 3HKDE 1MMDA 4Z8XA 4CI2B 3V3OA 2Q0LA 1VQWA 2NVKX 2H3RA 2C65A 4A56A 4EMWA 3AA7B 1CC2A 4U74A 3OBVE 2XQ9A 4U8MA 3NG7X 1IZNB 3BHKA 3LB8A 1PHHA 1IBKT 3ZMUB 1KF6A 2LSYA 1Y0PA 4JQ9A 3K3OA 4EQSA 3IWAA 2A3DA 2B76A 1DODA 4OVIA 3NK0X 1SE7A 3OKQA 1CL0A 3AXJB 1OJCA 1LVFA 3AXBA 4GDPA 5JCNA 2OAMA 3K8PC 5LOVE 3PO7A 2EHOD 4AKHA 4U8PA 2BG9C 3AE6A 1F8RA 4QH1A 3ONLC 5AQVB 5CFBA 3ZYLA 3UOXA 2YLTA 3Q5EA 4AOSA 3VR9A 5U63A 4DR3T 1OXZA 4AP1A 1QUUA 3SZ0A 3MJXA 3MKDA 4M1PA 3E1TA 1I6ZA 2XQ8A 3PUQA 4GYSA 2NP9A 4EV6A 3T1YT 2C67A 4P0BA 2Y6XA 3L09A 4GAVA 4ANJA 1CBOA 3Q5DA 3UU6A 2E1MA 2XHEB 4AI6A 4Y4NA 3AE5A 4NEVA 5CA0E 4XBFB 1YW0A 1LQTA 3P4QA 1BGJA 5FP3A 4NXMT 2YDQA 4YXDA 4AP3A 3UKAA 4CY6A 2IC9A 3SS1A 1EL7A 4H4XA 1NEKA 4X62T 4ZI2D 3LK2B 3DJJA 4LU6A 3VRAA 3RYIE 5BULA 2ZZBA 2X8GA 3IF8B 5HEJA 3LBXA 4H9NC 2JQHA 2VRLA 3IBPA 2JB1A 3OYZA 4U2YA 3NH3X 1D0YA 5BRTA 2D9DA 5FXWA 4JY2A 2WSSV 5LP6E 1F3PA 4CRTA 2BACA 1M7KA 2E9XC 2R45A 3GWFA 2E4GA 2LSKA 4K8DA 3FG2P 3W15B 3NKZA 1H84A 2MAWA 3PS9A 5J7XA 1IAPA 4DR1T 3RP8A 4A6NB 2H89A 1PBEA 2HQMA 4MJWA 3LSVA 2OLOA 2KZ7B 2Q7VA 2RA1A 3AECA 3DJEA 2WMNA 3OPCA 4CN6A 3KBUA 4H9QC 4NTDA 1XHCA 3FXEB 1SUMB 2YU2A 2WPEA 1GETA 4K5SA 2ODVA 4ADZA 3ZT5A 4BK3A 2GMHA 2WS3A 4U2LA 4X1KE 1D1AA 3UP4A 3OYXA 2OLTA 2HH7A 3AD7B 5KVIA 5L47A 2VL8A 1HG2A 4KI0F 2GR3A 1XPQA 3B57A 4HFBA 4OPUA 2B9YA 4G9KA 1IUTA 1XNQT 5CKUA 5BVAA 4LF6T 3A7MA 2H7OA 4ZOLE 4B67A 3KV5A 1UURA 3UOYA 1O95A 5JCMA 3UKLA 3DH9A 3V3NA 3M13A 3C4WA 2PHHA 4GAPA 4GKKT 4EAHA 5ER0A 3GMIA 3P8CD 5HWYA 1CJCA 1K0LA 4EEDA 5EB5A 3NWIA 4DVDA 5ABGA 2GEWA 3NGCX 4BJYA 1FOHA 4DIDB 2J1DG 4H4UA 2XFOA 1TYPA 1GREA 4IE7A 4REKA 5M4YA 1BR2A 3JAEA 1GRAA 1J5WA 4H4TA 4NIQA 3CX8B 4UELA 2K5BB 4JI5T 4QXCB 1XNRT 4Z25A 4J57A 3DP7A 4MLKA 3F8RA 3UTEA 4LA1A 2VB6A 2NR4A 1MIVA 2BS4A 5AQUB 5KNLA 3CNPA 1NHPA 2BG9B 5FMNA 5C8YE 2ZMAA 4J36A 1N4UA 3M65A 3KINB 3FZHB 2EQ7A 4EMJA 3HA4A 1ZKQA 3AXJA 4MBQA 2A9UA 3CX6B 3N2OA 2PFVA 5AQQB 1COYA 2UU9T 2GQFA 5IUXA 2YWLA 3O1JA 3TLTA 3AYIA 5BR8T 1DJQA 1GRTA 3D8XA 3ZSSA 4IT4A 3DGZA 2IAKA 3T37A 3SOLA 4C74A 2JAEA 3P50A 3RRCA 4LF4T 3CMLA 4A7AA 1DJNA 2KMFA 2ZLYA 3MZKB 2VK9A 3AE3A 4H4SA 3J7Yq 2ODUA 2CPTA 3UUXB 2CDUA 2HHHT 4LF5T 1HNWT 2V7MA 1NG3A 3RQUA 5J0ZA 3TKLB 3RQWA 3T2YA 5J60A 2GR2A 5DJQC 1FL2A 2BS3A 5HHFA 3G5RA 2C66A 5JTGA 2BABA 3NK1X 1Q1WA 4H9RC 2AQJA 2MBGA 4TV9E 4GKJT 4TZ4C 2PBIA 2XCGA 1N4WA 3UTGA 4O2BE 2W61A 4NZHA 3L8RA 1KEYA 3EVYA 4U8LA 4IA5A 2E9XB 1PJ5A 1S2YA 2VQET 2X8HA 2VKDA 2V3AA 5H6RB 4ZS2A 4N9XA 2R0GA 5KMGP 4YLHA 2XFUA 1MNDA 3RIUA 4PFOA 2KXPB 2GB0A 5GRTA 3N9MA 3FB2A 3OJAA 1KDGA 1GTHA 1NPXA 4DV0T 4C3XA 4DV5T 4YJ3E 2YR5A 3CPJG 2JMHA 5TAOA 4BURA 3LXDA 1W09A 2X9HA 4GK0E 2D0UA 5FYMA 1AOGA 1DOBA 2W00A 4O2AE 4X65T 4DV6T 1ZOVA 4NWZA 2EQ8A 5FXZA 4A6NA 3LZWA 3PVCA 2VVMA 2HPJA 2CVJA
chains in the Genus database with same CATH topology
2BK5A 3LJPA 1PXCA 2YQUA 4GDEA 2JB2A 1BWCA 3BHFA 3CPIG 3IC9A 4WX1A 2F5ZA 1ZMCA 1YQ3A 2RGJA 5C2TA 3P9UA 3SQPA 3VRBA 4YTMA 5M0ZA 3K7MX 2FJBA 2FJEA 1PBFA 3ISHA 2WOIA 3ZDNA 1D7YA 3GRTA 2UZZA 2XVJA 3Q6JA 5KMPA 3ITJA 3G5QA 1EL5A 4O5QA 1E6EA 4D04A 3ICTA 3B3RA 2BRAA 2Q6UA 1GRFA 5C3JA 3BI5A 3EPTA 1K4QA 3CGEA 3GYJA 2GAHB 1E1KA 1GERA 2OALA 2VQ7A 1Y56A 3SY4A 1IUVA 1H81A 3NT6A 2BC1A 3UKPA 2YLRA 4GF7A 5KOXA 4U8JA 3T14A 1NHRA 3AYLA 2YM1A 2YVJA 2YLSA 3OC4A 4DGKA 1LJ1A 1PBBA 1OJ9A 3VQRA 3QSMA 2C7GA 4A65A 2ZZ0A 5FS7A 1DOEA 1DNCA 4IA6A 1PXBA 4FX9A 1KNRA 1FECA 4EM4A 1E39A 3CNJA 3NIXA 4U8IA 2XYOA 4H2RA 1BKWA 2WBAA 4PABA 3S61A 1H7XA 3AEBA 4CCQA 5IQ4A 1OJDA 3AE9A 3NYCA 3FBSA 2EQ9A 4NEWA 2YG6A 2LFCA 2ARDA 4G6GA 3REDA 2WHDA 3CNTA 1QO8A 3SZWA 2RABA 4U2SA 3QFAA 3ZYXA 4D03A 3S5WA 1CJ2A 5JCLA 4II2A 4Y4LA 1NAAA 4TM3A 2A87A 2BK3A 4CNKA 2C70A 3CIRA 2IVDA 3GD4A 4A99A 5L46A 4H4QA 5GSNA 2O9ZA 3DGHA 3AEEA 2XLRA 2WOVA 3SXIA 2GR0A 3H4KA 3F8DA 4Z44A 4O5UA 1H82A 1GTEA 2BK4A 3LZXA 3UOZA 3CTYA 1TYTA 3AE1A 1E1LA 1XDIA 3CMMA 4TLZA 2WEUA 2FJAA 4ADWA 2Y6QA 1GESA 3DJGX 2X50A 1M64A 5KXJA 4H4WA 4J34A 1D4CA 4K22A 3P1WA 3I3LA 5KRQA 2GAGB 4B65A 2H88A 2GMJA 4U8OA 2BYBA 3QVRA 3UTFA 2C75A 1B37A 1O94A 3AEDA 1D4DA 3II4A 3ATQA 5IPYA 4K5RA 1S2QA 1GRBA 1GOSA 1NDAA 3QFBA 4G73A 1IUWA 4PAAA 4A5LA 3UKHA 4AOXA 4JN9A 1JU2A 2YR4A 1D5TA 3L1RA 3CNSA 3KVEA 2JKCA 3UKQA 4RG4A 3V3OA 1REOA 2Q0LA 1VQWA 1JRZA 1UKVG 2NVKX 1HYUA 2C65A 4ICYA 4EMWA 1CC2A 1GV4A 2B7SA 2OA1A 2Z5XA 4U8MA 1GALA 3NG7X 2R0PA 3BHKA 4Z24A 3LB8A 1RP0A 1PHHA 4II3A 3GWDA 4ECHA 3WE0A 3T2ZA 3KD9A 2R4EA 3URHA 5HXIA 2DKIA 1KF6A 1OJAA 1Y0PA 4JQ9A 4EQSA 3IWAA 2B76A 1DODA 4OVIA 3NK0X 2GF3A 4B63A 1CL0A 3RHAA 2BRYA 2BS2A 1VDCA 1OJCA 4X4JA 3AE2A 1L9DA 1X31B 3AXBA 3D1CA 4GDPA 4RSLA 4XXGA 3C96A 5JCNA 2OAMA 1BGNA 3IHMA 3PO7A 1ONFA 2V3BA 1NHQA 1YQ4A 3AE6A 2QA1A 4U8PA 1F8RA 1VRQB 5M10A 2RGHA 3VR8A 3UOXA 2XVFA 3GSIA 2YLTA 4B64A 4AOSA 3LOVA 4OPLA 1P2HA 1QJDA 2XDOA 3H8LA 3VR9A 2C73A 4UDQA 5U63A 4AP1A 3SZ0A 1K0IA 4XWRA 3CNDA 3E1TA 4WCTA 3AYJA 4EQXA 4H4YA 3P4SA 4JDRA 4KX6A 2VOUA 3QSEA 2C67A 2ACZA 1PJ6A 3ICSA 4KPRA 1BF3A 2YR6A 4GAVA 1CBOA 2NPXA 2E1MA 2VZ2A 2GVCA 4OCGA 2W0HA 3UTHA 2V5ZA 4E0VA 3AB1A 3F8PA 4Y4NA 3AE5A 4J33A 4NEVA 2OLNA 4APNA 4TM1A 2RGOA 2I0ZA 1ZMDA 1MOKA 1LQTA 2GH5A 3P4QA 1BGJA 2YVGA 3NTAA 4AT0A 2A8XA 4YXDA 1PS9A 1S3BA 3ADAB 3HYXA 4AP3A 4EIPA 2C64A 3UKAA 4CY6A 4UP3A 3G5SA 4Z2TA 1EL7A 4H4XA 3BNMA 1NEKA 2XLUA 2Y6RA 3QSSA 3C4AA 1JNZA 1VG0A 2YG5A 3DJJA 3EAOA 5HYMA 4LU6A 3VRAA 5BULA 2ZZBA 2X8GA 3O0HA 4B68A 1GXFA 4GR1A 3UP5A 4YKFA 3NYFA 1H83A 3AD8B 4NTCA 4H2NA 2VRLA 1YKJA 2C3DA 3AEGA 4RG3A 4H2QA 1ZK7A 4YSXA 2JB1A 3NH3X 4B1BA 2ZBWA 1B4VA 5BRTA 2XFNA 5FS9A 4M52A 5HY5A 4GRTA 3UOVA 2VVLG 1EBDA 1S3EA 5JCKA 1LVLA 5U1OA 3KLJA 5JCIA 2Q0KA 4JY2A 4LIIA 1F3PA 3HZLA 4CRTA 2BACA 4XWZA 1MXTA 2R45A 3GWFA 2E4GA 4YT0A 4JNAA 4K8DA 3FG2P 3H8IA 3ALLA 1JOAA 3CGBA 2JBVA 3GYIA 4B66A 1D7LA 1H84A 3RP6A 1L9CA 3PS9A 5J7XA 5CQFA 1GEUA 1ELIA 1PN0A 2WDVA 2IVEA 2H89A 1PBEA 2B7RA 3DK4A 2HQMA 3CGCA 4H2PA 2CULA 4MJWA 2OLOA 4EM3A 4JY3A 2Q7VA 3GMBA 3KKJA 3AECA 3DJEA 3AE7A 3AEAA 3NTDA 4OPIA 4OPGA 4FK1A 1GNDA 5KVHA 4NTDA 2YLWA 2B9XA 1XHCA 4Z43A 5BUKA 3GMCA 1F8SA 1V59A 2WPEA 1GETA 4K5SA 4J56A 4OPCA 4CNJA 4NTEA 4BK2A 4CBQA 4H50A 4BK3A 4GCMA 2GMHA 2WS3A 1EL8A 2WP6A 4U2LA 1PBDA 4H4RA 2BXRA 4OPDA 4H4ZA 3UP4A 3AD7B 3DA1A 3NKSA 4HB9A 5KVIA 1KSSA 1LPFA 2GR3A 1EL9A 1XPQA 4J31A 4X9NA 3AE4A 4OPUA 5TR3A 4DNAA 1GSNA 1MO9A 4EMIA 1ZY8A 2V6OA 2B9YA 4AT2A 4G9KA 1IUTA 3DJDA 2FJDA 3LADA 2WU2A 5CKUA 1B5QA 1NENA 3T31A 2CFYA 5BVAA 2TPRA 3SX6A 1RSGA 1E1NA 2QAEA 1CF3A 4A79A 3UKFA 3CPHG 2VVLA 3DK9A 1H86A 5FMHA 2V61A 4B67A 5KMRA 4ZN0A 2JK6A 3ATRA 3UOYA 1NHSA 2APGA 1E1MA 1NG4A 4YSHA 3SFEA 3GDNA 3Q9TA 1TRBA 2XFQA 4K7ZA 1O95A 5JCMA 3UKLA 1FEBA 1CC4A 5EB4A 4U8KA 3NLCA 3DH9A 1KFYA 3QJ4A 1JNRA 2WDRA 3M13A 4YWOA 3V3NA 4YTPA 4C3YA 1ZOYA 2PHHA 4GAPA 1VG9A 2BCPA 1LQUA 2XLPA 4CY8A 1FCDA 5ER0A 3BI4A 2WDQA 2B9WA 3NNEA 1CJCA 1K0LA 5EOWA 2X8CA 3ICRA 5EB5A 1O5WA 4IVOB 2GEWA 3NGCX 5IQ1A 2GRTA 1FOHA 4BJYA 1JEHA 3KPKA 4DSHA 1PBCA 4J2WA 4H4UA 3AEFA 1L9EA 1TYPA 2WETA 2XFOA 3B6DA 4U2TA 1GREA 4USQA 5DBJA 4REKA 4USRA 2XVEA 3SFDA 1Z6LA 3GRSA 3KA7A 3M12A 2WPFA 2C4CA 1GRAA 4H4TA 2JB3A 2BA9A 3ALMA 3QVPA 4EIQA 3SZCA 3KPFA 1N1PA 1KNPA 1RYIA 4Z25A 4J57A 3T0KA 3F8RA 1GT8A 4FDCB 3SZFA 3T2KA 3UTEA 4LA1A 4BK1A 3R9UA 4C5OA 1K0JA 1B8SA 3SGLA 4EQRA 4JNQA 4IVMB 3UCLA 2BS4A 2WOWA 5KNLA 3C4NA 3L8KA 3RP8A 3CNPA 1Q9IA 1YQZA 1NHPA 2EQ6A 3NHOX 2BXSA 5FS6A 3DMEA 3K30A 1GRHA 2VQBA 2J3NA 2R0CA 3EANA 3KU9A 1TDEA 2E5VA 2BCGG 4UDPA 5EBKA 4J36A 1N4UA 1IUXA 3GDPA 1IUSA 2TMDA 1F6MA 1ZDLA 2EQ7A 4EMJA 4ZCDA 1ZKQA 4YSZA 3COXA 3SM8A 5KMSA 3AD9B 3FMWA 2A89A 4G6HA 2WU5A 1PJ7A 1ZX9A 2YG4A 4UDRA 4Z2RA 1OJTA 5LV9A 4Y4MA 1COYA 2DKHA 2C72A 2GQFA 1F8WA 2XVIA 3CN8A 2YWLA 3AE8A 3V76A 3P4PA 3AYIA 1DJQA 1GRTA 2PYXA 3GYXA 3D8XA 4H7UA 3M0OA 2R46A 3DGZA 3T37A 3ALJA 1H7WA 3DK8A 3HYWA 4OPTA 4C74A 2JAEA 4YTNA 1YY5A 2X3NA 2XFPA 3NK2X 4K2XA 2YAUA 1KSUA 4P9SA 5FS8A 4G74A 4A7AA 4BJZA 1DJNA 2WPCA 3I6DA 2IIDA 2QA2A 1W4XA 3AE3A 3BNUA 2GR1A 4H4SA 1DXLA 4Z2UA 3RP7A 1M6IA 2WESA 2C76A 4H4PA 1D4EA 1PXAA 1JRYA 3EF6A 4ZCCA 2CDUA 4TLXA 3NN0X 3IHGA 4TM0A 3UKKA 5KWFA 1TDKA 1Q1RA 3RNMA 1NG3A 2YG3A 1N4VA 1FEAA 3AWIA 3T2YA 5J60A 5U25A 4A6NB 2GR2A 1FL2A 2BS3A 1LV0A 5HHFA 2WP9A 3G5RA 2C66A 1CHUA 2ZZCA 1Y56B 4HA6A 2BABA 2XVHA 3NK1X 1Q1WA 2AAQA 3NYEA 3VRDB 4YKGA 2AQJA 4CCRA 4C77A 3GD3A 1E7PA 4NNJA 2XCGA 1CJ3A 1N4WA 3UTGA 2XLSA 2R4JA 3NN6X 1IUUA 4NZHA 2AR8A 3FPZA 4U8LA 4BV6A 4IA5A 1ZP0A 4YSYA 4X9MA 4FK1C 4DSGA 1PJ5A 1S2YA 2X8HA 3HYVA 2WP5A 2V3AA 2YVFA 1DOCA 3BI2A 3JSKA 1LTXR 4N9XA 4GUVA 5KOWA 2R0GA 4H4VA 2YLZA 1QLBA 2XFUA 2FBWA 1L0VA 4TM4A 1BZLA 3K7QX 4A9WA 1PDHA 2GB0A 3FIMB 2XLTA 5GRTA 2YLXA 4EQWA 1KDGA 1GTHA 3NRNA 4Z26A 1GRGA 3ABVA 1NPXA 4IV9A 4C3XA 2YM2A 2YR5A 1JRXA 3CPJG 2R9ZA 3SYIA 4BURA 3LXDA 2QCUA 1CJ4A 1TDOA 1SEZA 5KMQA 2BC0A 2YG7A 3CGDA 3OZ2A 4I58A 1AOGA 2VRMA 1DOBA 2WQYA 1TDNA 2GQWA 2X99A 3K7TA 1IJHA 1GPEA 2Z5YA 4B69A 1ZOVA 4NWZA 1XANA 2EQ8A 2V60A 1CC6A 1TDFA 4A6NA 3IF9A 1H6VA 2GV8A 3LZWA 3PVCA 1P2EA 4U8NA 2VVMA 3P4RA 4I59A 2C3CA 2CVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BK5 A;  3LJP A;  1PXC A;  2YQU A;  4GDE A;  2JB2 A;  1BWC A;  3BHF A;  3CPI G;  3IC9 A;  4WX1 A;  2F5Z A;  1ZMC A;  1YQ3 A;  2RGJ A;  5C2T A;  3P9U A;  3SQP A;  3VRB A;  4YTM A;  5M0Z A;  3K7M X;  2FJB A;  2FJE A;  1PBF A;  3ISH A;  2WOI A;  3ZDN A;  1D7Y A;  3GRT A;  2UZZ A;  2XVJ A;  3Q6J A;  3ITJ A;  3G5Q A;  1EL5 A;  4O5Q A;  1E6E A;  4D04 A;  3ICT A;  3B3R A;  2Q6U A;  1GRF A;  5C3J A;  3BI5 A;  3EPT A;  1K4Q A;  3CGE A;  3GYJ A;  2GAH B;  1E1K A;  1GER A;  2OAL A;  2VQ7 A;  1Y56 A;  1IUV A;  1H81 A;  3NT6 A;  2BC1 A;  3UKP A;  2YLR A;  4GF7 A;  5KOX A;  4U8J A;  1NHR A;  3AYL A;  2YM1 A;  2YVJ A;  2YLS A;  3OC4 A;  4DGK A;  1LJ1 A;  1PBB A;  1OJ9 A;  3VQR A;  3QSM A;  2C7G A;  4A65 A;  2ZZ0 A;  5FS7 A;  1DOE A;  1DNC A;  4IA6 A;  1PXB A;  4FX9 A;  1KNR A;  1FEC A;  4EM4 A;  1E39 A;  3CNJ A;  3NIX A;  4U8I A;  2XYO A;  4H2R A;  1BKW A;  2WBA A;  4PAB A;  3S61 A;  1H7X A;  3AEB A;  4CCQ A;  5IQ4 A;  1OJD A;  3AE9 A;  3NYC A;  3FBS A;  2EQ9 A;  4NEW A;  2YG6 A;  2LFC A;  2ARD A;  3RED A;  2WHD A;  3CNT A;  1QO8 A;  2RAB A;  4U2S A;  3QFA A;  3ZYX A;  4D03 A;  3S5W A;  1CJ2 A;  5JCL A;  4Y4L A;  1NAA A;  4TM3 A;  2A87 A;  2BK3 A;  4CNK A;  2C70 A;  3CIR A;  2IVD A;  3GD4 A;  4A99 A;  5L46 A;  4H4Q A;  5GSN A;  2O9Z A;  3DGH A;  3AEE A;  2XLR A;  2WOV A;  2GR0 A;  3H4K A;  3F8D A;  4Z44 A;  4O5U A;  1H82 A;  1GTE A;  2BK4 A;  3LZX A;  3UOZ A;  3CTY A;  1TYT A;  3AE1 A;  1E1L A;  1XDI A;  4TLZ A;  2WEU A;  2FJA A;  4ADW A;  2Y6Q A;  1GES A;  3DJG X;  2X50 A;  1M64 A;  5KXJ A;  4H4W A;  4J34 A;  1D4C A;  4K22 A;  3P1W A;  3I3L A;  5KRQ A;  2GAG B;  4B65 A;  2H88 A;  2GMJ A;  4U8O A;  2BYB A;  3QVR A;  3UTF A;  2C75 A;  1B37 A;  1O94 A;  3AED A;  1D4D A;  3II4 A;  3ATQ A;  5IPY A;  4K5R A;  1S2Q A;  1GRB A;  1GOS A;  1NDA A;  3QFB A;  4A5L A;  1IUW A;  4PAA A;  3UKH A;  4AOX A;  4JN9 A;  1JU2 A;  2YR4 A;  1D5T A;  3L1R A;  3CNS A;  3KVE A;  2JKC A;  3UKQ A;  4RG4 A;  3V3O A;  1REO A;  2Q0L A;  1VQW A;  1JRZ A;  1UKV G;  2NVK X;  1HYU A;  2C65 A;  4ICY A;  4EMW A;  1CC2 A;  1GV4 A;  2B7S A;  2OA1 A;  2Z5X A;  4U8M A;  1GAL A;  3NG7 X;  2R0P A;  3BHK A;  4Z24 A;  3LB8 A;  1RP0 A;  1PHH A;  3GWD A;  4ECH A;  3WE0 A;  3KD9 A;  2R4E A;  3URH A;  5HXI A;  2DKI A;  1KF6 A;  1OJA A;  1Y0P A;  4JQ9 A;  4EQS A;  3IWA A;  2B76 A;  1DOD A;  4OVI A;  3NK0 X;  2GF3 A;  4B63 A;  1CL0 A;  3RHA A;  4X4J A;  2BS2 A;  1VDC A;  1OJC A;  3AE2 A;  1L9D A;  1X31 B;  3AXB A;  3D1C A;  4GDP A;  4RSL A;  4XXG A;  3C96 A;  5JCN A;  2OAM A;  1BGN A;  3IHM A;  3PO7 A;  1ONF A;  2V3B A;  1NHQ A;  1YQ4 A;  3AE6 A;  2QA1 A;  4U8P A;  1F8R A;  1VRQ B;  5M10 A;  2RGH A;  3VR8 A;  3UOX A;  2XVF A;  3GSI A;  2YLT A;  4B64 A;  4AOS A;  3LOV A;  4OPL A;  1P2H A;  1QJD A;  2XDO A;  3H8L A;  3VR9 A;  2C73 A;  4UDQ A;  5U63 A;  4AP1 A;  1K0I A;  4XWR A;  3CND A;  3E1T A;  4WCT A;  3AYJ A;  4EQX A;  4H4Y A;  3P4S A;  4JDR A;  4KX6 A;  2VOU A;  3QSE A;  2C67 A;  2ACZ A;  1PJ6 A;  3ICS A;  4KPR A;  1BF3 A;  2YR6 A;  1CBO A;  2NPX A;  2E1M A;  2VZ2 A;  2GVC A;  4OCG A;  2W0H A;  3UTH A;  2V5Z A;  4E0V A;  3AB1 A;  3F8P A;  4Y4N A;  3AE5 A;  4J33 A;  4NEV A;  2OLN A;  4APN A;  4TM1 A;  2RGO A;  2I0Z A;  1ZMD A;  1MOK A;  1LQT A;  2GH5 A;  3P4Q A;  1BGJ A;  2YVG A;  3NTA A;  4AT0 A;  2A8X A;  4YXD A;  1PS9 A;  1S3B A;  3ADA B;  4AP3 A;  4EIP A;  2C64 A;  3UKA A;  4CY6 A;  4UP3 A;  3G5S A;  4Z2T A;  1EL7 A;  4H4X A;  3BNM A;  1NEK A;  2XLU A;  2Y6R A;  3QSS A;  3C4A A;  1JNZ A;  1VG0 A;  2YG5 A;  3DJJ A;  3EAO A;  5HYM A;  4LU6 A;  3VRA A;  5BUL A;  2ZZB A;  2X8G A;  3O0H A;  4B68 A;  1GXF A;  4GR1 A;  3UP5 A;  4YKF A;  3NYF A;  1H83 A;  3AD8 B;  4NTC A;  4H2N A;  2VRL A;  1YKJ A;  2C3D A;  3AEG A;  4RG3 A;  4H2Q A;  1ZK7 A;  4YSX A;  2JB1 A;  3NH3 X;  4B1B A;  2ZBW A;  1B4V A;  5BRT A;  2XFN A;  5FS9 A;  4M52 A;  5HY5 A;  4GRT A;  3UOV A;  2VVL G;  1EBD A;  1S3E A;  5JCK A;  1LVL A;  5U1O A;  3KLJ A;  5JCI A;  2Q0K A;  4JY2 A;  4LII A;  1F3P A;  3HZL A;  4CRT A;  2BAC A;  4XWZ A;  1MXT A;  2R45 A;  3GWF A;  2E4G A;  4YT0 A;  4JNA A;  4K8D A;  3FG2 P;  3H8I A;  3ALL A;  1JOA A;  3CGB A;  2JBV A;  3GYI A;  4B66 A;  1D7L A;  1H84 A;  3RP6 A;  1L9C A;  3PS9 A;  5J7X A;  5CQF A;  1GEU A;  1ELI A;  1PN0 A;  2WDV A;  2IVE A;  2H89 A;  1PBE A;  2B7R A;  3DK4 A;  2HQM A;  3CGC A;  4H2P A;  2CUL A;  4MJW A;  2OLO A;  4EM3 A;  4JY3 A;  2Q7V A;  3GMB A;  3KKJ A;  3AEC A;  3DJE A;  3AE7 A;  3AEA A;  3NTD A;  4OPI A;  4OPG A;  4FK1 A;  1GND A;  5KVH A;  4NTD A;  2YLW A;  2B9X A;  1XHC A;  4Z43 A;  5BUK A;  3GMC A;  1F8S A;  1V59 A;  2WPE A;  1GET A;  4K5S A;  4J56 A;  4OPC A;  4CNJ A;  4NTE A;  4BK2 A;  4CBQ A;  4H50 A;  4BK3 A;  4GCM A;  2GMH A;  2WS3 A;  1EL8 A;  2WP6 A;  4U2L A;  1PBD A;  4H4R A;  2BXR A;  4OPD A;  4H4Z A;  3UP4 A;  3AD7 B;  3DA1 A;  3NKS A;  4HB9 A;  5KVI A;  1KSS A;  1LPF A;  2GR3 A;  1EL9 A;  1XPQ A;  4J31 A;  4X9N A;  3AE4 A;  4OPU A;  5TR3 A;  4DNA A;  1GSN A;  1MO9 A;  4EMI A;  1ZY8 A;  2V6O A;  2B9Y A;  4AT2 A;  1IUT A;  3DJD A;  2FJD A;  3LAD A;  2WU2 A;  5CKU A;  1B5Q A;  1NEN A;  2CFY A;  5BVA A;  2TPR A;  1RSG A;  1E1N A;  2QAE A;  1CF3 A;  4A79 A;  3UKF A;  3CPH G;  2VVL A;  3DK9 A;  1H86 A;  5FMH A;  2V61 A;  4B67 A;  4ZN0 A;  2JK6 A;  3ATR A;  3UOY A;  1NHS A;  2APG A;  1E1M A;  1NG4 A;  4YSH A;  3SFE A;  3GDN A;  3Q9T A;  1TRB A;  2XFQ A;  4K7Z A;  1O95 A;  5JCM A;  3UKL A;  1FEB A;  1CC4 A;  5EB4 A;  4U8K A;  3NLC A;  3DH9 A;  1KFY A;  3QJ4 A;  1JNR A;  2WDR A;  3M13 A;  4YWO A;  3V3N A;  4YTP A;  4C3Y A;  1ZOY A;  2PHH A;  1VG9 A;  2BCP A;  1LQU A;  2XLP A;  4CY8 A;  1FCD A;  5ER0 A;  3BI4 A;  2WDQ A;  2B9W A;  3NNE A;  1CJC A;  1K0L A;  5EOW A;  2X8C A;  3ICR A;  5EB5 A;  1O5W A;  4IVO B;  2GEW A;  3NGC X;  5IQ1 A;  2GRT A;  1FOH A;  4BJY A;  1JEH A;  4DSH A;  1PBC A;  4J2W A;  4H4U A;  3AEF A;  1L9E A;  1TYP A;  2WET A;  2XFO A;  3B6D A;  4U2T A;  1GRE A;  4USQ A;  5DBJ A;  4REK A;  4USR A;  2XVE A;  3SFD A;  1Z6L A;  3GRS A;  3KA7 A;  3M12 A;  2WPF A;  1GRA A;  4H4T A;  2JB3 A;  2BA9 A;  3ALM A;  3QVP A;  4EIQ A;  3KPF A;  1N1P A;  1KNP A;  1RYI A;  4Z25 A;  4J57 A;  3F8R A;  1GT8 A;  4FDC B;  4C5O A;  3UTE A;  4BK1 A;  4LA1 A;  3R9U A;  1K0J A;  1B8S A;  3SGL A;  4EQR A;  4JNQ A;  4IVM B;  3UCL A;  2BS4 A;  2WOW A;  3C4N A;  3L8K A;  3RP8 A;  3CNP A;  1Q9I A;  1YQZ A;  1NHP A;  2EQ6 A;  3NHO X;  2BXS A;  5FS6 A;  3DME A;  3K30 A;  1GRH A;  2VQB A;  2J3N A;  2R0C A;  3EAN A;  3KU9 A;  1TDE A;  2E5V A;  2BCG G;  4UDP A;  5EBK A;  4J36 A;  1N4U A;  1IUX A;  3GDP A;  1IUS A;  2TMD A;  1F6M A;  1ZDL A;  2EQ7 A;  4EMJ A;  4ZCD A;  1ZKQ A;  4YSZ A;  3COX A;  3SM8 A;  3AD9 B;  3FMW A;  2A89 A;  2WU5 A;  1PJ7 A;  1ZX9 A;  2YG4 A;  4UDR A;  4Z2R A;  1OJT A;  5LV9 A;  4Y4M A;  1COY A;  2DKH A;  2C72 A;  2GQF A;  1F8W A;  2XVI A;  3CN8 A;  2YWL A;  3AE8 A;  3V76 A;  3P4P A;  3AYI A;  1DJQ A;  1GRT A;  2PYX A;  3GYX A;  3D8X A;  4H7U A;  3M0O A;  2R46 A;  3DGZ A;  3T37 A;  3ALJ A;  1H7W A;  3DK8 A;  4OPT A;  4C74 A;  2JAE A;  4YTN A;  1YY5 A;  2X3N A;  2XFP A;  3NK2 X;  4K2X A;  2YAU A;  1KSU A;  4P9S A;  5FS8 A;  4A7A A;  4BJZ A;  1DJN A;  2WPC A;  3I6D A;  2IID A;  2QA2 A;  1W4X A;  3AE3 A;  3BNU A;  2GR1 A;  4H4S A;  1DXL A;  4Z2U A;  3RP7 A;  1M6I A;  2WES A;  2C76 A;  4H4P A;  1D4E A;  1PXA A;  1JRY A;  3EF6 A;  4ZCC A;  2CDU A;  4TLX A;  3NN0 X;  3IHG A;  4TM0 A;  3UKK A;  5KWF A;  1TDK A;  1Q1R A;  3RNM A;  1NG3 A;  2YG3 A;  1N4V A;  1FEA A;  3AWI A;  5J60 A;  5U25 A;  4A6N B;  2GR2 A;  1FL2 A;  2BS3 A;  1LV0 A;  5HHF A;  2WP9 A;  3G5R A;  2C66 A;  1CHU A;  2ZZC A;  1Y56 B;  4HA6 A;  2BAB A;  2XVH A;  3NK1 X;  1Q1W A;  2AAQ A;  3NYE A;  3VRD B;  4YKG A;  2AQJ A;  4CCR A;  4C77 A;  3GD3 A;  1E7P A;  2XCG A;  1CJ3 A;  1N4W A;  3UTG A;  2XLS A;  2R4J A;  3NN6 X;  1IUU A;  4NZH A;  2AR8 A;  3FPZ A;  4U8L A;  4BV6 A;  4IA5 A;  1ZP0 A;  4YSY A;  4X9M A;  4FK1 C;  4DSG A;  1PJ5 A;  1S2Y A;  2X8H A;  2WP5 A;  2V3A A;  2YVF A;  1DOC A;  3BI2 A;  3JSK A;  1LTX R;  4N9X A;  4GUV A;  5KOW A;  2R0G A;  4H4V A;  2YLZ A;  1QLB A;  2XFU A;  2FBW A;  1L0V A;  4TM4 A;  1BZL A;  3K7Q X;  4A9W A;  1PDH A;  2GB0 A;  3FIM B;  2XLT A;  5GRT A;  2YLX A;  4EQW A;  1KDG A;  1GTH A;  3NRN A;  4Z26 A;  1GRG A;  3ABV A;  1NPX A;  4IV9 A;  4C3X A;  2YM2 A;  2YR5 A;  1JRX A;  3CPJ G;  2R9Z A;  4BUR A;  3LXD A;  2QCU A;  1CJ4 A;  1TDO A;  1SEZ A;  2BC0 A;  2YG7 A;  3CGD A;  3OZ2 A;  4I58 A;  1AOG A;  2VRM A;  1DOB A;  2WQY A;  1TDN A;  2GQW A;  2X99 A;  3K7T A;  1IJH A;  1GPE A;  2Z5Y A;  4B69 A;  1ZOV A;  1XAN A;  2EQ8 A;  2V60 A;  1CC6 A;  1TDF A;  4A6N A;  3IF9 A;  1H6V A;  2GV8 A;  3LZW A;  3PVC A;  1P2E A;  4U8N A;  2VVM A;  3P4R A;  4I59 A;  2C3C A;  2CVJ A; 
#chains in the Genus database with same CATH topology
 2BVL A;  2BK5 A;  1OWA A;  3CPI G;  3IC9 A;  2WCA A;  1ZMC A;  3PUG A;  1OED B;  1D0Z A;  4JUY A;  5M0Z A;  1PBF A;  5JDM A;  4PK4 A;  1D7Y A;  2UZZ A;  3ITJ A;  3G5Q A;  4QH4 A;  4IL9 A;  2Q6U A;  3I9W A;  4OX9 T;  3JAD A;  3SY4 A;  2LKH A;  2JQ9 A;  4U8J A;  3EUH A;  1NHR A;  2YVJ A;  4WBN E;  3OC4 A;  3VQR A;  1T72 A;  4P0A A;  1Y01 A;  4EZH A;  5FS7 A;  1DOE A;  5LBQ B;  2KLQ A;  3PUS A;  4IA6 A;  4FX9 A;  1FMW A;  4EM4 A;  3NIX A;  4U8I A;  2V7K A;  2WBA A;  3ZKR A;  5BMV E;  4NEW A;  1NWM X;  4EIW A;  5JRC A;  4YJ2 E;  2WHD A;  2VKH A;  1QO8 A;  3SZW A;  4U2S A;  3A5X A;  3S5W A;  4DND A;  1CJ2 A;  4GYR A;  4TM3 A;  2XAG B;  2Q9Q B;  4U3C A;  2X0L B;  4CNK A;  3S4U A;  2ES0 A;  4N78 D;  2NW7 A;  4CXX A;  4JEU B;  2BVM A;  4JLE A;  2O9Z A;  4X64 T;  2XLR A;  2WOV A;  2F4V T;  3ZMZ B;  4IE4 A;  2BK4 A;  3CTY A;  5LMN T;  5ADX L;  3AE1 A;  1I94 T;  5HCJ A;  2CM0 A;  3PUW F;  3ZPO A;  2FJA A;  2W67 A;  1GES A;  2X50 A;  5DAB A;  4K22 A;  3P1W A;  3I3L A;  4TWD A;  2H88 A;  2GMJ A;  3ZYK A;  4U7Y A;  1O3X A;  2XQ5 A;  5JR9 B;  3UTF A;  1B37 A;  2KWH A;  3II4 A;  5JDQ A;  1GRB A;  1GOS A;  3UKH A;  4AOX A;  1IBM T;  3L1R A;  2BG9 A;  3UKQ A;  3MAC A;  1REO A;  2XJ7 A;  1JRZ A;  2WY2 A;  1HYU A;  3I1A A;  4ICY A;  4MAL A;  5FXV A;  2KWI B;  4WYV A;  1GV4 A;  1GAL A;  3I0Q A;  3JC6 C;  4COF A;  3GWD A;  3F31 A;  4HE8 A;  4TNV A;  4ECH A;  3T2Z A;  3KD9 A;  4B3M T;  2DKI A;  1OJA A;  2DNX A;  3RHA A;  3RKG A;  2BRY A;  4X4J A;  1X31 B;  4RSL A;  3C96 A;  5EZY E;  3U3I A;  2BG9 E;  1BGN A;  4LF9 T;  3LG7 A;  2V3B A;  1NHQ A;  3RC8 A;  3KFW X;  5ABH A;  2RGH A;  3VR8 A;  2WZI A;  2ZM0 A;  2YU1 A;  4O4J E;  4IST A;  2QGS A;  2XVF A;  1BR4 A;  4OYJ A;  1E1H B;  2UXB T;  3RIU C;  3H8L A;  2WAU A;  5FNV E;  4HN9 A;  3CND A;  4EXT A;  3ICS A;  2YK0 A;  1PJ6 A;  3ZN1 B;  2UXD T;  4XAX B;  2NPX A;  2JJ9 A;  2W0H A;  2V5Z A;  5HXS A;  3AB1 A;  2FUP A;  3RRW A;  2OLN A;  4APN A;  4TM1 A;  2E9X A;  4H9S E;  3HL6 A;  1ZMD A;  1FIO A;  3FZL B;  5L4E A;  4DR6 T;  5JVD E;  1SA0 E;  5AQO B;  2C64 A;  3H37 A;  4UP3 A;  3BNM A;  4UVA B;  2LKG A;  4ZI3 D;  3C4A A;  4WW0 A;  2JQK A;  4OYK A;  2CXD A;  3EDV A;  3ZJ2 A;  4B68 A;  4GR1 A;  5H6Q B;  1FMV A;  3NYF A;  1H83 A;  1N33 T;  4H2Q A;  1ZK7 A;  4YSX A;  4B1B A;  2ZBW A;  4GOU A;  2XFN A;  5HY5 A;  4GRT A;  2VVL G;  2IHR 1;  1EBD A;  1S3E A;  2D5U A;  2V6Y B;  4GK5 E;  3F57 A;  5LGU B;  3B13 A;  4LMK A;  4PW8 A;  3C98 B;  4XZC A;  2X67 A;  2VQF T;  3H8I A;  3CGB A;  5FVK A;  1D7L A;  1L9C A;  1N34 T;  1GEU A;  3KBT A;  1OED A;  4EM3 A;  1VCS A;  2W0G A;  5LBM A;  3OVU A;  4FK1 A;  1GND A;  2L3L A;  3T1H T;  5FY7 A;  5AQH B;  3FZF B;  2N9D A;  3ZCI A;  4Z43 A;  5BUK A;  4H63 H;  3PU8 A;  3RF1 A;  4OPC A;  2XQ7 A;  2X66 A;  4NTE A;  2X9Y A;  4H50 A;  4GCM A;  5EK3 A;  1EL8 A;  2IIU A;  2BXR A;  2MPK A;  1S94 A;  1OED E;  5HXE A;  5LJM A;  1NAF A;  4J31 A;  4X9N A;  1ZV4 X;  5TR3 A;  4DNA A;  1MO9 A;  4EMI A;  2NW9 A;  2V6O A;  1XZY A;  2VUR A;  3DJD A;  3ZT6 A;  5LHI B;  1NEN A;  3SX6 A;  1E1N A;  1CF3 A;  4FI5 A;  3CPH G;  2Q9Q A;  3CVR A;  2VVL A;  2JK6 A;  5AQK B;  3ATR A;  5J2T E;  3UU3 A;  3EHZ A;  3ZN0 B;  3SFE A;  3GDN A;  3Q9T A;  4YSH A;  1TRB A;  3FBL A;  3R84 B;  3ZLI A;  3LK3 B;  5EB4 A;  2HPL A;  1MIW A;  3AAI A;  4YWO A;  1JNR A;  2WDR A;  4YTP A;  2Z6E A;  1LQU A;  2XLP A;  1FCD A;  3BI4 A;  4EOZ B;  4HFE A;  2B9W A;  3NNE A;  1LVK A;  2X8C A;  1X9B A;  2K24 A;  3ZMS B;  1D1B A;  2QYW A;  4HGA A;  2GRT A;  5JR9 A;  2LRK A;  1JEH A;  3AAE B;  3KPK A;  4DSH A;  4G2A A;  2WET A;  2E2A A;  3CKD A;  4WBO A;  5ABF B;  3M12 A;  5HYA A;  2X0Y A;  2C4C A;  4BJM A;  3QVP A;  3QB5 K;  4UF0 A;  5JDH A;  1RYI A;  4JI1 T;  2R6G F;  3T0K A;  3T2K A;  4EYU A;  3NVO A;  4LMJ A;  4BK1 A;  4C5O A;  3ZST A;  1K0J A;  4EQR A;  2C5K T;  4JNQ A;  5HXC A;  3P7I A;  2LSJ A;  1Q9I A;  3AA1 B;  3N2K E;  2EQ6 A;  5JRE A;  3NHO X;  1GRH A;  2VQB A;  3H3M A;  2R0C A;  2XAQ B;  3EAN A;  3KU9 A;  1TDE A;  2E5V A;  1HNX T;  4UDP A;  5EBK A;  4ZCD A;  2W63 A;  3COX A;  3SM8 A;  3AD9 B;  3FMW A;  2K9A A;  1ZX9 A;  2WZH A;  4UDR A;  2LSG A;  2KT9 A;  2DKH A;  4HWC A;  4ILA A;  3CN8 A;  4UVB B;  3GYX A;  3LFM A;  2PYX A;  3M0O A;  2R46 A;  3DK8 A;  3HYW A;  3DTO A;  1YY5 A;  2EHO B;  1KSU A;  4TUY E;  4G74 A;  1ZEE A;  4ZZB A;  2UUC T;  3I6D A;  3B5M A;  3ZCJ A;  3BNU A;  2GR1 A;  1DXL A;  4IDZ A;  4H4P A;  1J1J A;  2V7L A;  5KWF A;  1Q1R A;  3RNM A;  5FL0 A;  1FEA A;  3V5U A;  4IDN A;  1LV0 A;  3NZP A;  4HA6 A;  2XAF B;  1LKX A;  4YKG A;  4C77 A;  3GD3 A;  1OED C;  3G06 A;  1CJ3 A;  5LG3 A;  2CEA A;  1IUU A;  1D1C A;  4F8H A;  1ZP0 A;  2V7I A;  4YSY A;  4ZHQ E;  4FK1 C;  4CQI A;  3HYV A;  4DSG A;  1LTX R;  4H4V A;  1QLB A;  3NRX A;  2M6I A;  1L0V A;  1BZL A;  4A9W A;  1XWM A;  1PDH A;  5JRC B;  2XLT A;  4EQW A;  2BBJ A;  4Z26 A;  2V6Y A;  1GRG A;  1U5P A;  3ABV A;  2J4G A;  2LE8 A;  2ZM6 T;  4PK5 A;  1TDO A;  2DCF A;  3ZEF B;  3R6N A;  1MMN A;  2YG7 A;  3CGD A;  4LML A;  2VRM A;  2WQY A;  4KHP T;  1TDN A;  2X99 A;  3K7T A;  2Z5Y A;  2BZB A;  1TDF A;  2V60 A;  2GV8 A;  5HXR A;  1P2E A;  3P4R A;  3JCF A;  4DUY T;  2C3C A;  2YQU A;  3BHF A;  3UU8 A;  2I0M A;  5HEH A;  2Q9Q C;  3P9U A;  3SQP A;  4YTM A;  2DHR A;  5HEU A;  2FJB A;  2BKP A;  4FJO A;  4ASK A;  2K3W A;  1EL5 A;  4D04 A;  2UXX B;  5AQM B;  3Q5X A;  3B3R A;  4JV5 T;  1IJ5 A;  1HG5 A;  2LT3 A;  3GYJ A;  2NW8 A;  4F6R C;  3NT6 A;  2UXN B;  3ETU A;  5KOX A;  5ETW A;  3T14 A;  4UV9 B;  4Q25 A;  1WFD A;  2AXD S;  3UUL A;  2YM1 A;  3AB3 B;  3SRZ A;  1UGO A;  2WBL A;  4DV4 T;  3Q2M A;  3QSM A;  2C7G A;  4CZZ B;  4A65 A;  4AKI A;  2ZZ0 A;  3NZQ A;  2E9X D;  4Z90 A;  5JR9 C;  4LF7 T;  3CNJ A;  2G0U A;  2W62 A;  4H2R A;  1BKW A;  2CCQ A;  2LEH A;  3E0Z A;  2BDE A;  2ARD A;  3P4W A;  4E7S A;  4LFC T;  1NAA A;  2A87 A;  3CIR A;  3RH3 A;  4IDP A;  3O4X E;  3GWH A;  4A5X A;  3C4X A;  5L46 A;  5GSN A;  3DGH A;  3VKH A;  4C90 A;  2IW5 B;  3L3P A;  4B3R T;  2GR0 A;  2JPF A;  2W2U A;  4HTE A;  3F8D A;  4L5G A;  3LZX A;  2XY8 B;  2CRB A;  4EZ4 A;  5LG4 A;  4ADW A;  3DJG X;  4YHH T;  5KRQ A;  4B65 A;  5ABF A;  4ZXL A;  3AVR A;  4AKL A;  5LXT E;  2QVA A;  2SPC A;  3PUX F;  5HAX A;  4K5R A;  1S2Q A;  1WRD A;  2L9Q A;  1NDA A;  1JU2 A;  2YR4 A;  1D5T A;  3CNS A;  3KVE A;  2XAS B;  5LJN A;  3RC3 A;  4RG4 A;  5AQL B;  3V5S A;  1UKV G;  4K0U A;  1N32 T;  4L9I A;  4CN4 A;  5FL1 A;  2B7S A;  1MNE A;  4WNK A;  2R0P A;  4DV3 T;  3ANW B;  4AKG A;  1T98 A;  3BK9 A;  4O4H E;  2WM9 A;  5LGN B;  1D0X A;  4B63 A;  1HNZ T;  3RLF F;  2BS2 A;  1VDC A;  4QKN A;  1W9R A;  1Z8U A;  2NWB A;  5JDG A;  1CUN A;  2Q9Q D;  3IHM A;  1WR0 A;  1HTJ F;  3PE0 A;  3PU3 A;  2EHO A;  2QA1 A;  1V9D A;  1VRQ B;  2IUB A;  2JQQ A;  4C91 A;  2NTX A;  5DQV A;  2BKN A;  4B64 A;  3LOV A;  1QJD A;  2XDO A;  4UDQ A;  5FKY A;  3AYJ A;  4H4Y A;  2CWO A;  3UUN A;  4JDR A;  4Z91 A;  3K3Q C;  1DU2 A;  4HFI A;  4EB6 E;  2ACZ A;  1H7C A;  5LYJ E;  4DUZ T;  2VZ2 A;  4OCG A;  1UX4 A;  1YKE B;  3IEE A;  3UTH A;  5IHY A;  4E0V A;  4GIW A;  3N9Q A;  3N9N A;  1MOK A;  2GH5 A;  3NTA A;  2A8X A;  4DO0 A;  3TLU A;  1PS9 A;  3ADA B;  3HYX A;  3QUJ A;  2WWV A;  3G5S A;  2KIN B;  2XLU A;  2Y6R A;  1JNZ A;  5AQP B;  2E5L T;  1VG0 A;  3N2G E;  1GXF A;  1VOM A;  3O1H A;  2AE9 A;  3UP5 A;  4NTC A;  2C3D A;  4J2C A;  1YKH B;  1B4V A;  5FS9 A;  4UXN B;  3UOV A;  1LVL A;  3CX7 B;  3KLJ A;  3HZL A;  4YY3 T;  1MXT A;  4YT0 A;  4JNA A;  4DR4 T;  2JBV A;  4TWF A;  3RP6 A;  1Z0P A;  4B66 A;  3E08 A;  2IC6 A;  4IGU A;  1ELI A;  1PN0 A;  4U33 A;  2IVE A;  4H2P A;  3DK4 A;  3CGC A;  4JY3 A;  4A97 A;  3KKJ A;  5KVH A;  4CI1 B;  2YLW A;  2B9X A;  5AFU L;  3GMC A;  3IA3 A;  4JI7 T;  1F8S A;  5L3C B;  1V59 A;  4J56 A;  4DMV A;  4BK2 A;  4CBQ A;  2A2F X;  4IIJ E;  3EAM A;  4UF0 B;  3TLV A;  2DL1 A;  3OTO T;  3DA1 A;  1WR6 A;  4P09 A;  5GON E;  3AE4 A;  3EAB A;  5F5W A;  2XQ4 A;  1MIY A;  4ZS3 A;  3LK4 2;  1WYB A;  2FJD A;  3HKE E;  3N9O A;  1B5Q A;  4JBW F;  2CFY A;  4KMC A;  2X68 A;  4DBQ A;  1RSG A;  2CMR A;  4KHZ F;  4A79 A;  4IL4 A;  3DK9 A;  1H86 A;  3ETV A;  4I55 E;  1T7S A;  5KMR A;  4JI6 T;  4UVC B;  2APG A;  1NG4 A;  4DV7 T;  4K7Z A;  5L2L A;  3AA6 B;  2UUB T;  4U8K A;  3BQL A;  4C3Y A;  2LSI A;  5HWX A;  1ZOY A;  3PUZ F;  1VG9 A;  4CY8 A;  2XUE A;  2LHN A;  4E7Z A;  3ICR A;  1O5W A;  5IQ1 A;  2GK9 A;  4TX5 A;  3C50 A;  4QX8 B;  4BAY B;  4J2W A;  4U2T A;  5DBJ A;  4USQ A;  2EHO C;  2XVE A;  3GRS A;  4DBR A;  2WPF A;  3MK7 C;  3ALM A;  4B3S T;  2BA9 A;  3KPF A;  1GT8 A;  1B8S A;  4IVM B;  3UCL A;  2CLY C;  2WOW A;  1N36 T;  3C4N A;  1HCI A;  1HF8 A;  3I0O A;  3L8K A;  4BJN A;  1WYC A;  4ILU A;  2CHN A;  2K48 A;  3K30 A;  3ANW A;  5FS6 A;  3HI2 A;  3PUY F;  1IUX A;  3GDP A;  4KP3 C;  1IUS A;  2TMD A;  1ZDL A;  5F8P A;  3MA9 A;  5KMS A;  4IRE A;  3I9Y A;  4H9P C;  2PG8 A;  2A89 A;  4PJL A;  4HFV A;  4HWD A;  4Z2R A;  1OJT A;  2KSR A;  4Y4M A;  3VHL A;  1F8W A;  2XVI A;  4X66 T;  2JMK A;  3V76 A;  2DWG A;  2V5D A;  3PJA A;  4O8S A;  5F3J A;  2H7V C;  4ZI2 C;  4IE5 A;  2JRK A;  4YTN A;  3NK2 X;  2X3N A;  4K2X A;  2YAU A;  4P9S A;  5FS8 A;  1WLX A;  3FBZ A;  1W4X A;  3AAA B;  4Z2U A;  4TWH A;  2LOP A;  3RP7 A;  1XMO T;  3FZK B;  2WES A;  2C76 A;  1PXA A;  5A1L A;  1JRY A;  3EF6 A;  4ZCC A;  1Y64 B;  4TLX A;  3NN0 X;  3UKK A;  3O1I A;  4ILC A;  3JC6 D;  4KUM B;  4AXP A;  5J2U E;  2YIN A;  3UUB A;  2XVH A;  3NYE A;  3UTK A;  3PV0 F;  4B3T T;  3UT5 E;  4PJM A;  4NNJ A;  2XLS A;  2R4J A;  2HN1 A;  2AR8 A;  4PJN A;  4X9M A;  3ZJ1 A;  4ZI7 E;  2YVF A;  1DOC A;  3BI2 A;  3JSK A;  1BR1 A;  4PFP A;  4QX7 B;  4GUV A;  5KOW A;  4I4T E;  5IYZ E;  2MTQ A;  3C64 A;  2ZM2 A;  4X20 E;  3X1D A;  4X1Y E;  4JEH B;  3FIM B;  1WCR A;  5LHG B;  2YLX A;  4MFR A;  3CWZ B;  5CJ5 A;  2V6X A;  4IV9 A;  1JRX A;  3SYI A;  2BKO A;  2I59 A;  3QC9 A;  1CJ4 A;  3T8O A;  1SEZ A;  3GN5 B;  5JH7 E;  3UUM A;  5CGM A;  3KVA A;  2RPA A;  3KV6 A;  2GQW A;  4B69 A;  1XAN A;  4CI3 B;  3IF9 A;  3Q9D A;  4DMW A;  4I59 A;  3LJP A;  3H3A A;  1PXC A;  4WX1 A;  4GDE A;  5AQR B;  1HR0 T;  4ZZC A;  1YQ3 A;  5C2T A;  5FVL A;  4QXB B;  2IML A;  3K7M X;  3ISH A;  4HWH A;  3GRT A;  2XVJ A;  1MMA A;  1KNZ A;  1E6E A;  2M67 A;  2YOE A;  3RKO A;  3ICT A;  5AQJ B;  2V8S V;  5C3J A;  1GRF A;  2YKS A;  3EPT A;  1K4Q A;  3CGE A;  4PJJ A;  2GAH B;  4HFD A;  3KVB A;  4CN1 A;  1E1K A;  1GER A;  2VQ7 A;  1Y56 A;  1IUV A;  3PUR A;  2YLR A;  4GF7 A;  2YLS A;  4DGK A;  1LJ1 A;  1PBB A;  2LHR A;  3Q5W A;  1OJ9 A;  2I6H A;  4O4L E;  4X5T A;  2DLR A;  3VU7 H;  3HKB E;  4DR2 T;  3FHN A;  4A98 A;  1DNC A;  1S35 A;  1PXB A;  1KNR A;  1FEC A;  3QOF A;  4TNW A;  5IQ4 A;  2L8K A;  1ZKE A;  3AE9 A;  3NYC A;  3FBS A;  2EQ9 A;  2YG6 A;  2LFC A;  4I0U A;  4G6G A;  2XQ6 A;  3CNT A;  3EI0 A;  3QFA A;  3PDY A;  5JCL A;  4Y4L A;  3AA0 B;  4NUV A;  2BK3 A;  2C70 A;  2J62 A;  4JI8 T;  1R8I A;  4A99 A;  2XAH B;  4U2Z A;  2B1E A;  3SXI A;  2V7J A;  3FXD B;  4Z44 A;  4O5U A;  1H82 A;  1GTE A;  1FEW A;  2KND A;  2LRL A;  3IHR A;  5AQN B;  5LNK A;  4QH5 A;  3RI5 A;  1E1L A;  1XDI A;  3CMM A;  1MMG A;  2CLY B;  2WEU A;  4I43 B;  4IDQ A;  2Y6Q A;  4H4W A;  1M64 A;  5KXJ A;  4J34 A;  1D4C A;  3UU5 A;  4ZEY A;  4NPP A;  4JI4 T;  2GAG B;  4HWF A;  5JDN A;  3QVR A;  2BBH A;  2CHO A;  3ATQ A;  2XSA A;  2V5C A;  3A8Y C;  1IBL T;  4G73 A;  4DR7 T;  3QFB A;  1IUW A;  4A5L A;  3RYH E;  1BR0 A;  2JKC A;  1HX1 B;  2MYS A;  3EDU A;  2VKO A;  2IDO B;  4HWI B;  3BQK A;  1UCU A;  1FJG T;  2DI4 A;  2OA1 A;  2Z5X A;  3TLS A;  4Z24 A;  1ZHC A;  1RP0 A;  4II3 A;  4TN7 B;  4PK6 A;  4IE6 A;  3WE0 A;  5HCM A;  3HR0 A;  2R4E A;  2PJQ A;  3URH A;  5HXI A;  1M62 A;  1KK7 A;  3KDS E;  5EK2 A;  3LDQ B;  2RP4 A;  2GF3 A;  2J47 A;  3AE2 A;  1L9D A;  3D1C A;  4XXG A;  3CQC B;  4OK0 A;  1ONF A;  1YQ4 A;  4PNI A;  2JIW A;  5M10 A;  2M6B A;  4NXN T;  5LMU T;  5L4H A;  5HXH A;  3GSI A;  4OPL A;  1P2H A;  2C73 A;  3L39 A;  1YXR A;  3RHW A;  1XDO A;  2Y8D A;  3N9P A;  1K0I A;  4XWR A;  5IWA T;  4O4I E;  4PAG A;  4K0K T;  2LM2 A;  2XZE A;  4OFZ A;  4WCT A;  4EQX A;  3P4S A;  4U7I A;  4KX6 A;  2WMO A;  2VOU A;  3QSE A;  4KPR A;  4ISS A;  2E8I A;  1BF3 A;  2YR6 A;  5LCY A;  2GVC A;  4UIG A;  3ZC0 A;  5KDM C;  4P1N A;  3F8P A;  2ACX A;  2PTF A;  4J33 A;  2LLY A;  1IJ6 A;  2RGO A;  4LFA T;  2I0Z A;  3F2E A;  4AT0 A;  2YVG A;  1S3B A;  4EIP A;  4Z2T A;  5HEO A;  1W0B A;  3QSS A;  3QNU A;  2UUA T;  5CA1 E;  4AQF A;  2YG5 A;  3EAO A;  5HYM A;  4EEB A;  3KV9 A;  5LA6 E;  3O0H A;  2LM9 A;  2QRX A;  3RGL A;  4YKF A;  3AD8 B;  2CXF A;  4H2N A;  5AQF B;  1YKJ A;  3FZM B;  3AEG A;  4RG3 A;  4DV2 T;  4WZX A;  5AQS B;  3WI3 A;  4M52 A;  2XQY A;  3GN5 A;  5JCK A;  5U1O A;  5JCI A;  2Q0K A;  4LII A;  4XWZ A;  2NTY A;  4CXY A;  1G73 A;  3ALL A;  1JOA A;  2WB5 A;  3GYI A;  4BA9 A;  5CQF A;  3ESL A;  2WDV A;  5L3D B;  2B7R A;  1VCT A;  2CUL A;  2X9W A;  3GMB A;  3AE7 A;  3AEA A;  3NTD A;  5EK4 A;  4OPI A;  4QXH B;  4OPG A;  1EZ3 A;  4CNJ A;  5E0O A;  2WP6 A;  3QK6 A;  1PBD A;  4H4R A;  4NUU A;  4OPD A;  4H4Z A;  3NKS A;  4HB9 A;  4G63 A;  1KSS A;  2VL0 A;  1LPF A;  1EL9 A;  3KV4 A;  2V1D B;  1GSN A;  4X1I E;  2X9X A;  3M3Z B;  1ZY8 A;  4IE0 A;  3RYF E;  4AT2 A;  4I50 E;  4ERR A;  1J5E T;  3JAF A;  3LAD A;  2WU2 A;  4HKA A;  3T31 A;  4AKR B;  2TPR A;  2QAE A;  4JI3 T;  4YHJ A;  3UKF A;  5FMH A;  2NOX A;  2V61 A;  4ZN0 A;  1NHS A;  2LJL A;  3RX6 A;  1E1M A;  2D0T A;  2Y48 B;  5J1G A;  2XFQ A;  5LB7 B;  1FEB A;  1CC4 A;  3NLC A;  1KFY A;  3QJ4 A;  3PJA J;  4L0R A;  2BCP A;  1G8X A;  4B6X A;  2WDQ A;  5EOW A;  3CK6 A;  1UX5 A;  5FXX A;  4IVO B;  3CPZ A;  5HEG A;  2V26 A;  1PBC A;  5ABE A;  4AIS A;  3AEF A;  5AQG B;  3RYC E;  1L9E A;  1HX8 A;  4UEM A;  3B6D A;  4JI0 T;  4USR A;  2XM1 A;  2X51 A;  3SFD A;  1Z6L A;  3KA7 A;  3UQ7 A;  4LF8 T;  4HFC A;  3WAJ A;  2JB3 A;  4EIQ A;  1U4Q A;  2LOS A;  5L3G B;  3SZC A;  3NBX X;  1N1P A;  1KNP A;  2XAJ B;  4FDC B;  3SZF A;  5DQW A;  3R9U A;  3SGL A;  5JQG E;  4H9O C;  3ZT7 A;  3ZMT B;  5L3B B;  1HS7 A;  1YQZ A;  4EGW A;  1UK5 A;  2BXS A;  3DME A;  3C4Z A;  2J3N A;  3SWH A;  2BCG G;  4U72 A;  4CXW A;  1F6M A;  3AVS A;  4YSZ A;  4LFB T;  3K1S A;  4G6H A;  2WU5 A;  1PJ7 A;  2YG4 A;  4H63 V;  5LV9 A;  2C5I T;  3CQG B;  3WAK A;  1XMQ T;  2C72 A;  3U78 A;  3AE8 A;  3C51 A;  1E2A A;  3P4P A;  3RIA A;  4H7U A;  4ZI3 C;  3QB5 A;  5L3F B;  1H7W A;  3ALJ A;  4OPT A;  4AQF C;  2XFP A;  2P9B A;  2VVN A;  3HKC E;  5LGT B;  4BJZ A;  2WPC A;  2IID A;  2QA2 A;  4ILB A;  2QA7 A;  1XDP A;  2XSB A;  1M6I A;  4IDO A;  3D0T A;  1D4E A;  3NRY A;  1T8B A;  2A72 A;  5FY0 A;  3IHG A;  4TM0 A;  2UXC T;  1TDK A;  3PUA A;  2YG3 A;  4HFH A;  1N4V A;  1GQE A;  2N1G A;  4QWN B;  3AWI A;  5U25 A;  2C0S A;  3O9X A;  2XQ3 A;  2WP9 A;  1CHU A;  2ZZC A;  1Y56 B;  2AAQ A;  2N2N A;  3VRD B;  4IHJ E;  2CBJ A;  4CCR A;  4UR9 A;  1E7P A;  1US7 B;  4YFS A;  5LHH B;  3NN6 X;  5JDL A;  3FPZ A;  3ONX A;  4BV6 A;  4TV8 E;  2WP5 A;  1X79 A;  4U31 A;  2VWA A;  2CWY A;  2YDR A;  2YLZ A;  2FBW A;  4TM4 A;  3K7Q X;  2OV9 A;  4V1A v;  2HN2 A;  2XPK A;  3LBX B;  3NRN A;  3UU4 A;  2YM2 A;  3GA8 A;  5JDF A;  2MOZ A;  2R9Z A;  2X0H A;  2QCU A;  1YD8 G;  2YEV C;  5KMQ A;  1UUS A;  2BC0 A;  3OZ2 A;  4JI2 T;  4I58 A;  2CBI A;  4AQY T;  1IJH A;  1GPE A;  3ZYM A;  1CC6 A;  1H6V A;  4U8N A;  1W0A A;  3RPU A;  4KBM B;  3ZMV B;  3PUV F;  4DV1 T;  2CE7 A;  2VVS A;  1SHZ C;  5AQT B;  2YDS A;  1BWC A;  2JB2 A;  4OHF A;  2F5Z A;  2XTL A;  3ONJ A;  2RGJ A;  3VRB A;  3TLW A;  2FJE A;  3UFG A;  2WOI A;  2W66 A;  3ZDN A;  3Q6J A;  5KMP A;  4O5Q A;  2XQA A;  3UFE A;  2BRA A;  3K3N A;  3BI5 A;  4AQG A;  3CQX C;  1B7T A;  2OAL A;  1H81 A;  2BC1 A;  3UKP A;  3ZC1 A;  4QHO A;  3AYL A;  5CB4 E;  2VAS A;  3RIF A;  3DJB A;  2W4X A;  5L3E B;  2XM2 A;  3J9X 1;  1E39 A;  2XYO A;  4PAB A;  3S61 A;  1H7X A;  3AEB A;  4CCQ A;  1OJD A;  5AQI B;  2VKJ A;  2C5J A;  3MXZ A;  1LRZ A;  3RED A;  5KX5 E;  5FY1 A;  2RAB A;  3ZYX A;  4D03 A;  2D2S A;  1QSD A;  4UV8 B;  4II2 A;  2ZM8 A;  2IVD A;  3GD4 A;  4DR5 T;  4H4Q A;  3AEE A;  3N5L A;  3H4K A;  2OA5 A;  4EYY R;  4HEA A;  3UOZ A;  4JYA T;  1TYT A;  2DWK A;  2YN6 A;  3N9L A;  4TLZ A;  4AIU A;  1VRB A;  3BQI A;  3LJC A;  2CA5 A;  1AJ3 A;  4U8O A;  2BYB A;  3PTR B;  1HFA A;  2C75 A;  2CXL A;  2WWU A;  3AED A;  1D4D A;  1O94 A;  5IPY A;  3E22 E;  4PAA A;  4JN9 A;  3UQ4 A;  4MHC A;  3VKG A;  3HKD E;  1MMD A;  4Z8X A;  4CI2 B;  3V3O A;  2Q0L A;  1VQW A;  2NVK X;  2H3R A;  2C65 A;  4A56 A;  4EMW A;  3AA7 B;  1CC2 A;  4U74 A;  3OBV E;  2XQ9 A;  4U8M A;  3NG7 X;  1IZN B;  3BHK A;  3LB8 A;  1PHH A;  1IBK T;  3ZMU B;  1KF6 A;  2LSY A;  1Y0P A;  4JQ9 A;  3K3O A;  4EQS A;  3IWA A;  2A3D A;  2B76 A;  1DOD A;  4OVI A;  3NK0 X;  1SE7 A;  3OKQ A;  1CL0 A;  3AXJ B;  1OJC A;  1LVF A;  3AXB A;  4GDP A;  5JCN A;  2OAM A;  3K8P C;  5LOV E;  3PO7 A;  2EHO D;  4AKH A;  4U8P A;  2BG9 C;  3AE6 A;  1F8R A;  4QH1 A;  3ONL C;  5AQV B;  5CFB A;  3ZYL A;  3UOX A;  2YLT A;  3Q5E A;  4AOS A;  3VR9 A;  5U63 A;  4DR3 T;  1OXZ A;  4AP1 A;  1QUU A;  3SZ0 A;  3MJX A;  3MKD A;  4M1P A;  3E1T A;  1I6Z A;  2XQ8 A;  3PUQ A;  4GYS A;  2NP9 A;  4EV6 A;  3T1Y T;  2C67 A;  4P0B A;  2Y6X A;  3L09 A;  4GAV A;  4ANJ A;  1CBO A;  3Q5D A;  3UU6 A;  2E1M A;  2XHE B;  4AI6 A;  4Y4N A;  3AE5 A;  4NEV A;  5CA0 E;  4XBF B;  1YW0 A;  1LQT A;  3P4Q A;  1BGJ A;  5FP3 A;  4NXM T;  2YDQ A;  4YXD A;  4AP3 A;  3UKA A;  4CY6 A;  2IC9 A;  3SS1 A;  1EL7 A;  4H4X A;  1NEK A;  4X62 T;  4ZI2 D;  3LK2 B;  3DJJ A;  4LU6 A;  3VRA A;  3RYI E;  5BUL A;  2ZZB A;  2X8G A;  3IF8 B;  5HEJ A;  3LBX A;  4H9N C;  2JQH A;  2VRL A;  3IBP A;  2JB1 A;  3OYZ A;  4U2Y A;  3NH3 X;  1D0Y A;  5BRT A;  2D9D A;  5FXW A;  4JY2 A;  2WSS V;  5LP6 E;  1F3P A;  4CRT A;  2BAC A;  1M7K A;  2E9X C;  2R45 A;  3GWF A;  2E4G A;  2LSK A;  4K8D A;  3FG2 P;  3W15 B;  3NKZ A;  1H84 A;  2MAW A;  3PS9 A;  5J7X A;  1IAP A;  4DR1 T;  3RP8 A;  4A6N B;  2H89 A;  1PBE A;  2HQM A;  4MJW A;  3LSV A;  2OLO A;  2KZ7 B;  2Q7V A;  2RA1 A;  3AEC A;  3DJE A;  2WMN A;  3OPC A;  4CN6 A;  3KBU A;  4H9Q C;  4NTD A;  1XHC A;  3FXE B;  1SUM B;  2YU2 A;  2WPE A;  1GET A;  4K5S A;  2ODV A;  4ADZ A;  3ZT5 A;  4BK3 A;  2GMH A;  2WS3 A;  4U2L A;  4X1K E;  1D1A A;  3UP4 A;  3OYX A;  2OLT A;  2HH7 A;  3AD7 B;  5KVI A;  5L47 A;  2VL8 A;  1HG2 A;  4KI0 F;  2GR3 A;  1XPQ A;  3B57 A;  4HFB A;  4OPU A;  2B9Y A;  4G9K A;  1IUT A;  1XNQ T;  5CKU A;  5BVA A;  4LF6 T;  3A7M A;  2H7O A;  4ZOL E;  4B67 A;  3KV5 A;  1UUR A;  3UOY A;  1O95 A;  5JCM A;  3UKL A;  3DH9 A;  3V3N A;  3M13 A;  3C4W A;  2PHH A;  4GAP A;  4GKK T;  4EAH A;  5ER0 A;  3GMI A;  3P8C D;  5HWY A;  1CJC A;  1K0L A;  4EED A;  5EB5 A;  3NWI A;  4DVD A;  5ABG A;  2GEW A;  3NGC X;  4BJY A;  1FOH A;  4DID B;  2J1D G;  4H4U A;  2XFO A;  1TYP A;  1GRE A;  4IE7 A;  4REK A;  5M4Y A;  1BR2 A;  3JAE A;  1GRA A;  1J5W A;  4H4T A;  4NIQ A;  3CX8 B;  4UEL A;  2K5B B;  4JI5 T;  4QXC B;  1XNR T;  4Z25 A;  4J57 A;  3DP7 A;  4MLK A;  3F8R A;  3UTE A;  4LA1 A;  2VB6 A;  2NR4 A;  1MIV A;  2BS4 A;  5AQU B;  5KNL A;  3CNP A;  1NHP A;  2BG9 B;  5FMN A;  5C8Y E;  2ZMA A;  4J36 A;  1N4U A;  3M65 A;  3KIN B;  3FZH B;  2EQ7 A;  4EMJ A;  3HA4 A;  1ZKQ A;  3AXJ A;  4MBQ A;  2A9U A;  3CX6 B;  3N2O A;  2PFV A;  5AQQ B;  1COY A;  2UU9 T;  2GQF A;  5IUX A;  2YWL A;  3O1J A;  3TLT A;  3AYI A;  5BR8 T;  1DJQ A;  1GRT A;  3D8X A;  3ZSS A;  4IT4 A;  3DGZ A;  2IAK A;  3T37 A;  3SOL A;  4C74 A;  2JAE A;  3P50 A;  3RRC A;  4LF4 T;  3CML A;  4A7A A;  1DJN A;  2KMF A;  2ZLY A;  3MZK B;  2VK9 A;  3AE3 A;  4H4S A;  3J7Y q;  2ODU A;  2CPT A;  3UUX B;  2CDU A;  2HHH T;  4LF5 T;  1HNW T;  2V7M A;  1NG3 A;  3RQU A;  5J0Z A;  3TKL B;  3RQW A;  3T2Y A;  5J60 A;  2GR2 A;  5DJQ C;  1FL2 A;  2BS3 A;  5HHF A;  3G5R A;  2C66 A;  5JTG A;  2BAB A;  3NK1 X;  1Q1W A;  4H9R C;  2AQJ A;  2MBG A;  4TV9 E;  4GKJ T;  4TZ4 C;  2PBI A;  2XCG A;  1N4W A;  3UTG A;  4O2B E;  2W61 A;  4NZH A;  3L8R A;  1KEY A;  3EVY A;  4U8L A;  4IA5 A;  2E9X B;  1PJ5 A;  1S2Y A;  2VQE T;  2X8H A;  2VKD A;  2V3A A;  5H6R B;  4ZS2 A;  4N9X A;  2R0G A;  5KMG P;  4YLH A;  2XFU A;  1MND A;  3RIU A;  4PFO A;  2KXP B;  2GB0 A;  5GRT A;  3N9M A;  3FB2 A;  3OJA A;  1KDG A;  1GTH A;  1NPX A;  4DV0 T;  4C3X A;  4DV5 T;  4YJ3 E;  2YR5 A;  3CPJ G;  2JMH A;  5TAO A;  4BUR A;  3LXD A;  1W09 A;  2X9H A;  4GK0 E;  2D0U A;  5FYM A;  1AOG A;  1DOB A;  2W00 A;  4O2A E;  4X65 T;  4DV6 T;  1ZOV A;  4NWZ A;  2EQ8 A;  5FXZ A;  4A6N A;  3LZW A;  3PVC A;  2VVM A;  2HPJ A;  2CVJ A; 
#chains in the Genus database with same CATH homology
 2BK5 A;  3LJP A;  1PXC A;  2YQU A;  4GDE A;  2JB2 A;  1BWC A;  3BHF A;  3CPI G;  3IC9 A;  4WX1 A;  2F5Z A;  1ZMC A;  1YQ3 A;  2RGJ A;  5C2T A;  3P9U A;  3SQP A;  3VRB A;  4YTM A;  5M0Z A;  3K7M X;  2FJB A;  2FJE A;  1PBF A;  3ISH A;  2WOI A;  3ZDN A;  1D7Y A;  3GRT A;  2UZZ A;  2XVJ A;  3Q6J A;  5KMP A;  3ITJ A;  3G5Q A;  1EL5 A;  4O5Q A;  1E6E A;  4D04 A;  3ICT A;  3B3R A;  2BRA A;  2Q6U A;  1GRF A;  5C3J A;  3BI5 A;  3EPT A;  1K4Q A;  3CGE A;  3GYJ A;  2GAH B;  1E1K A;  1GER A;  2OAL A;  2VQ7 A;  1Y56 A;  3SY4 A;  1IUV A;  1H81 A;  3NT6 A;  2BC1 A;  3UKP A;  2YLR A;  4GF7 A;  5KOX A;  4U8J A;  3T14 A;  1NHR A;  3AYL A;  2YM1 A;  2YVJ A;  2YLS A;  3OC4 A;  4DGK A;  1LJ1 A;  1PBB A;  1OJ9 A;  3VQR A;  3QSM A;  2C7G A;  4A65 A;  2ZZ0 A;  5FS7 A;  1DOE A;  1DNC A;  4IA6 A;  1PXB A;  4FX9 A;  1KNR A;  1FEC A;  4EM4 A;  1E39 A;  3CNJ A;  3NIX A;  4U8I A;  2XYO A;  4H2R A;  1BKW A;  2WBA A;  4PAB A;  3S61 A;  1H7X A;  3AEB A;  4CCQ A;  5IQ4 A;  1OJD A;  3AE9 A;  3NYC A;  3FBS A;  2EQ9 A;  4NEW A;  2YG6 A;  2LFC A;  2ARD A;  4G6G A;  3RED A;  2WHD A;  3CNT A;  1QO8 A;  3SZW A;  2RAB A;  4U2S A;  3QFA A;  3ZYX A;  4D03 A;  3S5W A;  1CJ2 A;  5JCL A;  4II2 A;  4Y4L A;  1NAA A;  4TM3 A;  2A87 A;  2BK3 A;  4CNK A;  2C70 A;  3CIR A;  2IVD A;  3GD4 A;  4A99 A;  5L46 A;  4H4Q A;  5GSN A;  2O9Z A;  3DGH A;  3AEE A;  2XLR A;  2WOV A;  3SXI A;  2GR0 A;  3H4K A;  3F8D A;  4Z44 A;  4O5U A;  1H82 A;  1GTE A;  2BK4 A;  3LZX A;  3UOZ A;  3CTY A;  1TYT A;  3AE1 A;  1E1L A;  1XDI A;  3CMM A;  4TLZ A;  2WEU A;  2FJA A;  4ADW A;  2Y6Q A;  1GES A;  3DJG X;  2X50 A;  1M64 A;  5KXJ A;  4H4W A;  4J34 A;  1D4C A;  4K22 A;  3P1W A;  3I3L A;  5KRQ A;  2GAG B;  4B65 A;  2H88 A;  2GMJ A;  4U8O A;  2BYB A;  3QVR A;  3UTF A;  2C75 A;  1B37 A;  1O94 A;  3AED A;  1D4D A;  3II4 A;  3ATQ A;  5IPY A;  4K5R A;  1S2Q A;  1GRB A;  1GOS A;  1NDA A;  3QFB A;  4G73 A;  1IUW A;  4PAA A;  4A5L A;  3UKH A;  4AOX A;  4JN9 A;  1JU2 A;  2YR4 A;  1D5T A;  3L1R A;  3CNS A;  3KVE A;  2JKC A;  3UKQ A;  4RG4 A;  3V3O A;  1REO A;  2Q0L A;  1VQW A;  1JRZ A;  1UKV G;  2NVK X;  1HYU A;  2C65 A;  4ICY A;  4EMW A;  1CC2 A;  1GV4 A;  2B7S A;  2OA1 A;  2Z5X A;  4U8M A;  1GAL A;  3NG7 X;  2R0P A;  3BHK A;  4Z24 A;  3LB8 A;  1RP0 A;  1PHH A;  4II3 A;  3GWD A;  4ECH A;  3WE0 A;  3T2Z A;  3KD9 A;  2R4E A;  3URH A;  5HXI A;  2DKI A;  1KF6 A;  1OJA A;  1Y0P A;  4JQ9 A;  4EQS A;  3IWA A;  2B76 A;  1DOD A;  4OVI A;  3NK0 X;  2GF3 A;  4B63 A;  1CL0 A;  3RHA A;  2BRY A;  2BS2 A;  1VDC A;  1OJC A;  4X4J A;  3AE2 A;  1L9D A;  1X31 B;  3AXB A;  3D1C A;  4GDP A;  4RSL A;  4XXG A;  3C96 A;  5JCN A;  2OAM A;  1BGN A;  3IHM A;  3PO7 A;  1ONF A;  2V3B A;  1NHQ A;  1YQ4 A;  3AE6 A;  2QA1 A;  4U8P A;  1F8R A;  1VRQ B;  5M10 A;  2RGH A;  3VR8 A;  3UOX A;  2XVF A;  3GSI A;  2YLT A;  4B64 A;  4AOS A;  3LOV A;  4OPL A;  1P2H A;  1QJD A;  2XDO A;  3H8L A;  3VR9 A;  2C73 A;  4UDQ A;  5U63 A;  4AP1 A;  3SZ0 A;  1K0I A;  4XWR A;  3CND A;  3E1T A;  4WCT A;  3AYJ A;  4EQX A;  4H4Y A;  3P4S A;  4JDR A;  4KX6 A;  2VOU A;  3QSE A;  2C67 A;  2ACZ A;  1PJ6 A;  3ICS A;  4KPR A;  1BF3 A;  2YR6 A;  4GAV A;  1CBO A;  2NPX A;  2E1M A;  2VZ2 A;  2GVC A;  4OCG A;  2W0H A;  3UTH A;  2V5Z A;  4E0V A;  3AB1 A;  3F8P A;  4Y4N A;  3AE5 A;  4J33 A;  4NEV A;  2OLN A;  4APN A;  4TM1 A;  2RGO A;  2I0Z A;  1ZMD A;  1MOK A;  1LQT A;  2GH5 A;  3P4Q A;  1BGJ A;  2YVG A;  3NTA A;  4AT0 A;  2A8X A;  4YXD A;  1PS9 A;  1S3B A;  3ADA B;  3HYX A;  4AP3 A;  4EIP A;  2C64 A;  3UKA A;  4CY6 A;  4UP3 A;  3G5S A;  4Z2T A;  1EL7 A;  4H4X A;  3BNM A;  1NEK A;  2XLU A;  2Y6R A;  3QSS A;  3C4A A;  1JNZ A;  1VG0 A;  2YG5 A;  3DJJ A;  3EAO A;  5HYM A;  4LU6 A;  3VRA A;  5BUL A;  2ZZB A;  2X8G A;  3O0H A;  4B68 A;  1GXF A;  4GR1 A;  3UP5 A;  4YKF A;  3NYF A;  1H83 A;  3AD8 B;  4NTC A;  4H2N A;  2VRL A;  1YKJ A;  2C3D A;  3AEG A;  4RG3 A;  4H2Q A;  1ZK7 A;  4YSX A;  2JB1 A;  3NH3 X;  4B1B A;  2ZBW A;  1B4V A;  5BRT A;  2XFN A;  5FS9 A;  4M52 A;  5HY5 A;  4GRT A;  3UOV A;  2VVL G;  1EBD A;  1S3E A;  5JCK A;  1LVL A;  5U1O A;  3KLJ A;  5JCI A;  2Q0K A;  4JY2 A;  4LII A;  1F3P A;  3HZL A;  4CRT A;  2BAC A;  4XWZ A;  1MXT A;  2R45 A;  3GWF A;  2E4G A;  4YT0 A;  4JNA A;  4K8D A;  3FG2 P;  3H8I A;  3ALL A;  1JOA A;  3CGB A;  2JBV A;  3GYI A;  4B66 A;  1D7L A;  1H84 A;  3RP6 A;  1L9C A;  3PS9 A;  5J7X A;  5CQF A;  1GEU A;  1ELI A;  1PN0 A;  2WDV A;  2IVE A;  2H89 A;  1PBE A;  2B7R A;  3DK4 A;  2HQM A;  3CGC A;  4H2P A;  2CUL A;  4MJW A;  2OLO A;  4EM3 A;  4JY3 A;  2Q7V A;  3GMB A;  3KKJ A;  3AEC A;  3DJE A;  3AE7 A;  3AEA A;  3NTD A;  4OPI A;  4OPG A;  4FK1 A;  1GND A;  5KVH A;  4NTD A;  2YLW A;  2B9X A;  1XHC A;  4Z43 A;  5BUK A;  3GMC A;  1F8S A;  1V59 A;  2WPE A;  1GET A;  4K5S A;  4J56 A;  4OPC A;  4CNJ A;  4NTE A;  4BK2 A;  4CBQ A;  4H50 A;  4BK3 A;  4GCM A;  2GMH A;  2WS3 A;  1EL8 A;  2WP6 A;  4U2L A;  1PBD A;  4H4R A;  2BXR A;  4OPD A;  4H4Z A;  3UP4 A;  3AD7 B;  3DA1 A;  3NKS A;  4HB9 A;  5KVI A;  1KSS A;  1LPF A;  2GR3 A;  1EL9 A;  1XPQ A;  4J31 A;  4X9N A;  3AE4 A;  4OPU A;  5TR3 A;  4DNA A;  1GSN A;  1MO9 A;  4EMI A;  1ZY8 A;  2V6O A;  2B9Y A;  4AT2 A;  4G9K A;  1IUT A;  3DJD A;  2FJD A;  3LAD A;  2WU2 A;  5CKU A;  1B5Q A;  1NEN A;  3T31 A;  2CFY A;  5BVA A;  2TPR A;  3SX6 A;  1RSG A;  1E1N A;  2QAE A;  1CF3 A;  4A79 A;  3UKF A;  3CPH G;  2VVL A;  3DK9 A;  1H86 A;  5FMH A;  2V61 A;  4B67 A;  5KMR A;  4ZN0 A;  2JK6 A;  3ATR A;  3UOY A;  1NHS A;  2APG A;  1E1M A;  1NG4 A;  4YSH A;  3SFE A;  3GDN A;  3Q9T A;  1TRB A;  2XFQ A;  4K7Z A;  1O95 A;  5JCM A;  3UKL A;  1FEB A;  1CC4 A;  5EB4 A;  4U8K A;  3NLC A;  3DH9 A;  1KFY A;  3QJ4 A;  1JNR A;  2WDR A;  3M13 A;  4YWO A;  3V3N A;  4YTP A;  4C3Y A;  1ZOY A;  2PHH A;  4GAP A;  1VG9 A;  2BCP A;  1LQU A;  2XLP A;  4CY8 A;  1FCD A;  5ER0 A;  3BI4 A;  2WDQ A;  2B9W A;  3NNE A;  1CJC A;  1K0L A;  5EOW A;  2X8C A;  3ICR A;  5EB5 A;  1O5W A;  4IVO B;  2GEW A;  3NGC X;  5IQ1 A;  2GRT A;  1FOH A;  4BJY A;  1JEH A;  3KPK A;  4DSH A;  1PBC A;  4J2W A;  4H4U A;  3AEF A;  1L9E A;  1TYP A;  2WET A;  2XFO A;  3B6D A;  4U2T A;  1GRE A;  4USQ A;  5DBJ A;  4REK A;  4USR A;  2XVE A;  3SFD A;  1Z6L A;  3GRS A;  3KA7 A;  3M12 A;  2WPF A;  2C4C A;  1GRA A;  4H4T A;  2JB3 A;  2BA9 A;  3ALM A;  3QVP A;  4EIQ A;  3SZC A;  3KPF A;  1N1P A;  1KNP A;  1RYI A;  4Z25 A;  4J57 A;  3T0K A;  3F8R A;  1GT8 A;  4FDC B;  3SZF A;  3T2K A;  3UTE A;  4LA1 A;  4BK1 A;  3R9U A;  4C5O A;  1K0J A;  1B8S A;  3SGL A;  4EQR A;  4JNQ A;  4IVM B;  3UCL A;  2BS4 A;  2WOW A;  5KNL A;  3C4N A;  3L8K A;  3RP8 A;  3CNP A;  1Q9I A;  1YQZ A;  1NHP A;  2EQ6 A;  3NHO X;  2BXS A;  5FS6 A;  3DME A;  3K30 A;  1GRH A;  2VQB A;  2J3N A;  2R0C A;  3EAN A;  3KU9 A;  1TDE A;  2E5V A;  2BCG G;  4UDP A;  5EBK A;  4J36 A;  1N4U A;  1IUX A;  3GDP A;  1IUS A;  2TMD A;  1F6M A;  1ZDL A;  2EQ7 A;  4EMJ A;  4ZCD A;  1ZKQ A;  4YSZ A;  3COX A;  3SM8 A;  5KMS A;  3AD9 B;  3FMW A;  2A89 A;  4G6H A;  2WU5 A;  1PJ7 A;  1ZX9 A;  2YG4 A;  4UDR A;  4Z2R A;  1OJT A;  5LV9 A;  4Y4M A;  1COY A;  2DKH A;  2C72 A;  2GQF A;  1F8W A;  2XVI A;  3CN8 A;  2YWL A;  3AE8 A;  3V76 A;  3P4P A;  3AYI A;  1DJQ A;  1GRT A;  2PYX A;  3GYX A;  3D8X A;  4H7U A;  3M0O A;  2R46 A;  3DGZ A;  3T37 A;  3ALJ A;  1H7W A;  3DK8 A;  3HYW A;  4OPT A;  4C74 A;  2JAE A;  4YTN A;  1YY5 A;  2X3N A;  2XFP A;  3NK2 X;  4K2X A;  2YAU A;  1KSU A;  4P9S A;  5FS8 A;  4G74 A;  4A7A A;  4BJZ A;  1DJN A;  2WPC A;  3I6D A;  2IID A;  2QA2 A;  1W4X A;  3AE3 A;  3BNU A;  2GR1 A;  4H4S A;  1DXL A;  4Z2U A;  3RP7 A;  1M6I A;  2WES A;  2C76 A;  4H4P A;  1D4E A;  1PXA A;  1JRY A;  3EF6 A;  4ZCC A;  2CDU A;  4TLX A;  3NN0 X;  3IHG A;  4TM0 A;  3UKK A;  5KWF A;  1TDK A;  1Q1R A;  3RNM A;  1NG3 A;  2YG3 A;  1N4V A;  1FEA A;  3AWI A;  3T2Y A;  5J60 A;  5U25 A;  4A6N B;  2GR2 A;  1FL2 A;  2BS3 A;  1LV0 A;  5HHF A;  2WP9 A;  3G5R A;  2C66 A;  1CHU A;  2ZZC A;  1Y56 B;  4HA6 A;  2BAB A;  2XVH A;  3NK1 X;  1Q1W A;  2AAQ A;  3NYE A;  3VRD B;  4YKG A;  2AQJ A;  4CCR A;  4C77 A;  3GD3 A;  1E7P A;  4NNJ A;  2XCG A;  1CJ3 A;  1N4W A;  3UTG A;  2XLS A;  2R4J A;  3NN6 X;  1IUU A;  4NZH A;  2AR8 A;  3FPZ A;  4U8L A;  4BV6 A;  4IA5 A;  1ZP0 A;  4YSY A;  4X9M A;  4FK1 C;  4DSG A;  1PJ5 A;  1S2Y A;  2X8H A;  3HYV A;  2WP5 A;  2V3A A;  2YVF A;  1DOC A;  3BI2 A;  3JSK A;  1LTX R;  4N9X A;  4GUV A;  5KOW A;  2R0G A;  4H4V A;  2YLZ A;  1QLB A;  2XFU A;  2FBW A;  1L0V A;  4TM4 A;  1BZL A;  3K7Q X;  4A9W A;  1PDH A;  2GB0 A;  3FIM B;  2XLT A;  5GRT A;  2YLX A;  4EQW A;  1KDG A;  1GTH A;  3NRN A;  4Z26 A;  1GRG A;  3ABV A;  1NPX A;  4IV9 A;  4C3X A;  2YM2 A;  2YR5 A;  1JRX A;  3CPJ G;  2R9Z A;  3SYI A;  4BUR A;  3LXD A;  2QCU A;  1CJ4 A;  1TDO A;  1SEZ A;  5KMQ A;  2BC0 A;  2YG7 A;  3CGD A;  3OZ2 A;  4I58 A;  1AOG A;  2VRM A;  1DOB A;  2WQY A;  1TDN A;  2GQW A;  2X99 A;  3K7T A;  1IJH A;  1GPE A;  2Z5Y A;  4B69 A;  1ZOV A;  4NWZ A;  1XAN A;  2EQ8 A;  2V60 A;  1CC6 A;  1TDF A;  4A6N A;  3IF9 A;  1H6V A;  2GV8 A;  3LZW A;  3PVC A;  1P2E A;  4U8N A;  2VVM A;  3P4R A;  4I59 A;  2C3C A;  2CVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...