1CHUA

Structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
532
structure length
478
Chain Sequence
b'NTLPEHSCDVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDITRRMHDISTLPPWDESRVENPDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPSILSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-ASPARTATE OXIDASE)
molecule tags Flavoenzyme
source organism Escherichia coli
publication title Structure of L-aspartate oxidase: implications for the succinate dehydrogenase/fumarate reductase oxidoreductase family.
pubmed doi rcsb
total genus 152
structure length 478
sequence length 532
ec nomenclature ec 1.4.3.16: L-aspartate oxidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 1chuA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1chuA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1chuA02
1F6MA 3EPTA 2CULA 3PVCA 1CJ2A 1M6IA 1BGNA 3NYCA 4YTNA 1BZLA 4H50A 1E1MA 4H4PA 2B9XA 4CCQA 4NTCA 1PJ7A 4B63A 2A8XA 3V3NA 2CVJA 4YSZA 4XWZA 3NGCX 1LQTA 1RSGA 1GRTA 1ZX9A 2VVLA 4B69A 5KWFA 1FECA 1TRBA 3AD7B 1S3EA 4NZHA 1DOEA 4U2LA 5C3JA 1JU2A 3LB8A 4X9MA 2XVEA 1GEUA 3ALMA 3NG7X 2JKCA 3DJJA 4EMIA 1DXLA 4OPLA 4EIQA 2ZBWA 3ICSA 2FBWA 1GV4A 4U8PA 2YAUA 3AYIA 2E5VA 3B6DA 4ICYA 4U8LA 1ZKQA 5EOWA 1REOA 3UP4A 5KOWA 2GQFA 3BI4A 3UOYA 1YQ3A 3P4SA 3NKSA 4AT2A 2OLNA 1KNPA 1TYPA 3KA7A 1JEHA 4C77A 2WDVA 4LU6A 1ZY8A 3F8DA 5IPYA 1TDEA 3NYEA 4H2PA 1DJNA 4N9XA 3AWIA 1CHUA 3UOXA 1S2QA 1NHPA 3QFAA 4E0VA 4J56A 4Z2RA 2QA2A 2YG4A 4U8OA 2RGOA 2BXSA 4EQRA 4U2TA 4EQXA 5M10A 1RP0A 3GD4A 3LXDA 2DKHA 1ZP0A 4I58A 1EBDA 3AE9A 2EQ7A 2XLTA 4CY8A 2WP9A 3G5SA 1CJCA 3UKAA 1AOGA 4H4VA 2DKIA 4U8NA 2HQMA 4B64A 3P4RA 2XLRA 2H88A 3C4NA 4OPDA 2ZZCA 1NG4A 3K7QX 1GRHA 1IUWA 1VG0A 4K5RA 2BC0A 1QJDA 3AEBA 3LADA 1S3BA 2FJBA 1O94A 2W0HA 2YVGA 3NTAA 3Q9TA 4CNKA 4TM0A 3E1TA 4GUVA 4C3XA 1PDHA 2XCGA 3UTEA 1NEKA 1Y56A 4KX6A 4DSHA 1L0VA 2VZ2A 4JN9A 5JCNA 2UZZA 2GR3A 4OPIA 2RGJA 1XHCA 4GF7A 5BRTA 1KNRA 4H2QA 5JCKA 2ARDA 2X8CA 2C3DA 3K7MX 4P9SA 3VQRA 3VRAA 2BS4A 1E39A 2V3BA 4K8DA 3BI5A 2X99A 2OAMA 3CNPA 2WOIA 3UTGA 1O95A 2VVLG 2OALA 2V6OA 5JCIA 3UOVA 1DNCA 2C65A 1IUSA 2IIDA 2YM1A 2R4JA 4Z44A 1NENA 2XYOA 4DGKA 1LTXR 3QSSA 5EBKA 3FMWA 2R0CA 3KKJA 1PXBA 1PBDA 2E1MA 4GDEA 4K5SA 2IVEA 3GMCA 4OPUA 1F3PA 3AE3A 3AEAA 1N4UA 4PABA 1GPEA 2WS3A 4YSYA 4O5UA 2GV8A 1PJ6A 2BCGG 3D1CA 4J34A 1UKVG 4C74A 1LQUA 4TM3A 3AECA 4OCGA 4HB9A 3AE2A 3OZ2A 3IWAA 3GYIA 4AOSA 3P4QA 3UTFA 4A6NA 2BA9A 3UCLA 2R45A 4NTEA 5U25A 3DJEA 2QA1A 1VRQB 4A7AA 2AAQA 3T37A 2J3NA 1GOSA 1DODA 1NPXA 2C64A 3CPJG 1ZMCA 2XDOA 4U2SA 3KU9A 4J36A 4BJZA 1PBEA 3ZYXA 1NHRA 1TYTA 1VG9A 4H7UA 4JDRA 1M64A 3G5RA 3NT6A 2GR2A 4U8IA 4OPGA 1L9CA 3NHOX 3AB1A 4EQSA 2YLSA 1KFYA 2JB3A 4A5LA 5HXIA 2JB1A 4DSGA 1EL8A 4H2NA 2YLWA 3M13A 3AYJA 2A89A 5EB4A 2BABA 2JB2A 3UKPA 4X9NA 2FJAA 1PS9A 1LVLA 2GMHA 2WOVA 3NRNA 4RSLA 5TR3A 2WDRA 1GTHA 4JNQA 5GSNA 1IJHA 1QO8A 2R9ZA 2XFOA 4A99A 4BK3A 5CQFA 2Y6QA 1JNZA 2BACA 2QCUA 2WEUA 2R4EA 3AEDA 3GWFA 4H4SA 5DBJA 1ZK7A 3GSIA 1NHQA 2B9WA 1ZOVA 1N4WA 3PO7A 1XPQA 2YG7A 4GCMA 5HHFA 2VOUA 3NYFA 3AE7A 3KLJA 1PHHA 1S2YA 3AXBA 2R46A 1H84A 3CNDA 3URHA 1Y0PA 2YG5A 3GRSA 3AYLA 3DK4A 4B1BA 4TLXA 3AE5A 1K0JA 2XFUA 1CJ4A 4U8MA 1D7YA 3CPIG 1V59A 4PAAA 4Z26A 1GRBA 4RG3A 4AOXA 4CRTA 2Z5YA 2IVDA 3CPHG 2BCPA 1F8SA 1JRXA 4CNJA 1HYUA 1E1NA 4CBQA 3UKQA 2VVMA 3QSMA 1BKWA 1FEBA 4YXDA 4EMJA 3DGHA 5U1OA 2YG3A 3CGCA 3NH3X 4JY2A 2C76A 1NHSA 1GREA 3JSKA 4UDQA 3NIXA 3I6DA 1BGJA 2GR1A 1BF3A 4YTPA 2A87A 2FJEA 2AR8A 4M52A 2YLXA 4CCRA 3GDPA 2WDQA 1FOHA 4BK2A 3K30A 3IC9A 4A6NB 4JNAA 1TDOA 5FMHA 2WETA 2NVKX 1IUTA 5CKUA 3RNMA 2BK4A 2EQ9A 1H86A 5LV9A 3P1WA 4EM4A 2CFYA 4BURA 1OJAA 2APGA 3VRBA 5U63A 3AE8A 1NDAA 1TDFA 1E7PA 4OPCA 5FS9A 1X31B 2XVIA 5KVHA 2GRTA 1W4XA 2V60A 3DJGX 1QLBA 2WHDA 4NEWA 1JRYA 4X4JA 3GMBA 1KDGA 3FG2P 2ZZ0A 5KXJA 2C70A 3SFEA 3NTDA 3L1RA 5JCMA 4H2RA 4A65A 3OC4A 4YWOA 4AT0A 2XFQA 4C3YA 2XVJA 4REKA 3PS9A 5KOXA 3CGBA 2WESA 3RP7A 2YR4A 4Z24A 5HY5A 1GALA 2GR0A 4Z43A 3II4A 2F5ZA 3NNEA 2GQWA 1GRFA 4XWRA 4Y4MA 2YVFA 4EQWA 1B8SA 2NPXA 1NAAA 1IUVA 4LIIA 1OJ9A 3DA1A 1GETA 4UP3A 3WE0A 4H4ZA 1P2EA 4FX9A 4Z2TA 2YWLA 2B76A 4H4XA 3IF9A 4U8KA 1KSSA 3UKHA 5BULA 3H8IA 4TLZA 1GERA 2B7SA 1GXFA 1H7XA 3F8RA 1D4CA 4FK1C 3LOVA 3IHGA 3K7TA 3H4KA 2CDUA 4YKFA 5JCLA 3DGZA 1XANA 3SGLA 3LZWA 5J60A 2TPRA 4YSXA 5J7XA 2GH5A 2XFPA 4J57A 3GDNA 4K2XA 4C5OA 1CL0A 2R0GA 2WU2A 2C3CA 1ZOYA 3KD9A 2WU5A 3FPZA 1H81A 1B4VA 1E1KA 2GMJA 2C73A 3BHKA 4D03A 5FS7A 2RGHA 3AE1A 3FIMB 3ICTA 3CIRA 2EQ6A 4U8JA 3CGEA 2WQYA 2XLPA 4J33A 3ATQA 2C75A 2O9ZA 4O5QA 3FBSA 3UP5A 2Q0LA 4Z25A 2JAEA 1E1LA 1VQWA 4B68A 2YM2A 3DK9A 3QVPA 1YQZA 5M0ZA 1MXTA 1K0IA 1VDCA 4APNA 2XVHA 3ZDNA 1JOAA 1KSUA 4USQA 1TDNA 2JK6A 3GWDA 2C67A 2PHHA 1XDIA 3CNJA 1MOKA 3AE6A 2YR5A 2VRMA 1ZDLA 3AE4A 4IA6A 4ADWA 3M0OA 4EIPA 3C96A 2XLUA 1DJQA 4HA6A 1KF6A 4H4TA 1CJ3A 2YLRA 5GRTA 2XLSA 2YQUA 2FJDA 1K0LA 3UTHA 1PN0A 1YKJA 3DMEA 3AEGA 1D4DA 2X8HA 2GB0A 1TDKA 1D7LA 3G5QA 3Q6JA 4YKGA 3ALLA 4B67A 1EL9A 5IQ1A 2C66A 4CY6A 1JNRA 1PXAA 3COXA 1Y56B 1OJDA 4BJYA 3AD8B 3NLCA 2I0ZA 2X50A 4EM3A 4KPRA 3CNSA 5EB5A 1CC4A 1DOBA 1LPFA 1FL2A 3NN6X 3DJDA 5C2TA 2YR6A 3EANA 3BI2A 3S5WA 2C72A 1CBOA 3CGDA 3AEFA 3BNMA 4H4YA 4Y4LA 3QVRA 2BS2A 1F8RA 4GRTA 2GAHB 1EL5A 4H4WA 1FEAA 3UKLA 2GEWA 1YY5A 3ALJA 3QSEA 3RP6A 2Q7VA 1N4VA 1RYIA 3IHMA 2V5ZA 2BYBA 1IUXA 4WCTA 1FCDA 4AP1A 1IUUA 2BK5A 3VR9A 4OPTA 2JBVA 2GF3A 1E6EA 5HYMA 3SM8A 4IVOB 4BK1A 3QJ4A 3ISHA 3KPFA 2GAGB 1Q1RA 4TM4A 1CF3A 4A9WA 5BVAA 3VRDB 2BS3A 2BK3A 2Z5XA 3NN0X 1PJ5A 5KVIA 1F8WA 2WBAA 5L46A 4XXGA 1CC2A 3NK0X 3R9UA 2Y6RA 4J2WA 4DNAA 2WPCA 1LJ1A 4GDPA 3AD9B 4LA1A 2XVFA 4Y4NA 4MJWA 2EQ8A 1GNDA 4NEVA 2E4GA 1GSNA 1Z6LA 2WP5A 3CN8A 3D8XA 3DK8A 1Q9IA 4YSHA 4YT0A 3NK2X 3GYXA 2GVCA 4FK1A 1D4EA 1BWCA 2LFCA 3S61A 1GRAA 2OA1A 2YLZA 1L9DA 1ONFA 1OJCA 3ATRA 1EL7A 2YLTA 4GR1A 4K7ZA 1YQ4A 3DH9A 3LZXA 4JY3A 4FDCB 2TMDA 4TM1A 1D5TA 3O0HA 5ER0A 2PYXA 3B3RA 1GTEA 4YTMA 3BNUA 1DOCA 4H4RA 3UOZA 2VQBA 2ZZBA 3VR8A 4UDPA 4IVMB 1PXCA 3GRTA 1SEZA 2C7GA 2Q6UA 1GRGA 1JRZA 1H83A 2OLOA 4AP3A 4H4QA 1GT8A 2RABA 3P9UA 4NTDA 5IQ4A 2WP6A 3EF6A 4IA5A 3ICRA 1Q1WA 3NK1X 4IV9A 1PBFA 1LV0A 2X3NA 2WOWA 1CC6A 1B37A 3REDA 1H82A 2XFNA 3CTYA 3F8PA 2V3AA 3LJPA 1N1PA 3ITJA 2BC1A 3ADAB 2QAEA 3V76A 2WPFA 2AQJA 4OVIA 1L9EA 1ZMDA 1B5QA 1PBCA 3KVEA 3V3OA 3M12A 2B7RA 2H89A 1OJTA 5FS8A 4EMWA 4Z2UA 3UKFA 5BUKA 4I59A 4K22A 2R0PA 3P4PA 1PBBA 3C4AA 4H4UA 3L8KA 4ECHA 2ACZA 1ELIA 4ZCDA 4JQ9A 4USRA 4J31A 2V61A 5FS6A 4B66A 1COYA 1P2HA 4WX1A 2VRLA 2X8GA 3BHFA 3QFBA 4BV6A 3EAOA 4ZCCA 1GESA 2BXRA 2YVJA 4A79A 4RG4A 3GD3A 1K4QA 5KRQA 1MO9A 2Q0KA 4UDRA 1H7WA 3AEEA 2B9YA 1H6VA 3I3LA 3UKKA 3RP8A 1O5WA 2WPEA 3SFDA 3SQPA 4B65A 3GYJA 4D04A 3CNTA 1NG3A 2YG6A 3HZLA 3RHAA 4ZN0A 3H8LA 2VQ7A 3ABVA
chains in the Genus database with same CATH superfamily
1BR2A 1F6MA 3PVCA 1CJ2A 3NYCA 3UUMA 3HI2A 4H4PA 1PJ7A 2CXDA 5AQKB 4FJOA 5DJQC 4LMJA 1ZX9A 4WW0A 3ZKRA 3AXJB 2JIWA 4DV4T 2XVEA 5LA6E 4I55E 3ALMA 4PK6A 4CXXA 5L4EA 4OPLA 3AA7B 3ICSA 2KZ7B 2FBWA 3T2YA 5CB4E 2LSGA 4U8PA 3KV4A 2YAUA 2E5VA 5EOWA 2CWYA 2E9XB 5JQGE 3B57A 1KNPA 3KA7A 3U3IA 5IPYA 2N1GA 4ZS3A 1DJNA 2E8IA 2VASA 2WSSV 1S2QA 1QSDA 4DUYT 2RGOA 2DWKA 3V5UA 4EQRA 3OJAA 4ZI3C 2LKHA 3UU4A 3OYXA 4LFCT 3G5SA 1CJCA 3UKAA 4H4VA 4U8NA 3P4RA 3C4NA 1NG4A 3F31A 3QC9A 3PU3A 3PURA 1D0YA 2UXDT 3LADA 1O94A 3E22E 2W0HA 3E1TA 3Q9DA 2EHOB 2V7JA 4KX6A 2RA1A 1L0VA 2HH7A 4JI5T 2GR3A 4OPIA 1KNRA 2NTYA 2C3DA 2L9QA 4N78D 3RGLA 3OKQA 4IDNA 2X99A 4AKGA 2WOIA 3UTGA 1ZV4X 2OALA 2XQ8A 2YM1A 1E2AA 5HXSA 2BG9B 3RH3A 2W00A 3LK3B 3PUSA 5KMRA 5EBKA 5J2UE 2R0CA 1PBDA 2E1MA 2BRAA 3LSVA 2V7KA 2E9XD 3GMCA 3AEAA 3SY4A 4UF0B 4BJNA 2WS3A 2BCGG 2XM2A 3D1CA 4OYJA 2LSYA 3P4QA 4A6NA 4O4HE 4LF6T 2BA9A 2R45A 4JI2T 2XPKA 4A7AA 2AAQA 3T37A 1GOSA 1DODA 4IREA 1ZMCA 3LDQB 3CX7B 3P8CD 3ZYXA 2LRLA 1TYTA 2GR2A 2X9XA 4OPGA 3AB1A 4EQSA 2YLSA 4ANJA 5HXIA 4FI5A 4NUVA 1UK5A 4PNIA 3M13A 3E08A 5AQHB 2NP9A 1M7KA 2VKJA 2WDRA 4KBMB 4AIUA 1IJHA 4B6XA 2XFOA 4BK3A 1JNZA 5ABHA 3KPKA 5DBJA 1ZK7A 1NHQA 2Y6XA 4LF8T 3UU8A 3PO7A 4GCMA 4UV8B 1SHZC 3ETUA 3N5LA 3DTOA 3KLJA 4HE8A 5JRCB 5AQOB 2YG5A 3GRSA 4CI2B 3AYLA 1V59A 2BBJA 4Z26A 4RG3A 3HKBE 1F8SA 1JRXA 4JI0T 4EMJA 3SZFA 5FP3A 3CGCA 3NH3X 1AJ3A 4ILUA 3C51A 4UDQA 3I6DA 2N2NA 2Z6EA 5FKYA 5AQFB 2FJEA 2YLXA 1G73A 1MIVA 3GDPA 4QX7B 5CA1E 4O2BE 2WETA 4CXWA 2VWAA 3WAKA 4ZOLE 3SYIA 4BURA 4AQFA 4QWNB 4LF9T 2WBLA 1E7PA 1W0AA 2MOZA 3T1HT 2P9BA 4HWFA 2GRTA 3K3OA 3UUBA 4NEWA 2CA5A 1JRYA 3EAMA 3FG2P 4V1Av 5KXJA 1HX8A 3NTDA 1IJ5A 5JCMA 4IDZA 4AT0A 3ZMSB 2WESA 5DQWA 4CN6A 2YR4A 4Z24A 3VKHA 3ETVA 4MHCA 4LIIA 3WE0A 3DA1A 4BA9A 1GETA 1P2EA 4FX9A 1LVKA 5JDQA 4TNWA 1S35A 3S4UA 3H8IA 3KVAA 1H7XA 5LOVE 3LOVA 1YW0A 2YOEA 2KWIB 2CDUA 5JCLA 5J2TE 1XANA 4X1YE 3M3ZB 4AKRB 4YSXA 1IBMT 2Y8DA 4YJ3E 2R0GA 2WU2A 1ZOYA 3SOLA 4I43B 3EDUA 2V6YB 3CIRA 2WQYA 3ATQA 2FUPA 2Q0LA 2XJ7A 4B68A 3DK9A 5M0ZA 5ETWA 2VQET 4AXPA 3OVUA 4DR1T 4U3CA 4KI0F 2JK6A 2VB6A 1XDIA 3L3PA 3G06A 4ZI3D 2L8KA 3PUVF 2KWHA 4IA6A 4ADWA 1IZNB 2XLUA 4HA6A 1KF6A 1CJ3A 1HR0T 2BVLA 4GKJT 2YLRA 4H9PC 3UTHA 2YQUA 1K0LA 2M6IA 1YKJA 2NR4A 2ZLYA 2X8HA 2NW9A 4GAPA 3D0TA 5FNVE 3DP7A 4IE0A 2GK9A 2YDQA 2AXDS 4EM3A 5AQNB 1MMNA 1FEWA 5H6QB 4ADZA 5EB5A 5CA0E 2UUAT 1XMQT 3PJAJ 1LPFA 2IC6A 3DJDA 5C2TA 2C72A 3RKOA 2JQ9A 4L9IA 2J4GA 2UXBT 1FMVA 1EL5A 2GAHB 1FEAA 3HL6A 4A56A 3QSEA 4NUUA 2Q7VA 1RYIA 3TLSA 3IHMA 5LGNB 3C98B 4WCTA 1FCDA 1IUUA 2BK5A 2JBVA 4PFPA 2EHOA 4CI1B 2HPLA 4BK1A 1Q1RA 2QGSA 3SZWA 4EOZB 3GMIA 2BS3A 2Z5XA 5KVIA 2WBAA 5L46A 4XXGA 3R9UA 2Y6RA 3EABA 4ZHQE 5FMNA 4NEVA 3OPCA 1Z6LA 2WP5A 4DV5T 4XZCA 3GYXA 2Q9QC 1BWCA 3S61A 5LHIB 2YLZA 4MALA 3IF8B 3LZXA 4TM1A 3O0HA 3A7MA 4H9SE 3B3RA 3BNUA 4H4RA 4G6GA 3Q5XA 2WWUA 2VL0A 3GRTA 2PFVA 3RYCE 1JRZA 3QB5A 2RABA 5IQ4A 4DIDB 3EF6A 3ICRA 4IA5A 1Q1WA 3KV5A 1PBFA 1LV0A 3N2GE 2WOWA 2X3NA 3GN5B 2XFNA 3F8PA 3LJPA 2LOPA 3FZMB 1FIOA 3E0ZA 2QAEA 2AQJA 5LB7B 4C90A 4X65T 1L9EA 5ABFA 3LBXA 4P0AA 2XM1A 3UTKA 2BBHA 4Z2UA 5A1LA 5C8YE 3HKCE 3P4PA 1PBBA 4H4UA 3L8KA 2ACZA 2IHR1 4H63H 4B66A 1P2HA 4WX1A 2XUEA 2X8GA 3QFBA 2DL1A 2H7OA 1GESA 2BXRA 4J2CA 4P0BA 1GQEA 4ZI2C 2B9YA 4COFA 1OEDB 2XQ5A 4ZI2D 2H3RA 1NG3A 2OV9A 3H8LA 2VQ7A 3K3NA 3EPTA 5KDMC 3EUHA 4O2AE 1BGNA 1M6IA 5KMQA 2X9YA 1BZLA 4KHPT 2B9XA 4HTEA 4B63A 4ZEYA 2A8XA 3V3NA 2YU2A 4XWZA 4ISTA 2PG8A 1LQTA 5FYMA 1GRTA 1RSGA 4B69A 4IDOA 1N34T 4NWZA 1FECA 3PUYF 4U2LA 1DOEA 2QVAA 5C3JA 2CXFA 5FXWA 4XBFB 1J1JA 4Z8XA 3UT5E 4EXTA 3MZKB 2Q9QA 3AYIA 5E0OA 3B6DA 4ICYA 2Y48B 4U8LA 5KOWA 1REOA 3JC6D 3UP4A 1N36T 1WR0A 3BI4A 4AT2A 4C77A 1JEHA 1XDOA 2WDVA 4LU6A 4JI4T 5F3JA 3Q5EA 4E0VA 4Z2RA 4J56A 5FVKA 4PAGA 4NPPA 3PU8A 4HWHA 3WAJA 5M10A 2CM0A 4I58A 1DU2A 5CFBA 2I0MA 2XLTA 2WP9A 1AOGA 4AI6A 1S94A 2HQMA 1UX5A 4DV2T 3LK42 4OPDA 2H88A 5LHHB 5LG4A 4DR3T 2VKDA 3ONXA 3NTAA 4CNKA 3NWIA 4GUVA 1US7B 2XCGA 1D1CA 1FJGT 4X66T 4JN9A 2ZM0A 5EK4A 5BRTA 2ODVA 4H2QA 2VVSA 2YU1A 4KMCA 2X8CA 5KMSA 3K7MX 4P9SA 3VQRA 3N2KE 2IUBA 1E39A 2CHOA 3IBPA 2JPFA 2VVLG 5JDFA 1VCSA 3QOFA 5JCIA 1DNCA 3KBTA 5DQVA 2C65A 3CX6B 5FL1A 2UXNB 2R4JA 1T72A 3T2ZA 2RP4A 5GONE 1LTXR 1BR4A 3RQWA 5TAOA 2XQYA 4OPUA 3AE3A 1HX1B 4EB6E 3VKGA 1KK7A 4EV6A 2GV8A 1PJ6A 4H9NC 3PUWF 1UKVG 4C74A 1LQUA 3ZCJA 3AECA 2IMLA 3AE2A 3T31A 3IWAA 4Q25A 3GYIA 1V9DA 5JRCA 4BJMA 2WB5A 2MPKA 4GAVA 4NTEA 5U25A 3DJEA 1HG5A 5EZYE 2K48A 4OHFA 2C64A 3CPJG 5HEGA 4J36A 4U2SA 2DLRA 4BJZA 2HN1A 1G8XA 1VG9A 1M64A 4U8IA 3VU7H 1HFAA 2JJ9A 1KFYA 2ZMAA 3ZCIA 2XSBA 4HKAA 2JMKA 3AA0B 3RIFA 3ONLC 4GYRA 1YKEB 5ABGA 2XSAA 3UKPA 2GMHA 2WOVA 4II3A 2I59A 4G73A 2UU9T 1QO8A 2R9ZA 3CMLA 5AQIB 3KV6A 5CQFA 2Y6QA 2WEUA 2QCUA 2R4EA 2V7MA 1ZEEA 3GWFA 4H4SA 1WLXA 2LM2A 2CBJA 5F8PA 5JH7E 1ZOVA 1N4WA 3SXIA 1XPQA 4UVAB 3C4ZA 1MMAA 3ZMVB 4K0KT 1S2YA 4IL9A 3URHA 3HKEE 1MIWA 2A3DA 4IE5A 1K0JA 4MLKA 2XFUA 4U8MA 2E9XA 2A2FX 3CPIG 2Z5YA 3HYVA 1UUSA 2BDEA 3EI0A 1HYUA 1E1NA 4CBQA 3UKQA 3QSMA 1I94T 1D1BA 4DNDA 3JSKA 3RHWA 2GR1A 2XQAA 3TLVA 3N9LA 3A8YC 2A87A 2AR8A 4M52A 4HWIB 2L3LA 2WDQA 1FOHA 3IC9A 4KUMB 4JNAA 4PK4A 5FMHA 1KNZA 1IUTA 2EQ9A 1H86A 3P1WA 2CFYA 5H6RB 2YDRA 3UULA 3AE8A 3RRWA 3I9WA 3AB3B 3L39A 5AQLB 4HFVA 2XVIA 4DMVA 3JCFA 5JDLA 1W4XA 3DJGX 2JRKA 3I9YA 2DI4A 3GMBA 3RIUC 4X20E 2C70A 1QUUA 3SFEA 4A65A 4A98A 2XFQA 2XVJA 5KOXA 2M67A 4QKNA 5HY5A 2HHHT 2F5ZA 1GRFA 4Y4MA 4EQWA 2NPXA 4PJMA 2A9UA 1NAAA 1IUVA 4UP3A 4JEHB 4QH1A 3SS1A 4H4ZA 2NWBA 5AQVB 2YWLA 4U8KA 4UEMA 3RF1A 5BULA 2UXXB 4TLZA 2QRXA 3ZYLA 3F8RA 1D4CA 5JVDE 3IHGA 3H4KA 3P7IA 5J60A 5J7XA 3CVRA 3GDNA 4C5OA 1CL0A 2C3CA 1XNRT 2WU5A 4DV1T 5IWAT 3FPZA 4LMLA 1E1KA 3BHKA 3CMMA 2RGHA 3ICTA 2SPCA 2XLPA 2C75A 2O9ZA 4O5QA 4DR4T 3FBSA 2VVNA 2WMOA 1VQWA 2JAEA 1T98A 1MXTA 4A5XA 2XVHA 3ZT6A 1EZ3A 3ZDNA 3NRXA 1W9RA 3N9PA 3GWDA 1H7CA 2VRMA 3NRYA 3ZMTB 1ZDLA 4EIPA 4HFIA 2ODUA 2J62A 3AA1B 4H4TA 3CQCB 1PN0A 2GB0A 3G5QA 1HTJF 3QUJA 3SX6A 3EVYA 3ALLA 1EL9A 4EEBA 5IQ1A 4TZ4C 4CY6A 2DCFA 3H37A 2X50A 3CNSA 1E1HB 2N9DA 5JR9C 4EEDA 5LGTB 1LVFA 2YR6A 3BI2A 1CBOA 3CGDA 3AEFA 3B5MA 4Y4LA 2C4CA 2PJQA 3H3AA 4TV9E 2BS2A 4DR5T 4GRTA 4ZXLA 3UKLA 2GEWA 1YY5A 3VHLA 2V5ZA 3ESLA 4AP1A 3ZJ1A 4OPTA 2GF3A 2IAKA 3AXJA 3MJXA 3PUQA 1E6EA 5HYMA 3ISHA 5EK2A 4TM4A 5BVAA 1XMOT 4EZHA 2PTFA 5FXXA 2XQ7A 1F8WA 4JI7T 4ILBA 4UV9B 4IIJE 3NK0X 4UIGA 4J2WA 2XVFA 4Y4NA 2V26A 2E4GA 4ERRA 5EK3A 3CN8A 4EAHA 3UU5A 2IIUA 1Q9IA 3D8XA 3DK8A 4YSHA 2GVCA 4FK1A 3P4WA 2CWOA 3U78A 1GRAA 5BMVE 2OA1A 2YN6A 2MBGA 3ZYMA 3V5SA 2NW8A 4K7ZA 1YQ4A 3DH9A 4JY3A 4G6HA 2WM9A 4L0RA 2A72A 2PYXA 4YTMA 1DOCA 3UOZA 2E5LT 3LBXB 4UXNB 2Q6UA 1SA0E 3N9MA 1H83A 2OLOA 4NTDA 1GT8A 2WP6A 2XZEA 3BQLA 2D9DA 3REDA 4AKHA 2WY2A 3CTYA 4DV3T 3H3MA 3ZT7A 1N1PA 3PDYA 2BC1A 2NW7A 2VL8A 2WPFA 3V76A 1B5QA 1PBCA 3V3OA 3M12A 2WMNA 5JDGA 3O4XE 4K22A 4G2AA 3SZ0A 2R0PA 1BR0A 4EIWA 5LGUB 4ZCDA 4JQ9A 5AFUL 5FS6A 1COYA 1D0XA 2LSJA 3TLTA 4JYAT 3EAOA 4ZCCA 2X51A 4GOUA 4DO0A 4CZZB 3PE0A 5AQJB 5KRQA 3QB5K 2Q0KA 1H7WA 2NTXA 1H6VA 3I3LA 2WPEA 3SFDA 4IE7A 2MAWA 1FMWA 3SQPA 4B65A 4D04A 3CNTA 2YG6A 1T7SA 3MXZA 4TUYE 4YTNA 3PJAA 1E1MA 4CCQA 3KV9A 4B3RT 5KMGP 2CVJA 2WAUA 1XZYA 3P50A 2VQFT 1OXZA 5FXVA 1TRBA 2W66A 3AD7B 4NZHA 4I50E 1JU2A 1R8IA 3TKLB 3UUXB 3LB8A 1GEUA 3PTRB 3T0KA 1OEDA 3NG7X 3RIAA 4EMIA 3DJJA 5DABA 4EIQA 2ZBWA 3N9QA 3ZC1A 1ZKQA 3I1AA 5FXZA 1YQ3A 3UOYA 2OLNA 1TYPA 1WFDA 1ZY8A 1TDEA 3NYEA 3CX8B 4HN9A 3WI3A 5ABEA 1NWMX 4H2PA 4U7IA 4C91A 4U8OA 2BXSA 4EQXA 2CCQA 1RP0A 2YDSA 3LXDA 1D1AA 1EBDA 3AE9A 1CUNA 2EQ7A 3OYZA 1XDPA 3CQXC 4DV7T 2ZZCA 3W15B 1GRHA 1VG0A 5L3GB 4E7ZA 4K5RA 1QJDA 3Q9TA 2VKHA 4TM0A 4C3XA 3N9OA 3UTEA 4JEUB 1NEKA 1Y56A 2UZZA 1MNEA 1XHCA 1MNDA 5JCKA 3LG7A 4UVCB 3ZMZB 2CXLA 3VRAA 2BS4A 4IHJE 2G0UA 3B13A 2OAMA 3CNPA 2ACXA 5LJNA 1U5PA 1O95A 2V6OA 4IGUA 3PUGA 3ZEFB 3KINB 5L3EB 4DGKA 5HXHA 2OLTA 5AQUB 3FMWA 3ZLIA 3KKJA 4GDEA 4K5SA 1F3PA 4OK0A 3L09A 1N4UA 4PABA 4YSYA 3MA9A 5JREA 4PK5A 2X67A 4J34A 4OCGA 4HB9A 4AOSA 3UTFA 4PJJA 3UCLA 2YKSA 2V6XA 4ZS2A 5LBQB 2H7VC 5HWYA 3AAIA 2CPTA 3CQGB 2QA1A 3IHRA 2CHNA 1OWAA 4QH5A 2XDOA 4GKKT 3KU9A 2LE8A 1PBEA 3RKGA 2BKNA 4GYSA 1KEYA 1NHRA 4H7UA 3G5RA 3K1SA 3KFWX 2XAQB 3AAEB 2LKGA 2LSKA 4A5LA 4DSGA 1EL8A 3JAEA 3AYJA 2A89A 4UF0A 2VKOA 2JB2A 3RRCA 4X9NA 2KNDA 2FJAA 1PS9A 1LVLA 4RSLA 5JDHA 1GTHA 4JNQA 5LG3A 4ZZBA 5GSNA 4U72A 2LM9A 2BACA 3AEDA 4AQGA 2B9WA 4UR9A 3FHNA 5HHFA 2VOUA 3AE7A 1PHHA 3AXBA 1H84A 3CNDA 5L2LA 2EHOC 1Y0PA 3DK4A 4TLXA 3AE5A 3DJBA 1CJ4A 1D7YA 2V8SV 5HCJA 5AQRB 4CRTA 3A5XA 2LSIA 4TX5A 3NZQA 4TWHA 4EYYR 2VVMA 4PJLA 4DV6T 4YXDA 3DGHA 2YG3A 2BKPA 4YJ2E 2LHRA 2C76A 3I0OA 3RPUA 1WYBA 1BGJA 1BF3A 3HYXA 4CCRA 3ANWB 3M65A 4H63V 2XAFB 3K30A 4A6NB 2NVKX 5IYZE 2K24A 5LV9A 3JAFA 2JMHA 2V7IA 4WYVA 1Y01A 1J5ET 3QK6A 1NDAA 4OPCA 5L3BB 1VOMA 3ZC0A 5KVHA 4JLEA 3CKDA 4ILAA 2V60A 2XHEB 2WHDA 4X4JA 1KDGA 4U7YA 2K9AA 3JADA 2ZZ0A 5LMNT 3F57A 5J1GA 1HS7A 2K5BB 3OC4A 5HAXA 4C3YA 4REKA 3RP7A 3O1IA 2ES0A 1GALA 3AAAB 1XWMA 3IEEA 3II4A 4B3TT 3NNEA 2GQWA 1U4QA 4CN1A 2YVFA 1B8SA 2LHNA 2BG9E 2DNXA 2Q9QD 4M1PA 1OJ9A 1T8BA 2B76A 4IE4A 4DVDA 3IF9A 5LXTE 1KSSA 3L8RA 5KX5E 1XNQT 2CMRA 2WWVA 2B7SA 2V1DB 4WBNE 4HFEA 3O1HA 2BG9C 5HYAA 3DGZA 2LLYA 1LKXA 2GH5A 4B3ST 2XFPA 4J57A 5CGMA 4U2YA 3I0QA 4IE6A 2KMFA 2KSRA 4DBQA 4U74A 4ZI7E 2GMJA 2QA7A 4D03A 5FS7A 3AE1A 2X0LB 5IUXA 2EQ6A 4U8JA 2UXCT 5LP6E 3UP5A 4Z25A 2YM2A 3QVPA 2IDOB 2X9WA 5AQSB 1YQZA 1I6ZA 1K0IA 2XQ6A 3UQ7A 1VDCA 5F5WA 2XASB 1JOAA 1KSUA 3ZT5A 4II2A 1WR6A 1TDNA 2C67A 3FZHB 4DBRA 3CNJA 3T2KA 1MOKA 5FY7A 3AE4A 2HN2A 3M0OA 5LJMA 5FL0A 5AQGB 5HEHA 4DR2T 5GRTA 3MKDA 3T8OA 3PV0F 1D4DA 2WZIA 3Q6JA 3EHZA 2IC9A 4YKGA 2QYWA 4B67A 3HR0A 2LT3A 1JNRA 3COXA 1OJDA 3AD8B 3NLCA 3UU6A 2X68A 4KPRA 3RQUA 1CC4A 1DOBA 3HA4A 3ZYKA 4AISA 3NN6X 3S5WA 2D0TA 4IDPA 4G63A 3RC3A 3K8PC 3LJCA 3QVRA 1F8RA 4IDQA 4H4WA 3UFGA 2ZM2A 4U33A 4JI1T 2BYBA 2C5KT 2W62A 1IUXA 5JTGA 2DHRA 4LFAT 4U2ZA 3SM8A 4OYKA 3ZMUB 3OTOT 1O3XA 4IVOB 2AE9A 2K3WA 3KPFA 4QXCB 4A9WA 3VRDB 4O4JE 5KMPA 1CC2A 1LJ1A 4GDPA 2W67A 3PUXF 3T1YT 1GSNA 2C5IT 4NIQA 4U31A 3UFEA 5LHGB 4F6RC 5LMUT 3MACA 1UURA 3NVOA 1EL7A 2YLTA 4HEAA 1VCTA 1YKHB 4CN4A 4FDCB 5ER0A 1D5TA 1IJ6A 4XAXB 4O4LE 2VQBA 4UDPA 4LF4T 5ABFB 1PXCA 1SEZA 3C64A 2C7GA 4WBOA 1GRGA 4QH4A 4AP3A 4H4QA 4JI6T 3MK7C 4H9OC 4CXYA 1CC6A 1B37A 3Q5WA 1NAFA 2LEHA 4QXHB 4AQYT 3RIUA 4I4TE 3ZJ2A 4Z90A 3UQ4A 4OVIA 2C0SA 1ZMDA 3KVEA 2B7RA 1OJTA 1IAPA 5BUKA 3UKFA 4I59A 3R6NA 4DMWA 5L3FB 4ECHA 5HEUA 1ELIA 3OBVE 4J31A 2V61A 4IT4A 4WZXA 2C5JA 4ZZCA 2RPAA 3GA8A 2X0YA 1N32T 4RG4A 3GN5A 1K4QA 1MO9A 2UUCT 3FBLA 4UDRA 2CLYC 2W2UA 2UUBT 3RP8A 3RC8A 5LYJE 3UU3A 5HXRA 3J9X1 4ZN0A 5CJ5A 4AKLA 1MMGA 5HWXA 2CULA 4O8SA 4H50A 1OEDE 4NXMT 4NTCA 4TN7B 1W0BA 1ZHCA 4YSZA 3NGCX 3Q5DA 3PUAA 2VVLA 5KWFA 1S3EA 4X9MA 1WYCA 2LRKA 5L3CB 4AKIA 5ADXL 2JKCA 1DXLA 1GV4A 4Z91A 3FB2A 4IL4A 4YY3T 2GQFA 3N9NA 3P4SA 3NKSA 2DWGA 1HF8A 1SE7A 3LK2B 2LJLA 3F8DA 1HNXT 1UX4A 4X1IE 4N9XA 1IBLT 3AWIA 1CHUA 3UOXA 3QFAA 1NHPA 4HFCA 2QA2A 2YG4A 2CEAA 4CI3B 4U2TA 1W09A 2I6HA 3GD4A 2W0GA 2DKHA 1ZP0A 5JR9A 5J0ZA 4CY8A 2YINA 2DKIA 4P09A 1HCIA 2XQ9A 4JBWF 2V5CA 4X1KE 4B64A 3FZKB 2XLRA 3NKZA 3K7QX 1IUWA 3RYFE 5L3DB 2E9XC 2BC0A 2BVMA 3AEBA 1S3BA 2FJBA 1BR1A 2YVGA 3FBZA 1PDHA 2NOXA 4DSHA 2VZ2A 5JCNA 1WRDA 2RGJA 4GF7A 2ARDA 4K8DA 2V3BA 4NXNT 3BI5A 3KBUA 4MBQA 3O9XA 4F8HA 4BAYB 3UOVA 1IUSA 3Q2MA 5M4YA 2IIDA 4WNKA 4Z44A 3KVBA 1NENA 2XYOA 3QSSA 4O4IE 3QNUA 2PBIA 4AQFC 3TLUA 1PXBA 2IVEA 2MTQA 2BKOA 4A97A 1GPEA 4O5UA 4TM3A 2XQ4A 2CLYB 3BQIA 5IHYA 1X79A 4QHOA 3OZ2A 5LNKA 4DV0T 4L5GA 2ZM8A 3RLFF 1VRQB 1MMDA 2J3NA 3AVRA 4DR6T 1NPXA 4X62T 2BG9A 3NBXX 2VURA 2BRYA 4JDRA 4B3MT 1J5WA 3NT6A 3SRZA 1L9CA 3NHOX 2JB3A 2JB1A 2W61A 5LBMA 1Z0PA 2XY8B 4DUZT 4H2NA 3RX6A 2YLWA 2EHOD 3SZCA 1YD8G 4PW8A 5EB4A 2BABA 3O1JA 3NRNA 5TR3A 4H9RC 2R6GF 3CPZA 2JQHA 4A99A 5HEOA 5KNLA 2JQKA 4UELA 3GSIA 1OEDC 1N33T 1SUMB 1ZKEA 2YG7A 4HGAA 1MIYA 1Y64B 4KHZF 3TLWA 3NYFA 2R46A 3T14A 2MYSA 2XAGB 4HFDA 5FVLA 3AVSA 3SWHA 4B1BA 5HXEA 4HFHA 4PAAA 1GRBA 4AOXA 1HNZT 4JUYA 5HEJA 3CK6A 2IVDA 3CPHG 2BCPA 4CNJA 3C4XA 4TV8E 1BKWA 2X0HA 1FEBA 5U1OA 3J7Yq 4JY2A 1NHSA 5AQPB 1GREA 3FXEB 4DR7T 2KLQA 4EYUA 3NIXA 4EGWA 4HFBA 4YTPA 5L4HA 4ISSA 4BK2A 2B1EA 4X64T 4TWDA 1TDOA 2YK0A 5CKUA 3RNMA 2BK4A 4ILCA 4EM4A 2XTLA 1UCUA 3HKDE 1OJAA 2APGA 2BZBA 2CE7A 3VRBA 5U63A 1TDFA 4JV5T 5FS9A 1X31B 4GK5E 4PFOA 5BR8T 3FXDB 3ZN1B 1QLBA 2V7LA 4JI3T 5HXCA 5JR9B 5AQQB 3L1RA 4H2RA 4YWOA 2KXPB 1UGOA 4YLHA 3PS9A 3CGBA 3KDSE 4PJNA 2GR0A 2KINB 4Z43A 4G74A 4XWRA 4YFSA 2VK9A 4CQIA 2ZM6T 4Z2TA 4H4XA 3R84B 3UKHA 3RYHE 1GERA 4K0UA 4HWCA 1GXFA 5LCYA 1HG2A 4FK1C 2W63A 1HNWT 4GIWA 4HWDA 3K7TA 4YKFA 1VRBA 2X9HA 3SGLA 3LZWA 4MFRA 3CWZB 2CRBA 2TPRA 3ZN0B 3FZFB 4K2XA 3KD9A 5FY1A 1H81A 1B4VA 4EZ4A 2C73A 1WCRA 3FIMB 2V6YA 3CGEA 4J33A 1IBKT 3F2EA 2V5DA 4YHJA 1E1LA 2D0UA 4OFZA 2KT9A 5HCMA 4X5TA 4APNA 2Q9QB 4P1NA 4USQA 4G9KA 2PHHA 3AE6A 2YR5A 3AA6B 3C96A 1DJQA 3PUZF 4H9QC 2XLSA 2FJDA 3FZLB 3DMEA 3AEGA 1TDKA 1D7LA 3JC6C 4QX8B 2C66A 1PXAA 1Y56B 4BJYA 1LRZA 2I0ZA 5L47A 2XQ3A 3NZPA 3BQKA 3ZSSA 1FL2A 3X1DA 3IA3A 3EANA 4H4YA 3BNMA 4LMKA 4E7SA 4I0UA 1D0ZA 1B7TA 2LOSA 4OX9T 3ALJA 3RP6A 1N4VA 3VR9A 3UUNA 2WZHA 3QJ4A 4YHHT 2GAGB 1CF3A 2XAHB 4LF7T 2BK3A 2W4XA 3NN0X 1PJ5A 4GK0E 3EDVA 4LFBT 2OA5A 3C50A 4DNAA 2WPCA 2D2SA 2JQQA 3AD9B 4LA1A 2X66A 4MJWA 4NNJA 2EQ8A 1GNDA 1M62A 1Z8UA 4YT0A 3NK2X 1D4EA 5JDNA 2LFCA 1L9DA 5FY0A 1ONFA 1OJCA 3RYIE 3ZPOA 3ATRA 3C4WA 4GR1A 5AQMB 5AQTB 2TMDA 1GTEA 1X9BA 2ZZBA 2WCAA 3VR8A 3K3QC 4IVMB 4JI8T 3N2OA 3RI5A 4TNVA 2IW5B 2HPJA 3P9UA 3NK1X 4IV9A 1H82A 4UVBB 2V3AA 3BK9A 2D5UA 4KP3C 3ITJA 4LF5T 3ADAB 3GWHA 3HYWA 4TWFA 2H89A 3LFMA 5FS8A 3ZSTA 4EMWA 2XAJB 2M6BA 3C4AA 3ANWA 4ASKA 4USRA 3ONJA 1YXRA 2VRLA 3BHFA 2YEVC 4BV6A 2CBIA 2F4VT 2YVJA 4A79A 3GD3A 5JDMA 3AEEA 3UKKA 1O5WA 2J47A 2J1DG 4QXBB 3GYJA 2E2AA 3HZLA 3RHAA 3ABVA
chains in the Genus database with same CATH topology
1F6MA 3EPTA 2CULA 3PVCA 1CJ2A 1M6IA 1BGNA 3NYCA 5KMQA 4YTNA 1BZLA 4H50A 1E1MA 4H4PA 2B9XA 4CCQA 4NTCA 1PJ7A 4B63A 2A8XA 3V3NA 2CVJA 4YSZA 4XWZA 3NGCX 1LQTA 1RSGA 1GRTA 1ZX9A 2VVLA 4B69A 4NWZA 5KWFA 1FECA 1TRBA 3AD7B 1S3EA 4NZHA 1DOEA 4U2LA 5C3JA 1JU2A 3LB8A 4X9MA 2XVEA 1GEUA 3T0KA 3ALMA 3NG7X 2JKCA 3DJJA 4EMIA 1DXLA 4OPLA 4EIQA 2ZBWA 3ICSA 2FBWA 1GV4A 3T2YA 4U8PA 2YAUA 3AYIA 2E5VA 3B6DA 4ICYA 4U8LA 1ZKQA 5EOWA 1REOA 3UP4A 5KOWA 2GQFA 3BI4A 3UOYA 1YQ3A 3P4SA 3NKSA 4AT2A 2OLNA 1KNPA 1TYPA 3KA7A 1JEHA 4C77A 2WDVA 4LU6A 1ZY8A 3F8DA 5IPYA 1TDEA 3NYEA 4H2PA 1DJNA 4N9XA 3AWIA 1CHUA 3UOXA 1S2QA 1NHPA 3QFAA 4E0VA 4J56A 4Z2RA 2QA2A 2YG4A 4U8OA 2RGOA 2BXSA 4EQRA 4U2TA 4EQXA 5M10A 1RP0A 3GD4A 3LXDA 2DKHA 1ZP0A 4I58A 1EBDA 3AE9A 2EQ7A 2XLTA 4CY8A 2WP9A 3G5SA 1CJCA 3UKAA 1AOGA 4H4VA 2DKIA 4U8NA 2HQMA 4B64A 3P4RA 2XLRA 2H88A 3C4NA 4OPDA 2ZZCA 1NG4A 3K7QX 1GRHA 1IUWA 1VG0A 4K5RA 2BC0A 1QJDA 3AEBA 3LADA 1S3BA 2FJBA 1O94A 2W0HA 2YVGA 3NTAA 3Q9TA 4CNKA 4TM0A 3E1TA 4GUVA 4C3XA 1PDHA 2XCGA 3UTEA 1NEKA 1Y56A 4KX6A 4DSHA 1L0VA 2VZ2A 4JN9A 5JCNA 2UZZA 2GR3A 4OPIA 2RGJA 1XHCA 4GF7A 5BRTA 1KNRA 4H2QA 5JCKA 2ARDA 2X8CA 5KMSA 2C3DA 3K7MX 4P9SA 3VQRA 3VRAA 2BS4A 1E39A 2V3BA 4K8DA 3BI5A 2X99A 2OAMA 3CNPA 2WOIA 3UTGA 1O95A 2VVLG 2OALA 2V6OA 5JCIA 3UOVA 1DNCA 2C65A 1IUSA 2IIDA 2YM1A 2R4JA 4Z44A 3T2ZA 1NENA 2XYOA 4DGKA 1LTXR 3QSSA 5KMRA 5EBKA 3FMWA 2R0CA 3KKJA 1PXBA 1PBDA 2E1MA 2BRAA 4GDEA 2IVEA 4K5SA 3GMCA 4OPUA 1F3PA 3AE3A 3AEAA 3SY4A 1N4UA 4PABA 1GPEA 2WS3A 4YSYA 4O5UA 2GV8A 1PJ6A 2BCGG 3D1CA 4J34A 1UKVG 4C74A 1LQUA 4TM3A 3AECA 4OCGA 4HB9A 3AE2A 3T31A 3OZ2A 3IWAA 3GYIA 4AOSA 3P4QA 3UTFA 4A6NA 2BA9A 3UCLA 4GAVA 2R45A 4NTEA 5U25A 3DJEA 2QA1A 1VRQB 4A7AA 2AAQA 3T37A 2J3NA 1GOSA 1DODA 1NPXA 2C64A 3CPJG 1ZMCA 2XDOA 4U2SA 3KU9A 4J36A 4BJZA 1PBEA 3ZYXA 2BRYA 1NHRA 1TYTA 1VG9A 4H7UA 4JDRA 1M64A 3G5RA 3NT6A 2GR2A 4U8IA 4OPGA 1L9CA 3NHOX 3AB1A 4EQSA 2YLSA 1KFYA 2JB3A 4A5LA 5HXIA 2JB1A 4DSGA 1EL8A 4H2NA 2YLWA 3M13A 3AYJA 2A89A 3SZCA 5EB4A 2BABA 2JB2A 3UKPA 4X9NA 2FJAA 1PS9A 1LVLA 2GMHA 2WOVA 3NRNA 4II3A 4RSLA 5TR3A 2WDRA 1GTHA 4G73A 4JNQA 5GSNA 1IJHA 1QO8A 2R9ZA 2XFOA 4A99A 4BK3A 5CQFA 2Y6QA 1JNZA 2BACA 2QCUA 2WEUA 2R4EA 3AEDA 3KPKA 5KNLA 3GWFA 4H4SA 5DBJA 1ZK7A 3GSIA 1NHQA 2B9WA 1ZOVA 1N4WA 3PO7A 1XPQA 3SXIA 2YG7A 4GCMA 5HHFA 2VOUA 3NYFA 3AE7A 3KLJA 1PHHA 1S2YA 3AXBA 2R46A 1H84A 3T14A 3CNDA 3URHA 1Y0PA 2YG5A 3GRSA 3AYLA 3DK4A 4B1BA 4TLXA 3AE5A 1K0JA 2XFUA 1CJ4A 4U8MA 1D7YA 3CPIG 1V59A 4PAAA 4Z26A 1GRBA 4RG3A 4AOXA 4CRTA 2Z5YA 3HYVA 2IVDA 3CPHG 2BCPA 1F8SA 1JRXA 4CNJA 1HYUA 1E1NA 4CBQA 3UKQA 2VVMA 3QSMA 1BKWA 1FEBA 4YXDA 4EMJA 3DGHA 5U1OA 2YG3A 3SZFA 3CGCA 3NH3X 4JY2A 2C76A 1NHSA 1GREA 3JSKA 4UDQA 3NIXA 3I6DA 1BGJA 2GR1A 1BF3A 4YTPA 2A87A 3HYXA 2FJEA 2AR8A 4M52A 2YLXA 4CCRA 3GDPA 2WDQA 1FOHA 4BK2A 3K30A 3IC9A 4A6NB 4JNAA 1TDOA 5FMHA 2WETA 2NVKX 1IUTA 5CKUA 3RNMA 2BK4A 2EQ9A 1H86A 5LV9A 3P1WA 4EM4A 2CFYA 3SYIA 4BURA 1OJAA 2APGA 3VRBA 5U63A 3AE8A 1NDAA 1TDFA 1E7PA 4OPCA 5FS9A 1X31B 2XVIA 5KVHA 2GRTA 1W4XA 2V60A 3DJGX 1QLBA 2WHDA 4NEWA 1JRYA 4X4JA 3GMBA 1KDGA 3FG2P 2ZZ0A 5KXJA 2C70A 3SFEA 3NTDA 3L1RA 5JCMA 4H2RA 4A65A 3OC4A 4YWOA 4AT0A 2XFQA 4C3YA 2XVJA 4REKA 3PS9A 5KOXA 3CGBA 2WESA 3RP7A 2YR4A 4Z24A 5HY5A 1GALA 2GR0A 4Z43A 4G74A 3II4A 2F5ZA 3NNEA 2GQWA 1GRFA 4XWRA 4Y4MA 2YVFA 4EQWA 1B8SA 2NPXA 1NAAA 1IUVA 4LIIA 1OJ9A 3DA1A 1GETA 4UP3A 3WE0A 4H4ZA 1P2EA 4FX9A 4Z2TA 2YWLA 2B76A 4H4XA 3IF9A 4U8KA 1KSSA 3UKHA 5BULA 3H8IA 4TLZA 1GERA 2B7SA 1GXFA 1H7XA 3F8RA 1D4CA 4FK1C 3LOVA 3IHGA 3K7TA 3H4KA 2CDUA 4YKFA 5JCLA 3DGZA 1XANA 3SGLA 3LZWA 5J60A 2TPRA 4YSXA 5J7XA 2GH5A 2XFPA 4J57A 3GDNA 4K2XA 4C5OA 1CL0A 2R0GA 2WU2A 2C3CA 1ZOYA 3KD9A 2WU5A 3FPZA 1H81A 1B4VA 1E1KA 2GMJA 2C73A 3BHKA 4D03A 3CMMA 5FS7A 2RGHA 3AE1A 3FIMB 3ICTA 3CIRA 2EQ6A 4U8JA 3CGEA 2WQYA 2XLPA 4J33A 3ATQA 2C75A 2O9ZA 4O5QA 3FBSA 3UP5A 2Q0LA 4Z25A 2JAEA 1E1LA 1VQWA 4B68A 2YM2A 3DK9A 3QVPA 1YQZA 5M0ZA 1MXTA 1K0IA 1VDCA 4APNA 2XVHA 3ZDNA 1JOAA 1KSUA 4USQA 4II2A 1TDNA 2JK6A 3GWDA 2C67A 2PHHA 4G9KA 1XDIA 3CNJA 3T2KA 1MOKA 3AE6A 2YR5A 2VRMA 1ZDLA 3AE4A 4IA6A 4ADWA 3M0OA 4EIPA 3C96A 2XLUA 1DJQA 4HA6A 1KF6A 4H4TA 1CJ3A 2YLRA 5GRTA 2XLSA 2YQUA 2FJDA 1K0LA 3UTHA 1PN0A 1YKJA 3DMEA 3AEGA 1D4DA 2X8HA 2GB0A 1TDKA 4GAPA 1D7LA 3G5QA 3Q6JA 4YKGA 3SX6A 3ALLA 4B67A 1EL9A 5IQ1A 2C66A 4CY6A 1JNRA 1PXAA 3COXA 1Y56B 1OJDA 4BJYA 3AD8B 3NLCA 2I0ZA 2X50A 4EM3A 4KPRA 3CNSA 5EB5A 1CC4A 1DOBA 1LPFA 1FL2A 3NN6X 3DJDA 5C2TA 2YR6A 3EANA 3BI2A 3S5WA 2C72A 1CBOA 3CGDA 3AEFA 3BNMA 4H4YA 4Y4LA 2C4CA 3QVRA 2BS2A 1F8RA 4GRTA 2GAHB 1EL5A 4H4WA 1FEAA 3UKLA 2GEWA 1YY5A 3ALJA 3QSEA 3RP6A 2Q7VA 1N4VA 1RYIA 3IHMA 2V5ZA 2BYBA 1IUXA 4WCTA 1FCDA 4AP1A 1IUUA 2BK5A 3VR9A 4OPTA 2JBVA 2GF3A 1E6EA 5HYMA 3SM8A 4IVOB 4BK1A 3QJ4A 3ISHA 3KPFA 2GAGB 1Q1RA 4TM4A 1CF3A 4A9WA 5BVAA 3VRDB 3SZWA 2BS3A 2BK3A 2Z5XA 3NN0X 1PJ5A 5KVIA 1F8WA 5KMPA 2WBAA 5L46A 4XXGA 1CC2A 3NK0X 3R9UA 2Y6RA 4J2WA 4DNAA 2WPCA 1LJ1A 4GDPA 3AD9B 4LA1A 2XVFA 4Y4NA 4MJWA 4NNJA 2EQ8A 1GNDA 4NEVA 2E4GA 1GSNA 1Z6LA 2WP5A 3CN8A 3D8XA 3DK8A 1Q9IA 4YSHA 4YT0A 3GYXA 3NK2X 2GVCA 4FK1A 1D4EA 1BWCA 2LFCA 3S61A 1GRAA 2OA1A 2YLZA 1L9DA 1ONFA 1OJCA 3ATRA 1EL7A 2YLTA 4GR1A 4K7ZA 1YQ4A 3DH9A 3LZXA 4JY3A 4G6HA 4FDCB 2TMDA 4TM1A 1D5TA 3O0HA 5ER0A 2PYXA 3B3RA 1GTEA 4YTMA 3BNUA 1DOCA 4H4RA 3UOZA 2VQBA 2ZZBA 3VR8A 4G6GA 4UDPA 4IVMB 1PXCA 3GRTA 1SEZA 2C7GA 2Q6UA 1GRGA 1JRZA 1H83A 2OLOA 4AP3A 4H4QA 1GT8A 2RABA 3P9UA 4NTDA 5IQ4A 2WP6A 3EF6A 4IA5A 3ICRA 1Q1WA 3NK1X 4IV9A 1PBFA 1LV0A 2X3NA 2WOWA 1CC6A 1B37A 3REDA 1H82A 2XFNA 3CTYA 3F8PA 2V3AA 3LJPA 1N1PA 3ITJA 2BC1A 3ADAB 2QAEA 3V76A 2WPFA 2AQJA 4OVIA 3HYWA 1L9EA 1ZMDA 1B5QA 1PBCA 3KVEA 3V3OA 3M12A 2B7RA 2H89A 1OJTA 5FS8A 4EMWA 4Z2UA 3UKFA 5BUKA 4I59A 4K22A 3SZ0A 2R0PA 3P4PA 1PBBA 3C4AA 4H4UA 3L8KA 4ECHA 2ACZA 1ELIA 4ZCDA 4JQ9A 4USRA 4J31A 2V61A 5FS6A 4B66A 1COYA 1P2HA 4WX1A 2VRLA 2X8GA 3BHFA 3QFBA 4BV6A 3EAOA 4ZCCA 1GESA 2BXRA 2YVJA 4A79A 4RG4A 3GD3A 1K4QA 5KRQA 1MO9A 2Q0KA 4UDRA 1H7WA 3AEEA 2B9YA 1H6VA 3I3LA 3UKKA 3RP8A 1O5WA 2WPEA 3SFDA 3SQPA 4B65A 3GYJA 4D04A 3CNTA 1NG3A 2YG6A 3HZLA 3RHAA 4ZN0A 3H8LA 2VQ7A 3ABVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F6M A;  3EPT A;  2CUL A;  3PVC A;  1CJ2 A;  1M6I A;  1BGN A;  3NYC A;  4YTN A;  1BZL A;  4H50 A;  1E1M A;  4H4P A;  2B9X A;  4CCQ A;  4NTC A;  1PJ7 A;  4B63 A;  2A8X A;  3V3N A;  2CVJ A;  4YSZ A;  4XWZ A;  3NGC X;  1LQT A;  1RSG A;  1GRT A;  1ZX9 A;  2VVL A;  4B69 A;  5KWF A;  1FEC A;  1TRB A;  3AD7 B;  1S3E A;  4NZH A;  1DOE A;  4U2L A;  5C3J A;  1JU2 A;  3LB8 A;  4X9M A;  2XVE A;  1GEU A;  3ALM A;  3NG7 X;  2JKC A;  3DJJ A;  4EMI A;  1DXL A;  4OPL A;  4EIQ A;  2ZBW A;  3ICS A;  2FBW A;  1GV4 A;  4U8P A;  2YAU A;  3AYI A;  2E5V A;  3B6D A;  4ICY A;  4U8L A;  1ZKQ A;  5EOW A;  1REO A;  3UP4 A;  5KOW A;  2GQF A;  3BI4 A;  3UOY A;  1YQ3 A;  3P4S A;  3NKS A;  4AT2 A;  2OLN A;  1KNP A;  1TYP A;  3KA7 A;  1JEH A;  4C77 A;  2WDV A;  4LU6 A;  1ZY8 A;  3F8D A;  5IPY A;  1TDE A;  3NYE A;  4H2P A;  1DJN A;  4N9X A;  3AWI A;  1CHU A;  3UOX A;  1S2Q A;  1NHP A;  3QFA A;  4E0V A;  4J56 A;  4Z2R A;  2QA2 A;  2YG4 A;  4U8O A;  2RGO A;  2BXS A;  4EQR A;  4U2T A;  4EQX A;  5M10 A;  1RP0 A;  3GD4 A;  3LXD A;  2DKH A;  1ZP0 A;  4I58 A;  1EBD A;  3AE9 A;  2EQ7 A;  2XLT A;  4CY8 A;  2WP9 A;  3G5S A;  1CJC A;  3UKA A;  1AOG A;  4H4V A;  2DKI A;  4U8N A;  2HQM A;  4B64 A;  3P4R A;  2XLR A;  2H88 A;  3C4N A;  4OPD A;  2ZZC A;  1NG4 A;  3K7Q X;  1GRH A;  1IUW A;  1VG0 A;  4K5R A;  2BC0 A;  1QJD A;  3AEB A;  3LAD A;  1S3B A;  2FJB A;  1O94 A;  2W0H A;  2YVG A;  3NTA A;  3Q9T A;  4CNK A;  4TM0 A;  3E1T A;  4GUV A;  4C3X A;  1PDH A;  2XCG A;  3UTE A;  1NEK A;  1Y56 A;  4KX6 A;  4DSH A;  1L0V A;  2VZ2 A;  4JN9 A;  5JCN A;  2UZZ A;  2GR3 A;  4OPI A;  2RGJ A;  1XHC A;  4GF7 A;  5BRT A;  1KNR A;  4H2Q A;  5JCK A;  2ARD A;  2X8C A;  2C3D A;  3K7M X;  4P9S A;  3VQR A;  3VRA A;  2BS4 A;  1E39 A;  2V3B A;  4K8D A;  3BI5 A;  2X99 A;  2OAM A;  3CNP A;  2WOI A;  3UTG A;  1O95 A;  2VVL G;  2OAL A;  2V6O A;  5JCI A;  3UOV A;  1DNC A;  2C65 A;  1IUS A;  2IID A;  2YM1 A;  2R4J A;  4Z44 A;  1NEN A;  2XYO A;  4DGK A;  1LTX R;  3QSS A;  5EBK A;  3FMW A;  2R0C A;  3KKJ A;  1PXB A;  1PBD A;  2E1M A;  4GDE A;  4K5S A;  2IVE A;  3GMC A;  4OPU A;  1F3P A;  3AE3 A;  3AEA A;  1N4U A;  4PAB A;  1GPE A;  2WS3 A;  4YSY A;  4O5U A;  2GV8 A;  1PJ6 A;  2BCG G;  3D1C A;  4J34 A;  1UKV G;  4C74 A;  1LQU A;  4TM3 A;  3AEC A;  4OCG A;  4HB9 A;  3AE2 A;  3OZ2 A;  3IWA A;  3GYI A;  4AOS A;  3P4Q A;  3UTF A;  4A6N A;  2BA9 A;  3UCL A;  2R45 A;  4NTE A;  5U25 A;  3DJE A;  2QA1 A;  1VRQ B;  4A7A A;  2AAQ A;  3T37 A;  2J3N A;  1GOS A;  1DOD A;  1NPX A;  2C64 A;  3CPJ G;  1ZMC A;  2XDO A;  4U2S A;  3KU9 A;  4J36 A;  4BJZ A;  1PBE A;  3ZYX A;  1NHR A;  1TYT A;  1VG9 A;  4H7U A;  4JDR A;  1M64 A;  3G5R A;  3NT6 A;  2GR2 A;  4U8I A;  4OPG A;  1L9C A;  3NHO X;  3AB1 A;  4EQS A;  2YLS A;  1KFY A;  2JB3 A;  4A5L A;  5HXI A;  2JB1 A;  4DSG A;  1EL8 A;  4H2N A;  2YLW A;  3M13 A;  3AYJ A;  2A89 A;  5EB4 A;  2BAB A;  2JB2 A;  3UKP A;  4X9N A;  2FJA A;  1PS9 A;  1LVL A;  2GMH A;  2WOV A;  3NRN A;  4RSL A;  5TR3 A;  2WDR A;  1GTH A;  4JNQ A;  5GSN A;  1IJH A;  1QO8 A;  2R9Z A;  2XFO A;  4A99 A;  4BK3 A;  5CQF A;  2Y6Q A;  1JNZ A;  2BAC A;  2QCU A;  2WEU A;  2R4E A;  3AED A;  3GWF A;  4H4S A;  5DBJ A;  1ZK7 A;  3GSI A;  1NHQ A;  2B9W A;  1ZOV A;  1N4W A;  3PO7 A;  1XPQ A;  2YG7 A;  4GCM A;  5HHF A;  2VOU A;  3NYF A;  3AE7 A;  3KLJ A;  1PHH A;  1S2Y A;  3AXB A;  2R46 A;  1H84 A;  3CND A;  3URH A;  1Y0P A;  2YG5 A;  3GRS A;  3AYL A;  3DK4 A;  4B1B A;  4TLX A;  3AE5 A;  1K0J A;  2XFU A;  1CJ4 A;  4U8M A;  1D7Y A;  3CPI G;  1V59 A;  4PAA A;  4Z26 A;  1GRB A;  4RG3 A;  4AOX A;  4CRT A;  2Z5Y A;  2IVD A;  3CPH G;  2BCP A;  1F8S A;  1JRX A;  4CNJ A;  1HYU A;  1E1N A;  4CBQ A;  3UKQ A;  2VVM A;  3QSM A;  1BKW A;  1FEB A;  4YXD A;  4EMJ A;  3DGH A;  5U1O A;  2YG3 A;  3CGC A;  3NH3 X;  4JY2 A;  2C76 A;  1NHS A;  1GRE A;  3JSK A;  4UDQ A;  3NIX A;  3I6D A;  1BGJ A;  2GR1 A;  1BF3 A;  4YTP A;  2A87 A;  2FJE A;  2AR8 A;  4M52 A;  2YLX A;  4CCR A;  3GDP A;  2WDQ A;  1FOH A;  4BK2 A;  3K30 A;  3IC9 A;  4A6N B;  4JNA A;  1TDO A;  5FMH A;  2WET A;  2NVK X;  1IUT A;  5CKU A;  3RNM A;  2BK4 A;  2EQ9 A;  1H86 A;  5LV9 A;  3P1W A;  4EM4 A;  2CFY A;  4BUR A;  1OJA A;  2APG A;  3VRB A;  5U63 A;  3AE8 A;  1NDA A;  1TDF A;  1E7P A;  4OPC A;  5FS9 A;  1X31 B;  2XVI A;  5KVH A;  2GRT A;  1W4X A;  2V60 A;  3DJG X;  1QLB A;  2WHD A;  4NEW A;  1JRY A;  4X4J A;  3GMB A;  1KDG A;  3FG2 P;  2ZZ0 A;  5KXJ A;  2C70 A;  3SFE A;  3NTD A;  3L1R A;  5JCM A;  4H2R A;  4A65 A;  3OC4 A;  4YWO A;  4AT0 A;  2XFQ A;  4C3Y A;  2XVJ A;  4REK A;  3PS9 A;  5KOX A;  3CGB A;  2WES A;  3RP7 A;  2YR4 A;  4Z24 A;  5HY5 A;  1GAL A;  2GR0 A;  4Z43 A;  3II4 A;  2F5Z A;  3NNE A;  2GQW A;  1GRF A;  4XWR A;  4Y4M A;  2YVF A;  4EQW A;  1B8S A;  2NPX A;  1NAA A;  1IUV A;  4LII A;  1OJ9 A;  3DA1 A;  1GET A;  4UP3 A;  3WE0 A;  4H4Z A;  1P2E A;  4FX9 A;  4Z2T A;  2YWL A;  2B76 A;  4H4X A;  3IF9 A;  4U8K A;  1KSS A;  3UKH A;  5BUL A;  3H8I A;  4TLZ A;  1GER A;  2B7S A;  1GXF A;  1H7X A;  3F8R A;  1D4C A;  4FK1 C;  3LOV A;  3IHG A;  3K7T A;  3H4K A;  2CDU A;  4YKF A;  5JCL A;  3DGZ A;  1XAN A;  3SGL A;  3LZW A;  5J60 A;  2TPR A;  4YSX A;  5J7X A;  2GH5 A;  2XFP A;  4J57 A;  3GDN A;  4K2X A;  4C5O A;  1CL0 A;  2R0G A;  2WU2 A;  2C3C A;  1ZOY A;  3KD9 A;  2WU5 A;  3FPZ A;  1H81 A;  1B4V A;  1E1K A;  2GMJ A;  2C73 A;  3BHK A;  4D03 A;  5FS7 A;  2RGH A;  3AE1 A;  3FIM B;  3ICT A;  3CIR A;  2EQ6 A;  4U8J A;  3CGE A;  2WQY A;  2XLP A;  4J33 A;  3ATQ A;  2C75 A;  2O9Z A;  4O5Q A;  3FBS A;  3UP5 A;  2Q0L A;  4Z25 A;  2JAE A;  1E1L A;  1VQW A;  4B68 A;  2YM2 A;  3DK9 A;  3QVP A;  1YQZ A;  5M0Z A;  1MXT A;  1K0I A;  1VDC A;  4APN A;  2XVH A;  3ZDN A;  1JOA A;  1KSU A;  4USQ A;  1TDN A;  2JK6 A;  3GWD A;  2C67 A;  2PHH A;  1XDI A;  3CNJ A;  1MOK A;  3AE6 A;  2YR5 A;  2VRM A;  1ZDL A;  3AE4 A;  4IA6 A;  4ADW A;  3M0O A;  4EIP A;  3C96 A;  2XLU A;  1DJQ A;  4HA6 A;  1KF6 A;  4H4T A;  1CJ3 A;  2YLR A;  5GRT A;  2XLS A;  2YQU A;  2FJD A;  1K0L A;  3UTH A;  1PN0 A;  1YKJ A;  3DME A;  3AEG A;  1D4D A;  2X8H A;  2GB0 A;  1TDK A;  1D7L A;  3G5Q A;  3Q6J A;  4YKG A;  3ALL A;  4B67 A;  1EL9 A;  5IQ1 A;  2C66 A;  4CY6 A;  1JNR A;  1PXA A;  3COX A;  1Y56 B;  1OJD A;  4BJY A;  3AD8 B;  3NLC A;  2I0Z A;  2X50 A;  4EM3 A;  4KPR A;  3CNS A;  5EB5 A;  1CC4 A;  1DOB A;  1LPF A;  1FL2 A;  3NN6 X;  3DJD A;  5C2T A;  2YR6 A;  3EAN A;  3BI2 A;  3S5W A;  2C72 A;  1CBO A;  3CGD A;  3AEF A;  3BNM A;  4H4Y A;  4Y4L A;  3QVR A;  2BS2 A;  1F8R A;  4GRT A;  2GAH B;  1EL5 A;  4H4W A;  1FEA A;  3UKL A;  2GEW A;  1YY5 A;  3ALJ A;  3QSE A;  3RP6 A;  2Q7V A;  1N4V A;  1RYI A;  3IHM A;  2V5Z A;  2BYB A;  1IUX A;  4WCT A;  1FCD A;  4AP1 A;  1IUU A;  2BK5 A;  3VR9 A;  4OPT A;  2JBV A;  2GF3 A;  1E6E A;  5HYM A;  3SM8 A;  4IVO B;  4BK1 A;  3QJ4 A;  3ISH A;  3KPF A;  2GAG B;  1Q1R A;  4TM4 A;  1CF3 A;  4A9W A;  5BVA A;  3VRD B;  2BS3 A;  2BK3 A;  2Z5X A;  3NN0 X;  1PJ5 A;  5KVI A;  1F8W A;  2WBA A;  5L46 A;  4XXG A;  1CC2 A;  3NK0 X;  3R9U A;  2Y6R A;  4J2W A;  4DNA A;  2WPC A;  1LJ1 A;  4GDP A;  3AD9 B;  4LA1 A;  2XVF A;  4Y4N A;  4MJW A;  2EQ8 A;  1GND A;  4NEV A;  2E4G A;  1GSN A;  1Z6L A;  2WP5 A;  3CN8 A;  3D8X A;  3DK8 A;  1Q9I A;  4YSH A;  4YT0 A;  3NK2 X;  3GYX A;  2GVC A;  4FK1 A;  1D4E A;  1BWC A;  2LFC A;  3S61 A;  1GRA A;  2OA1 A;  2YLZ A;  1L9D A;  1ONF A;  1OJC A;  3ATR A;  1EL7 A;  2YLT A;  4GR1 A;  4K7Z A;  1YQ4 A;  3DH9 A;  3LZX A;  4JY3 A;  4FDC B;  2TMD A;  4TM1 A;  1D5T A;  3O0H A;  5ER0 A;  2PYX A;  3B3R A;  1GTE A;  4YTM A;  3BNU A;  1DOC A;  4H4R A;  3UOZ A;  2VQB A;  2ZZB A;  3VR8 A;  4UDP A;  4IVM B;  1PXC A;  3GRT A;  1SEZ A;  2C7G A;  2Q6U A;  1GRG A;  1JRZ A;  1H83 A;  2OLO A;  4AP3 A;  4H4Q A;  1GT8 A;  2RAB A;  3P9U A;  4NTD A;  5IQ4 A;  2WP6 A;  3EF6 A;  4IA5 A;  3ICR A;  1Q1W A;  3NK1 X;  4IV9 A;  1PBF A;  1LV0 A;  2X3N A;  2WOW A;  1CC6 A;  1B37 A;  3RED A;  1H82 A;  2XFN A;  3CTY A;  3F8P A;  2V3A A;  3LJP A;  1N1P A;  3ITJ A;  2BC1 A;  3ADA B;  2QAE A;  3V76 A;  2WPF A;  2AQJ A;  4OVI A;  1L9E A;  1ZMD A;  1B5Q A;  1PBC A;  3KVE A;  3V3O A;  3M12 A;  2B7R A;  2H89 A;  1OJT A;  5FS8 A;  4EMW A;  4Z2U A;  3UKF A;  5BUK A;  4I59 A;  4K22 A;  2R0P A;  3P4P A;  1PBB A;  3C4A A;  4H4U A;  3L8K A;  4ECH A;  2ACZ A;  1ELI A;  4ZCD A;  4JQ9 A;  4USR A;  4J31 A;  2V61 A;  5FS6 A;  4B66 A;  1COY A;  1P2H A;  4WX1 A;  2VRL A;  2X8G A;  3BHF A;  3QFB A;  4BV6 A;  3EAO A;  4ZCC A;  1GES A;  2BXR A;  2YVJ A;  4A79 A;  4RG4 A;  3GD3 A;  1K4Q A;  5KRQ A;  1MO9 A;  2Q0K A;  4UDR A;  1H7W A;  3AEE A;  2B9Y A;  1H6V A;  3I3L A;  3UKK A;  3RP8 A;  1O5W A;  2WPE A;  3SFD A;  3SQP A;  4B65 A;  3GYJ A;  4D04 A;  3CNT A;  1NG3 A;  2YG6 A;  3HZL A;  3RHA A;  4ZN0 A;  3H8L A;  2VQ7 A;  3ABV A; 
#chains in the Genus database with same CATH topology
 1BR2 A;  1F6M A;  3PVC A;  1CJ2 A;  3NYC A;  3UUM A;  3HI2 A;  4H4P A;  1PJ7 A;  2CXD A;  5AQK B;  4FJO A;  5DJQ C;  4LMJ A;  1ZX9 A;  4WW0 A;  3ZKR A;  3AXJ B;  2JIW A;  4DV4 T;  2XVE A;  5LA6 E;  4I55 E;  3ALM A;  4PK6 A;  4CXX A;  5L4E A;  4OPL A;  3AA7 B;  3ICS A;  2KZ7 B;  2FBW A;  3T2Y A;  5CB4 E;  2LSG A;  4U8P A;  3KV4 A;  2YAU A;  2E5V A;  5EOW A;  2CWY A;  2E9X B;  5JQG E;  3B57 A;  1KNP A;  3KA7 A;  3U3I A;  5IPY A;  2N1G A;  4ZS3 A;  1DJN A;  2E8I A;  2VAS A;  2WSS V;  1S2Q A;  1QSD A;  4DUY T;  2RGO A;  2DWK A;  3V5U A;  4EQR A;  3OJA A;  4ZI3 C;  2LKH A;  3UU4 A;  3OYX A;  4LFC T;  3G5S A;  1CJC A;  3UKA A;  4H4V A;  4U8N A;  3P4R A;  3C4N A;  1NG4 A;  3F31 A;  3QC9 A;  3PU3 A;  3PUR A;  1D0Y A;  2UXD T;  3LAD A;  1O94 A;  3E22 E;  2W0H A;  3E1T A;  3Q9D A;  2EHO B;  2V7J A;  4KX6 A;  2RA1 A;  1L0V A;  2HH7 A;  4JI5 T;  2GR3 A;  4OPI A;  1KNR A;  2NTY A;  2C3D A;  2L9Q A;  4N78 D;  3RGL A;  3OKQ A;  4IDN A;  2X99 A;  4AKG A;  2WOI A;  3UTG A;  1ZV4 X;  2OAL A;  2XQ8 A;  2YM1 A;  1E2A A;  5HXS A;  2BG9 B;  3RH3 A;  2W00 A;  3LK3 B;  3PUS A;  5KMR A;  5EBK A;  5J2U E;  2R0C A;  1PBD A;  2E1M A;  2BRA A;  3LSV A;  2V7K A;  2E9X D;  3GMC A;  3AEA A;  3SY4 A;  4UF0 B;  4BJN A;  2WS3 A;  2BCG G;  2XM2 A;  3D1C A;  4OYJ A;  2LSY A;  3P4Q A;  4A6N A;  4O4H E;  4LF6 T;  2BA9 A;  2R45 A;  4JI2 T;  2XPK A;  4A7A A;  2AAQ A;  3T37 A;  1GOS A;  1DOD A;  4IRE A;  1ZMC A;  3LDQ B;  3CX7 B;  3P8C D;  3ZYX A;  2LRL A;  1TYT A;  2GR2 A;  2X9X A;  4OPG A;  3AB1 A;  4EQS A;  2YLS A;  4ANJ A;  5HXI A;  4FI5 A;  4NUV A;  1UK5 A;  4PNI A;  3M13 A;  3E08 A;  5AQH B;  2NP9 A;  1M7K A;  2VKJ A;  2WDR A;  4KBM B;  4AIU A;  1IJH A;  4B6X A;  2XFO A;  4BK3 A;  1JNZ A;  5ABH A;  3KPK A;  5DBJ A;  1ZK7 A;  1NHQ A;  2Y6X A;  4LF8 T;  3UU8 A;  3PO7 A;  4GCM A;  4UV8 B;  1SHZ C;  3ETU A;  3N5L A;  3DTO A;  3KLJ A;  4HE8 A;  5JRC B;  5AQO B;  2YG5 A;  3GRS A;  4CI2 B;  3AYL A;  1V59 A;  2BBJ A;  4Z26 A;  4RG3 A;  3HKB E;  1F8S A;  1JRX A;  4JI0 T;  4EMJ A;  3SZF A;  5FP3 A;  3CGC A;  3NH3 X;  1AJ3 A;  4ILU A;  3C51 A;  4UDQ A;  3I6D A;  2N2N A;  2Z6E A;  5FKY A;  5AQF B;  2FJE A;  2YLX A;  1G73 A;  1MIV A;  3GDP A;  4QX7 B;  5CA1 E;  4O2B E;  2WET A;  4CXW A;  2VWA A;  3WAK A;  4ZOL E;  3SYI A;  4BUR A;  4AQF A;  4QWN B;  4LF9 T;  2WBL A;  1E7P A;  1W0A A;  2MOZ A;  3T1H T;  2P9B A;  4HWF A;  2GRT A;  3K3O A;  3UUB A;  4NEW A;  2CA5 A;  1JRY A;  3EAM A;  3FG2 P;  4V1A v;  5KXJ A;  1HX8 A;  3NTD A;  1IJ5 A;  5JCM A;  4IDZ A;  4AT0 A;  3ZMS B;  2WES A;  5DQW A;  4CN6 A;  2YR4 A;  4Z24 A;  3VKH A;  3ETV A;  4MHC A;  4LII A;  3WE0 A;  3DA1 A;  4BA9 A;  1GET A;  1P2E A;  4FX9 A;  1LVK A;  5JDQ A;  4TNW A;  1S35 A;  3S4U A;  3H8I A;  3KVA A;  1H7X A;  5LOV E;  3LOV A;  1YW0 A;  2YOE A;  2KWI B;  2CDU A;  5JCL A;  5J2T E;  1XAN A;  4X1Y E;  3M3Z B;  4AKR B;  4YSX A;  1IBM T;  2Y8D A;  4YJ3 E;  2R0G A;  2WU2 A;  1ZOY A;  3SOL A;  4I43 B;  3EDU A;  2V6Y B;  3CIR A;  2WQY A;  3ATQ A;  2FUP A;  2Q0L A;  2XJ7 A;  4B68 A;  3DK9 A;  5M0Z A;  5ETW A;  2VQE T;  4AXP A;  3OVU A;  4DR1 T;  4U3C A;  4KI0 F;  2JK6 A;  2VB6 A;  1XDI A;  3L3P A;  3G06 A;  4ZI3 D;  2L8K A;  3PUV F;  2KWH A;  4IA6 A;  4ADW A;  1IZN B;  2XLU A;  4HA6 A;  1KF6 A;  1CJ3 A;  1HR0 T;  2BVL A;  4GKJ T;  2YLR A;  4H9P C;  3UTH A;  2YQU A;  1K0L A;  2M6I A;  1YKJ A;  2NR4 A;  2ZLY A;  2X8H A;  2NW9 A;  4GAP A;  3D0T A;  5FNV E;  3DP7 A;  4IE0 A;  2GK9 A;  2YDQ A;  2AXD S;  4EM3 A;  5AQN B;  1MMN A;  1FEW A;  5H6Q B;  4ADZ A;  5EB5 A;  5CA0 E;  2UUA T;  1XMQ T;  3PJA J;  1LPF A;  2IC6 A;  3DJD A;  5C2T A;  2C72 A;  3RKO A;  2JQ9 A;  4L9I A;  2J4G A;  2UXB T;  1FMV A;  1EL5 A;  2GAH B;  1FEA A;  3HL6 A;  4A56 A;  3QSE A;  4NUU A;  2Q7V A;  1RYI A;  3TLS A;  3IHM A;  5LGN B;  3C98 B;  4WCT A;  1FCD A;  1IUU A;  2BK5 A;  2JBV A;  4PFP A;  2EHO A;  4CI1 B;  2HPL A;  4BK1 A;  1Q1R A;  2QGS A;  3SZW A;  4EOZ B;  3GMI A;  2BS3 A;  2Z5X A;  5KVI A;  2WBA A;  5L46 A;  4XXG A;  3R9U A;  2Y6R A;  3EAB A;  4ZHQ E;  5FMN A;  4NEV A;  3OPC A;  1Z6L A;  2WP5 A;  4DV5 T;  4XZC A;  3GYX A;  2Q9Q C;  1BWC A;  3S61 A;  5LHI B;  2YLZ A;  4MAL A;  3IF8 B;  3LZX A;  4TM1 A;  3O0H A;  3A7M A;  4H9S E;  3B3R A;  3BNU A;  4H4R A;  4G6G A;  3Q5X A;  2WWU A;  2VL0 A;  3GRT A;  2PFV A;  3RYC E;  1JRZ A;  3QB5 A;  2RAB A;  5IQ4 A;  4DID B;  3EF6 A;  3ICR A;  4IA5 A;  1Q1W A;  3KV5 A;  1PBF A;  1LV0 A;  3N2G E;  2WOW A;  2X3N A;  3GN5 B;  2XFN A;  3F8P A;  3LJP A;  2LOP A;  3FZM B;  1FIO A;  3E0Z A;  2QAE A;  2AQJ A;  5LB7 B;  4C90 A;  4X65 T;  1L9E A;  5ABF A;  3LBX A;  4P0A A;  2XM1 A;  3UTK A;  2BBH A;  4Z2U A;  5A1L A;  5C8Y E;  3HKC E;  3P4P A;  1PBB A;  4H4U A;  3L8K A;  2ACZ A;  2IHR 1;  4H63 H;  4B66 A;  1P2H A;  4WX1 A;  2XUE A;  2X8G A;  3QFB A;  2DL1 A;  2H7O A;  1GES A;  2BXR A;  4J2C A;  4P0B A;  1GQE A;  4ZI2 C;  2B9Y A;  4COF A;  1OED B;  2XQ5 A;  4ZI2 D;  2H3R A;  1NG3 A;  2OV9 A;  3H8L A;  2VQ7 A;  3K3N A;  3EPT A;  5KDM C;  3EUH A;  4O2A E;  1BGN A;  1M6I A;  5KMQ A;  2X9Y A;  1BZL A;  4KHP T;  2B9X A;  4HTE A;  4B63 A;  4ZEY A;  2A8X A;  3V3N A;  2YU2 A;  4XWZ A;  4IST A;  2PG8 A;  1LQT A;  5FYM A;  1GRT A;  1RSG A;  4B69 A;  4IDO A;  1N34 T;  4NWZ A;  1FEC A;  3PUY F;  4U2L A;  1DOE A;  2QVA A;  5C3J A;  2CXF A;  5FXW A;  4XBF B;  1J1J A;  4Z8X A;  3UT5 E;  4EXT A;  3MZK B;  2Q9Q A;  3AYI A;  5E0O A;  3B6D A;  4ICY A;  2Y48 B;  4U8L A;  5KOW A;  1REO A;  3JC6 D;  3UP4 A;  1N36 T;  1WR0 A;  3BI4 A;  4AT2 A;  4C77 A;  1JEH A;  1XDO A;  2WDV A;  4LU6 A;  4JI4 T;  5F3J A;  3Q5E A;  4E0V A;  4Z2R A;  4J56 A;  5FVK A;  4PAG A;  4NPP A;  3PU8 A;  4HWH A;  3WAJ A;  5M10 A;  2CM0 A;  4I58 A;  1DU2 A;  5CFB A;  2I0M A;  2XLT A;  2WP9 A;  1AOG A;  4AI6 A;  1S94 A;  2HQM A;  1UX5 A;  4DV2 T;  3LK4 2;  4OPD A;  2H88 A;  5LHH B;  5LG4 A;  4DR3 T;  2VKD A;  3ONX A;  3NTA A;  4CNK A;  3NWI A;  4GUV A;  1US7 B;  2XCG A;  1D1C A;  1FJG T;  4X66 T;  4JN9 A;  2ZM0 A;  5EK4 A;  5BRT A;  2ODV A;  4H2Q A;  2VVS A;  2YU1 A;  4KMC A;  2X8C A;  5KMS A;  3K7M X;  4P9S A;  3VQR A;  3N2K E;  2IUB A;  1E39 A;  2CHO A;  3IBP A;  2JPF A;  2VVL G;  5JDF A;  1VCS A;  3QOF A;  5JCI A;  1DNC A;  3KBT A;  5DQV A;  2C65 A;  3CX6 B;  5FL1 A;  2UXN B;  2R4J A;  1T72 A;  3T2Z A;  2RP4 A;  5GON E;  1LTX R;  1BR4 A;  3RQW A;  5TAO A;  2XQY A;  4OPU A;  3AE3 A;  1HX1 B;  4EB6 E;  3VKG A;  1KK7 A;  4EV6 A;  2GV8 A;  1PJ6 A;  4H9N C;  3PUW F;  1UKV G;  4C74 A;  1LQU A;  3ZCJ A;  3AEC A;  2IML A;  3AE2 A;  3T31 A;  3IWA A;  4Q25 A;  3GYI A;  1V9D A;  5JRC A;  4BJM A;  2WB5 A;  2MPK A;  4GAV A;  4NTE A;  5U25 A;  3DJE A;  1HG5 A;  5EZY E;  2K48 A;  4OHF A;  2C64 A;  3CPJ G;  5HEG A;  4J36 A;  4U2S A;  2DLR A;  4BJZ A;  2HN1 A;  1G8X A;  1VG9 A;  1M64 A;  4U8I A;  3VU7 H;  1HFA A;  2JJ9 A;  1KFY A;  2ZMA A;  3ZCI A;  2XSB A;  4HKA A;  2JMK A;  3AA0 B;  3RIF A;  3ONL C;  4GYR A;  1YKE B;  5ABG A;  2XSA A;  3UKP A;  2GMH A;  2WOV A;  4II3 A;  2I59 A;  4G73 A;  2UU9 T;  1QO8 A;  2R9Z A;  3CML A;  5AQI B;  3KV6 A;  5CQF A;  2Y6Q A;  2WEU A;  2QCU A;  2R4E A;  2V7M A;  1ZEE A;  3GWF A;  4H4S A;  1WLX A;  2LM2 A;  2CBJ A;  5F8P A;  5JH7 E;  1ZOV A;  1N4W A;  3SXI A;  1XPQ A;  4UVA B;  3C4Z A;  1MMA A;  3ZMV B;  4K0K T;  1S2Y A;  4IL9 A;  3URH A;  3HKE E;  1MIW A;  2A3D A;  4IE5 A;  1K0J A;  4MLK A;  2XFU A;  4U8M A;  2E9X A;  2A2F X;  3CPI G;  2Z5Y A;  3HYV A;  1UUS A;  2BDE A;  3EI0 A;  1HYU A;  1E1N A;  4CBQ A;  3UKQ A;  3QSM A;  1I94 T;  1D1B A;  4DND A;  3JSK A;  3RHW A;  2GR1 A;  2XQA A;  3TLV A;  3N9L A;  3A8Y C;  2A87 A;  2AR8 A;  4M52 A;  4HWI B;  2L3L A;  2WDQ A;  1FOH A;  3IC9 A;  4KUM B;  4JNA A;  4PK4 A;  5FMH A;  1KNZ A;  1IUT A;  2EQ9 A;  1H86 A;  3P1W A;  2CFY A;  5H6R B;  2YDR A;  3UUL A;  3AE8 A;  3RRW A;  3I9W A;  3AB3 B;  3L39 A;  5AQL B;  4HFV A;  2XVI A;  4DMV A;  3JCF A;  5JDL A;  1W4X A;  3DJG X;  2JRK A;  3I9Y A;  2DI4 A;  3GMB A;  3RIU C;  4X20 E;  2C70 A;  1QUU A;  3SFE A;  4A65 A;  4A98 A;  2XFQ A;  2XVJ A;  5KOX A;  2M67 A;  4QKN A;  5HY5 A;  2HHH T;  2F5Z A;  1GRF A;  4Y4M A;  4EQW A;  2NPX A;  4PJM A;  2A9U A;  1NAA A;  1IUV A;  4UP3 A;  4JEH B;  4QH1 A;  3SS1 A;  4H4Z A;  2NWB A;  5AQV B;  2YWL A;  4U8K A;  4UEM A;  3RF1 A;  5BUL A;  2UXX B;  4TLZ A;  2QRX A;  3ZYL A;  3F8R A;  1D4C A;  5JVD E;  3IHG A;  3H4K A;  3P7I A;  5J60 A;  5J7X A;  3CVR A;  3GDN A;  4C5O A;  1CL0 A;  2C3C A;  1XNR T;  2WU5 A;  4DV1 T;  5IWA T;  3FPZ A;  4LML A;  1E1K A;  3BHK A;  3CMM A;  2RGH A;  3ICT A;  2SPC A;  2XLP A;  2C75 A;  2O9Z A;  4O5Q A;  4DR4 T;  3FBS A;  2VVN A;  2WMO A;  1VQW A;  2JAE A;  1T98 A;  1MXT A;  4A5X A;  2XVH A;  3ZT6 A;  1EZ3 A;  3ZDN A;  3NRX A;  1W9R A;  3N9P A;  3GWD A;  1H7C A;  2VRM A;  3NRY A;  3ZMT B;  1ZDL A;  4EIP A;  4HFI A;  2ODU A;  2J62 A;  3AA1 B;  4H4T A;  3CQC B;  1PN0 A;  2GB0 A;  3G5Q A;  1HTJ F;  3QUJ A;  3SX6 A;  3EVY A;  3ALL A;  1EL9 A;  4EEB A;  5IQ1 A;  4TZ4 C;  4CY6 A;  2DCF A;  3H37 A;  2X50 A;  3CNS A;  1E1H B;  2N9D A;  5JR9 C;  4EED A;  5LGT B;  1LVF A;  2YR6 A;  3BI2 A;  1CBO A;  3CGD A;  3AEF A;  3B5M A;  4Y4L A;  2C4C A;  2PJQ A;  3H3A A;  4TV9 E;  2BS2 A;  4DR5 T;  4GRT A;  4ZXL A;  3UKL A;  2GEW A;  1YY5 A;  3VHL A;  2V5Z A;  3ESL A;  4AP1 A;  3ZJ1 A;  4OPT A;  2GF3 A;  2IAK A;  3AXJ A;  3MJX A;  3PUQ A;  1E6E A;  5HYM A;  3ISH A;  5EK2 A;  4TM4 A;  5BVA A;  1XMO T;  4EZH A;  2PTF A;  5FXX A;  2XQ7 A;  1F8W A;  4JI7 T;  4ILB A;  4UV9 B;  4IIJ E;  3NK0 X;  4UIG A;  4J2W A;  2XVF A;  4Y4N A;  2V26 A;  2E4G A;  4ERR A;  5EK3 A;  3CN8 A;  4EAH A;  3UU5 A;  2IIU A;  1Q9I A;  3D8X A;  3DK8 A;  4YSH A;  2GVC A;  4FK1 A;  3P4W A;  2CWO A;  3U78 A;  1GRA A;  5BMV E;  2OA1 A;  2YN6 A;  2MBG A;  3ZYM A;  3V5S A;  2NW8 A;  4K7Z A;  1YQ4 A;  3DH9 A;  4JY3 A;  4G6H A;  2WM9 A;  4L0R A;  2A72 A;  2PYX A;  4YTM A;  1DOC A;  3UOZ A;  2E5L T;  3LBX B;  4UXN B;  2Q6U A;  1SA0 E;  3N9M A;  1H83 A;  2OLO A;  4NTD A;  1GT8 A;  2WP6 A;  2XZE A;  3BQL A;  2D9D A;  3RED A;  4AKH A;  2WY2 A;  3CTY A;  4DV3 T;  3H3M A;  3ZT7 A;  1N1P A;  3PDY A;  2BC1 A;  2NW7 A;  2VL8 A;  2WPF A;  3V76 A;  1B5Q A;  1PBC A;  3V3O A;  3M12 A;  2WMN A;  5JDG A;  3O4X E;  4K22 A;  4G2A A;  3SZ0 A;  2R0P A;  1BR0 A;  4EIW A;  5LGU B;  4ZCD A;  4JQ9 A;  5AFU L;  5FS6 A;  1COY A;  1D0X A;  2LSJ A;  3TLT A;  4JYA T;  3EAO A;  4ZCC A;  2X51 A;  4GOU A;  4DO0 A;  4CZZ B;  3PE0 A;  5AQJ B;  5KRQ A;  3QB5 K;  2Q0K A;  1H7W A;  2NTX A;  1H6V A;  3I3L A;  2WPE A;  3SFD A;  4IE7 A;  2MAW A;  1FMW A;  3SQP A;  4B65 A;  4D04 A;  3CNT A;  2YG6 A;  1T7S A;  3MXZ A;  4TUY E;  4YTN A;  3PJA A;  1E1M A;  4CCQ A;  3KV9 A;  4B3R T;  5KMG P;  2CVJ A;  2WAU A;  1XZY A;  3P50 A;  2VQF T;  1OXZ A;  5FXV A;  1TRB A;  2W66 A;  3AD7 B;  4NZH A;  4I50 E;  1JU2 A;  1R8I A;  3TKL B;  3UUX B;  3LB8 A;  1GEU A;  3PTR B;  3T0K A;  1OED A;  3NG7 X;  3RIA A;  4EMI A;  3DJJ A;  5DAB A;  4EIQ A;  2ZBW A;  3N9Q A;  3ZC1 A;  1ZKQ A;  3I1A A;  5FXZ A;  1YQ3 A;  3UOY A;  2OLN A;  1TYP A;  1WFD A;  1ZY8 A;  1TDE A;  3NYE A;  3CX8 B;  4HN9 A;  3WI3 A;  5ABE A;  1NWM X;  4H2P A;  4U7I A;  4C91 A;  4U8O A;  2BXS A;  4EQX A;  2CCQ A;  1RP0 A;  2YDS A;  3LXD A;  1D1A A;  1EBD A;  3AE9 A;  1CUN A;  2EQ7 A;  3OYZ A;  1XDP A;  3CQX C;  4DV7 T;  2ZZC A;  3W15 B;  1GRH A;  1VG0 A;  5L3G B;  4E7Z A;  4K5R A;  1QJD A;  3Q9T A;  2VKH A;  4TM0 A;  4C3X A;  3N9O A;  3UTE A;  4JEU B;  1NEK A;  1Y56 A;  2UZZ A;  1MNE A;  1XHC A;  1MND A;  5JCK A;  3LG7 A;  4UVC B;  3ZMZ B;  2CXL A;  3VRA A;  2BS4 A;  4IHJ E;  2G0U A;  3B13 A;  2OAM A;  3CNP A;  2ACX A;  5LJN A;  1U5P A;  1O95 A;  2V6O A;  4IGU A;  3PUG A;  3ZEF B;  3KIN B;  5L3E B;  4DGK A;  5HXH A;  2OLT A;  5AQU B;  3FMW A;  3ZLI A;  3KKJ A;  4GDE A;  4K5S A;  1F3P A;  4OK0 A;  3L09 A;  1N4U A;  4PAB A;  4YSY A;  3MA9 A;  5JRE A;  4PK5 A;  2X67 A;  4J34 A;  4OCG A;  4HB9 A;  4AOS A;  3UTF A;  4PJJ A;  3UCL A;  2YKS A;  2V6X A;  4ZS2 A;  5LBQ B;  2H7V C;  5HWY A;  3AAI A;  2CPT A;  3CQG B;  2QA1 A;  3IHR A;  2CHN A;  1OWA A;  4QH5 A;  2XDO A;  4GKK T;  3KU9 A;  2LE8 A;  1PBE A;  3RKG A;  2BKN A;  4GYS A;  1KEY A;  1NHR A;  4H7U A;  3G5R A;  3K1S A;  3KFW X;  2XAQ B;  3AAE B;  2LKG A;  2LSK A;  4A5L A;  4DSG A;  1EL8 A;  3JAE A;  3AYJ A;  2A89 A;  4UF0 A;  2VKO A;  2JB2 A;  3RRC A;  4X9N A;  2KND A;  2FJA A;  1PS9 A;  1LVL A;  4RSL A;  5JDH A;  1GTH A;  4JNQ A;  5LG3 A;  4ZZB A;  5GSN A;  4U72 A;  2LM9 A;  2BAC A;  3AED A;  4AQG A;  2B9W A;  4UR9 A;  3FHN A;  5HHF A;  2VOU A;  3AE7 A;  1PHH A;  3AXB A;  1H84 A;  3CND A;  5L2L A;  2EHO C;  1Y0P A;  3DK4 A;  4TLX A;  3AE5 A;  3DJB A;  1CJ4 A;  1D7Y A;  2V8S V;  5HCJ A;  5AQR B;  4CRT A;  3A5X A;  2LSI A;  4TX5 A;  3NZQ A;  4TWH A;  4EYY R;  2VVM A;  4PJL A;  4DV6 T;  4YXD A;  3DGH A;  2YG3 A;  2BKP A;  4YJ2 E;  2LHR A;  2C76 A;  3I0O A;  3RPU A;  1WYB A;  1BGJ A;  1BF3 A;  3HYX A;  4CCR A;  3ANW B;  3M65 A;  4H63 V;  2XAF B;  3K30 A;  4A6N B;  2NVK X;  5IYZ E;  2K24 A;  5LV9 A;  3JAF A;  2JMH A;  2V7I A;  4WYV A;  1Y01 A;  1J5E T;  3QK6 A;  1NDA A;  4OPC A;  5L3B B;  1VOM A;  3ZC0 A;  5KVH A;  4JLE A;  3CKD A;  4ILA A;  2V60 A;  2XHE B;  2WHD A;  4X4J A;  1KDG A;  4U7Y A;  2K9A A;  3JAD A;  2ZZ0 A;  5LMN T;  3F57 A;  5J1G A;  1HS7 A;  2K5B B;  3OC4 A;  5HAX A;  4C3Y A;  4REK A;  3RP7 A;  3O1I A;  2ES0 A;  1GAL A;  3AAA B;  1XWM A;  3IEE A;  3II4 A;  4B3T T;  3NNE A;  2GQW A;  1U4Q A;  4CN1 A;  2YVF A;  1B8S A;  2LHN A;  2BG9 E;  2DNX A;  2Q9Q D;  4M1P A;  1OJ9 A;  1T8B A;  2B76 A;  4IE4 A;  4DVD A;  3IF9 A;  5LXT E;  1KSS A;  3L8R A;  5KX5 E;  1XNQ T;  2CMR A;  2WWV A;  2B7S A;  2V1D B;  4WBN E;  4HFE A;  3O1H A;  2BG9 C;  5HYA A;  3DGZ A;  2LLY A;  1LKX A;  2GH5 A;  4B3S T;  2XFP A;  4J57 A;  5CGM A;  4U2Y A;  3I0Q A;  4IE6 A;  2KMF A;  2KSR A;  4DBQ A;  4U74 A;  4ZI7 E;  2GMJ A;  2QA7 A;  4D03 A;  5FS7 A;  3AE1 A;  2X0L B;  5IUX A;  2EQ6 A;  4U8J A;  2UXC T;  5LP6 E;  3UP5 A;  4Z25 A;  2YM2 A;  3QVP A;  2IDO B;  2X9W A;  5AQS B;  1YQZ A;  1I6Z A;  1K0I A;  2XQ6 A;  3UQ7 A;  1VDC A;  5F5W A;  2XAS B;  1JOA A;  1KSU A;  3ZT5 A;  4II2 A;  1WR6 A;  1TDN A;  2C67 A;  3FZH B;  4DBR A;  3CNJ A;  3T2K A;  1MOK A;  5FY7 A;  3AE4 A;  2HN2 A;  3M0O A;  5LJM A;  5FL0 A;  5AQG B;  5HEH A;  4DR2 T;  5GRT A;  3MKD A;  3T8O A;  3PV0 F;  1D4D A;  2WZI A;  3Q6J A;  3EHZ A;  2IC9 A;  4YKG A;  2QYW A;  4B67 A;  3HR0 A;  2LT3 A;  1JNR A;  3COX A;  1OJD A;  3AD8 B;  3NLC A;  3UU6 A;  2X68 A;  4KPR A;  3RQU A;  1CC4 A;  1DOB A;  3HA4 A;  3ZYK A;  4AIS A;  3NN6 X;  3S5W A;  2D0T A;  4IDP A;  4G63 A;  3RC3 A;  3K8P C;  3LJC A;  3QVR A;  1F8R A;  4IDQ A;  4H4W A;  3UFG A;  2ZM2 A;  4U33 A;  4JI1 T;  2BYB A;  2C5K T;  2W62 A;  1IUX A;  5JTG A;  2DHR A;  4LFA T;  4U2Z A;  3SM8 A;  4OYK A;  3ZMU B;  3OTO T;  1O3X A;  4IVO B;  2AE9 A;  2K3W A;  3KPF A;  4QXC B;  4A9W A;  3VRD B;  4O4J E;  5KMP A;  1CC2 A;  1LJ1 A;  4GDP A;  2W67 A;  3PUX F;  3T1Y T;  1GSN A;  2C5I T;  4NIQ A;  4U31 A;  3UFE A;  5LHG B;  4F6R C;  5LMU T;  3MAC A;  1UUR A;  3NVO A;  1EL7 A;  2YLT A;  4HEA A;  1VCT A;  1YKH B;  4CN4 A;  4FDC B;  5ER0 A;  1D5T A;  1IJ6 A;  4XAX B;  4O4L E;  2VQB A;  4UDP A;  4LF4 T;  5ABF B;  1PXC A;  1SEZ A;  3C64 A;  2C7G A;  4WBO A;  1GRG A;  4QH4 A;  4AP3 A;  4H4Q A;  4JI6 T;  3MK7 C;  4H9O C;  4CXY A;  1CC6 A;  1B37 A;  3Q5W A;  1NAF A;  2LEH A;  4QXH B;  4AQY T;  3RIU A;  4I4T E;  3ZJ2 A;  4Z90 A;  3UQ4 A;  4OVI A;  2C0S A;  1ZMD A;  3KVE A;  2B7R A;  1OJT A;  1IAP A;  5BUK A;  3UKF A;  4I59 A;  3R6N A;  4DMW A;  5L3F B;  4ECH A;  5HEU A;  1ELI A;  3OBV E;  4J31 A;  2V61 A;  4IT4 A;  4WZX A;  2C5J A;  4ZZC A;  2RPA A;  3GA8 A;  2X0Y A;  1N32 T;  4RG4 A;  3GN5 A;  1K4Q A;  1MO9 A;  2UUC T;  3FBL A;  4UDR A;  2CLY C;  2W2U A;  2UUB T;  3RP8 A;  3RC8 A;  5LYJ E;  3UU3 A;  5HXR A;  3J9X 1;  4ZN0 A;  5CJ5 A;  4AKL A;  1MMG A;  5HWX A;  2CUL A;  4O8S A;  4H50 A;  1OED E;  4NXM T;  4NTC A;  4TN7 B;  1W0B A;  1ZHC A;  4YSZ A;  3NGC X;  3Q5D A;  3PUA A;  2VVL A;  5KWF A;  1S3E A;  4X9M A;  1WYC A;  2LRK A;  5L3C B;  4AKI A;  5ADX L;  2JKC A;  1DXL A;  1GV4 A;  4Z91 A;  3FB2 A;  4IL4 A;  4YY3 T;  2GQF A;  3N9N A;  3P4S A;  3NKS A;  2DWG A;  1HF8 A;  1SE7 A;  3LK2 B;  2LJL A;  3F8D A;  1HNX T;  1UX4 A;  4X1I E;  4N9X A;  1IBL T;  3AWI A;  1CHU A;  3UOX A;  3QFA A;  1NHP A;  4HFC A;  2QA2 A;  2YG4 A;  2CEA A;  4CI3 B;  4U2T A;  1W09 A;  2I6H A;  3GD4 A;  2W0G A;  2DKH A;  1ZP0 A;  5JR9 A;  5J0Z A;  4CY8 A;  2YIN A;  2DKI A;  4P09 A;  1HCI A;  2XQ9 A;  4JBW F;  2V5C A;  4X1K E;  4B64 A;  3FZK B;  2XLR A;  3NKZ A;  3K7Q X;  1IUW A;  3RYF E;  5L3D B;  2E9X C;  2BC0 A;  2BVM A;  3AEB A;  1S3B A;  2FJB A;  1BR1 A;  2YVG A;  3FBZ A;  1PDH A;  2NOX A;  4DSH A;  2VZ2 A;  5JCN A;  1WRD A;  2RGJ A;  4GF7 A;  2ARD A;  4K8D A;  2V3B A;  4NXN T;  3BI5 A;  3KBU A;  4MBQ A;  3O9X A;  4F8H A;  4BAY B;  3UOV A;  1IUS A;  3Q2M A;  5M4Y A;  2IID A;  4WNK A;  4Z44 A;  3KVB A;  1NEN A;  2XYO A;  3QSS A;  4O4I E;  3QNU A;  2PBI A;  4AQF C;  3TLU A;  1PXB A;  2IVE A;  2MTQ A;  2BKO A;  4A97 A;  1GPE A;  4O5U A;  4TM3 A;  2XQ4 A;  2CLY B;  3BQI A;  5IHY A;  1X79 A;  4QHO A;  3OZ2 A;  5LNK A;  4DV0 T;  4L5G A;  2ZM8 A;  3RLF F;  1VRQ B;  1MMD A;  2J3N A;  3AVR A;  4DR6 T;  1NPX A;  4X62 T;  2BG9 A;  3NBX X;  2VUR A;  2BRY A;  4JDR A;  4B3M T;  1J5W A;  3NT6 A;  3SRZ A;  1L9C A;  3NHO X;  2JB3 A;  2JB1 A;  2W61 A;  5LBM A;  1Z0P A;  2XY8 B;  4DUZ T;  4H2N A;  3RX6 A;  2YLW A;  2EHO D;  3SZC A;  1YD8 G;  4PW8 A;  5EB4 A;  2BAB A;  3O1J A;  3NRN A;  5TR3 A;  4H9R C;  2R6G F;  3CPZ A;  2JQH A;  4A99 A;  5HEO A;  5KNL A;  2JQK A;  4UEL A;  3GSI A;  1OED C;  1N33 T;  1SUM B;  1ZKE A;  2YG7 A;  4HGA A;  1MIY A;  1Y64 B;  4KHZ F;  3TLW A;  3NYF A;  2R46 A;  3T14 A;  2MYS A;  2XAG B;  4HFD A;  5FVL A;  3AVS A;  3SWH A;  4B1B A;  5HXE A;  4HFH A;  4PAA A;  1GRB A;  4AOX A;  1HNZ T;  4JUY A;  5HEJ A;  3CK6 A;  2IVD A;  3CPH G;  2BCP A;  4CNJ A;  3C4X A;  4TV8 E;  1BKW A;  2X0H A;  1FEB A;  5U1O A;  3J7Y q;  4JY2 A;  1NHS A;  5AQP B;  1GRE A;  3FXE B;  4DR7 T;  2KLQ A;  4EYU A;  3NIX A;  4EGW A;  4HFB A;  4YTP A;  5L4H A;  4ISS A;  4BK2 A;  2B1E A;  4X64 T;  4TWD A;  1TDO A;  2YK0 A;  5CKU A;  3RNM A;  2BK4 A;  4ILC A;  4EM4 A;  2XTL A;  1UCU A;  3HKD E;  1OJA A;  2APG A;  2BZB A;  2CE7 A;  3VRB A;  5U63 A;  1TDF A;  4JV5 T;  5FS9 A;  1X31 B;  4GK5 E;  4PFO A;  5BR8 T;  3FXD B;  3ZN1 B;  1QLB A;  2V7L A;  4JI3 T;  5HXC A;  5JR9 B;  5AQQ B;  3L1R A;  4H2R A;  4YWO A;  2KXP B;  1UGO A;  4YLH A;  3PS9 A;  3CGB A;  3KDS E;  4PJN A;  2GR0 A;  2KIN B;  4Z43 A;  4G74 A;  4XWR A;  4YFS A;  2VK9 A;  4CQI A;  2ZM6 T;  4Z2T A;  4H4X A;  3R84 B;  3UKH A;  3RYH E;  1GER A;  4K0U A;  4HWC A;  1GXF A;  5LCY A;  1HG2 A;  4FK1 C;  2W63 A;  1HNW T;  4GIW A;  4HWD A;  3K7T A;  4YKF A;  1VRB A;  2X9H A;  3SGL A;  3LZW A;  4MFR A;  3CWZ B;  2CRB A;  2TPR A;  3ZN0 B;  3FZF B;  4K2X A;  3KD9 A;  5FY1 A;  1H81 A;  1B4V A;  4EZ4 A;  2C73 A;  1WCR A;  3FIM B;  2V6Y A;  3CGE A;  4J33 A;  1IBK T;  3F2E A;  2V5D A;  4YHJ A;  1E1L A;  2D0U A;  4OFZ A;  2KT9 A;  5HCM A;  4X5T A;  4APN A;  2Q9Q B;  4P1N A;  4USQ A;  4G9K A;  2PHH A;  3AE6 A;  2YR5 A;  3AA6 B;  3C96 A;  1DJQ A;  3PUZ F;  4H9Q C;  2XLS A;  2FJD A;  3FZL B;  3DME A;  3AEG A;  1TDK A;  1D7L A;  3JC6 C;  4QX8 B;  2C66 A;  1PXA A;  1Y56 B;  4BJY A;  1LRZ A;  2I0Z A;  5L47 A;  2XQ3 A;  3NZP A;  3BQK A;  3ZSS A;  1FL2 A;  3X1D A;  3IA3 A;  3EAN A;  4H4Y A;  3BNM A;  4LMK A;  4E7S A;  4I0U A;  1D0Z A;  1B7T A;  2LOS A;  4OX9 T;  3ALJ A;  3RP6 A;  1N4V A;  3VR9 A;  3UUN A;  2WZH A;  3QJ4 A;  4YHH T;  2GAG B;  1CF3 A;  2XAH B;  4LF7 T;  2BK3 A;  2W4X A;  3NN0 X;  1PJ5 A;  4GK0 E;  3EDV A;  4LFB T;  2OA5 A;  3C50 A;  4DNA A;  2WPC A;  2D2S A;  2JQQ A;  3AD9 B;  4LA1 A;  2X66 A;  4MJW A;  4NNJ A;  2EQ8 A;  1GND A;  1M62 A;  1Z8U A;  4YT0 A;  3NK2 X;  1D4E A;  5JDN A;  2LFC A;  1L9D A;  5FY0 A;  1ONF A;  1OJC A;  3RYI E;  3ZPO A;  3ATR A;  3C4W A;  4GR1 A;  5AQM B;  5AQT B;  2TMD A;  1GTE A;  1X9B A;  2ZZB A;  2WCA A;  3VR8 A;  3K3Q C;  4IVM B;  4JI8 T;  3N2O A;  3RI5 A;  4TNV A;  2IW5 B;  2HPJ A;  3P9U A;  3NK1 X;  4IV9 A;  1H82 A;  4UVB B;  2V3A A;  3BK9 A;  2D5U A;  4KP3 C;  3ITJ A;  4LF5 T;  3ADA B;  3GWH A;  3HYW A;  4TWF A;  2H89 A;  3LFM A;  5FS8 A;  3ZST A;  4EMW A;  2XAJ B;  2M6B A;  3C4A A;  3ANW A;  4ASK A;  4USR A;  3ONJ A;  1YXR A;  2VRL A;  3BHF A;  2YEV C;  4BV6 A;  2CBI A;  2F4V T;  2YVJ A;  4A79 A;  3GD3 A;  5JDM A;  3AEE A;  3UKK A;  1O5W A;  2J47 A;  2J1D G;  4QXB B;  3GYJ A;  2E2A A;  3HZL A;  3RHA A;  3ABV A; 
#chains in the Genus database with same CATH homology
 1F6M A;  3EPT A;  2CUL A;  3PVC A;  1CJ2 A;  1M6I A;  1BGN A;  3NYC A;  5KMQ A;  4YTN A;  1BZL A;  4H50 A;  1E1M A;  4H4P A;  2B9X A;  4CCQ A;  4NTC A;  1PJ7 A;  4B63 A;  2A8X A;  3V3N A;  2CVJ A;  4YSZ A;  4XWZ A;  3NGC X;  1LQT A;  1RSG A;  1GRT A;  1ZX9 A;  2VVL A;  4B69 A;  4NWZ A;  5KWF A;  1FEC A;  1TRB A;  3AD7 B;  1S3E A;  4NZH A;  1DOE A;  4U2L A;  5C3J A;  1JU2 A;  3LB8 A;  4X9M A;  2XVE A;  1GEU A;  3T0K A;  3ALM A;  3NG7 X;  2JKC A;  3DJJ A;  4EMI A;  1DXL A;  4OPL A;  4EIQ A;  2ZBW A;  3ICS A;  2FBW A;  1GV4 A;  3T2Y A;  4U8P A;  2YAU A;  3AYI A;  2E5V A;  3B6D A;  4ICY A;  4U8L A;  1ZKQ A;  5EOW A;  1REO A;  3UP4 A;  5KOW A;  2GQF A;  3BI4 A;  3UOY A;  1YQ3 A;  3P4S A;  3NKS A;  4AT2 A;  2OLN A;  1KNP A;  1TYP A;  3KA7 A;  1JEH A;  4C77 A;  2WDV A;  4LU6 A;  1ZY8 A;  3F8D A;  5IPY A;  1TDE A;  3NYE A;  4H2P A;  1DJN A;  4N9X A;  3AWI A;  1CHU A;  3UOX A;  1S2Q A;  1NHP A;  3QFA A;  4E0V A;  4J56 A;  4Z2R A;  2QA2 A;  2YG4 A;  4U8O A;  2RGO A;  2BXS A;  4EQR A;  4U2T A;  4EQX A;  5M10 A;  1RP0 A;  3GD4 A;  3LXD A;  2DKH A;  1ZP0 A;  4I58 A;  1EBD A;  3AE9 A;  2EQ7 A;  2XLT A;  4CY8 A;  2WP9 A;  3G5S A;  1CJC A;  3UKA A;  1AOG A;  4H4V A;  2DKI A;  4U8N A;  2HQM A;  4B64 A;  3P4R A;  2XLR A;  2H88 A;  3C4N A;  4OPD A;  2ZZC A;  1NG4 A;  3K7Q X;  1GRH A;  1IUW A;  1VG0 A;  4K5R A;  2BC0 A;  1QJD A;  3AEB A;  3LAD A;  1S3B A;  2FJB A;  1O94 A;  2W0H A;  2YVG A;  3NTA A;  3Q9T A;  4CNK A;  4TM0 A;  3E1T A;  4GUV A;  4C3X A;  1PDH A;  2XCG A;  3UTE A;  1NEK A;  1Y56 A;  4KX6 A;  4DSH A;  1L0V A;  2VZ2 A;  4JN9 A;  5JCN A;  2UZZ A;  2GR3 A;  4OPI A;  2RGJ A;  1XHC A;  4GF7 A;  5BRT A;  1KNR A;  4H2Q A;  5JCK A;  2ARD A;  2X8C A;  5KMS A;  2C3D A;  3K7M X;  4P9S A;  3VQR A;  3VRA A;  2BS4 A;  1E39 A;  2V3B A;  4K8D A;  3BI5 A;  2X99 A;  2OAM A;  3CNP A;  2WOI A;  3UTG A;  1O95 A;  2VVL G;  2OAL A;  2V6O A;  5JCI A;  3UOV A;  1DNC A;  2C65 A;  1IUS A;  2IID A;  2YM1 A;  2R4J A;  4Z44 A;  3T2Z A;  1NEN A;  2XYO A;  4DGK A;  1LTX R;  3QSS A;  5KMR A;  5EBK A;  3FMW A;  2R0C A;  3KKJ A;  1PXB A;  1PBD A;  2E1M A;  2BRA A;  4GDE A;  2IVE A;  4K5S A;  3GMC A;  4OPU A;  1F3P A;  3AE3 A;  3AEA A;  3SY4 A;  1N4U A;  4PAB A;  1GPE A;  2WS3 A;  4YSY A;  4O5U A;  2GV8 A;  1PJ6 A;  2BCG G;  3D1C A;  4J34 A;  1UKV G;  4C74 A;  1LQU A;  4TM3 A;  3AEC A;  4OCG A;  4HB9 A;  3AE2 A;  3T31 A;  3OZ2 A;  3IWA A;  3GYI A;  4AOS A;  3P4Q A;  3UTF A;  4A6N A;  2BA9 A;  3UCL A;  4GAV A;  2R45 A;  4NTE A;  5U25 A;  3DJE A;  2QA1 A;  1VRQ B;  4A7A A;  2AAQ A;  3T37 A;  2J3N A;  1GOS A;  1DOD A;  1NPX A;  2C64 A;  3CPJ G;  1ZMC A;  2XDO A;  4U2S A;  3KU9 A;  4J36 A;  4BJZ A;  1PBE A;  3ZYX A;  2BRY A;  1NHR A;  1TYT A;  1VG9 A;  4H7U A;  4JDR A;  1M64 A;  3G5R A;  3NT6 A;  2GR2 A;  4U8I A;  4OPG A;  1L9C A;  3NHO X;  3AB1 A;  4EQS A;  2YLS A;  1KFY A;  2JB3 A;  4A5L A;  5HXI A;  2JB1 A;  4DSG A;  1EL8 A;  4H2N A;  2YLW A;  3M13 A;  3AYJ A;  2A89 A;  3SZC A;  5EB4 A;  2BAB A;  2JB2 A;  3UKP A;  4X9N A;  2FJA A;  1PS9 A;  1LVL A;  2GMH A;  2WOV A;  3NRN A;  4II3 A;  4RSL A;  5TR3 A;  2WDR A;  1GTH A;  4G73 A;  4JNQ A;  5GSN A;  1IJH A;  1QO8 A;  2R9Z A;  2XFO A;  4A99 A;  4BK3 A;  5CQF A;  2Y6Q A;  1JNZ A;  2BAC A;  2QCU A;  2WEU A;  2R4E A;  3AED A;  3KPK A;  5KNL A;  3GWF A;  4H4S A;  5DBJ A;  1ZK7 A;  3GSI A;  1NHQ A;  2B9W A;  1ZOV A;  1N4W A;  3PO7 A;  1XPQ A;  3SXI A;  2YG7 A;  4GCM A;  5HHF A;  2VOU A;  3NYF A;  3AE7 A;  3KLJ A;  1PHH A;  1S2Y A;  3AXB A;  2R46 A;  1H84 A;  3T14 A;  3CND A;  3URH A;  1Y0P A;  2YG5 A;  3GRS A;  3AYL A;  3DK4 A;  4B1B A;  4TLX A;  3AE5 A;  1K0J A;  2XFU A;  1CJ4 A;  4U8M A;  1D7Y A;  3CPI G;  1V59 A;  4PAA A;  4Z26 A;  1GRB A;  4RG3 A;  4AOX A;  4CRT A;  2Z5Y A;  3HYV A;  2IVD A;  3CPH G;  2BCP A;  1F8S A;  1JRX A;  4CNJ A;  1HYU A;  1E1N A;  4CBQ A;  3UKQ A;  2VVM A;  3QSM A;  1BKW A;  1FEB A;  4YXD A;  4EMJ A;  3DGH A;  5U1O A;  2YG3 A;  3SZF A;  3CGC A;  3NH3 X;  4JY2 A;  2C76 A;  1NHS A;  1GRE A;  3JSK A;  4UDQ A;  3NIX A;  3I6D A;  1BGJ A;  2GR1 A;  1BF3 A;  4YTP A;  2A87 A;  3HYX A;  2FJE A;  2AR8 A;  4M52 A;  2YLX A;  4CCR A;  3GDP A;  2WDQ A;  1FOH A;  4BK2 A;  3K30 A;  3IC9 A;  4A6N B;  4JNA A;  1TDO A;  5FMH A;  2WET A;  2NVK X;  1IUT A;  5CKU A;  3RNM A;  2BK4 A;  2EQ9 A;  1H86 A;  5LV9 A;  3P1W A;  4EM4 A;  2CFY A;  3SYI A;  4BUR A;  1OJA A;  2APG A;  3VRB A;  5U63 A;  3AE8 A;  1NDA A;  1TDF A;  1E7P A;  4OPC A;  5FS9 A;  1X31 B;  2XVI A;  5KVH A;  2GRT A;  1W4X A;  2V60 A;  3DJG X;  1QLB A;  2WHD A;  4NEW A;  1JRY A;  4X4J A;  3GMB A;  1KDG A;  3FG2 P;  2ZZ0 A;  5KXJ A;  2C70 A;  3SFE A;  3NTD A;  3L1R A;  5JCM A;  4H2R A;  4A65 A;  3OC4 A;  4YWO A;  4AT0 A;  2XFQ A;  4C3Y A;  2XVJ A;  4REK A;  3PS9 A;  5KOX A;  3CGB A;  2WES A;  3RP7 A;  2YR4 A;  4Z24 A;  5HY5 A;  1GAL A;  2GR0 A;  4Z43 A;  4G74 A;  3II4 A;  2F5Z A;  3NNE A;  2GQW A;  1GRF A;  4XWR A;  4Y4M A;  2YVF A;  4EQW A;  1B8S A;  2NPX A;  1NAA A;  1IUV A;  4LII A;  1OJ9 A;  3DA1 A;  1GET A;  4UP3 A;  3WE0 A;  4H4Z A;  1P2E A;  4FX9 A;  4Z2T A;  2YWL A;  2B76 A;  4H4X A;  3IF9 A;  4U8K A;  1KSS A;  3UKH A;  5BUL A;  3H8I A;  4TLZ A;  1GER A;  2B7S A;  1GXF A;  1H7X A;  3F8R A;  1D4C A;  4FK1 C;  3LOV A;  3IHG A;  3K7T A;  3H4K A;  2CDU A;  4YKF A;  5JCL A;  3DGZ A;  1XAN A;  3SGL A;  3LZW A;  5J60 A;  2TPR A;  4YSX A;  5J7X A;  2GH5 A;  2XFP A;  4J57 A;  3GDN A;  4K2X A;  4C5O A;  1CL0 A;  2R0G A;  2WU2 A;  2C3C A;  1ZOY A;  3KD9 A;  2WU5 A;  3FPZ A;  1H81 A;  1B4V A;  1E1K A;  2GMJ A;  2C73 A;  3BHK A;  4D03 A;  3CMM A;  5FS7 A;  2RGH A;  3AE1 A;  3FIM B;  3ICT A;  3CIR A;  2EQ6 A;  4U8J A;  3CGE A;  2WQY A;  2XLP A;  4J33 A;  3ATQ A;  2C75 A;  2O9Z A;  4O5Q A;  3FBS A;  3UP5 A;  2Q0L A;  4Z25 A;  2JAE A;  1E1L A;  1VQW A;  4B68 A;  2YM2 A;  3DK9 A;  3QVP A;  1YQZ A;  5M0Z A;  1MXT A;  1K0I A;  1VDC A;  4APN A;  2XVH A;  3ZDN A;  1JOA A;  1KSU A;  4USQ A;  4II2 A;  1TDN A;  2JK6 A;  3GWD A;  2C67 A;  2PHH A;  4G9K A;  1XDI A;  3CNJ A;  3T2K A;  1MOK A;  3AE6 A;  2YR5 A;  2VRM A;  1ZDL A;  3AE4 A;  4IA6 A;  4ADW A;  3M0O A;  4EIP A;  3C96 A;  2XLU A;  1DJQ A;  4HA6 A;  1KF6 A;  4H4T A;  1CJ3 A;  2YLR A;  5GRT A;  2XLS A;  2YQU A;  2FJD A;  1K0L A;  3UTH A;  1PN0 A;  1YKJ A;  3DME A;  3AEG A;  1D4D A;  2X8H A;  2GB0 A;  1TDK A;  4GAP A;  1D7L A;  3G5Q A;  3Q6J A;  4YKG A;  3SX6 A;  3ALL A;  4B67 A;  1EL9 A;  5IQ1 A;  2C66 A;  4CY6 A;  1JNR A;  1PXA A;  3COX A;  1Y56 B;  1OJD A;  4BJY A;  3AD8 B;  3NLC A;  2I0Z A;  2X50 A;  4EM3 A;  4KPR A;  3CNS A;  5EB5 A;  1CC4 A;  1DOB A;  1LPF A;  1FL2 A;  3NN6 X;  3DJD A;  5C2T A;  2YR6 A;  3EAN A;  3BI2 A;  3S5W A;  2C72 A;  1CBO A;  3CGD A;  3AEF A;  3BNM A;  4H4Y A;  4Y4L A;  2C4C A;  3QVR A;  2BS2 A;  1F8R A;  4GRT A;  2GAH B;  1EL5 A;  4H4W A;  1FEA A;  3UKL A;  2GEW A;  1YY5 A;  3ALJ A;  3QSE A;  3RP6 A;  2Q7V A;  1N4V A;  1RYI A;  3IHM A;  2V5Z A;  2BYB A;  1IUX A;  4WCT A;  1FCD A;  4AP1 A;  1IUU A;  2BK5 A;  3VR9 A;  4OPT A;  2JBV A;  2GF3 A;  1E6E A;  5HYM A;  3SM8 A;  4IVO B;  4BK1 A;  3QJ4 A;  3ISH A;  3KPF A;  2GAG B;  1Q1R A;  4TM4 A;  1CF3 A;  4A9W A;  5BVA A;  3VRD B;  3SZW A;  2BS3 A;  2BK3 A;  2Z5X A;  3NN0 X;  1PJ5 A;  5KVI A;  1F8W A;  5KMP A;  2WBA A;  5L46 A;  4XXG A;  1CC2 A;  3NK0 X;  3R9U A;  2Y6R A;  4J2W A;  4DNA A;  2WPC A;  1LJ1 A;  4GDP A;  3AD9 B;  4LA1 A;  2XVF A;  4Y4N A;  4MJW A;  4NNJ A;  2EQ8 A;  1GND A;  4NEV A;  2E4G A;  1GSN A;  1Z6L A;  2WP5 A;  3CN8 A;  3D8X A;  3DK8 A;  1Q9I A;  4YSH A;  4YT0 A;  3GYX A;  3NK2 X;  2GVC A;  4FK1 A;  1D4E A;  1BWC A;  2LFC A;  3S61 A;  1GRA A;  2OA1 A;  2YLZ A;  1L9D A;  1ONF A;  1OJC A;  3ATR A;  1EL7 A;  2YLT A;  4GR1 A;  4K7Z A;  1YQ4 A;  3DH9 A;  3LZX A;  4JY3 A;  4G6H A;  4FDC B;  2TMD A;  4TM1 A;  1D5T A;  3O0H A;  5ER0 A;  2PYX A;  3B3R A;  1GTE A;  4YTM A;  3BNU A;  1DOC A;  4H4R A;  3UOZ A;  2VQB A;  2ZZB A;  3VR8 A;  4G6G A;  4UDP A;  4IVM B;  1PXC A;  3GRT A;  1SEZ A;  2C7G A;  2Q6U A;  1GRG A;  1JRZ A;  1H83 A;  2OLO A;  4AP3 A;  4H4Q A;  1GT8 A;  2RAB A;  3P9U A;  4NTD A;  5IQ4 A;  2WP6 A;  3EF6 A;  4IA5 A;  3ICR A;  1Q1W A;  3NK1 X;  4IV9 A;  1PBF A;  1LV0 A;  2X3N A;  2WOW A;  1CC6 A;  1B37 A;  3RED A;  1H82 A;  2XFN A;  3CTY A;  3F8P A;  2V3A A;  3LJP A;  1N1P A;  3ITJ A;  2BC1 A;  3ADA B;  2QAE A;  3V76 A;  2WPF A;  2AQJ A;  4OVI A;  3HYW A;  1L9E A;  1ZMD A;  1B5Q A;  1PBC A;  3KVE A;  3V3O A;  3M12 A;  2B7R A;  2H89 A;  1OJT A;  5FS8 A;  4EMW A;  4Z2U A;  3UKF A;  5BUK A;  4I59 A;  4K22 A;  3SZ0 A;  2R0P A;  3P4P A;  1PBB A;  3C4A A;  4H4U A;  3L8K A;  4ECH A;  2ACZ A;  1ELI A;  4ZCD A;  4JQ9 A;  4USR A;  4J31 A;  2V61 A;  5FS6 A;  4B66 A;  1COY A;  1P2H A;  4WX1 A;  2VRL A;  2X8G A;  3BHF A;  3QFB A;  4BV6 A;  3EAO A;  4ZCC A;  1GES A;  2BXR A;  2YVJ A;  4A79 A;  4RG4 A;  3GD3 A;  1K4Q A;  5KRQ A;  1MO9 A;  2Q0K A;  4UDR A;  1H7W A;  3AEE A;  2B9Y A;  1H6V A;  3I3L A;  3UKK A;  3RP8 A;  1O5W A;  2WPE A;  3SFD A;  3SQP A;  4B65 A;  3GYJ A;  4D04 A;  3CNT A;  1NG3 A;  2YG6 A;  3HZL A;  3RHA A;  4ZN0 A;  3H8L A;  2VQ7 A;  3ABV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...