3VRAA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 192
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vraA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vraA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vraA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vraA04
2WP6A 4H2NA 3M12A 1PHHA 2Z5YA 3ITJA 5EB5A 1ZP0A 3AE3A 4WX1A 4FX9A 4APNA 4A6NA 4CBQA 2LFCA 2VZ2A 4A65A 5C3JA 4JDRA 3CTYA 2OLOA 4OPDA 1XHCA 1BF3A 1VRQB 2YWLA 1E1LA 3NG7X 4XWRA 5KOXA 2V60A 2H88A 3AEEA 2ACZA 2B9YA 3BI4A 4K2XA 3DJGX 2F5ZA 1ZOYA 3UKAA 1GETA 5BUKA 3DH9A 1E1KA 1S2QA 4EQWA 3SFDA 3QVPA 4UP3A 1YQZA 4CRTA 1O5WA 4H4ZA 5DBJA 1H82A 1IUUA 1TDKA 3WE0A 1D5TA 2FJEA 1F3PA 1PJ6A 4XXGA 2YG4A 3GMCA 1N4WA 3SUCA 2Q7VA 4X4JA 1PN0A 1DOBA 2EQ7A 5EBKA 2OALA 2XLSA 4BK3A 1CJ2A 3CGBA 3NTDA 2GR0A 2GQWA 1GEUA 3F8PA 4LU6A 2YR6A 2RGOA 4U8MA 2BA9A 2C65A 1Q1RA 3KKJA 3VRDB 4OPGA 1NHSA 3P9UA 4K5RA 4ADWA 2GR2A 3ZYXA 4UDPA 4MJWA 2C72A 4U8KA 2VVMA 3NN6X 4YTPA 3NH3X 4X9NA 1H7WA 4EMWA 1KDGA 1PBEA 2VQBA 2V61A 3LB8A 1OJTA 2YG3A 1D4CA 4YSZA 4CNKA 4EMJA 3AD9B 3FG2P 2YM1A 4A5LA 2WDRA 1JEHA 3FBSA 4H2RA 4H4SA 1D7LA 3VQRA 2WPFA 3DK9A 5HHFA 2B7SA 2GV8A 1IUXA 2WPCA 5LV9A 3GSIA 3KPFA 4H4TA 3UKKA 2OAMA 4GUVA 2WBAA 2XFUA 5KXJA 4J33A 2R0GA 3H4KA 1IJHA 1GRGA 1UKVG 1Y56A 2XLRA 1ELIA 2QA1A 1YQ3A 5JCNA 4ZCDA 3DJDA 4FK1A 3CPJG 2JBVA 1GTHA 1VG0A 1MO9A 4AT2A 3LJPA 2X99A 1B8SA 3BI5A 3CNSA 4U8JA 4DGKA 5KVHA 2RGHA 2TMDA 1XPQA 3UOYA 4OPCA 3GYIA 3D1CA 5JCKA 3RP6A 3HZLA 4GRTA 3QFAA 1ZK7A 3C4NA 2R4EA 4YTMA 4HA6A 1E1NA 1GREA 4EIPA 2H89A 2XVHA 1TDNA 1PBBA 1EL7A 1NHRA 2JB1A 1JRYA 1IUVA 4CY6A 2A8XA 2WP5A 2E5VA 4YSXA 2B7RA 4C77A 2BXRA 3RP8A 1OJ9A 3IHMA 2XFQA 2OA1A 3ALJA 3GDPA 2O9ZA 4K5SA 4NTCA 4U8LA 4ICYA 2R0CA 2CVJA 3CPHG 4U2SA 3UOZA 1LJ1A 2AAQA 2QCUA 1GV4A 2JKCA 1DOEA 1NEKA 2CDUA 3KLJA 4J2WA 3C4AA 1TDEA 4BURA 1GESA 2WS3A 4CY8A 1NG4A 1D4EA 4JNAA 2C66A 3AECA 3ALMA 4B65A 2NVKX 3CIRA 5FS7A 5FS8A 1IUSA 1DODA 2YAUA 2C76A 2YLSA 3GWDA 4NTDA 4O5QA 4JY2A 4TM3A 4A7AA 1AOGA 1FOHA 4U2TA 1GNDA 3CGDA 4EQRA 2Z5XA 3UTEA 4OPLA 2X50A 4U8IA 1NDAA 4A6NB 3LZXA 3L1RA 3OZ2A 2ZBWA 2FJDA 3UTHA 5JCIA 2WP9A 1PXBA 2GVCA 4BJYA 3PO7A 5EB4A 1YKJA 4IVOB 3QSEA 3K7QX 3H8IA 1CC4A 2XLPA 3ZDNA 5EOWA 3E1TA 2XYOA 2JAEA 1QO8A 1Z6LA 2XFPA 2APGA 5JCLA 3FIMB 1H81A 2YM2A 2XVIA 4NEWA 1CJ4A 2BK3A 1CBOA 4U8PA 2VRLA 1E6EA 3GQKA 2BS4A 1NPXA 3BHFA 3K30A 2WDQA 3AEDA 1TRBA 4H4QA 5M0ZA 2PHHA 1DJNA 3P4PA 3DGHA 2FBWA 4CNJA 4IA6A 3ICRA 1H84A 2YQUA 3JSKA 3AEBA 3NK1X 3AE1A 3BHKA 2JB2A 1M6IA 1LV0A 2CULA 2IVEA 3K7MX 4CCQA 2UZZA 4GR1A 3ABVA 4YKFA 4ZN0A 4AT0A 3P4SA 1P2HA 3UKPA 1F6MA 1XDIA 3NGCX 4EIQA 1YQ4A 3I6DA 2QAEA 3CNPA 1PBCA 3PVCA 1PBFA 5CKUA 2B9WA 4REKA 3FMWA 5JCMA 1GTEA 3AE2A 3AYIA 5M10A 2YLTA 3H8LA 4GF7A 3ATQA 1JRZA 2XFNA 2ZZBA 4KPRA 3AB1A 3FPZA 5U1OA 1KNRA 3AE7A 3RNMA 2C64A 2Y6QA 3AXBA 3D8XA 4UDRA 2VVLA 4P9SA 1NHQA 2DKIA 3C96A 3UKLA 4H4RA 2YLZA 3GYJA 3AEFA 3UP5A 3GRSA 2B9XA 2RABA 2V3AA 3G5RA 3REDA 3VRBA 2C7GA 3GDNA 2C75A 1BWCA 1B5QA 1BGNA 1ZOVA 4PABA 5IPYA 1CC2A 2YG6A 3G5QA 3LZWA 3RP7A 1E7PA 4YXDA 2WPEA 3EF6A 1CL0A 1ZMCA 3SFEA 2GMJA 2C3DA 1Y56B 2VQ7A 4OPIA 3UKHA 3ALLA 2GMHA 3QFBA 5CQFA 2IVDA 1PJ5A 2BABA 3VR9A 3AYLA 2V5ZA 2ARDA 1KF6A 1W4XA 4D04A 4IVMB 1DXLA 4H4XA 1GT8A 2WESA 1D4DA 1REOA 2HQMA 3GMBA 3NYCA 4U8NA 1OJDA 3ISHA 2XLTA 1COYA 2J3NA 3NRNA 1K4QA 4GDEA 3RHAA 3DK8A 1GOSA 3IC9A 4Z24A 4E0VA 4NEVA 4YTNA 4U2LA 4XWZA 4X9MA 2Q0LA 1KNPA 1DJQA 5C2TA 5TR3A 2AQJA 4J57A 2BC1A 5KOWA 3P4RA 4N9XA 1CC6A 3KA7A 4H50A 2X8CA 1N1PA 4H4YA 5HXIA 3URHA 4C3YA 3M13A 3NYFA 1OJAA 3NYEA 1MOKA 1GRFA 4B67A 4BV6A 2GH5A 4AP1A 3GYXA 1GRHA 3UTFA 4EM3A 2BC0A 2C70A 1QLBA 2XVJA 4USQA 4DSGA 1KFYA 1RP0A 5KVIA 1S3EA 2YG5A 4H2QA 2GB0A 3I3LA 5FS6A 1NAAA 1GRBA 3CGCA 1YY5A 2R45A 1Q9IA 2R4JA 1ZDLA 2XCGA 1S3BA 3GRTA 3NK2X 2RGJA 1MXTA 4J36A 4K8DA 2R9ZA 4EQSA 3NIXA 3SGLA 3GD3A 2B76A 2GEWA 1ZMDA 3LADA 5KRQA 3V3OA 3UOXA 1EL9A 1GERA 1PBDA 4Z26A 2JB3A 3IWAA 2WHDA 3ICTA 3T37A 4TM0A 3BNMA 2ZZ0A 4TLZA 4BK2A 1H7XA 4TM4A 3UCLA 2Y6RA 4J34A 4Z25A 4ECHA 1LTXR 5KWFA 3CN8A 5U25A 2VVLG 1GSNA 3BI2A 3VRAA 2V3BA 2YLRA 4B1BA 4Z44A 2WQYA 1NHPA 4IV9A 4B64A 1VQWA 4KX6A 2YLWA 3LXDA 4B69A 3NN0X 1RSGA 3AEGA 3AE5A 2GRTA 5HYMA 1PDHA 4FDCB 1HYUA 2WU5A 2XLUA 4U8OA 1CJ3A 2WDVA 4H7UA 1BZLA 2WOIA 2X8HA 2YG7A 4JNQA 4HB9A 2Q0KA 3V3NA 1RYIA 4BK1A 4EMIA 5ER0A 2BK4A 1OJCA 3LOVA 4IA5A 3DA1A 1KSSA 1GALA 1H6VA 2Q6UA 4Y4NA 2WETA 1VG9A 1F8SA 2AR8A 2BACA 1CJCA 3UP4A 1PS9A 3QSSA 2WOWA 1GRTA 1K0LA 3DJEA 3QJ4A 4WCTA 1S2YA 5U63A 3GWFA 1B4VA 4AOSA 3DGZA 4YT0A 3UKFA 2VRMA 4YSYA 4Y4MA 3UTGA 1LPFA 4GCMA 3KVEA 3SQPA 4BJZA 1H86A 2WEUA 1EL8A 1JNZA 1CF3A 1LQUA 3GD4A 4H4UA 4Z2UA 2C3CA 4B68A 1Y0PA 1GXFA 2W0HA 3NTAA 3R9UA 4DNAA 3NNEA 2BXSA 4C5OA 3AE9A 4Z43A 2YR5A 4FK1C 4AP3A 2BS2A 2XVFA 1XANA 3NLCA 4D03A 2BCGG 4Y4LA 3S61A 1L9DA 1FL2A 1TDFA 3NT6A 3IF9A 3AE6A 4EQXA 1IUTA 1H83A 1PXCA 2X8GA 4M52A 4NZHA 5J60A 1L9CA 5L46A 1GRAA 4C74A 2BCPA 1ONFA 1ZX9A 2YVGA 3CPIG 1NG3A 5IQ4A 3NK0X 2BS3A 4TLXA 2YVFA 2EQ8A 5GSNA 4H4WA 4RG4A 2PYXA 2E1MA 3QVRA 2EQ6A 3DJJA 4RG3A 4UDQA 2FJBA 3M0OA 2OLNA 4O5UA 1F8RA 1L9EA 4DSHA 1F8WA 4LIIA 4JN9A 1CHUA 1DNCA 1Q1WA 4Z2TA 3AE4A 3P4QA 2YLXA 1EBDA 1M64A 2WOVA 2GQFA 4K7ZA 1JRXA 3DK4A 2JK6A 3OC4A 1VDCA 2C73A 3DMEA 4JQ9A 1JU2A 4YWOA 3UOVA 3SM8A 1N4UA 3L8KA 4LA1A 3CNJA 3AD8B 1L0VA 1QJDA 2GF3A 3AWIA 3F8RA 1V59A 3KU9A 4GDPA 1JOAA 1P2EA 2XFOA 3B6DA 3IHGA 4USRA 4OCGA 4OPUA 1BKWA 3AEAA 1DOCA 2A87A 4H4PA 4AOXA 5BVAA 3EAOA 3EANA 5BRTA 2GR1A 3VR8A 4PAAA 2XVEA 3G5SA 4CCRA 3GQHA 1TDOA 3AYJA 4C3XA 1E1MA 1D7YA 1PJ7A 3BNUA 1SEZA 3ICSA 5FMHA 4ZCCA 2GR3A 4A99A 1FEAA 4EM4A 1ZY8A 1PXAA 3F8DA 2CFYA 1B37A 1O95A 2GAGB 4I58A 2I0ZA 2A89A 3Q6JA 4B63A 4JY3A 4J31A 2ZZCA 4NTEA 4K22A 2BK5A 4YKGA 1TYTA 2C67A 2XDOA 5FS9A 4OVIA 1KSUA 2R0PA 1X31B 2NPXA 2QA2A 2YVJA 4A9WA 4RSLA 3P1WA 4B66A 1K0JA 1K0IA 3PS9A 3II4A 4J56A 3AE8A 3S5WA 3V76A 3ADAB 5IQ1A 4TM1A 2VOUA 2DKHA 4Z2RA 2E4GA 1TYPA 1FCDA 3EPTA 2WU2A 2TPRA 3ATRA 3CNTA 2IIDA 1EL5A 3B3RA 1IUWA 1NENA 4H4VA 2GAHB 4H2PA 2BYBA 3NHOX 2X3NA 3Q9TA 2V6OA 4I59A 2YR4A 5HY5A 2FJAA 3KD9A 3QSMA 1ZKQA 4OPTA 4YSHA 1O94A 2EQ9A 3UKQA 3O0HA 1E39A 1BGJA 5J7XA 1JNRA 3AD7B 3K7TA 1LVLA 1FEBA 5GRTA 3CGEA 1LQTA 3NKSA 3CNDA 1GPEA 3COXA 2R46A 1FECA 4A79A 1N4VA 5BULA
chains in the Genus database with same CATH superfamily
2WP6A 3M12A 3CKDA 1VBE4 3Q5EA 2XAHB 3T2YA 4U7YA 4CZZB 4A6NA 1AR84 3ONLC 1BF3A 4AIUA 1VRQB 3UUXB 5LMUT 3JAEA 3AEEA 4JI8T 2OA5A 5KNLA 2E8IA 4K2XA 3DJGX 3CVRA 2CM0A 2DNXA 1XDPA 4L5GA 2V6XA 1S2QA 4HFHA 2VWAA 2WB5A 4HWCA 1D1AA 3ANWA 5AQTB 5HEUA 2H3RA 5ABEA 1H82A 3WE0A 1D5TA 1HX1B 2VQFT 1F3PA 2PZSA 1PJ6A 3GMCA 4PNIA 1UURA 3ZLIA 1BR1A 1PO14 3KDSE 4UV9B 5L4EA 2QRXA 4LU6A 3UQ4A 4XZCA 4BAYB 5JR9C 1OOPD 2BA9A 2KT9A 1Q1RA 4OPGA 4HWDA 3ZYXA 2C72A 4YTPA 2CXLA 4TWFA 1KEYA 4EMWA 1KDGA 2VQBA 3P8CD 4YSZA 4EMJA 3FG2P 3HKCE 4H2RA 4ZZCA 5ABFB 1D7LA 3A8YC 4IIJE 2GV8A 4UIGA 3KPFA 4HTEA 3UKKA 4GUVA 4IDOA 2XFUA 3KVAA 5JR9B 5KXJA 2R0GA 1LKXA 3H4KA 1UKVG 1VBC4 2XLRA 1ELIA 2QA1A 3UFEA 4ZCDA 3BQKA 2JBVA 1EAH4 2L3LA 1MO9A 2CLYB 5JDQA 2JIWA 4QH5A 4EZ4A 4QHOA 3LJPA 4NWZA 4DGKA 3QK6A 3MZKB 2H7VC 3L8RA 4JI0T 3D1CA 1SE7A 4GRTA 4ISSA 2W4XA 1UGOA 2V1DB 4YTMA 1HS7A 1E1NA 1GREA 3S4UA 3MACA 3FZFB 3NRXA 1PBBA 4GKKT 2JB1A 4II2A 2LM2A 4X1YE 3V5UA 1XNRT 4AXPA 4I55E 2L9QA 4U8LA 4ICYA 2KSRA 2CDUA 1TDEA 4TNWA 2Q9QC 1NG4A 5LHHB 1ASJ4 2NVKX 3JADA 3T8OA 5FS8A 1DODA 2YLSA 4O5QA 1Z8UA 4A7AA 3RGLA 1D1BA 2JQHA 2X0HA 3T2KA 2PFVA 3N9MA 4EQRA 2HWC4 3C50A 4A6NB 2XAGB 4TZ4C 3OZ2A 4C90A 5JCIA 4DUYT 1WCRA 1YKJA 2D0UA 3K7QX 2XLPA 5EOWA 3EI0A 1Z6LA 5ETWA 3FIMB 2YM2A 1XNQT 4Q25A 3GQKA 1W9RA 3BHFA 1T72A 2NTXA 4EB6E 3AEDA 1TRBA 2HPLA 5M0ZA 5KMGP 1N33T 2JMKA 3GN5B 4IA6A 3JSKA 2YINA 2MOZA 5FP3A 2JB2A 5TAOA 3K7MX 4GR1A 2AXDS 4GK5E 3AAEB 2VKDA 1M62A 1F6MA 2XQ5A 4EIQA 3K3NA 2QAEA 2F4VT 4CXYA 3FMWA 3K8PC 3ZYMA 4DR6T 1IJ5A 2BBHA 3ZKRA 1GTEA 3BQIA 3RYIE 1HG2A 2ZZBA 4EOZB 5HWXA 4KPRA 2XZEA 2D2SA 3FPZA 2JQQA 4P9SA 1YKHB 3GRSA 3G5RA 4NNJA 2C75A 1BWCA 1BGNA 1HRV4 2KMFA 1CC2A 1E7PA 3CX7B 4BA9A 3LG7A 4UF0B 2C3DA 2I59A 4OPIA 3C51A 3UKHA 3ALLA 5CQFA 4GYRA 1T98A 2BABA 2ARDA 1KF6A 1W4XA 1W09A 2X0LB 4TV9E 2XHEB 2DL1A 1YD8G 3UUNA 5JDNA 2CEAA 1OJDA 4OFZA 5BR8T 4MBQA 1VOMA 2J3NA 2XLTA 3ISHA 5EK4A 1U4QA 4NEVA 4U3CA 2LM9A 4YTNA 4U2LA 2C5KT 2XTLA 2AQJA 3P4RA 2RA1A 4H4YA 3E0ZA 2X68A 1XDOA 3H3MA 1FEWA 4QH1A 4DV2T 4C3YA 1OJAA 1MOKA 2NW8A 4CXXA 2GH5A 2WBLA 3IHRA 1GRHA 5LBQB 2YDSA 4USQA 1QLBA 2VQET 1RP0A 4DIDB 3SXIA 1S3EA 2GB0A 3QNUA 4HWHA 2D0TA 4KMCA 1VRBA 2XCGA 1S3BA 5HEGA 3N5LA 4GAVA 4J36A 4K8DA 5L3DB 3SGLA 2B76A 4Q4V4 3AA1B 3VKGA 3V3OA 2IW5B 2ACXA 3PUYF 2EHOA 3ICTA 2W62A 2ZZ0A 5FXWA 2Y6XA 1H7XA 2Y6RA 4Z25A 5KWFA 2WCAA 2N2NA 2LHNA 4Z44A 4B64A 4B69A 2EX3A 2E9XA 3NN0X 1RSGA 2GRTA 5HYMA 4EV6A 2QA7A 1PDHA 4U8OA 1CJ3A 3PUZF 2WOIA 2X8HA 4JNQA 2LFCA 3V3NA 2KWHA 3AAAB 1RYIA 5ER0A 2X51A 4IA5A 3UP4A 5LYJE 1MMDA 1PS9A 3QSSA 2NR4A 5AQRB 1K0LA 4WCTA 5U63A 3GWFA 1B4VA 3CK6A 4DV5T 2FUPA 4Y4MA 5HEJA 2VL8A 4A5XA 2ODUA 2YKSA 4GCMA 2WEUA 3GD4A 1LQUA 4E7ZA 4YHHT 3RC8A 3PU3A 3ZT7A 2IC6A 2XM1A 5AQNB 2W0HA 4J2CA 3NNEA 2XJ7A 4AP3A 2BS2A 3NLCA 1QUUA 4D03A 5JDHA 2QGSA 1MIWA 3N9NA 3NT6A 3IF9A 3AE6A 3ZPOA 5LGTB 4C74A 2BCPA 4II3A 1ONFA 2YVGA 4ZI3C 1IAPA 1E1HB 3VU7H 4Z8XA 2KLQA 3SOLA 4PJLA 1BR0A 3ZYKA 5GSNA 2IMLA 1SHZC 2YEVC 5CJ5A 2E1MA 3PDYA 4RG3A 1L9EA 5HXHA 4JN9A 4A98A 1HCIA 5FVLA 3RIAA 4Z2TA 3TLTA 1M64A 1JRXA 4JI6T 3HYWA 3E22E 3SS1A 3M65A 2C73A 1JU2A 1H7CA 3R6NA 4LA1A 1WYCA 3CNJA 4GDPA 3KU9A 1JOAA 2XFOA 2UXXB 3B6DA 5F8PA 1DOCA 3EAOA 5HXCA 3VR8A 2IUBA 4AQYT 4C3XA 4O4IE 3BNUA 4A99A 2MPKA 3L39A 4JV5T 1ZY8A 2NW7A 2E9XC 5JDFA 2C0SA 1O95A 2K9AA 4I58A 3LK2B 2I0ZA 4B63A 4GOUA 4CQIA 3K3OA 2XDOA 3CQXC 1T7SA 2NPXA 2EHOB 2J47A 2PBIA 4RSLA 2HPJA 2GK9A 3AA7B 4B66A 1K0IA 5J2TE 3AE8A 4KHZF 3V76A 5IQ1A 1NA1D 2VOUA 2DKHA 4Z2RA 2V7MA 1FJGT 2XQYA 3TLWA 4I0UA 2LEHA 4YHJA 2E9XB 2LSYA 4X64T 3CQCB 3Q9TA 4X62T 4I59A 2E5LT 2JQ9A 2EQ9A 3UKQA 1E39A 1JNRA 1NAFA 5AFUL 1FEBA 5GRTA 3NKSA 3CNDA 4I50E 4PJNA 3COXA 2R46A 1FECA 2I0MA 5BULA 2OLTA 4B6XA 5KDMC 4P1NA 4CBQA 3NRYA 5C3JA 3SYIA 1XHCA 1UK5A 3U78A 5FNVE 2WAUA 3I9WA 2ODVA 3KFWX 5LB7B 3OYXA 3AA6B 1XWMA 4BJMA 2G0UA 1E1KA 3QVPA 5M4YA 3HA4A 4UELA 4U72A 1MQTD 5DBJA 4ZI3D 4QH4A 1N4WA 3SUCA 3RIUC 1PN0A 1DOBA 2SPCA 5EBKA 3CMMA 3K1SA 3NTDA 4P0BA 3ZJ2A 1GEUA 4PW8A 4YJ3E 5KMRA 4KBMB 2RGOA 1MNDA 4O8SA 2ZM2A 3VRDB 3TLSA 1NHSA 4AISA 2K3WA 5EK2A 4U8KA 1D0ZA 2VL0A 3NN6X 4X9NA 5JDMA 2R044 2V61A 1OJTA 1D4CA 4CNKA 3AD9B 4X65T 2YM1A 2WDRA 1JEHA 3FBSA 3P7IA 4H4SA 1HXS4 2EHOD 1PIV4 3ZMZB 3DK9A 2B7SA 2D9DA 1IUXA 2LSIA 2WPCA 4WBOA 3LFMA 4IE6A 2XQ4A 2LRKA 2OAMA 5JH7E 1GRGA 3DP7A 4EYUA 2BBJA 2JJ9A 2E9XD 3AAIA 4F8HA 4FK1A 2BKNA 1J5ET 3HL6A 1B8SA 3CNSA 4U8JA 5KVHA 4EEBA 3JC6C 5JCKA 4H63H 3KV5A 3H37A 5LNKA 1U5PA 3EDVA 4IL9A 5CA0E 4DV0T 2XVHA 3RI5A 1RVF4 1I94T 1IUVA 3T0KA 2A8XA 1VBA4 1VCSA 2B7RA 4C77A 1HNWT 2CMRA 4JBWF 4WZXA 3CPHG 4U2SA 3UOZA 2X9HA 1DOEA 3C4AA 1MNEA 4BURA 4JNAA 2C66A 2NW9A 3HKBE 3ALMA 3UU3A 4NTDA 1AOGA 3HR0A 4U2TA 2PG8A 1GNDA 3CGDA 3UTEA 4OPLA 4U8IA 3X1DA 3UTHA 1LVKA 5AQKB 4AQFA 3PUSA 4QWNB 4QX7B 1PXBA 2X67A 2PY5A 3ZDNA 3E1TA 5JCLA 4HFVA 3RHWA 2XAJB 2NTYA 2PYJA 2VRLA 2BS4A 5DABA 1NPXA 3K30A 5AQQB 3PJAA 3V5SA 4CNJA 1XI1A 3SZ0A 3AE1A 3GMIA 4CCQA 4DO0A 4ZN0A 3N2GE 1P2HA 3UKPA 5H6QB 4NXMT 2R074 3I6DA 4IREA 3CNPA 3JBG4 3PUQA 5LJMA 2UXCT 4ZI7E 5CKUA 2B9WA 4REKA 2XY8B 2YLTA 3ZJ1A 3H8LA 1W0BA 4H9SE 1JRZA 1N32T 2XFNA 2JMHA 3AB1A 5U1OA 4FJOA 3RNMA 2Y6QA 2DKIA 2YLZA 2LHRA 3AEFA 2CLYC 2WWUA 2RABA 1H8TD 4C91A 2C7GA 3F31A 1B5QA 2A2FX 3H3AA 3G5QA 4I43B 4YXDA 3ESLA 2BDEA 1OXZA 3RKGA 1HRI4 1CL0A 4AKHA 2BVLA 1ZMCA 2GMJA 4WBNE 2GMHA 3I9YA 3VR9A 2V5ZA 1S94A 4IVMB 1GT8A 1HFAA 2VURA 2HQMA 3GMBA 3NYCA 4DBRA 4U8NA 3CPZA 3VKHA 1COYA 1ZKEA 4DR4T 1K4QA 4JUYA 1GOSA 4E0VA 3JC6D 1BEV4 4XWZA 4X9MA 2Q0LA 1DJQA 5C2TA 2IDOB 2MTQA 4MALA 2BC1A 1CC6A 4Q4W4 5LHGB 3OTOT 2X8CA 2N1GA 3URHA 3M13A 3UUMA 3NYEA 1GRFA 4TWDA 4AP1A 2DCFA 2HHHT 3UTFA 4DSGA 3N2KE 2YG5A 5FS6A 3CGCA 1GRBA 2YK0A 5L3BB 2R45A 4YFSA 4ZEYA 3ZSTA 4DNDA 2R4JA 3GRTA 4K0KT 3NK2X 1MXTA 5IWAT 1WYBA 2UXBT 2ES0A 2V7LA 4H9PC 4KP3C 1GERA 4Z26A 4TV8E 4CI3B 3T37A 4TLZA 4QX8B 4TM4A 4J34A 2NOXA 1LTXR 3CN8A 5U25A 5LGNB 3BI2A 4QXBB 3RIFA 3VRAA 2CBIA 4B1BA 2HN1A 3ETVA 4KX6A 2YLWA 2RPAA 3IA3A 2CHOA 2X9XA 4WNKA 2BKPA 1XMQT 4FDCB 2WU5A 3HI2A 2Q0KA 4QKNA 3KBTA 5KMQA 1X9BA 3LOVA 3ANWB 3NKZA 1KSSA 1GALA 1H6VA 4Y4NA 5FL1A 2WETA 1VG9A 1F8SA 3DTOA 3DJEA 1HNXT 1S2YA 4E7SA 3N9OA 3RLFF 4YSYA 1OEDA 2K48A 4BJZA 4OYKA 3RPUA 1EL8A 1JNZA 1CF3A 2BG9A 3T1YT 4CN6A 3JD74 2IAKA 4B68A 1Y0PA 3RKOA 4C5OA 4B3TT 4Z43A 3UULA 1VRH4 4UVBB 3FI7A 3PUXF 1XANA 2C5IT 2BCGG 4Y4LA 4I4TE 5HXRA 3MA9A 4ZOLE 1MMGA 1PXCA 4M52A 1RUF4 5J60A 1L9CA 3OJAA 4JEUB 2VVNA 2W66A 2BS3A 3UTKA 2YVFA 2EQ8A 4PJJA 3VHLA 2V5DA 5F5WA 3QVRA 3EAMA 4EGWA 4UDQA 2FJBA 5FL0A 4G6GA 4KUMB 1N36T 4DSHA 1F8WA 5HXEA 1CHUA 4PDWD 1DNCA 1HR0T 2YLXA 2JQKA 1EBDA 5HCMA 2GQFA 1Y64B 1W0AA 1XMOT 2LT3A 3UOVA 3EABA 1N4UA 3EVYA 4JI2T 1QJDA 3VQRA 3IHGA 4USRA 3PTRB 5LHIB 1BKWA 4H4PA 3CWZB 4AOXA 5JTGA 5HWYA 3EANA 2XVEA 3G5SA 4CCRA 3GQHA 3FB2A 4ZHQE 5L3CB 5JRCA 2V8SV 3WAKA 1UX5A 1EZ3A 1RUH4 2XQ8A 3CX6B 1FEAA 3P50A 4MLKA 3F8DA 1B37A 1PVC4 2A89A 3AXJA 5L2LA 4NXNT 5H6RB 4O4HE 5FS9A 2C67A 4OVIA 1KSUA 2R0PA 3LK3B 2QA2A 2YVJA 3GWHA 3ZYLA 2BRAA 4U31A 3RC3A 1AL24 4J56A 1YXRA 2ZM8A 3CNTA 1EL5A 2AE9A 2XQ7A 4EIWA 2BG9C 4Q4X4 2V7JA 2V6OA 2YR4A 4B3ST 3KD9A 2UXNB 5LG3A 3HKEE 3PURA 4OK0A 3W15B 1O94A 3FZLB 3M3ZB 5FY7A 1LQTA 4LF9T 3OKQA 2IC9A 2CRBA 4H2NA 5LGUB 5CFBA 4DR2T 3ETUA 2Z5YA 1ZP0A 5BMVE 5EB5A 4ZZBA 4FX9A 2W00A 1E2AA 1FMWA 2VKHA 5ADXL 2VZ2A 3RQUA 1DU2A 3LK42 2BG9B 3BQLA 4CN1A 2PTFA 5E0OA 3KV9A 4AKRB 2XAQB 4LF5T 3BK9A 4XWRA 5KOXA 4U2YA 2V60A 1WFDA 2H88A 2JRKA 5LCYA 3BI4A 2QYWA 1ZOYA 3UKAA 4A56A 5BUKA 2KNDA 4LF7T 4HWFA 4EQWA 4M1PA 3SFDA 1YQZA 2DWKA 5JQGE 4EYYR 1TDKA 1J5WA 4UV8B 2FJEA 2KXPB 4XAXB 2YG4A 2X9WA 5IYZE 2XQAA 4X4JA 4BK3A 3UFGA 1CJ2A 4HFEA 3CGBA 2LRLA 5AQUB 2GQWA 4H63V 3F8PA 3ZEFB 4P0AA 1FMVA 4NUUA 2LSGA 3PUAA 5FY0A 4U8MA 4HEAA 1HX8A 3SZFA 4K5RA 4ADWA 3B57A 3ZC1A 5C8YE 2VVMA 5FY1A 2V6YA 4UXNB 4Z91A 1PBEA 3LB8A 3AVSA 2PJQA 2YG3A 3N9QA 4A5LA 4DR1T 1D0YA 1GQEA 5JRCB 2EHOC 1PO24 4H4TA 5FMNA 5HEHA 2WBAA 4J33A 2IIUA 1YQ3A 5JCNA 3CPJG 1GTHA 3AXJB 2J4GA 3EDUA 2CE7A 2X99A 3FXDB 3MKDA 1XPQA 2TMDA 2R6GF 2WSSV 2YOEA 3RP6A 4EAHA 1ZK7A 3RYFE 3C4NA 2ZM0A 3O4XE 2H7OA 3KPKA 5LBMA 2VK9A 3SRZA 5GONE 3QOFA 3L3PA 4WW0A 2J62A 2WZHA 3NBXX 1NHRA 4PK5A 4CY6A 1JRYA 4XBFB 2WP5A 2W67A 2E5VA 4YSXA 2BXRA 3RP8A 1YW0A 4L9IA 3ALJA 5HEOA 2O9ZA 4K5SA 2CVJA 1LJ1A 2AAQA 2QCUA 1GV4A 1NEKA 3KLJA 1GESA 4CY8A 5AQHB 1S35A 4B65A 3LSVA 3CIRA 5FS7A 2LLYA 2YAUA 2C76A 4TM3A 4JLEA 2V5CA 2Z5XA 1NDAA 3LZXA 1RUD4 4B3RT 5EB4A 3QSEA 2CHNA 4EEDA 2JAEA 5JVDE 1QO8A 3SZWA 2XFPA 3UQ7A 1MIVA 2APGA 2HH7A 1H81A 5A1LA 4UVAB 4OX9T 2BK3A 1CBOA 3PU8A 1E6EA 3O1HA 5J1GA 1RUC4 1HG5A 2WDQA 3B13A 3OPCA 3Q9DA 4F6RC 4H4QA 3P4PA 4IL4A 1H84A 2YQUA 1VBB4 2C4CA 1LV0A 2CULA 2UZZA 3ABVA 2X5ID 4YKFA 4AT0A 3P4SA 3CMLA 1WRDA 2MAWA 4K0UA 1AR94 5JDLA 1IJ6A 1D0XA 3C64A 3OVUA 2YN6A 2L8KA 3AYIA 4GF7A 4PFOA 2XQ6A 5CA1E 2V6YB 3RX6A 3AE7A 1OWAA 3D8XA 3NZQA 4UDRA 3UKLA 4H4RA 3GYJA 2B9XA 2WWVA 3VRBA 5AQGB 5IPYA 3TKLB 2N9DA 2YG6A 4TWHA 2R064 3Q2MA 5L3EB 2BKOA 2YDRA 2WPEA 2WMNA 3PE0A 1PJ5A 2WZIA 2RM24 4D04A 2HWB4 4H4XA 2WESA 1D4DA 1Y01A 1REOA 3SZCA 5JDGA 1R8IA 5HAXA 4GDEA 4Z24A 3UU5A 1RUE4 3RQWA 1KNPA 1RUI4 5TR3A 2RMU4 4ISTA 4YY3T 2XSBA 4AQGA 4N9XA 4H50A 4PK6A 5AQLB 5HXIA 1N1PA 5L3FB 3B5MA 3NYFA 4B67A 4BV6A 5JR9A 3GYXA 4DR3T 4DV6T 1KFYA 5KVIA 4G6HA 3FZMB 2LKHA 3I3LA 2RP4A 3QUJA 1NAAA 1UCUA 1Q9IA 4NUVA 4BJNA 3Q5DA 1ZDLA 3TLVA 1M7KA 5DQWA 4EQSA 2V7KA 1Z7S4 3NIXA 2GEWA 3LADA 3N9LA 5CGMA 1ZMDA 5KRQA 2A3DA 3UOXA 1PBDA 4PK4A 2WHDA 4IDQA 1V9DA 4TM0A 4B3MT 3BNMA 3DJBA 4BK2A 4ECHA 5LMNT 4HFBA 3KV4A 2LOSA 4Q4Y4 3FZKB 2V3BA 1NHPA 1VQWA 2W0GA 3AEGA 3AE5A 4RHV4 1HYUA 2XLUA 4TN7B 2WDVA 4A97A 4H7UA 3J8F4 3DA1A 4DV3T 3NZPA 5ABGA 1CJCA 2V26A 3LDQB 3Q5XA 2WOWA 5KMPA 1GRTA 3QJ4A 4FI5A 4AOSA 4Z90A 5FYMA 3ZMTB 3KVEA 1WR6A 2VVSA 2Q9QA 4ZXLA 4PFPA 3NTAA 4DNAA 3RF1A 3AE9A 2YR5A 4FK1C 4CXWA 4O4LE 5ABHA 3WAJA 2CXDA 3GN5A 3S61A 5IHYA 4H9QC 4HGAA 1L9DA 2CXFA 4EQXA 2CWYA 1IUTA 4NZHA 1GRAA 4DBQA 5KX5E 3CPIG 4CI1B 3KV6A 2ZM6T 5FVKA 5IQ4A 1WR0A 4JI3T 1ZEEA 2HN2A 4DUZT 4H4WA 3IF8B 2OLNA 4O5UA 4QXHB 4UVCB 1Q1WA 5LOVE 2XUEA 2D5UA 4JI7T 3D0TA 4K7ZA 2JK6A 1HNZT 3OC4A 4PJMA 2P9BA 3RYHE 1VDCA 4JQ9A 1X79A 3SM8A 3L8KA 3FHNA 3PJAJ 3AWIA 3F8RA 1P2EA 1OEDE 3N2OA 3NWIA 4OPUA 3GA8A 3AEAA 2BG9E 5BVAA 5BRTA 1K5MD 4UF0A 4G63A 4HN9A 1TDOA 4X1KE 4AQFC 3AYJA 1RUG4 3A5XA 1E1MA 2XSAA 1D7YA 2KZ7B 1PJ7A 4G2AA 1SEZA 3AB3B 5J0ZA 1PXAA 4WYVA 4CI2B 2LOPA 2I6HA 4O4JE 4J31A 4ZI2D 2ZZCA 4YKGA 1TYTA 3G06A 4COFA 2XASB 4LFAT 1X31B 4IDZA 3FBZA 1D4M4 1IBLT 1POV0 1K0JA 3PS9A 3II4A 1MMAA 3T2ZA 3ADAB 4DMVA 1US7B 1TYPA 2XM2A 1FCDA 1G73A 3EPTA 2TPRA 3ATRA 2KINB 3OBVE 4CN4A 4H4VA 1NENA 4HE8A 1NCQD 2GAHB 4H2PA 4TX5A 4JI5T 2C5JA 2VASA 1XHXA 1FIOA 1ZKQA 4YSHA 4GAPA 3O0HA 1BGJA 4ILUA 3K7TA 5DQVA 3ZMUB 1LVLA 3PV0F 4ILBA 1GPEA 2CCQA 1NHQA 3HYXA 1PHHA 3ITJA 4LMLA 3AE3A 4UR9A 4WX1A 1Z0PA 3Q5WA 4APNA 4A65A 4JDRA 4OPDA 3CTYA 2OLOA 3F2EA 4IDPA 4DVDA 2LJLA 3QB5K 5HCJA 2YWLA 1E1LA 2ZMAA 2IHR1 3NG7X 2Q9QB 2B9YA 2ACZA 2F5ZA 4JI1T 1GETA 3UU8A 3DH9A 2M6BA 4GK0E 4UP3A 4CRTA 1O5WA 1IBMT 4U33A 4H4ZA 2Y8DA 1IUUA 1HTJF 4ERRA 5AQOB 3U3IA 4GKJT 4XXGA 4ILCA 4IHJE 5HXSA 2Q7VA 4IT4A 2EQ7A 2OALA 2XLSA 2LSJA 1O3XA 2GR0A 2K24A 5KMSA 2YR6A 2V7IA 2C65A 3KKJA 3P9UA 3ZMVB 2GR2A 4UDPA 4MJWA 3FZHB 3KINB 3NH3X 4LFBT 1H7WA 4X5TA 4TUYE 4HKAA 3EUHA 4LMKA 2JPFA 3QB5A 1MMNA 3JAFA 2CPTA 2WPFA 1KNZA 5HHFA 2VB6A 2XQ3A 3ZCJA 5LV9A 2M67A 4NIQA 4AKGA 3GSIA 4NPPA 2LKGA 1IJHA 1Y56A 3MXZA 3DJDA 1VG0A 4U74A 1BR2A 1IBKT 4UEMA 4O2BE 4AT2A 3BI5A 4V1Av 2RGHA 3UOYA 4AKIA 3GYIA 4OPCA 2J1DG 3T1HT 3HZLA 3QFAA 2VKJA 2R4EA 4HA6A 4H9NC 4EIPA 1RMU4 2H89A 1TDNA 4JEHB 5DJQC 1KK7A 1EL7A 1AJ3A 2PLV4 4GB34 5FXXA 5EK3A 4ADZA 4DV1T 2YU2A 1OJ9A 2B1EA 2XFQA 1OEDC 2OA1A 3IHMA 3GDPA 4NTCA 2Q9QD 5AQSB 2R0CA 1AR74 2JKCA 4J2WA 2LE8A 2WS3A 1D4EA 1RUJ4 3AECA 2UUCT 2XAFB 1IUSA 5HY5A 3GWDA 3ZT5A 2K5BB 4JY2A 1FOHA 1B7TA 2PW9A 1BR4A 4DV7T 2X50A 5CB4E 3SY4A 3L1RA 1J1JA 2FJDA 3PUWF 4P09A 2ZBWA 2WP9A 2GVCA 4BJYA 1R094 1HF8A 3PO7A 1LRZA 2OV9A 4IVOB 3H8IA 3LBXA 2KWIB 1OEDB 1CC4A 2XYOA 3P4WA 2XVIA 4NEWA 1CJ4A 4ASKA 1CUNA 2YDQA 4U8PA 5L47A 4HFCA 2PHHA 1DJNA 3DGHA 2FBWA 3IBPA 4U7IA 4HFDA 3T31A 3L09A 3ICRA 3AEBA 4ZS3A 3AVRA 5AQPB 5FXVA 3KBUA 3BHKA 3NK1X 1M6IA 4N78D 2IVEA 1N34T 3MJXA 5HYAA 1XDIA 3NGCX 4YLHA 2W2UA 1YQ4A 4DMWA 1PBCA 2W63A 3PVCA 1PBFA 2Z6EA 3HYVA 1R084 5AQIB 5JCMA 3F57A 5LA6E 3AE2A 2UU9T 5M10A 3J9X1 3ATQA 2VKOA 1KNRA 2C64A 3AXBA 2MYSA 4HFIA 2VVLA 3C96A 3PUGA 1EV14 4DR5T 3UP5A 1QSDA 2M6IA 2V3AA 3REDA 1MIYA 3GDNA 3ZT6A 1ZOVA 4G74A 4PABA 2WMOA 3LZWA 3RP7A 2PYLA 3UU4A 2A72A 2W61A 2XQ9A 3EF6A 4OHFA 3SFEA 4AI6A 4ZS2A 1ZHCA 1Y56B 2VQ7A 2BZBA 3QFBA 2IVDA 3AYLA 1DXLA 2DHRA 3RRCA 4IE5A 1XZYA 4MHCA 4YJ2E 3NRNA 3RHAA 3DK8A 3IC9A 4L0RA 3KVBA 4U2ZA 4X66T 3C4XA 4J57A 4LF6T 5KOWA 3RIUA 4G73A 3KA7A 3NVOA 4DR7T 3R84B 3C4WA 4JYAT 3A7MA 2RS14 4TNVA 3J7Yq 4EM3A 2BC0A 2C70A 2XVJA 2RS54 3OYZA 4H2QA 3ZN1B 1YY5A 2CA5A 5LG4A 4ANJA 1LVFA 2RGJA 2DLRA 2R9ZA 3GD3A 3C98B 4O2AE 1EL9A 3ZCIA 5LJNA 2JB3A 3IWAA 4KI0F 1COV4 2E2AA 3UCLA 3LBXB 4PAGA 2VVLG 2XPKA 3HKDE 3ONJA 1GSNA 2Y48B 4IGUA 2YLRA 2LSKA 3TLUA 2NWBA 2WQYA 5LXTE 4IV9A 3LXDA 3I0OA 3IEEA 3SWHA 3PUVF 1BZLA 2X9YA 4EZHA 2WM9A 2YG7A 4HB9A 4BK1A 4EMIA 5AQJB 2BK4A 1OJCA 4H9OC 2Q6UA 3I1AA 2AR8A 2BACA 5AQMB 4GIWA 5IUXA 1SUMB 4LFCT 4X1IE 3DGZA 4YT0A 3UKFA 2VRMA 3UTGA 1LPFA 3E08A 3SQPA 1IZNB 1UUSA 1WLXA 3RRWA 1H86A 4H4UA 4AKLA 1ZV4X 4Z2UA 2C3CA 1GXFA 1VCTA 3R9UA 2BXSA 5AQFB 3FXEB 3UU6A 5EZYE 2XVFA 2QVAA 5L4HA 3O1IA 4OYJA 1AR64 3ZC0A 3C4ZA 1TDFA 1FL2A 4X20E 4IE4A 1H83A 2X8GA 5L46A 1ZX9A 1NG3A 4DV4T 5L3GB 3NK0X 2DI4A 4TLXA 4JI4T 4RG4A 3O1JA 3O9XA 2PYXA 2EQ6A 3DJJA 1D1CA 3M0OA 3RH3A 3AA0B 1F8RA 4LIIA 2UUAT 2NP9A 3AE4A 5F3JA 3P4QA 2WOVA 4IE0A 1RHI4 3DK4A 5FKYA 1I6ZA 4YWOA 3LJCA 3DMEA 5AQVB 3UUBA 3AD8B 1L0VA 1G8XA 2GF3A 1V59A 4OCGA 2A87A 1YKEB 5ABFA 2RR14 2BRYA 2GR1A 4PAAA 3I0QA 4QXCB 4IE7A 3FBLA 2BVMA 1SA0E 3ICSA 3ZMSB 5J2UE 5FMHA 4ZCCA 1XHZA 2GR3A 4EM4A 2CWOA 2WY2A 2X66A 2YU1A 3CX8B 2CFYA 1VBD4 4KHPT 3T14A 3SX6A 2GAGB 4LF8T 4H9RC 3Q6JA 5LP6E 4JY3A 5JREA 1T8BA 4NTEA 4K22A 3JCFA 3CQGB 2BK5A 2UXDT 4MFRA 5FXZA 4ZI2C 4A9WA 3EHZA 3RYCE 2X0YA 3P1WA 3QC9A 3S5WA 4GYSA 4HWIB 4TM1A 2RS34 3ONXA 2E4GA 4EXTA 3ZN0B 2WU2A 2IIDA 2A9UA 3B3RA 1IUWA 2CBJA 2DWGA 3N9PA 2BYBA 3NHOX 2X3NA 2ZLYA 4LMJA 2FJAA 3MK7C 2R7FA 3QSMA 4OPTA 3K3QC 1NWMX 1UX4A 4LF4T 4IDNA 3ZSSA 3UT5E 2UUBT 5J7XA 2MBGA 3AD7B 4ILAA 3WI3A 4G9KA 3CGEA 4A79A 1N4VA
chains in the Genus database with same CATH topology
2WP6A 3HYXA 4H2NA 3M12A 1PHHA 2Z5YA 3ITJA 5EB5A 1ZP0A 3AE3A 4WX1A 4FX9A 3T2YA 4APNA 4A6NA 4CBQA 2LFCA 2VZ2A 4A65A 5C3JA 4JDRA 3CTYA 2OLOA 4OPDA 3SYIA 1XHCA 1BF3A 1VRQB 2YWLA 1E1LA 3NG7X 4XWRA 5KOXA 2V60A 2H88A 3AEEA 2ACZA 2B9YA 5KNLA 3BI4A 4K2XA 3DJGX 2F5ZA 1ZOYA 3UKAA 1GETA 5BUKA 3DH9A 1E1KA 1S2QA 4EQWA 3SFDA 3QVPA 4UP3A 1YQZA 4CRTA 1O5WA 4H4ZA 5DBJA 1H82A 1IUUA 1TDKA 3WE0A 1D5TA 2FJEA 1F3PA 1PJ6A 4XXGA 2YG4A 3GMCA 1N4WA 3SUCA 2Q7VA 4X4JA 1PN0A 1DOBA 2EQ7A 5EBKA 2OALA 2XLSA 3CMMA 1CJ2A 3CGBA 3NTDA 4BK3A 2GR0A 2GQWA 1GEUA 3F8PA 4LU6A 5KMSA 5KMRA 2YR6A 2RGOA 4U8MA 2BA9A 2C65A 1Q1RA 3KKJA 3VRDB 4OPGA 3SZFA 1NHSA 3P9UA 4K5RA 4ADWA 2GR2A 3ZYXA 4UDPA 4MJWA 2C72A 4U8KA 2VVMA 3NN6X 4YTPA 3NH3X 4X9NA 1H7WA 4EMWA 1KDGA 1PBEA 2VQBA 2V61A 3LB8A 1OJTA 2YG3A 1D4CA 4YSZA 4CNKA 4EMJA 3AD9B 3FG2P 2YM1A 4A5LA 2WDRA 1JEHA 3FBSA 4H2RA 4H4SA 1D7LA 3VQRA 2WPFA 3DK9A 5HHFA 2B7SA 2GV8A 1IUXA 2WPCA 5LV9A 3GSIA 3KPFA 4H4TA 3UKKA 2OAMA 4GUVA 2WBAA 2XFUA 5KXJA 4J33A 2R0GA 3H4KA 1IJHA 1GRGA 1UKVG 1Y56A 2XLRA 1ELIA 2QA1A 1YQ3A 5JCNA 4ZCDA 3DJDA 4FK1A 3CPJG 2JBVA 1GTHA 1VG0A 1MO9A 4AT2A 3LJPA 2X99A 1B8SA 4NWZA 3BI5A 3CNSA 4U8JA 4DGKA 5KVHA 2RGHA 2TMDA 1XPQA 3UOYA 4OPCA 3GYIA 3D1CA 5JCKA 3RP6A 3HZLA 4GRTA 3QFAA 1ZK7A 3C4NA 2R4EA 4YTMA 4HA6A 3KPKA 1E1NA 1GREA 4EIPA 2H89A 2XVHA 1TDNA 1PBBA 1EL7A 1NHRA 2JB1A 1JRYA 1IUVA 4II2A 3T0KA 2A8XA 4CY6A 2WP5A 2E5VA 4YSXA 2B7RA 4C77A 2BXRA 3RP8A 1OJ9A 3IHMA 2XFQA 2OA1A 3ALJA 3GDPA 2O9ZA 4K5SA 4NTCA 4U8LA 4ICYA 2R0CA 2CVJA 3CPHG 4U2SA 3UOZA 1LJ1A 2AAQA 2QCUA 1GV4A 2JKCA 1DOEA 1NEKA 2CDUA 3KLJA 4J2WA 3C4AA 1TDEA 4BURA 1GESA 2WS3A 4CY8A 1NG4A 1D4EA 4JNAA 2C66A 3AECA 3ALMA 4B65A 2NVKX 3CIRA 5FS7A 5FS8A 1IUSA 1DODA 2YAUA 2C76A 2YLSA 3GWDA 4NTDA 4O5QA 4JY2A 4TM3A 4A7AA 1AOGA 1FOHA 4U2TA 3T2KA 1GNDA 3CGDA 4EQRA 2Z5XA 3UTEA 4OPLA 2X50A 4U8IA 1NDAA 3SY4A 3LZXA 3L1RA 4A6NB 3OZ2A 2ZBWA 2FJDA 3UTHA 5JCIA 2WP9A 1PXBA 2GVCA 4BJYA 3PO7A 5EB4A 1YKJA 4IVOB 3QSEA 3K7QX 3H8IA 1CC4A 2XLPA 3ZDNA 5EOWA 3E1TA 2XYOA 2JAEA 1QO8A 1Z6LA 3SZWA 2XFPA 2APGA 5JCLA 3FIMB 1H81A 2YM2A 2XVIA 4NEWA 1CJ4A 2BK3A 1CBOA 4U8PA 2VRLA 1E6EA 3GQKA 2BS4A 1NPXA 3BHFA 3K30A 2WDQA 3AEDA 1TRBA 4H4QA 5M0ZA 2PHHA 1DJNA 3P4PA 3DGHA 2FBWA 4CNJA 3T31A 4IA6A 3ICRA 1H84A 2YQUA 3JSKA 3AEBA 3NK1X 3SZ0A 3AE1A 3BHKA 2C4CA 2JB2A 1M6IA 1LV0A 2CULA 2IVEA 3K7MX 4CCQA 2UZZA 4GR1A 3ABVA 4YKFA 4ZN0A 4AT0A 3P4SA 1P2HA 3UKPA 1F6MA 1XDIA 3NGCX 4EIQA 1YQ4A 3I6DA 2QAEA 3CNPA 1PBCA 3PVCA 1PBFA 3HYVA 5CKUA 2B9WA 4REKA 3FMWA 5JCMA 1GTEA 3AE2A 3AYIA 5M10A 2YLTA 3H8LA 4GF7A 3ATQA 1JRZA 2XFNA 2ZZBA 4KPRA 3AB1A 3FPZA 5U1OA 1KNRA 3AE7A 3RNMA 2C64A 2Y6QA 3AXBA 3D8XA 4UDRA 2VVLA 4P9SA 1NHQA 2DKIA 3C96A 3UKLA 4H4RA 2YLZA 3GYJA 3AEFA 3UP5A 3GRSA 2B9XA 2RABA 2V3AA 3G5RA 3REDA 3VRBA 4NNJA 2C7GA 3GDNA 2C75A 1BWCA 1B5QA 1BGNA 1ZOVA 4G74A 4PABA 5IPYA 1CC2A 2YG6A 3G5QA 3LZWA 3RP7A 1E7PA 4YXDA 2WPEA 3EF6A 1CL0A 1ZMCA 3SFEA 2GMJA 2C3DA 1Y56B 2VQ7A 4OPIA 3UKHA 3ALLA 2GMHA 3QFBA 5CQFA 2IVDA 1PJ5A 2BABA 3VR9A 3AYLA 2V5ZA 2ARDA 1KF6A 1W4XA 4D04A 4IVMB 1DXLA 4H4XA 1GT8A 2WESA 1D4DA 1REOA 3SZCA 2HQMA 3GMBA 3NYCA 4U8NA 1OJDA 3ISHA 2XLTA 1COYA 2J3NA 3NRNA 1K4QA 4GDEA 3RHAA 3DK8A 1GOSA 3IC9A 4Z24A 4E0VA 4NEVA 4YTNA 4U2LA 4XWZA 4X9MA 2Q0LA 1KNPA 1DJQA 5C2TA 5TR3A 2AQJA 4J57A 2BC1A 5KOWA 3P4RA 4N9XA 1CC6A 4G73A 3KA7A 4H50A 2X8CA 1N1PA 4H4YA 5HXIA 3URHA 4C3YA 3M13A 3NYFA 1OJAA 3NYEA 1MOKA 1GRFA 4B67A 4BV6A 2GH5A 4AP1A 3GYXA 1GRHA 3UTFA 4EM3A 2BC0A 2C70A 1QLBA 2XVJA 4USQA 4DSGA 1KFYA 1RP0A 5KVIA 3SXIA 1S3EA 2YG5A 4G6HA 4H2QA 2GB0A 3I3LA 5FS6A 1NAAA 1GRBA 3CGCA 1YY5A 2R45A 1Q9IA 2R4JA 1ZDLA 2XCGA 1S3BA 3GRTA 3NK2X 2RGJA 4GAVA 1MXTA 4J36A 4K8DA 2R9ZA 4EQSA 3NIXA 3SGLA 3GD3A 2B76A 2GEWA 1ZMDA 3LADA 5KRQA 3V3OA 3UOXA 1EL9A 1GERA 1PBDA 4Z26A 2JB3A 3IWAA 2WHDA 3ICTA 3T37A 4TM0A 3BNMA 2ZZ0A 4TLZA 4BK2A 1H7XA 4TM4A 3UCLA 2Y6RA 4J34A 4Z25A 4ECHA 1LTXR 5KWFA 3CN8A 5U25A 2VVLG 1GSNA 3BI2A 3VRAA 2V3BA 2YLRA 4B1BA 4Z44A 2WQYA 1NHPA 4IV9A 4B64A 1VQWA 4KX6A 2YLWA 3LXDA 4B69A 3NN0X 1RSGA 3AEGA 3AE5A 2GRTA 5HYMA 1PDHA 4FDCB 1HYUA 2WU5A 2XLUA 4U8OA 1CJ3A 2WDVA 4H7UA 1BZLA 2WOIA 2X8HA 2YG7A 4JNQA 4HB9A 2Q0KA 3V3NA 1RYIA 4BK1A 4EMIA 5KMQA 5ER0A 2BK4A 1OJCA 3LOVA 4IA5A 3DA1A 1KSSA 1GALA 1H6VA 2Q6UA 4Y4NA 2WETA 1VG9A 1F8SA 2AR8A 2BACA 1CJCA 3UP4A 1PS9A 3QSSA 5KMPA 2WOWA 1GRTA 1K0LA 3DJEA 3QJ4A 4WCTA 1S2YA 5U63A 3GWFA 1B4VA 4AOSA 3DGZA 4YT0A 3UKFA 2VRMA 4YSYA 4Y4MA 3UTGA 1LPFA 4GCMA 3KVEA 3SQPA 4BJZA 1H86A 2WEUA 1EL8A 1JNZA 1CF3A 1LQUA 3GD4A 4H4UA 4Z2UA 2C3CA 4B68A 1Y0PA 1GXFA 2W0HA 3NTAA 3R9UA 4DNAA 3NNEA 2BXSA 4C5OA 3AE9A 4Z43A 2YR5A 4FK1C 4AP3A 2BS2A 2XVFA 1XANA 3NLCA 4D03A 2BCGG 4Y4LA 3S61A 1L9DA 1FL2A 1TDFA 3NT6A 3IF9A 3AE6A 4EQXA 1IUTA 1H83A 1PXCA 2X8GA 4M52A 4NZHA 5J60A 1L9CA 5L46A 1GRAA 4C74A 2BCPA 4II3A 1ONFA 1ZX9A 2YVGA 3CPIG 1NG3A 5IQ4A 3NK0X 2BS3A 4TLXA 2YVFA 2EQ8A 5GSNA 4H4WA 4RG4A 2PYXA 2E1MA 3QVRA 2EQ6A 3DJJA 4RG3A 4UDQA 2FJBA 3M0OA 2OLNA 4G6GA 4O5UA 1F8RA 1L9EA 4DSHA 1F8WA 4LIIA 4JN9A 1CHUA 1DNCA 1Q1WA 4Z2TA 3AE4A 3P4QA 2YLXA 1EBDA 1M64A 2WOVA 2GQFA 4K7ZA 1JRXA 3DK4A 2JK6A 3HYWA 3OC4A 1VDCA 2C73A 3DMEA 4JQ9A 1JU2A 4YWOA 3UOVA 3SM8A 1N4UA 3L8KA 4LA1A 3CNJA 3AD8B 1L0VA 1QJDA 2GF3A 3AWIA 3F8RA 1V59A 3KU9A 4GDPA 1JOAA 1P2EA 2XFOA 3B6DA 3IHGA 4USRA 4OCGA 4OPUA 1BKWA 3AEAA 1DOCA 2A87A 4H4PA 4AOXA 5BVAA 3EAOA 3EANA 5BRTA 2BRYA 3VR8A 2GR1A 4PAAA 2XVEA 3G5SA 4CCRA 3GQHA 1TDOA 3AYJA 4C3XA 1E1MA 1D7YA 1PJ7A 3BNUA 1SEZA 3ICSA 5FMHA 4ZCCA 2GR3A 4A99A 1FEAA 4EM4A 1ZY8A 1PXAA 3F8DA 2CFYA 1B37A 3T14A 3SX6A 1O95A 2GAGB 4I58A 2I0ZA 2A89A 3Q6JA 4B63A 4JY3A 4J31A 2ZZCA 4NTEA 4K22A 2BK5A 4YKGA 1TYTA 2C67A 2XDOA 5FS9A 4OVIA 1KSUA 2R0PA 1X31B 2NPXA 2QA2A 2YVJA 4A9WA 2BRAA 4RSLA 3P1WA 4B66A 1K0JA 1K0IA 3PS9A 3II4A 4J56A 3AE8A 3S5WA 3T2ZA 3V76A 3ADAB 5IQ1A 4TM1A 2VOUA 2DKHA 4Z2RA 2E4GA 1TYPA 1FCDA 3EPTA 2WU2A 2TPRA 3ATRA 3CNTA 2IIDA 1EL5A 3B3RA 1IUWA 1NENA 4H4VA 2GAHB 4H2PA 2BYBA 3NHOX 2X3NA 3Q9TA 2V6OA 4I59A 2YR4A 5HY5A 2FJAA 3KD9A 3QSMA 1ZKQA 4OPTA 4YSHA 1O94A 2EQ9A 3UKQA 4GAPA 3O0HA 1E39A 1BGJA 5J7XA 1JNRA 3AD7B 3K7TA 1LVLA 1FEBA 4G9KA 5GRTA 3CGEA 1LQTA 3NKSA 3CNDA 1GPEA 3COXA 2R46A 1FECA 4A79A 1N4VA 5BULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP6 A;  4H2N A;  3M12 A;  1PHH A;  2Z5Y A;  3ITJ A;  5EB5 A;  1ZP0 A;  3AE3 A;  4WX1 A;  4FX9 A;  4APN A;  4A6N A;  4CBQ A;  2LFC A;  2VZ2 A;  4A65 A;  5C3J A;  4JDR A;  3CTY A;  2OLO A;  4OPD A;  1XHC A;  1BF3 A;  1VRQ B;  2YWL A;  1E1L A;  3NG7 X;  4XWR A;  5KOX A;  2V60 A;  2H88 A;  3AEE A;  2ACZ A;  2B9Y A;  3BI4 A;  4K2X A;  3DJG X;  2F5Z A;  1ZOY A;  3UKA A;  1GET A;  5BUK A;  3DH9 A;  1E1K A;  1S2Q A;  4EQW A;  3SFD A;  3QVP A;  4UP3 A;  1YQZ A;  4CRT A;  1O5W A;  4H4Z A;  5DBJ A;  1H82 A;  1IUU A;  1TDK A;  3WE0 A;  1D5T A;  2FJE A;  1F3P A;  1PJ6 A;  4XXG A;  2YG4 A;  3GMC A;  1N4W A;  3SUC A;  2Q7V A;  4X4J A;  1PN0 A;  1DOB A;  2EQ7 A;  5EBK A;  2OAL A;  2XLS A;  4BK3 A;  1CJ2 A;  3CGB A;  3NTD A;  2GR0 A;  2GQW A;  1GEU A;  3F8P A;  4LU6 A;  2YR6 A;  2RGO A;  4U8M A;  2BA9 A;  2C65 A;  1Q1R A;  3KKJ A;  3VRD B;  4OPG A;  1NHS A;  3P9U A;  4K5R A;  4ADW A;  2GR2 A;  3ZYX A;  4UDP A;  4MJW A;  2C72 A;  4U8K A;  2VVM A;  3NN6 X;  4YTP A;  3NH3 X;  4X9N A;  1H7W A;  4EMW A;  1KDG A;  1PBE A;  2VQB A;  2V61 A;  3LB8 A;  1OJT A;  2YG3 A;  1D4C A;  4YSZ A;  4CNK A;  4EMJ A;  3AD9 B;  3FG2 P;  2YM1 A;  4A5L A;  2WDR A;  1JEH A;  3FBS A;  4H2R A;  4H4S A;  1D7L A;  3VQR A;  2WPF A;  3DK9 A;  5HHF A;  2B7S A;  2GV8 A;  1IUX A;  2WPC A;  5LV9 A;  3GSI A;  3KPF A;  4H4T A;  3UKK A;  2OAM A;  4GUV A;  2WBA A;  2XFU A;  5KXJ A;  4J33 A;  2R0G A;  3H4K A;  1IJH A;  1GRG A;  1UKV G;  1Y56 A;  2XLR A;  1ELI A;  2QA1 A;  1YQ3 A;  5JCN A;  4ZCD A;  3DJD A;  4FK1 A;  3CPJ G;  2JBV A;  1GTH A;  1VG0 A;  1MO9 A;  4AT2 A;  3LJP A;  2X99 A;  1B8S A;  3BI5 A;  3CNS A;  4U8J A;  4DGK A;  5KVH A;  2RGH A;  2TMD A;  1XPQ A;  3UOY A;  4OPC A;  3GYI A;  3D1C A;  5JCK A;  3RP6 A;  3HZL A;  4GRT A;  3QFA A;  1ZK7 A;  3C4N A;  2R4E A;  4YTM A;  4HA6 A;  1E1N A;  1GRE A;  4EIP A;  2H89 A;  2XVH A;  1TDN A;  1PBB A;  1EL7 A;  1NHR A;  2JB1 A;  1JRY A;  1IUV A;  4CY6 A;  2A8X A;  2WP5 A;  2E5V A;  4YSX A;  2B7R A;  4C77 A;  2BXR A;  3RP8 A;  1OJ9 A;  3IHM A;  2XFQ A;  2OA1 A;  3ALJ A;  3GDP A;  2O9Z A;  4K5S A;  4NTC A;  4U8L A;  4ICY A;  2R0C A;  2CVJ A;  3CPH G;  4U2S A;  3UOZ A;  1LJ1 A;  2AAQ A;  2QCU A;  1GV4 A;  2JKC A;  1DOE A;  1NEK A;  2CDU A;  3KLJ A;  4J2W A;  3C4A A;  1TDE A;  4BUR A;  1GES A;  2WS3 A;  4CY8 A;  1NG4 A;  1D4E A;  4JNA A;  2C66 A;  3AEC A;  3ALM A;  4B65 A;  2NVK X;  3CIR A;  5FS7 A;  5FS8 A;  1IUS A;  1DOD A;  2YAU A;  2C76 A;  2YLS A;  3GWD A;  4NTD A;  4O5Q A;  4JY2 A;  4TM3 A;  4A7A A;  1AOG A;  1FOH A;  4U2T A;  1GND A;  3CGD A;  4EQR A;  2Z5X A;  3UTE A;  4OPL A;  2X50 A;  4U8I A;  1NDA A;  4A6N B;  3LZX A;  3L1R A;  3OZ2 A;  2ZBW A;  2FJD A;  3UTH A;  5JCI A;  2WP9 A;  1PXB A;  2GVC A;  4BJY A;  3PO7 A;  5EB4 A;  1YKJ A;  4IVO B;  3QSE A;  3K7Q X;  3H8I A;  1CC4 A;  2XLP A;  3ZDN A;  5EOW A;  3E1T A;  2XYO A;  2JAE A;  1QO8 A;  1Z6L A;  2XFP A;  2APG A;  5JCL A;  3FIM B;  1H81 A;  2YM2 A;  2XVI A;  4NEW A;  1CJ4 A;  2BK3 A;  1CBO A;  4U8P A;  2VRL A;  1E6E A;  3GQK A;  2BS4 A;  1NPX A;  3BHF A;  3K30 A;  2WDQ A;  3AED A;  1TRB A;  4H4Q A;  5M0Z A;  2PHH A;  1DJN A;  3P4P A;  3DGH A;  2FBW A;  4CNJ A;  4IA6 A;  3ICR A;  1H84 A;  2YQU A;  3JSK A;  3AEB A;  3NK1 X;  3AE1 A;  3BHK A;  2JB2 A;  1M6I A;  1LV0 A;  2CUL A;  2IVE A;  3K7M X;  4CCQ A;  2UZZ A;  4GR1 A;  3ABV A;  4YKF A;  4ZN0 A;  4AT0 A;  3P4S A;  1P2H A;  3UKP A;  1F6M A;  1XDI A;  3NGC X;  4EIQ A;  1YQ4 A;  3I6D A;  2QAE A;  3CNP A;  1PBC A;  3PVC A;  1PBF A;  5CKU A;  2B9W A;  4REK A;  3FMW A;  5JCM A;  1GTE A;  3AE2 A;  3AYI A;  5M10 A;  2YLT A;  3H8L A;  4GF7 A;  3ATQ A;  1JRZ A;  2XFN A;  2ZZB A;  4KPR A;  3AB1 A;  3FPZ A;  5U1O A;  1KNR A;  3AE7 A;  3RNM A;  2C64 A;  2Y6Q A;  3AXB A;  3D8X A;  4UDR A;  2VVL A;  4P9S A;  1NHQ A;  2DKI A;  3C96 A;  3UKL A;  4H4R A;  2YLZ A;  3GYJ A;  3AEF A;  3UP5 A;  3GRS A;  2B9X A;  2RAB A;  2V3A A;  3G5R A;  3RED A;  3VRB A;  2C7G A;  3GDN A;  2C75 A;  1BWC A;  1B5Q A;  1BGN A;  1ZOV A;  4PAB A;  5IPY A;  1CC2 A;  2YG6 A;  3G5Q A;  3LZW A;  3RP7 A;  1E7P A;  4YXD A;  2WPE A;  3EF6 A;  1CL0 A;  1ZMC A;  3SFE A;  2GMJ A;  2C3D A;  1Y56 B;  2VQ7 A;  4OPI A;  3UKH A;  3ALL A;  2GMH A;  3QFB A;  5CQF A;  2IVD A;  1PJ5 A;  2BAB A;  3VR9 A;  3AYL A;  2V5Z A;  2ARD A;  1KF6 A;  1W4X A;  4D04 A;  4IVM B;  1DXL A;  4H4X A;  1GT8 A;  2WES A;  1D4D A;  1REO A;  2HQM A;  3GMB A;  3NYC A;  4U8N A;  1OJD A;  3ISH A;  2XLT A;  1COY A;  2J3N A;  3NRN A;  1K4Q A;  4GDE A;  3RHA A;  3DK8 A;  1GOS A;  3IC9 A;  4Z24 A;  4E0V A;  4NEV A;  4YTN A;  4U2L A;  4XWZ A;  4X9M A;  2Q0L A;  1KNP A;  1DJQ A;  5C2T A;  5TR3 A;  2AQJ A;  4J57 A;  2BC1 A;  5KOW A;  3P4R A;  4N9X A;  1CC6 A;  3KA7 A;  4H50 A;  2X8C A;  1N1P A;  4H4Y A;  5HXI A;  3URH A;  4C3Y A;  3M13 A;  3NYF A;  1OJA A;  3NYE A;  1MOK A;  1GRF A;  4B67 A;  4BV6 A;  2GH5 A;  4AP1 A;  3GYX A;  1GRH A;  3UTF A;  4EM3 A;  2BC0 A;  2C70 A;  1QLB A;  2XVJ A;  4USQ A;  4DSG A;  1KFY A;  1RP0 A;  5KVI A;  1S3E A;  2YG5 A;  4H2Q A;  2GB0 A;  3I3L A;  5FS6 A;  1NAA A;  1GRB A;  3CGC A;  1YY5 A;  2R45 A;  1Q9I A;  2R4J A;  1ZDL A;  2XCG A;  1S3B A;  3GRT A;  3NK2 X;  2RGJ A;  1MXT A;  4J36 A;  4K8D A;  2R9Z A;  4EQS A;  3NIX A;  3SGL A;  3GD3 A;  2B76 A;  2GEW A;  1ZMD A;  3LAD A;  5KRQ A;  3V3O A;  3UOX A;  1EL9 A;  1GER A;  1PBD A;  4Z26 A;  2JB3 A;  3IWA A;  2WHD A;  3ICT A;  3T37 A;  4TM0 A;  3BNM A;  2ZZ0 A;  4TLZ A;  4BK2 A;  1H7X A;  4TM4 A;  3UCL A;  2Y6R A;  4J34 A;  4Z25 A;  4ECH A;  1LTX R;  5KWF A;  3CN8 A;  5U25 A;  2VVL G;  1GSN A;  3BI2 A;  3VRA A;  2V3B A;  2YLR A;  4B1B A;  4Z44 A;  2WQY A;  1NHP A;  4IV9 A;  4B64 A;  1VQW A;  4KX6 A;  2YLW A;  3LXD A;  4B69 A;  3NN0 X;  1RSG A;  3AEG A;  3AE5 A;  2GRT A;  5HYM A;  1PDH A;  4FDC B;  1HYU A;  2WU5 A;  2XLU A;  4U8O A;  1CJ3 A;  2WDV A;  4H7U A;  1BZL A;  2WOI A;  2X8H A;  2YG7 A;  4JNQ A;  4HB9 A;  2Q0K A;  3V3N A;  1RYI A;  4BK1 A;  4EMI A;  5ER0 A;  2BK4 A;  1OJC A;  3LOV A;  4IA5 A;  3DA1 A;  1KSS A;  1GAL A;  1H6V A;  2Q6U A;  4Y4N A;  2WET A;  1VG9 A;  1F8S A;  2AR8 A;  2BAC A;  1CJC A;  3UP4 A;  1PS9 A;  3QSS A;  2WOW A;  1GRT A;  1K0L A;  3DJE A;  3QJ4 A;  4WCT A;  1S2Y A;  5U63 A;  3GWF A;  1B4V A;  4AOS A;  3DGZ A;  4YT0 A;  3UKF A;  2VRM A;  4YSY A;  4Y4M A;  3UTG A;  1LPF A;  4GCM A;  3KVE A;  3SQP A;  4BJZ A;  1H86 A;  2WEU A;  1EL8 A;  1JNZ A;  1CF3 A;  1LQU A;  3GD4 A;  4H4U A;  4Z2U A;  2C3C A;  4B68 A;  1Y0P A;  1GXF A;  2W0H A;  3NTA A;  3R9U A;  4DNA A;  3NNE A;  2BXS A;  4C5O A;  3AE9 A;  4Z43 A;  2YR5 A;  4FK1 C;  4AP3 A;  2BS2 A;  2XVF A;  1XAN A;  3NLC A;  4D03 A;  2BCG G;  4Y4L A;  3S61 A;  1L9D A;  1FL2 A;  1TDF A;  3NT6 A;  3IF9 A;  3AE6 A;  4EQX A;  1IUT A;  1H83 A;  1PXC A;  2X8G A;  4M52 A;  4NZH A;  5J60 A;  1L9C A;  5L46 A;  1GRA A;  4C74 A;  2BCP A;  1ONF A;  1ZX9 A;  2YVG A;  3CPI G;  1NG3 A;  5IQ4 A;  3NK0 X;  2BS3 A;  4TLX A;  2YVF A;  2EQ8 A;  5GSN A;  4H4W A;  4RG4 A;  2PYX A;  2E1M A;  3QVR A;  2EQ6 A;  3DJJ A;  4RG3 A;  4UDQ A;  2FJB A;  3M0O A;  2OLN A;  4O5U A;  1F8R A;  1L9E A;  4DSH A;  1F8W A;  4LII A;  4JN9 A;  1CHU A;  1DNC A;  1Q1W A;  4Z2T A;  3AE4 A;  3P4Q A;  2YLX A;  1EBD A;  1M64 A;  2WOV A;  2GQF A;  4K7Z A;  1JRX A;  3DK4 A;  2JK6 A;  3OC4 A;  1VDC A;  2C73 A;  3DME A;  4JQ9 A;  1JU2 A;  4YWO A;  3UOV A;  3SM8 A;  1N4U A;  3L8K A;  4LA1 A;  3CNJ A;  3AD8 B;  1L0V A;  1QJD A;  2GF3 A;  3AWI A;  3F8R A;  1V59 A;  3KU9 A;  4GDP A;  1JOA A;  1P2E A;  2XFO A;  3B6D A;  3IHG A;  4USR A;  4OCG A;  4OPU A;  1BKW A;  3AEA A;  1DOC A;  2A87 A;  4H4P A;  4AOX A;  5BVA A;  3EAO A;  3EAN A;  5BRT A;  2GR1 A;  3VR8 A;  4PAA A;  2XVE A;  3G5S A;  4CCR A;  3GQH A;  1TDO A;  3AYJ A;  4C3X A;  1E1M A;  1D7Y A;  1PJ7 A;  3BNU A;  1SEZ A;  3ICS A;  5FMH A;  4ZCC A;  2GR3 A;  4A99 A;  1FEA A;  4EM4 A;  1ZY8 A;  1PXA A;  3F8D A;  2CFY A;  1B37 A;  1O95 A;  2GAG B;  4I58 A;  2I0Z A;  2A89 A;  3Q6J A;  4B63 A;  4JY3 A;  4J31 A;  2ZZC A;  4NTE A;  4K22 A;  2BK5 A;  4YKG A;  1TYT A;  2C67 A;  2XDO A;  5FS9 A;  4OVI A;  1KSU A;  2R0P A;  1X31 B;  2NPX A;  2QA2 A;  2YVJ A;  4A9W A;  4RSL A;  3P1W A;  4B66 A;  1K0J A;  1K0I A;  3PS9 A;  3II4 A;  4J56 A;  3AE8 A;  3S5W A;  3V76 A;  3ADA B;  5IQ1 A;  4TM1 A;  2VOU A;  2DKH A;  4Z2R A;  2E4G A;  1TYP A;  1FCD A;  3EPT A;  2WU2 A;  2TPR A;  3ATR A;  3CNT A;  2IID A;  1EL5 A;  3B3R A;  1IUW A;  1NEN A;  4H4V A;  2GAH B;  4H2P A;  2BYB A;  3NHO X;  2X3N A;  3Q9T A;  2V6O A;  4I59 A;  2YR4 A;  5HY5 A;  2FJA A;  3KD9 A;  3QSM A;  1ZKQ A;  4OPT A;  4YSH A;  1O94 A;  2EQ9 A;  3UKQ A;  3O0H A;  1E39 A;  1BGJ A;  5J7X A;  1JNR A;  3AD7 B;  3K7T A;  1LVL A;  1FEB A;  5GRT A;  3CGE A;  1LQT A;  3NKS A;  3CND A;  1GPE A;  3COX A;  2R46 A;  1FEC A;  4A79 A;  1N4V A;  5BUL A; 
#chains in the Genus database with same CATH topology
 2WP6 A;  3M12 A;  3CKD A;  1VBE 4;  3Q5E A;  2XAH B;  3T2Y A;  4U7Y A;  4CZZ B;  4A6N A;  1AR8 4;  3ONL C;  1BF3 A;  4AIU A;  1VRQ B;  3UUX B;  5LMU T;  3JAE A;  3AEE A;  4JI8 T;  2OA5 A;  5KNL A;  2E8I A;  4K2X A;  3DJG X;  3CVR A;  2CM0 A;  2DNX A;  1XDP A;  4L5G A;  2V6X A;  1S2Q A;  4HFH A;  2VWA A;  2WB5 A;  4HWC A;  1D1A A;  3ANW A;  5AQT B;  5HEU A;  2H3R A;  5ABE A;  1H82 A;  3WE0 A;  1D5T A;  1HX1 B;  2VQF T;  1F3P A;  2PZS A;  1PJ6 A;  3GMC A;  4PNI A;  1UUR A;  3ZLI A;  1BR1 A;  1PO1 4;  3KDS E;  4UV9 B;  5L4E A;  2QRX A;  4LU6 A;  3UQ4 A;  4XZC A;  4BAY B;  5JR9 C;  1OOP D;  2BA9 A;  2KT9 A;  1Q1R A;  4OPG A;  4HWD A;  3ZYX A;  2C72 A;  4YTP A;  2CXL A;  4TWF A;  1KEY A;  4EMW A;  1KDG A;  2VQB A;  3P8C D;  4YSZ A;  4EMJ A;  3FG2 P;  3HKC E;  4H2R A;  4ZZC A;  5ABF B;  1D7L A;  3A8Y C;  4IIJ E;  2GV8 A;  4UIG A;  3KPF A;  4HTE A;  3UKK A;  4GUV A;  4IDO A;  2XFU A;  3KVA A;  5JR9 B;  5KXJ A;  2R0G A;  1LKX A;  3H4K A;  1UKV G;  1VBC 4;  2XLR A;  1ELI A;  2QA1 A;  3UFE A;  4ZCD A;  3BQK A;  2JBV A;  1EAH 4;  2L3L A;  1MO9 A;  2CLY B;  5JDQ A;  2JIW A;  4QH5 A;  4EZ4 A;  4QHO A;  3LJP A;  4NWZ A;  4DGK A;  3QK6 A;  3MZK B;  2H7V C;  3L8R A;  4JI0 T;  3D1C A;  1SE7 A;  4GRT A;  4ISS A;  2W4X A;  1UGO A;  2V1D B;  4YTM A;  1HS7 A;  1E1N A;  1GRE A;  3S4U A;  3MAC A;  3FZF B;  3NRX A;  1PBB A;  4GKK T;  2JB1 A;  4II2 A;  2LM2 A;  4X1Y E;  3V5U A;  1XNR T;  4AXP A;  4I55 E;  2L9Q A;  4U8L A;  4ICY A;  2KSR A;  2CDU A;  1TDE A;  4TNW A;  2Q9Q C;  1NG4 A;  5LHH B;  1ASJ 4;  2NVK X;  3JAD A;  3T8O A;  5FS8 A;  1DOD A;  2YLS A;  4O5Q A;  1Z8U A;  4A7A A;  3RGL A;  1D1B A;  2JQH A;  2X0H A;  3T2K A;  2PFV A;  3N9M A;  4EQR A;  2HWC 4;  3C50 A;  4A6N B;  2XAG B;  4TZ4 C;  3OZ2 A;  4C90 A;  5JCI A;  4DUY T;  1WCR A;  1YKJ A;  2D0U A;  3K7Q X;  2XLP A;  5EOW A;  3EI0 A;  1Z6L A;  5ETW A;  3FIM B;  2YM2 A;  1XNQ T;  4Q25 A;  3GQK A;  1W9R A;  3BHF A;  1T72 A;  2NTX A;  4EB6 E;  3AED A;  1TRB A;  2HPL A;  5M0Z A;  5KMG P;  1N33 T;  2JMK A;  3GN5 B;  4IA6 A;  3JSK A;  2YIN A;  2MOZ A;  5FP3 A;  2JB2 A;  5TAO A;  3K7M X;  4GR1 A;  2AXD S;  4GK5 E;  3AAE B;  2VKD A;  1M62 A;  1F6M A;  2XQ5 A;  4EIQ A;  3K3N A;  2QAE A;  2F4V T;  4CXY A;  3FMW A;  3K8P C;  3ZYM A;  4DR6 T;  1IJ5 A;  2BBH A;  3ZKR A;  1GTE A;  3BQI A;  3RYI E;  1HG2 A;  2ZZB A;  4EOZ B;  5HWX A;  4KPR A;  2XZE A;  2D2S A;  3FPZ A;  2JQQ A;  4P9S A;  1YKH B;  3GRS A;  3G5R A;  4NNJ A;  2C75 A;  1BWC A;  1BGN A;  1HRV 4;  2KMF A;  1CC2 A;  1E7P A;  3CX7 B;  4BA9 A;  3LG7 A;  4UF0 B;  2C3D A;  2I59 A;  4OPI A;  3C51 A;  3UKH A;  3ALL A;  5CQF A;  4GYR A;  1T98 A;  2BAB A;  2ARD A;  1KF6 A;  1W4X A;  1W09 A;  2X0L B;  4TV9 E;  2XHE B;  2DL1 A;  1YD8 G;  3UUN A;  5JDN A;  2CEA A;  1OJD A;  4OFZ A;  5BR8 T;  4MBQ A;  1VOM A;  2J3N A;  2XLT A;  3ISH A;  5EK4 A;  1U4Q A;  4NEV A;  4U3C A;  2LM9 A;  4YTN A;  4U2L A;  2C5K T;  2XTL A;  2AQJ A;  3P4R A;  2RA1 A;  4H4Y A;  3E0Z A;  2X68 A;  1XDO A;  3H3M A;  1FEW A;  4QH1 A;  4DV2 T;  4C3Y A;  1OJA A;  1MOK A;  2NW8 A;  4CXX A;  2GH5 A;  2WBL A;  3IHR A;  1GRH A;  5LBQ B;  2YDS A;  4USQ A;  1QLB A;  2VQE T;  1RP0 A;  4DID B;  3SXI A;  1S3E A;  2GB0 A;  3QNU A;  4HWH A;  2D0T A;  4KMC A;  1VRB A;  2XCG A;  1S3B A;  5HEG A;  3N5L A;  4GAV A;  4J36 A;  4K8D A;  5L3D B;  3SGL A;  2B76 A;  4Q4V 4;  3AA1 B;  3VKG A;  3V3O A;  2IW5 B;  2ACX A;  3PUY F;  2EHO A;  3ICT A;  2W62 A;  2ZZ0 A;  5FXW A;  2Y6X A;  1H7X A;  2Y6R A;  4Z25 A;  5KWF A;  2WCA A;  2N2N A;  2LHN A;  4Z44 A;  4B64 A;  4B69 A;  2EX3 A;  2E9X A;  3NN0 X;  1RSG A;  2GRT A;  5HYM A;  4EV6 A;  2QA7 A;  1PDH A;  4U8O A;  1CJ3 A;  3PUZ F;  2WOI A;  2X8H A;  4JNQ A;  2LFC A;  3V3N A;  2KWH A;  3AAA B;  1RYI A;  5ER0 A;  2X51 A;  4IA5 A;  3UP4 A;  5LYJ E;  1MMD A;  1PS9 A;  3QSS A;  2NR4 A;  5AQR B;  1K0L A;  4WCT A;  5U63 A;  3GWF A;  1B4V A;  3CK6 A;  4DV5 T;  2FUP A;  4Y4M A;  5HEJ A;  2VL8 A;  4A5X A;  2ODU A;  2YKS A;  4GCM A;  2WEU A;  3GD4 A;  1LQU A;  4E7Z A;  4YHH T;  3RC8 A;  3PU3 A;  3ZT7 A;  2IC6 A;  2XM1 A;  5AQN B;  2W0H A;  4J2C A;  3NNE A;  2XJ7 A;  4AP3 A;  2BS2 A;  3NLC A;  1QUU A;  4D03 A;  5JDH A;  2QGS A;  1MIW A;  3N9N A;  3NT6 A;  3IF9 A;  3AE6 A;  3ZPO A;  5LGT B;  4C74 A;  2BCP A;  4II3 A;  1ONF A;  2YVG A;  4ZI3 C;  1IAP A;  1E1H B;  3VU7 H;  4Z8X A;  2KLQ A;  3SOL A;  4PJL A;  1BR0 A;  3ZYK A;  5GSN A;  2IML A;  1SHZ C;  2YEV C;  5CJ5 A;  2E1M A;  3PDY A;  4RG3 A;  1L9E A;  5HXH A;  4JN9 A;  4A98 A;  1HCI A;  5FVL A;  3RIA A;  4Z2T A;  3TLT A;  1M64 A;  1JRX A;  4JI6 T;  3HYW A;  3E22 E;  3SS1 A;  3M65 A;  2C73 A;  1JU2 A;  1H7C A;  3R6N A;  4LA1 A;  1WYC A;  3CNJ A;  4GDP A;  3KU9 A;  1JOA A;  2XFO A;  2UXX B;  3B6D A;  5F8P A;  1DOC A;  3EAO A;  5HXC A;  3VR8 A;  2IUB A;  4AQY T;  4C3X A;  4O4I E;  3BNU A;  4A99 A;  2MPK A;  3L39 A;  4JV5 T;  1ZY8 A;  2NW7 A;  2E9X C;  5JDF A;  2C0S A;  1O95 A;  2K9A A;  4I58 A;  3LK2 B;  2I0Z A;  4B63 A;  4GOU A;  4CQI A;  3K3O A;  2XDO A;  3CQX C;  1T7S A;  2NPX A;  2EHO B;  2J47 A;  2PBI A;  4RSL A;  2HPJ A;  2GK9 A;  3AA7 B;  4B66 A;  1K0I A;  5J2T E;  3AE8 A;  4KHZ F;  3V76 A;  5IQ1 A;  1NA1 D;  2VOU A;  2DKH A;  4Z2R A;  2V7M A;  1FJG T;  2XQY A;  3TLW A;  4I0U A;  2LEH A;  4YHJ A;  2E9X B;  2LSY A;  4X64 T;  3CQC B;  3Q9T A;  4X62 T;  4I59 A;  2E5L T;  2JQ9 A;  2EQ9 A;  3UKQ A;  1E39 A;  1JNR A;  1NAF A;  5AFU L;  1FEB A;  5GRT A;  3NKS A;  3CND A;  4I50 E;  4PJN A;  3COX A;  2R46 A;  1FEC A;  2I0M A;  5BUL A;  2OLT A;  4B6X A;  5KDM C;  4P1N A;  4CBQ A;  3NRY A;  5C3J A;  3SYI A;  1XHC A;  1UK5 A;  3U78 A;  5FNV E;  2WAU A;  3I9W A;  2ODV A;  3KFW X;  5LB7 B;  3OYX A;  3AA6 B;  1XWM A;  4BJM A;  2G0U A;  1E1K A;  3QVP A;  5M4Y A;  3HA4 A;  4UEL A;  4U72 A;  1MQT D;  5DBJ A;  4ZI3 D;  4QH4 A;  1N4W A;  3SUC A;  3RIU C;  1PN0 A;  1DOB A;  2SPC A;  5EBK A;  3CMM A;  3K1S A;  3NTD A;  4P0B A;  3ZJ2 A;  1GEU A;  4PW8 A;  4YJ3 E;  5KMR A;  4KBM B;  2RGO A;  1MND A;  4O8S A;  2ZM2 A;  3VRD B;  3TLS A;  1NHS A;  4AIS A;  2K3W A;  5EK2 A;  4U8K A;  1D0Z A;  2VL0 A;  3NN6 X;  4X9N A;  5JDM A;  2R04 4;  2V61 A;  1OJT A;  1D4C A;  4CNK A;  3AD9 B;  4X65 T;  2YM1 A;  2WDR A;  1JEH A;  3FBS A;  3P7I A;  4H4S A;  1HXS 4;  2EHO D;  1PIV 4;  3ZMZ B;  3DK9 A;  2B7S A;  2D9D A;  1IUX A;  2LSI A;  2WPC A;  4WBO A;  3LFM A;  4IE6 A;  2XQ4 A;  2LRK A;  2OAM A;  5JH7 E;  1GRG A;  3DP7 A;  4EYU A;  2BBJ A;  2JJ9 A;  2E9X D;  3AAI A;  4F8H A;  4FK1 A;  2BKN A;  1J5E T;  3HL6 A;  1B8S A;  3CNS A;  4U8J A;  5KVH A;  4EEB A;  3JC6 C;  5JCK A;  4H63 H;  3KV5 A;  3H37 A;  5LNK A;  1U5P A;  3EDV A;  4IL9 A;  5CA0 E;  4DV0 T;  2XVH A;  3RI5 A;  1RVF 4;  1I94 T;  1IUV A;  3T0K A;  2A8X A;  1VBA 4;  1VCS A;  2B7R A;  4C77 A;  1HNW T;  2CMR A;  4JBW F;  4WZX A;  3CPH G;  4U2S A;  3UOZ A;  2X9H A;  1DOE A;  3C4A A;  1MNE A;  4BUR A;  4JNA A;  2C66 A;  2NW9 A;  3HKB E;  3ALM A;  3UU3 A;  4NTD A;  1AOG A;  3HR0 A;  4U2T A;  2PG8 A;  1GND A;  3CGD A;  3UTE A;  4OPL A;  4U8I A;  3X1D A;  3UTH A;  1LVK A;  5AQK B;  4AQF A;  3PUS A;  4QWN B;  4QX7 B;  1PXB A;  2X67 A;  2PY5 A;  3ZDN A;  3E1T A;  5JCL A;  4HFV A;  3RHW A;  2XAJ B;  2NTY A;  2PYJ A;  2VRL A;  2BS4 A;  5DAB A;  1NPX A;  3K30 A;  5AQQ B;  3PJA A;  3V5S A;  4CNJ A;  1XI1 A;  3SZ0 A;  3AE1 A;  3GMI A;  4CCQ A;  4DO0 A;  4ZN0 A;  3N2G E;  1P2H A;  3UKP A;  5H6Q B;  4NXM T;  2R07 4;  3I6D A;  4IRE A;  3CNP A;  3JBG 4;  3PUQ A;  5LJM A;  2UXC T;  4ZI7 E;  5CKU A;  2B9W A;  4REK A;  2XY8 B;  2YLT A;  3ZJ1 A;  3H8L A;  1W0B A;  4H9S E;  1JRZ A;  1N32 T;  2XFN A;  2JMH A;  3AB1 A;  5U1O A;  4FJO A;  3RNM A;  2Y6Q A;  2DKI A;  2YLZ A;  2LHR A;  3AEF A;  2CLY C;  2WWU A;  2RAB A;  1H8T D;  4C91 A;  2C7G A;  3F31 A;  1B5Q A;  2A2F X;  3H3A A;  3G5Q A;  4I43 B;  4YXD A;  3ESL A;  2BDE A;  1OXZ A;  3RKG A;  1HRI 4;  1CL0 A;  4AKH A;  2BVL A;  1ZMC A;  2GMJ A;  4WBN E;  2GMH A;  3I9Y A;  3VR9 A;  2V5Z A;  1S94 A;  4IVM B;  1GT8 A;  1HFA A;  2VUR A;  2HQM A;  3GMB A;  3NYC A;  4DBR A;  4U8N A;  3CPZ A;  3VKH A;  1COY A;  1ZKE A;  4DR4 T;  1K4Q A;  4JUY A;  1GOS A;  4E0V A;  3JC6 D;  1BEV 4;  4XWZ A;  4X9M A;  2Q0L A;  1DJQ A;  5C2T A;  2IDO B;  2MTQ A;  4MAL A;  2BC1 A;  1CC6 A;  4Q4W 4;  5LHG B;  3OTO T;  2X8C A;  2N1G A;  3URH A;  3M13 A;  3UUM A;  3NYE A;  1GRF A;  4TWD A;  4AP1 A;  2DCF A;  2HHH T;  3UTF A;  4DSG A;  3N2K E;  2YG5 A;  5FS6 A;  3CGC A;  1GRB A;  2YK0 A;  5L3B B;  2R45 A;  4YFS A;  4ZEY A;  3ZST A;  4DND A;  2R4J A;  3GRT A;  4K0K T;  3NK2 X;  1MXT A;  5IWA T;  1WYB A;  2UXB T;  2ES0 A;  2V7L A;  4H9P C;  4KP3 C;  1GER A;  4Z26 A;  4TV8 E;  4CI3 B;  3T37 A;  4TLZ A;  4QX8 B;  4TM4 A;  4J34 A;  2NOX A;  1LTX R;  3CN8 A;  5U25 A;  5LGN B;  3BI2 A;  4QXB B;  3RIF A;  3VRA A;  2CBI A;  4B1B A;  2HN1 A;  3ETV A;  4KX6 A;  2YLW A;  2RPA A;  3IA3 A;  2CHO A;  2X9X A;  4WNK A;  2BKP A;  1XMQ T;  4FDC B;  2WU5 A;  3HI2 A;  2Q0K A;  4QKN A;  3KBT A;  5KMQ A;  1X9B A;  3LOV A;  3ANW B;  3NKZ A;  1KSS A;  1GAL A;  1H6V A;  4Y4N A;  5FL1 A;  2WET A;  1VG9 A;  1F8S A;  3DTO A;  3DJE A;  1HNX T;  1S2Y A;  4E7S A;  3N9O A;  3RLF F;  4YSY A;  1OED A;  2K48 A;  4BJZ A;  4OYK A;  3RPU A;  1EL8 A;  1JNZ A;  1CF3 A;  2BG9 A;  3T1Y T;  4CN6 A;  3JD7 4;  2IAK A;  4B68 A;  1Y0P A;  3RKO A;  4C5O A;  4B3T T;  4Z43 A;  3UUL A;  1VRH 4;  4UVB B;  3FI7 A;  3PUX F;  1XAN A;  2C5I T;  2BCG G;  4Y4L A;  4I4T E;  5HXR A;  3MA9 A;  4ZOL E;  1MMG A;  1PXC A;  4M52 A;  1RUF 4;  5J60 A;  1L9C A;  3OJA A;  4JEU B;  2VVN A;  2W66 A;  2BS3 A;  3UTK A;  2YVF A;  2EQ8 A;  4PJJ A;  3VHL A;  2V5D A;  5F5W A;  3QVR A;  3EAM A;  4EGW A;  4UDQ A;  2FJB A;  5FL0 A;  4G6G A;  4KUM B;  1N36 T;  4DSH A;  1F8W A;  5HXE A;  1CHU A;  4PDW D;  1DNC A;  1HR0 T;  2YLX A;  2JQK A;  1EBD A;  5HCM A;  2GQF A;  1Y64 B;  1W0A A;  1XMO T;  2LT3 A;  3UOV A;  3EAB A;  1N4U A;  3EVY A;  4JI2 T;  1QJD A;  3VQR A;  3IHG A;  4USR A;  3PTR B;  5LHI B;  1BKW A;  4H4P A;  3CWZ B;  4AOX A;  5JTG A;  5HWY A;  3EAN A;  2XVE A;  3G5S A;  4CCR A;  3GQH A;  3FB2 A;  4ZHQ E;  5L3C B;  5JRC A;  2V8S V;  3WAK A;  1UX5 A;  1EZ3 A;  1RUH 4;  2XQ8 A;  3CX6 B;  1FEA A;  3P50 A;  4MLK A;  3F8D A;  1B37 A;  1PVC 4;  2A89 A;  3AXJ A;  5L2L A;  4NXN T;  5H6R B;  4O4H E;  5FS9 A;  2C67 A;  4OVI A;  1KSU A;  2R0P A;  3LK3 B;  2QA2 A;  2YVJ A;  3GWH A;  3ZYL A;  2BRA A;  4U31 A;  3RC3 A;  1AL2 4;  4J56 A;  1YXR A;  2ZM8 A;  3CNT A;  1EL5 A;  2AE9 A;  2XQ7 A;  4EIW A;  2BG9 C;  4Q4X 4;  2V7J A;  2V6O A;  2YR4 A;  4B3S T;  3KD9 A;  2UXN B;  5LG3 A;  3HKE E;  3PUR A;  4OK0 A;  3W15 B;  1O94 A;  3FZL B;  3M3Z B;  5FY7 A;  1LQT A;  4LF9 T;  3OKQ A;  2IC9 A;  2CRB A;  4H2N A;  5LGU B;  5CFB A;  4DR2 T;  3ETU A;  2Z5Y A;  1ZP0 A;  5BMV E;  5EB5 A;  4ZZB A;  4FX9 A;  2W00 A;  1E2A A;  1FMW A;  2VKH A;  5ADX L;  2VZ2 A;  3RQU A;  1DU2 A;  3LK4 2;  2BG9 B;  3BQL A;  4CN1 A;  2PTF A;  5E0O A;  3KV9 A;  4AKR B;  2XAQ B;  4LF5 T;  3BK9 A;  4XWR A;  5KOX A;  4U2Y A;  2V60 A;  1WFD A;  2H88 A;  2JRK A;  5LCY A;  3BI4 A;  2QYW A;  1ZOY A;  3UKA A;  4A56 A;  5BUK A;  2KND A;  4LF7 T;  4HWF A;  4EQW A;  4M1P A;  3SFD A;  1YQZ A;  2DWK A;  5JQG E;  4EYY R;  1TDK A;  1J5W A;  4UV8 B;  2FJE A;  2KXP B;  4XAX B;  2YG4 A;  2X9W A;  5IYZ E;  2XQA A;  4X4J A;  4BK3 A;  3UFG A;  1CJ2 A;  4HFE A;  3CGB A;  2LRL A;  5AQU B;  2GQW A;  4H63 V;  3F8P A;  3ZEF B;  4P0A A;  1FMV A;  4NUU A;  2LSG A;  3PUA A;  5FY0 A;  4U8M A;  4HEA A;  1HX8 A;  3SZF A;  4K5R A;  4ADW A;  3B57 A;  3ZC1 A;  5C8Y E;  2VVM A;  5FY1 A;  2V6Y A;  4UXN B;  4Z91 A;  1PBE A;  3LB8 A;  3AVS A;  2PJQ A;  2YG3 A;  3N9Q A;  4A5L A;  4DR1 T;  1D0Y A;  1GQE A;  5JRC B;  2EHO C;  1PO2 4;  4H4T A;  5FMN A;  5HEH A;  2WBA A;  4J33 A;  2IIU A;  1YQ3 A;  5JCN A;  3CPJ G;  1GTH A;  3AXJ B;  2J4G A;  3EDU A;  2CE7 A;  2X99 A;  3FXD B;  3MKD A;  1XPQ A;  2TMD A;  2R6G F;  2WSS V;  2YOE A;  3RP6 A;  4EAH A;  1ZK7 A;  3RYF E;  3C4N A;  2ZM0 A;  3O4X E;  2H7O A;  3KPK A;  5LBM A;  2VK9 A;  3SRZ A;  5GON E;  3QOF A;  3L3P A;  4WW0 A;  2J62 A;  2WZH A;  3NBX X;  1NHR A;  4PK5 A;  4CY6 A;  1JRY A;  4XBF B;  2WP5 A;  2W67 A;  2E5V A;  4YSX A;  2BXR A;  3RP8 A;  1YW0 A;  4L9I A;  3ALJ A;  5HEO A;  2O9Z A;  4K5S A;  2CVJ A;  1LJ1 A;  2AAQ A;  2QCU A;  1GV4 A;  1NEK A;  3KLJ A;  1GES A;  4CY8 A;  5AQH B;  1S35 A;  4B65 A;  3LSV A;  3CIR A;  5FS7 A;  2LLY A;  2YAU A;  2C76 A;  4TM3 A;  4JLE A;  2V5C A;  2Z5X A;  1NDA A;  3LZX A;  1RUD 4;  4B3R T;  5EB4 A;  3QSE A;  2CHN A;  4EED A;  2JAE A;  5JVD E;  1QO8 A;  3SZW A;  2XFP A;  3UQ7 A;  1MIV A;  2APG A;  2HH7 A;  1H81 A;  5A1L A;  4UVA B;  4OX9 T;  2BK3 A;  1CBO A;  3PU8 A;  1E6E A;  3O1H A;  5J1G A;  1RUC 4;  1HG5 A;  2WDQ A;  3B13 A;  3OPC A;  3Q9D A;  4F6R C;  4H4Q A;  3P4P A;  4IL4 A;  1H84 A;  2YQU A;  1VBB 4;  2C4C A;  1LV0 A;  2CUL A;  2UZZ A;  3ABV A;  2X5I D;  4YKF A;  4AT0 A;  3P4S A;  3CML A;  1WRD A;  2MAW A;  4K0U A;  1AR9 4;  5JDL A;  1IJ6 A;  1D0X A;  3C64 A;  3OVU A;  2YN6 A;  2L8K A;  3AYI A;  4GF7 A;  4PFO A;  2XQ6 A;  5CA1 E;  2V6Y B;  3RX6 A;  3AE7 A;  1OWA A;  3D8X A;  3NZQ A;  4UDR A;  3UKL A;  4H4R A;  3GYJ A;  2B9X A;  2WWV A;  3VRB A;  5AQG B;  5IPY A;  3TKL B;  2N9D A;  2YG6 A;  4TWH A;  2R06 4;  3Q2M A;  5L3E B;  2BKO A;  2YDR A;  2WPE A;  2WMN A;  3PE0 A;  1PJ5 A;  2WZI A;  2RM2 4;  4D04 A;  2HWB 4;  4H4X A;  2WES A;  1D4D A;  1Y01 A;  1REO A;  3SZC A;  5JDG A;  1R8I A;  5HAX A;  4GDE A;  4Z24 A;  3UU5 A;  1RUE 4;  3RQW A;  1KNP A;  1RUI 4;  5TR3 A;  2RMU 4;  4IST A;  4YY3 T;  2XSB A;  4AQG A;  4N9X A;  4H50 A;  4PK6 A;  5AQL B;  5HXI A;  1N1P A;  5L3F B;  3B5M A;  3NYF A;  4B67 A;  4BV6 A;  5JR9 A;  3GYX A;  4DR3 T;  4DV6 T;  1KFY A;  5KVI A;  4G6H A;  3FZM B;  2LKH A;  3I3L A;  2RP4 A;  3QUJ A;  1NAA A;  1UCU A;  1Q9I A;  4NUV A;  4BJN A;  3Q5D A;  1ZDL A;  3TLV A;  1M7K A;  5DQW A;  4EQS A;  2V7K A;  1Z7S 4;  3NIX A;  2GEW A;  3LAD A;  3N9L A;  5CGM A;  1ZMD A;  5KRQ A;  2A3D A;  3UOX A;  1PBD A;  4PK4 A;  2WHD A;  4IDQ A;  1V9D A;  4TM0 A;  4B3M T;  3BNM A;  3DJB A;  4BK2 A;  4ECH A;  5LMN T;  4HFB A;  3KV4 A;  2LOS A;  4Q4Y 4;  3FZK B;  2V3B A;  1NHP A;  1VQW A;  2W0G A;  3AEG A;  3AE5 A;  4RHV 4;  1HYU A;  2XLU A;  4TN7 B;  2WDV A;  4A97 A;  4H7U A;  3J8F 4;  3DA1 A;  4DV3 T;  3NZP A;  5ABG A;  1CJC A;  2V26 A;  3LDQ B;  3Q5X A;  2WOW A;  5KMP A;  1GRT A;  3QJ4 A;  4FI5 A;  4AOS A;  4Z90 A;  5FYM A;  3ZMT B;  3KVE A;  1WR6 A;  2VVS A;  2Q9Q A;  4ZXL A;  4PFP A;  3NTA A;  4DNA A;  3RF1 A;  3AE9 A;  2YR5 A;  4FK1 C;  4CXW A;  4O4L E;  5ABH A;  3WAJ A;  2CXD A;  3GN5 A;  3S61 A;  5IHY A;  4H9Q C;  4HGA A;  1L9D A;  2CXF A;  4EQX A;  2CWY A;  1IUT A;  4NZH A;  1GRA A;  4DBQ A;  5KX5 E;  3CPI G;  4CI1 B;  3KV6 A;  2ZM6 T;  5FVK A;  5IQ4 A;  1WR0 A;  4JI3 T;  1ZEE A;  2HN2 A;  4DUZ T;  4H4W A;  3IF8 B;  2OLN A;  4O5U A;  4QXH B;  4UVC B;  1Q1W A;  5LOV E;  2XUE A;  2D5U A;  4JI7 T;  3D0T A;  4K7Z A;  2JK6 A;  1HNZ T;  3OC4 A;  4PJM A;  2P9B A;  3RYH E;  1VDC A;  4JQ9 A;  1X79 A;  3SM8 A;  3L8K A;  3FHN A;  3PJA J;  3AWI A;  3F8R A;  1P2E A;  1OED E;  3N2O A;  3NWI A;  4OPU A;  3GA8 A;  3AEA A;  2BG9 E;  5BVA A;  5BRT A;  1K5M D;  4UF0 A;  4G63 A;  4HN9 A;  1TDO A;  4X1K E;  4AQF C;  3AYJ A;  1RUG 4;  3A5X A;  1E1M A;  2XSA A;  1D7Y A;  2KZ7 B;  1PJ7 A;  4G2A A;  1SEZ A;  3AB3 B;  5J0Z A;  1PXA A;  4WYV A;  4CI2 B;  2LOP A;  2I6H A;  4O4J E;  4J31 A;  4ZI2 D;  2ZZC A;  4YKG A;  1TYT A;  3G06 A;  4COF A;  2XAS B;  4LFA T;  1X31 B;  4IDZ A;  3FBZ A;  1D4M 4;  1IBL T;  1POV 0;  1K0J A;  3PS9 A;  3II4 A;  1MMA A;  3T2Z A;  3ADA B;  4DMV A;  1US7 B;  1TYP A;  2XM2 A;  1FCD A;  1G73 A;  3EPT A;  2TPR A;  3ATR A;  2KIN B;  3OBV E;  4CN4 A;  4H4V A;  1NEN A;  4HE8 A;  1NCQ D;  2GAH B;  4H2P A;  4TX5 A;  4JI5 T;  2C5J A;  2VAS A;  1XHX A;  1FIO A;  1ZKQ A;  4YSH A;  4GAP A;  3O0H A;  1BGJ A;  4ILU A;  3K7T A;  5DQV A;  3ZMU B;  1LVL A;  3PV0 F;  4ILB A;  1GPE A;  2CCQ A;  1NHQ A;  3HYX A;  1PHH A;  3ITJ A;  4LML A;  3AE3 A;  4UR9 A;  4WX1 A;  1Z0P A;  3Q5W A;  4APN A;  4A65 A;  4JDR A;  4OPD A;  3CTY A;  2OLO A;  3F2E A;  4IDP A;  4DVD A;  2LJL A;  3QB5 K;  5HCJ A;  2YWL A;  1E1L A;  2ZMA A;  2IHR 1;  3NG7 X;  2Q9Q B;  2B9Y A;  2ACZ A;  2F5Z A;  4JI1 T;  1GET A;  3UU8 A;  3DH9 A;  2M6B A;  4GK0 E;  4UP3 A;  4CRT A;  1O5W A;  1IBM T;  4U33 A;  4H4Z A;  2Y8D A;  1IUU A;  1HTJ F;  4ERR A;  5AQO B;  3U3I A;  4GKJ T;  4XXG A;  4ILC A;  4IHJ E;  5HXS A;  2Q7V A;  4IT4 A;  2EQ7 A;  2OAL A;  2XLS A;  2LSJ A;  1O3X A;  2GR0 A;  2K24 A;  5KMS A;  2YR6 A;  2V7I A;  2C65 A;  3KKJ A;  3P9U A;  3ZMV B;  2GR2 A;  4UDP A;  4MJW A;  3FZH B;  3KIN B;  3NH3 X;  4LFB T;  1H7W A;  4X5T A;  4TUY E;  4HKA A;  3EUH A;  4LMK A;  2JPF A;  3QB5 A;  1MMN A;  3JAF A;  2CPT A;  2WPF A;  1KNZ A;  5HHF A;  2VB6 A;  2XQ3 A;  3ZCJ A;  5LV9 A;  2M67 A;  4NIQ A;  4AKG A;  3GSI A;  4NPP A;  2LKG A;  1IJH A;  1Y56 A;  3MXZ A;  3DJD A;  1VG0 A;  4U74 A;  1BR2 A;  1IBK T;  4UEM A;  4O2B E;  4AT2 A;  3BI5 A;  4V1A v;  2RGH A;  3UOY A;  4AKI A;  3GYI A;  4OPC A;  2J1D G;  3T1H T;  3HZL A;  3QFA A;  2VKJ A;  2R4E A;  4HA6 A;  4H9N C;  4EIP A;  1RMU 4;  2H89 A;  1TDN A;  4JEH B;  5DJQ C;  1KK7 A;  1EL7 A;  1AJ3 A;  2PLV 4;  4GB3 4;  5FXX A;  5EK3 A;  4ADZ A;  4DV1 T;  2YU2 A;  1OJ9 A;  2B1E A;  2XFQ A;  1OED C;  2OA1 A;  3IHM A;  3GDP A;  4NTC A;  2Q9Q D;  5AQS B;  2R0C A;  1AR7 4;  2JKC A;  4J2W A;  2LE8 A;  2WS3 A;  1D4E A;  1RUJ 4;  3AEC A;  2UUC T;  2XAF B;  1IUS A;  5HY5 A;  3GWD A;  3ZT5 A;  2K5B B;  4JY2 A;  1FOH A;  1B7T A;  2PW9 A;  1BR4 A;  4DV7 T;  2X50 A;  5CB4 E;  3SY4 A;  3L1R A;  1J1J A;  2FJD A;  3PUW F;  4P09 A;  2ZBW A;  2WP9 A;  2GVC A;  4BJY A;  1R09 4;  1HF8 A;  3PO7 A;  1LRZ A;  2OV9 A;  4IVO B;  3H8I A;  3LBX A;  2KWI B;  1OED B;  1CC4 A;  2XYO A;  3P4W A;  2XVI A;  4NEW A;  1CJ4 A;  4ASK A;  1CUN A;  2YDQ A;  4U8P A;  5L47 A;  4HFC A;  2PHH A;  1DJN A;  3DGH A;  2FBW A;  3IBP A;  4U7I A;  4HFD A;  3T31 A;  3L09 A;  3ICR A;  3AEB A;  4ZS3 A;  3AVR A;  5AQP B;  5FXV A;  3KBU A;  3BHK A;  3NK1 X;  1M6I A;  4N78 D;  2IVE A;  1N34 T;  3MJX A;  5HYA A;  1XDI A;  3NGC X;  4YLH A;  2W2U A;  1YQ4 A;  4DMW A;  1PBC A;  2W63 A;  3PVC A;  1PBF A;  2Z6E A;  3HYV A;  1R08 4;  5AQI B;  5JCM A;  3F57 A;  5LA6 E;  3AE2 A;  2UU9 T;  5M10 A;  3J9X 1;  3ATQ A;  2VKO A;  1KNR A;  2C64 A;  3AXB A;  2MYS A;  4HFI A;  2VVL A;  3C96 A;  3PUG A;  1EV1 4;  4DR5 T;  3UP5 A;  1QSD A;  2M6I A;  2V3A A;  3RED A;  1MIY A;  3GDN A;  3ZT6 A;  1ZOV A;  4G74 A;  4PAB A;  2WMO A;  3LZW A;  3RP7 A;  2PYL A;  3UU4 A;  2A72 A;  2W61 A;  2XQ9 A;  3EF6 A;  4OHF A;  3SFE A;  4AI6 A;  4ZS2 A;  1ZHC A;  1Y56 B;  2VQ7 A;  2BZB A;  3QFB A;  2IVD A;  3AYL A;  1DXL A;  2DHR A;  3RRC A;  4IE5 A;  1XZY A;  4MHC A;  4YJ2 E;  3NRN A;  3RHA A;  3DK8 A;  3IC9 A;  4L0R A;  3KVB A;  4U2Z A;  4X66 T;  3C4X A;  4J57 A;  4LF6 T;  5KOW A;  3RIU A;  4G73 A;  3KA7 A;  3NVO A;  4DR7 T;  3R84 B;  3C4W A;  4JYA T;  3A7M A;  2RS1 4;  4TNV A;  3J7Y q;  4EM3 A;  2BC0 A;  2C70 A;  2XVJ A;  2RS5 4;  3OYZ A;  4H2Q A;  3ZN1 B;  1YY5 A;  2CA5 A;  5LG4 A;  4ANJ A;  1LVF A;  2RGJ A;  2DLR A;  2R9Z A;  3GD3 A;  3C98 B;  4O2A E;  1EL9 A;  3ZCI A;  5LJN A;  2JB3 A;  3IWA A;  4KI0 F;  1COV 4;  2E2A A;  3UCL A;  3LBX B;  4PAG A;  2VVL G;  2XPK A;  3HKD E;  3ONJ A;  1GSN A;  2Y48 B;  4IGU A;  2YLR A;  2LSK A;  3TLU A;  2NWB A;  2WQY A;  5LXT E;  4IV9 A;  3LXD A;  3I0O A;  3IEE A;  3SWH A;  3PUV F;  1BZL A;  2X9Y A;  4EZH A;  2WM9 A;  2YG7 A;  4HB9 A;  4BK1 A;  4EMI A;  5AQJ B;  2BK4 A;  1OJC A;  4H9O C;  2Q6U A;  3I1A A;  2AR8 A;  2BAC A;  5AQM B;  4GIW A;  5IUX A;  1SUM B;  4LFC T;  4X1I E;  3DGZ A;  4YT0 A;  3UKF A;  2VRM A;  3UTG A;  1LPF A;  3E08 A;  3SQP A;  1IZN B;  1UUS A;  1WLX A;  3RRW A;  1H86 A;  4H4U A;  4AKL A;  1ZV4 X;  4Z2U A;  2C3C A;  1GXF A;  1VCT A;  3R9U A;  2BXS A;  5AQF B;  3FXE B;  3UU6 A;  5EZY E;  2XVF A;  2QVA A;  5L4H A;  3O1I A;  4OYJ A;  1AR6 4;  3ZC0 A;  3C4Z A;  1TDF A;  1FL2 A;  4X20 E;  4IE4 A;  1H83 A;  2X8G A;  5L46 A;  1ZX9 A;  1NG3 A;  4DV4 T;  5L3G B;  3NK0 X;  2DI4 A;  4TLX A;  4JI4 T;  4RG4 A;  3O1J A;  3O9X A;  2PYX A;  2EQ6 A;  3DJJ A;  1D1C A;  3M0O A;  3RH3 A;  3AA0 B;  1F8R A;  4LII A;  2UUA T;  2NP9 A;  3AE4 A;  5F3J A;  3P4Q A;  2WOV A;  4IE0 A;  1RHI 4;  3DK4 A;  5FKY A;  1I6Z A;  4YWO A;  3LJC A;  3DME A;  5AQV B;  3UUB A;  3AD8 B;  1L0V A;  1G8X A;  2GF3 A;  1V59 A;  4OCG A;  2A87 A;  1YKE B;  5ABF A;  2RR1 4;  2BRY A;  2GR1 A;  4PAA A;  3I0Q A;  4QXC B;  4IE7 A;  3FBL A;  2BVM A;  1SA0 E;  3ICS A;  3ZMS B;  5J2U E;  5FMH A;  4ZCC A;  1XHZ A;  2GR3 A;  4EM4 A;  2CWO A;  2WY2 A;  2X66 A;  2YU1 A;  3CX8 B;  2CFY A;  1VBD 4;  4KHP T;  3T14 A;  3SX6 A;  2GAG B;  4LF8 T;  4H9R C;  3Q6J A;  5LP6 E;  4JY3 A;  5JRE A;  1T8B A;  4NTE A;  4K22 A;  3JCF A;  3CQG B;  2BK5 A;  2UXD T;  4MFR A;  5FXZ A;  4ZI2 C;  4A9W A;  3EHZ A;  3RYC E;  2X0Y A;  3P1W A;  3QC9 A;  3S5W A;  4GYS A;  4HWI B;  4TM1 A;  2RS3 4;  3ONX A;  2E4G A;  4EXT A;  3ZN0 B;  2WU2 A;  2IID A;  2A9U A;  3B3R A;  1IUW A;  2CBJ A;  2DWG A;  3N9P A;  2BYB A;  3NHO X;  2X3N A;  2ZLY A;  4LMJ A;  2FJA A;  3MK7 C;  2R7F A;  3QSM A;  4OPT A;  3K3Q C;  1NWM X;  1UX4 A;  4LF4 T;  4IDN A;  3ZSS A;  3UT5 E;  2UUB T;  5J7X A;  2MBG A;  3AD7 B;  4ILA A;  3WI3 A;  4G9K A;  3CGE A;  4A79 A;  1N4V A; 
#chains in the Genus database with same CATH homology
 2WP6 A;  3HYX A;  4H2N A;  3M12 A;  1PHH A;  2Z5Y A;  3ITJ A;  5EB5 A;  1ZP0 A;  3AE3 A;  4WX1 A;  4FX9 A;  3T2Y A;  4APN A;  4A6N A;  4CBQ A;  2LFC A;  2VZ2 A;  4A65 A;  5C3J A;  4JDR A;  3CTY A;  2OLO A;  4OPD A;  3SYI A;  1XHC A;  1BF3 A;  1VRQ B;  2YWL A;  1E1L A;  3NG7 X;  4XWR A;  5KOX A;  2V60 A;  2H88 A;  3AEE A;  2ACZ A;  2B9Y A;  5KNL A;  3BI4 A;  4K2X A;  3DJG X;  2F5Z A;  1ZOY A;  3UKA A;  1GET A;  5BUK A;  3DH9 A;  1E1K A;  1S2Q A;  4EQW A;  3SFD A;  3QVP A;  4UP3 A;  1YQZ A;  4CRT A;  1O5W A;  4H4Z A;  5DBJ A;  1H82 A;  1IUU A;  1TDK A;  3WE0 A;  1D5T A;  2FJE A;  1F3P A;  1PJ6 A;  4XXG A;  2YG4 A;  3GMC A;  1N4W A;  3SUC A;  2Q7V A;  4X4J A;  1PN0 A;  1DOB A;  2EQ7 A;  5EBK A;  2OAL A;  2XLS A;  3CMM A;  1CJ2 A;  3CGB A;  3NTD A;  4BK3 A;  2GR0 A;  2GQW A;  1GEU A;  3F8P A;  4LU6 A;  5KMS A;  5KMR A;  2YR6 A;  2RGO A;  4U8M A;  2BA9 A;  2C65 A;  1Q1R A;  3KKJ A;  3VRD B;  4OPG A;  3SZF A;  1NHS A;  3P9U A;  4K5R A;  4ADW A;  2GR2 A;  3ZYX A;  4UDP A;  4MJW A;  2C72 A;  4U8K A;  2VVM A;  3NN6 X;  4YTP A;  3NH3 X;  4X9N A;  1H7W A;  4EMW A;  1KDG A;  1PBE A;  2VQB A;  2V61 A;  3LB8 A;  1OJT A;  2YG3 A;  1D4C A;  4YSZ A;  4CNK A;  4EMJ A;  3AD9 B;  3FG2 P;  2YM1 A;  4A5L A;  2WDR A;  1JEH A;  3FBS A;  4H2R A;  4H4S A;  1D7L A;  3VQR A;  2WPF A;  3DK9 A;  5HHF A;  2B7S A;  2GV8 A;  1IUX A;  2WPC A;  5LV9 A;  3GSI A;  3KPF A;  4H4T A;  3UKK A;  2OAM A;  4GUV A;  2WBA A;  2XFU A;  5KXJ A;  4J33 A;  2R0G A;  3H4K A;  1IJH A;  1GRG A;  1UKV G;  1Y56 A;  2XLR A;  1ELI A;  2QA1 A;  1YQ3 A;  5JCN A;  4ZCD A;  3DJD A;  4FK1 A;  3CPJ G;  2JBV A;  1GTH A;  1VG0 A;  1MO9 A;  4AT2 A;  3LJP A;  2X99 A;  1B8S A;  4NWZ A;  3BI5 A;  3CNS A;  4U8J A;  4DGK A;  5KVH A;  2RGH A;  2TMD A;  1XPQ A;  3UOY A;  4OPC A;  3GYI A;  3D1C A;  5JCK A;  3RP6 A;  3HZL A;  4GRT A;  3QFA A;  1ZK7 A;  3C4N A;  2R4E A;  4YTM A;  4HA6 A;  3KPK A;  1E1N A;  1GRE A;  4EIP A;  2H89 A;  2XVH A;  1TDN A;  1PBB A;  1EL7 A;  1NHR A;  2JB1 A;  1JRY A;  1IUV A;  4II2 A;  3T0K A;  2A8X A;  4CY6 A;  2WP5 A;  2E5V A;  4YSX A;  2B7R A;  4C77 A;  2BXR A;  3RP8 A;  1OJ9 A;  3IHM A;  2XFQ A;  2OA1 A;  3ALJ A;  3GDP A;  2O9Z A;  4K5S A;  4NTC A;  4U8L A;  4ICY A;  2R0C A;  2CVJ A;  3CPH G;  4U2S A;  3UOZ A;  1LJ1 A;  2AAQ A;  2QCU A;  1GV4 A;  2JKC A;  1DOE A;  1NEK A;  2CDU A;  3KLJ A;  4J2W A;  3C4A A;  1TDE A;  4BUR A;  1GES A;  2WS3 A;  4CY8 A;  1NG4 A;  1D4E A;  4JNA A;  2C66 A;  3AEC A;  3ALM A;  4B65 A;  2NVK X;  3CIR A;  5FS7 A;  5FS8 A;  1IUS A;  1DOD A;  2YAU A;  2C76 A;  2YLS A;  3GWD A;  4NTD A;  4O5Q A;  4JY2 A;  4TM3 A;  4A7A A;  1AOG A;  1FOH A;  4U2T A;  3T2K A;  1GND A;  3CGD A;  4EQR A;  2Z5X A;  3UTE A;  4OPL A;  2X50 A;  4U8I A;  1NDA A;  3SY4 A;  3LZX A;  3L1R A;  4A6N B;  3OZ2 A;  2ZBW A;  2FJD A;  3UTH A;  5JCI A;  2WP9 A;  1PXB A;  2GVC A;  4BJY A;  3PO7 A;  5EB4 A;  1YKJ A;  4IVO B;  3QSE A;  3K7Q X;  3H8I A;  1CC4 A;  2XLP A;  3ZDN A;  5EOW A;  3E1T A;  2XYO A;  2JAE A;  1QO8 A;  1Z6L A;  3SZW A;  2XFP A;  2APG A;  5JCL A;  3FIM B;  1H81 A;  2YM2 A;  2XVI A;  4NEW A;  1CJ4 A;  2BK3 A;  1CBO A;  4U8P A;  2VRL A;  1E6E A;  3GQK A;  2BS4 A;  1NPX A;  3BHF A;  3K30 A;  2WDQ A;  3AED A;  1TRB A;  4H4Q A;  5M0Z A;  2PHH A;  1DJN A;  3P4P A;  3DGH A;  2FBW A;  4CNJ A;  3T31 A;  4IA6 A;  3ICR A;  1H84 A;  2YQU A;  3JSK A;  3AEB A;  3NK1 X;  3SZ0 A;  3AE1 A;  3BHK A;  2C4C A;  2JB2 A;  1M6I A;  1LV0 A;  2CUL A;  2IVE A;  3K7M X;  4CCQ A;  2UZZ A;  4GR1 A;  3ABV A;  4YKF A;  4ZN0 A;  4AT0 A;  3P4S A;  1P2H A;  3UKP A;  1F6M A;  1XDI A;  3NGC X;  4EIQ A;  1YQ4 A;  3I6D A;  2QAE A;  3CNP A;  1PBC A;  3PVC A;  1PBF A;  3HYV A;  5CKU A;  2B9W A;  4REK A;  3FMW A;  5JCM A;  1GTE A;  3AE2 A;  3AYI A;  5M10 A;  2YLT A;  3H8L A;  4GF7 A;  3ATQ A;  1JRZ A;  2XFN A;  2ZZB A;  4KPR A;  3AB1 A;  3FPZ A;  5U1O A;  1KNR A;  3AE7 A;  3RNM A;  2C64 A;  2Y6Q A;  3AXB A;  3D8X A;  4UDR A;  2VVL A;  4P9S A;  1NHQ A;  2DKI A;  3C96 A;  3UKL A;  4H4R A;  2YLZ A;  3GYJ A;  3AEF A;  3UP5 A;  3GRS A;  2B9X A;  2RAB A;  2V3A A;  3G5R A;  3RED A;  3VRB A;  4NNJ A;  2C7G A;  3GDN A;  2C75 A;  1BWC A;  1B5Q A;  1BGN A;  1ZOV A;  4G74 A;  4PAB A;  5IPY A;  1CC2 A;  2YG6 A;  3G5Q A;  3LZW A;  3RP7 A;  1E7P A;  4YXD A;  2WPE A;  3EF6 A;  1CL0 A;  1ZMC A;  3SFE A;  2GMJ A;  2C3D A;  1Y56 B;  2VQ7 A;  4OPI A;  3UKH A;  3ALL A;  2GMH A;  3QFB A;  5CQF A;  2IVD A;  1PJ5 A;  2BAB A;  3VR9 A;  3AYL A;  2V5Z A;  2ARD A;  1KF6 A;  1W4X A;  4D04 A;  4IVM B;  1DXL A;  4H4X A;  1GT8 A;  2WES A;  1D4D A;  1REO A;  3SZC A;  2HQM A;  3GMB A;  3NYC A;  4U8N A;  1OJD A;  3ISH A;  2XLT A;  1COY A;  2J3N A;  3NRN A;  1K4Q A;  4GDE A;  3RHA A;  3DK8 A;  1GOS A;  3IC9 A;  4Z24 A;  4E0V A;  4NEV A;  4YTN A;  4U2L A;  4XWZ A;  4X9M A;  2Q0L A;  1KNP A;  1DJQ A;  5C2T A;  5TR3 A;  2AQJ A;  4J57 A;  2BC1 A;  5KOW A;  3P4R A;  4N9X A;  1CC6 A;  4G73 A;  3KA7 A;  4H50 A;  2X8C A;  1N1P A;  4H4Y A;  5HXI A;  3URH A;  4C3Y A;  3M13 A;  3NYF A;  1OJA A;  3NYE A;  1MOK A;  1GRF A;  4B67 A;  4BV6 A;  2GH5 A;  4AP1 A;  3GYX A;  1GRH A;  3UTF A;  4EM3 A;  2BC0 A;  2C70 A;  1QLB A;  2XVJ A;  4USQ A;  4DSG A;  1KFY A;  1RP0 A;  5KVI A;  3SXI A;  1S3E A;  2YG5 A;  4G6H A;  4H2Q A;  2GB0 A;  3I3L A;  5FS6 A;  1NAA A;  1GRB A;  3CGC A;  1YY5 A;  2R45 A;  1Q9I A;  2R4J A;  1ZDL A;  2XCG A;  1S3B A;  3GRT A;  3NK2 X;  2RGJ A;  4GAV A;  1MXT A;  4J36 A;  4K8D A;  2R9Z A;  4EQS A;  3NIX A;  3SGL A;  3GD3 A;  2B76 A;  2GEW A;  1ZMD A;  3LAD A;  5KRQ A;  3V3O A;  3UOX A;  1EL9 A;  1GER A;  1PBD A;  4Z26 A;  2JB3 A;  3IWA A;  2WHD A;  3ICT A;  3T37 A;  4TM0 A;  3BNM A;  2ZZ0 A;  4TLZ A;  4BK2 A;  1H7X A;  4TM4 A;  3UCL A;  2Y6R A;  4J34 A;  4Z25 A;  4ECH A;  1LTX R;  5KWF A;  3CN8 A;  5U25 A;  2VVL G;  1GSN A;  3BI2 A;  3VRA A;  2V3B A;  2YLR A;  4B1B A;  4Z44 A;  2WQY A;  1NHP A;  4IV9 A;  4B64 A;  1VQW A;  4KX6 A;  2YLW A;  3LXD A;  4B69 A;  3NN0 X;  1RSG A;  3AEG A;  3AE5 A;  2GRT A;  5HYM A;  1PDH A;  4FDC B;  1HYU A;  2WU5 A;  2XLU A;  4U8O A;  1CJ3 A;  2WDV A;  4H7U A;  1BZL A;  2WOI A;  2X8H A;  2YG7 A;  4JNQ A;  4HB9 A;  2Q0K A;  3V3N A;  1RYI A;  4BK1 A;  4EMI A;  5KMQ A;  5ER0 A;  2BK4 A;  1OJC A;  3LOV A;  4IA5 A;  3DA1 A;  1KSS A;  1GAL A;  1H6V A;  2Q6U A;  4Y4N A;  2WET A;  1VG9 A;  1F8S A;  2AR8 A;  2BAC A;  1CJC A;  3UP4 A;  1PS9 A;  3QSS A;  5KMP A;  2WOW A;  1GRT A;  1K0L A;  3DJE A;  3QJ4 A;  4WCT A;  1S2Y A;  5U63 A;  3GWF A;  1B4V A;  4AOS A;  3DGZ A;  4YT0 A;  3UKF A;  2VRM A;  4YSY A;  4Y4M A;  3UTG A;  1LPF A;  4GCM A;  3KVE A;  3SQP A;  4BJZ A;  1H86 A;  2WEU A;  1EL8 A;  1JNZ A;  1CF3 A;  1LQU A;  3GD4 A;  4H4U A;  4Z2U A;  2C3C A;  4B68 A;  1Y0P A;  1GXF A;  2W0H A;  3NTA A;  3R9U A;  4DNA A;  3NNE A;  2BXS A;  4C5O A;  3AE9 A;  4Z43 A;  2YR5 A;  4FK1 C;  4AP3 A;  2BS2 A;  2XVF A;  1XAN A;  3NLC A;  4D03 A;  2BCG G;  4Y4L A;  3S61 A;  1L9D A;  1FL2 A;  1TDF A;  3NT6 A;  3IF9 A;  3AE6 A;  4EQX A;  1IUT A;  1H83 A;  1PXC A;  2X8G A;  4M52 A;  4NZH A;  5J60 A;  1L9C A;  5L46 A;  1GRA A;  4C74 A;  2BCP A;  4II3 A;  1ONF A;  1ZX9 A;  2YVG A;  3CPI G;  1NG3 A;  5IQ4 A;  3NK0 X;  2BS3 A;  4TLX A;  2YVF A;  2EQ8 A;  5GSN A;  4H4W A;  4RG4 A;  2PYX A;  2E1M A;  3QVR A;  2EQ6 A;  3DJJ A;  4RG3 A;  4UDQ A;  2FJB A;  3M0O A;  2OLN A;  4G6G A;  4O5U A;  1F8R A;  1L9E A;  4DSH A;  1F8W A;  4LII A;  4JN9 A;  1CHU A;  1DNC A;  1Q1W A;  4Z2T A;  3AE4 A;  3P4Q A;  2YLX A;  1EBD A;  1M64 A;  2WOV A;  2GQF A;  4K7Z A;  1JRX A;  3DK4 A;  2JK6 A;  3HYW A;  3OC4 A;  1VDC A;  2C73 A;  3DME A;  4JQ9 A;  1JU2 A;  4YWO A;  3UOV A;  3SM8 A;  1N4U A;  3L8K A;  4LA1 A;  3CNJ A;  3AD8 B;  1L0V A;  1QJD A;  2GF3 A;  3AWI A;  3F8R A;  1V59 A;  3KU9 A;  4GDP A;  1JOA A;  1P2E A;  2XFO A;  3B6D A;  3IHG A;  4USR A;  4OCG A;  4OPU A;  1BKW A;  3AEA A;  1DOC A;  2A87 A;  4H4P A;  4AOX A;  5BVA A;  3EAO A;  3EAN A;  5BRT A;  2BRY A;  3VR8 A;  2GR1 A;  4PAA A;  2XVE A;  3G5S A;  4CCR A;  3GQH A;  1TDO A;  3AYJ A;  4C3X A;  1E1M A;  1D7Y A;  1PJ7 A;  3BNU A;  1SEZ A;  3ICS A;  5FMH A;  4ZCC A;  2GR3 A;  4A99 A;  1FEA A;  4EM4 A;  1ZY8 A;  1PXA A;  3F8D A;  2CFY A;  1B37 A;  3T14 A;  3SX6 A;  1O95 A;  2GAG B;  4I58 A;  2I0Z A;  2A89 A;  3Q6J A;  4B63 A;  4JY3 A;  4J31 A;  2ZZC A;  4NTE A;  4K22 A;  2BK5 A;  4YKG A;  1TYT A;  2C67 A;  2XDO A;  5FS9 A;  4OVI A;  1KSU A;  2R0P A;  1X31 B;  2NPX A;  2QA2 A;  2YVJ A;  4A9W A;  2BRA A;  4RSL A;  3P1W A;  4B66 A;  1K0J A;  1K0I A;  3PS9 A;  3II4 A;  4J56 A;  3AE8 A;  3S5W A;  3T2Z A;  3V76 A;  3ADA B;  5IQ1 A;  4TM1 A;  2VOU A;  2DKH A;  4Z2R A;  2E4G A;  1TYP A;  1FCD A;  3EPT A;  2WU2 A;  2TPR A;  3ATR A;  3CNT A;  2IID A;  1EL5 A;  3B3R A;  1IUW A;  1NEN A;  4H4V A;  2GAH B;  4H2P A;  2BYB A;  3NHO X;  2X3N A;  3Q9T A;  2V6O A;  4I59 A;  2YR4 A;  5HY5 A;  2FJA A;  3KD9 A;  3QSM A;  1ZKQ A;  4OPT A;  4YSH A;  1O94 A;  2EQ9 A;  3UKQ A;  4GAP A;  3O0H A;  1E39 A;  1BGJ A;  5J7X A;  1JNR A;  3AD7 B;  3K7T A;  1LVL A;  1FEB A;  4G9K A;  5GRT A;  3CGE A;  1LQT A;  3NKS A;  3CND A;  1GPE A;  3COX A;  2R46 A;  1FEC A;  4A79 A;  1N4V A;  5BUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...