3VRAA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
total genus 192
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vraA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vraA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vraA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vraA04
2GRTA 2V61A 4OPIA 1PBBA 2XDOA 1GXFA 2YVGA 4K22A 1DODA 1NEKA 3P4PA 1H7WA 1Q1WA 2YLWA 3DK8A 3EPTA 5BULA 3Q6JA 4OCGA 4OPLA 2H88A 2BS4A 1Z6LA 3BHKA 1CC6A 1LTXR 4U8KA 1Q1RA 2UZZA 3GRTA 4YWOA 1XDIA 4B67A 1XPQA 5LV9A 2J3NA 1D7LA 3LJPA 1QJDA 3ALJA 2XLSA 3ITJA 2AQJA 2O9ZA 3EANA 2R4EA 4BV6A 1DJNA 1PBDA 1FEAA 2Q0LA 1JNRA 2JB3A 4RSLA 5FS8A 2BXRA 2F5ZA 1CJ4A 1P2HA 2ZZCA 3CNDA 3IHMA 2R0GA 3NYEA 5IPYA 4HA6A 1F8SA 4B1BA 4A6NB 1N4VA 1RP0A 2B7SA 4WCTA 2R0PA 5JCKA 1FEBA 3S5WA 1IUSA 1GTEA 4ZCDA 1BGJA 2ZZBA 1PBEA 1TDKA 4O5UA 1L9DA 3CNPA 3SQPA 3GWFA 2BCPA 3GWDA 4UDRA 5IQ1A 2WOVA 3RP6A 3QFAA 3BI4A 5C2TA 3ZYXA 3SFDA 1YY5A 3BI5A 3PO7A 1D4DA 4GDEA 4XXGA 4CBQA 4U8MA 2B9YA 2ARDA 4JN9A 4NTDA 4C3YA 4IV9A 1ZP0A 2XVHA 1PN0A 2WDVA 4H4QA 5CQFA 5FS9A 1H84A 4TM0A 3REDA 3KD9A 3GYJA 2YVJA 3RP7A 3UP4A 4K2XA 3NLCA 4IA6A 3P4SA 1RSGA 3CGEA 5KRQA 1Y56B 4H4PA 2VVMA 4EIPA 1TDOA 1W4XA 1NG4A 2BA9A 2EQ6A 2XCGA 3QSMA 2WETA 2ZBWA 4H4XA 4K8DA 4AP1A 4CNKA 3ICTA 4GUVA 5KOXA 4U8IA 2A89A 2BACA 1NENA 1GREA 1PS9A 1UKVG 2BS2A 3OC4A 4U8NA 1H6VA 3PVCA 3ADAB 4Z26A 2WDQA 1VDCA 1KNPA 4TM3A 1NHRA 1JRXA 2VVLA 3II4A 4I59A 3NRNA 3R9UA 3SUCA 1E1MA 4IA5A 2TMDA 1IUTA 2JBVA 3UOVA 1Q9IA 4LU6A 3AB1A 1DOCA 3FMWA 4H2PA 2GQFA 1E1LA 2OAMA 2GAGB 2PYXA 1ZMDA 3VQRA 2GH5A 3AE3A 2XVFA 3G5SA 2WDRA 3BNUA 3B6DA 2WQYA 4IVOB 4CNJA 3DGZA 1VG9A 3GDPA 1IUXA 1BZLA 1V59A 3GQHA 4J33A 1JRYA 4AT0A 4AP3A 3ATQA 1CBOA 3COXA 2C75A 1X31B 1MO9A 1MOKA 1PXCA 3K7TA 1IUUA 3M12A 4H4SA 2YLXA 2WOIA 4CY8A 3AE5A 1S2YA 2QA2A 4YKGA 3FG2P 4A79A 4I58A 4USQA 1OJTA 3K7MX 2W0HA 4NTCA 4H4UA 3AEEA 4Z44A 3AEBA 1VG0A 1F3PA 3AEGA 1D4CA 5KOWA 1B8SA 3LZWA 5GSNA 1TDFA 3UTGA 1PDHA 4ZN0A 3SFEA 3CPJG 3O0HA 2A8XA 1O5WA 3NG7X 3KLJA 1YQ3A 2RGOA 3AWIA 3DJEA 1CC4A 3GDNA 3CGBA 1D4EA 5EB5A 3DK9A 1OJCA 3AYJA 3QVRA 3QVPA 3UKFA 4OPGA 4FDCB 2GB0A 1PJ7A 2R45A 3M13A 3UTFA 2VQ7A 4BJZA 1NDAA 1REOA 1TYPA 3FIMB 4P9SA 1K0JA 4H2NA 1K0IA 2GEWA 2VQBA 4WX1A 2IIDA 1MXTA 2Y6QA 1KFYA 2BABA 1PXBA 3G5RA 1K4QA 4U2SA 3SM8A 1NHSA 4X9MA 1NHQA 3V3NA 3VRBA 2VRLA 5KVHA 2BCGG 1BF3A 1YKJA 4NEWA 2C7GA 3L8KA 4UDQA 1EL7A 5JCIA 1M64A 1S3EA 4AOXA 5BUKA 1B37A 4AOSA 3CIRA 2B9WA 1HYUA 3CNJA 2Q6UA 2YM2A 4NEVA 4ZCCA 5J60A 5BVAA 3UTHA 1XANA 4JDRA 3AE2A 4U8LA 3ALLA 1H81A 4Z2TA 4J57A 2FJBA 1ZOVA 1CJ2A 5KWFA 3AE8A 1GPEA 4EMIA 2ZZ0A 2V3BA 2XLPA 4A9WA 1CJCA 4YSZA 1ZOYA 2BYBA 1OJDA 2C76A 3IC9A 4U8JA 4C3XA 2AAQA 4D04A 2C3DA 1EL9A 2Q7VA 3M0OA 3RNMA 1XHCA 3UCLA 2R9ZA 2YWLA 3EF6A 3P9UA 4DNAA 1ZMCA 3CGCA 3F8DA 3BNMA 1DJQA 1FOHA 3P1WA 3AD7B 5ER0A 2XFUA 1F6MA 3S61A 3AD8B 3ALMA 1GRFA 2BC1A 4J56A 2YAUA 2YG6A 1GRTA 4RG4A 2YLSA 1GNDA 3IHGA 4OPCA 2VVLG 1FCDA 2BXSA 3KA7A 1LJ1A 3PS9A 2NVKX 3NK1X 2X50A 2E5VA 1ZDLA 3KKJA 5HY5A 4YTPA 3I6DA 3ATRA 2FJEA 4K5SA 3WE0A 2A87A 1TDNA 2X8GA 1GV4A 3BHFA 4ICYA 4Z43A 3P4RA 2YM1A 3NHOX 3QFBA 2GMJA 3DMEA 2YR4A 3NIXA 1N1PA 2WEUA 4B68A 2E4GA 2GV8A 4Y4NA 2BK3A 1ELIA 1IUVA 3KVEA 4U2TA 1NHPA 2V3AA 3NTAA 4M52A 4E0VA 2V5ZA 5JCNA 4BURA 4H2QA 2JKCA 1N4UA 3NK2X 3ISHA 3AEDA 2OLNA 3HZLA 2YLTA 4OPTA 5L46A 1CL0A 3NK0X 5FS6A 2OLOA 2B76A 3UKLA 2GR0A 2WP6A 1TRBA 1E39A 2C67A 3DA1A 3GD3A 1S3BA 1PJ6A 1RYIA 3C4NA 4JY2A 3KU9A 4H4ZA 4LA1A 1PHHA 3NN0X 4H4VA 1H86A 1JRZA 4H7UA 1DNCA 3I3LA 1L9EA 1BGNA 3SGLA 1S2QA 4J34A 3CNSA 3V3OA 1Y0PA 2YG4A 2RABA 3D1CA 2AR8A 2WESA 4A5LA 4B69A 2FBWA 2NPXA 4C77A 3AE7A 4EM4A 2X3NA 3AECA 4TLZA 2BC0A 1ZX9A 2V60A 3FPZA 3CPIG 4YKFA 4CCRA 4YTMA 4K5RA 1GTHA 1JEHA 3GYXA 1QO8A 1D7YA 3UKHA 1L9CA 4A65A 1CF3A 3GD4A 3VRDB 3G5QA 5IQ4A 1E1KA 1FL2A 3T37A 3C96A 2EQ7A 1SEZA 4EQSA 2WU2A 2XVIA 2ACZA 2YLRA 3AD9B 1VRQB 3LZXA 3NNEA 3Q9TA 5U1OA 3GQKA 1NAAA 2OALA 1NPXA 3GMCA 5M10A 3IF9A 4EQXA 3UOYA 3AE1A 4XWZA 2Y6RA 2XVJA 4GR1A 4H4RA 1LQUA 2GAHB 1NG3A 4KX6A 4JQ9A 2VOUA 1KSUA 3UKKA 4YSYA 1GRAA 1YQ4A 5HXIA 5C3JA 3K30A 2Q0KA 3L1RA 1GERA 3JSKA 3DH9A 3OZ2A 4H4TA 1PBCA 4J31A 4IVMB 5HYMA 2YG3A 2YR5A 2YQUA 1B5QA 3E1TA 4EM3A 1TYTA 3VR8A 1LVLA 3RP8A 2FJAA 1JNZA 2C73A 4C74A 4GRTA 4N9XA 4EMJA 3CN8A 4YSXA 3AYIA 4A7AA 4H50A 4O5QA 1D5TA 2JAEA 3ICSA 5DBJA 4J2WA 2BK4A 2QA1A 2V6OA 4ADWA 1JOAA 1TDEA 3QSSA 5KXJA 4PAAA 4OPDA 5CKUA 2XYOA 3LOVA 4GF7A 4REKA 3UKPA 4FK1A 2XLTA 2GR2A 4APNA 2JB1A 3AE4A 2PHHA 1IUWA 2R46A 4EIQA 3NKSA 4FX9A 1PBFA 1ZY8A 5JCLA 3GYIA 1KSSA 2WBAA 1Y56A 5EBKA 5EB4A 2WPEA 2LFCA 3UOXA 3BI2A 2WPCA 2XLUA 1KNRA 3D8XA 3DJDA 4XWRA 5JCMA 1BKWA 1LQTA 1GRBA 2YG7A 2X8HA 4J36A 1GALA 1O95A 3CTYA 4DSGA 3UOZA 2C3CA 1COYA 4YXDA 1N4WA 1VQWA 3KPFA 2DKIA 1H83A 5J7XA 2WHDA 1E6EA 2C70A 4H4YA 1FECA 1GEUA 1ZKQA 2CULA 2X8CA 3LADA 3NYCA 4OPUA 4EQWA 4TM4A 1LV0A 2Z5XA 3H8IA 5HHFA 1PJ5A 5GRTA 4X9NA 3UP5A 3FBSA 1EL5A 2XFQA 3AEAA 2VRMA 4A99A 2GVCA 3F8RA 4LIIA 3GSIA 4JNAA 1YQZA 2YLZA 5FS7A 1ZK7A 4H2RA 2WPFA 3H8LA 1DOEA 1O94A 4Z25A 2E1MA 1CHUA 2YR6A 4U8PA 4B63A 3F8PA 3P4QA 4YTNA 1DOBA 1H7XA 2BK5A 2GF3A 2HQMA 2WU5A 3B3RA 5KVIA 2APGA 2XVEA 3VRAA 4JNQA 2YG5A 4EMWA 4RG3A 3NT6A 4CY6A 2QAEA 4OVIA 3DJJA 3UKAA 1F8RA 3UKQA 3GMBA 1H82A 3UTEA 4EQRA 4BJYA 2C72A 3EAOA 2TPRA 3NTDA 1JU2A 3ABVA 2GR3A 2WP5A 2B7RA 4NTEA 3AXBA 2RGJA 4B65A 4YSHA 4HB9A 1CJ3A 1GETA 2CFYA 4USRA 2XFNA 1GESA 4GCMA 4CRTA 2WOWA 4MJWA 4K7ZA 1ONFA 5FMHA 1E7PA 3C4AA 4TLXA 4UDPA 2WP9A 2QCUA 3CGDA 5BRTA 3GRSA 3URHA 2R4JA 4FK1C 3IWAA 4U8OA 3NH3X 2XFOA 1OJAA 2GR1A 3K7QX 2IVDA 2VZ2A 4NZHA 4H4WA 3AE9A 2JB2A 5TR3A 3DK4A 4D03A 3H4KA 1GSNA 4U2LA 3ICRA 3QJ4A 4Z2RA 2BS3A 4AT2A 4BK3A 1KF6A 2I0ZA 3VR9A 1L0VA 4B64A 1GT8A 4JY3A 2H89A 3RHAA 1PXAA 5U63A 2GMHA 2YVFA 2XFPA 1CC2A 3NGCX 4DGKA 2EQ9A 4ECHA 2RGHA 4Y4LA 2DKHA 1K0LA 3LXDA 1QLBA 4YT0A 1F8WA 1KDGA 2IVEA 1IJHA 2C64A 4GDPA 4DSHA 3CNTA 4UP3A 1DXLA 4Z24A 4A6NA 2FJDA 3AEFA 1LPFA 1M6IA 2GQWA 2B9XA 3V76A 1GOSA 4BK2A 1E1NA 1EL8A 1AOGA 4CCQA 1BWCA 4Z2UA 4B66A 2CDUA 2CVJA 2XLRA 1OJ9A 4X4JA 1B4VA 3QSEA 2WS3A 2EQ8A 4BK1A 3ZDNA 4Y4MA 5U25A 2C65A 2OA1A 3NYFA 1EBDA 2R0CA 3NN6X 2Z5YA 1GRHA 3AE6A 2JK6A 2C66A 4PABA 4TM1A 4C5OA 5EOWA 5M0ZA 3DGHA 3LB8A 3DJGX 1GRGA 4KPRA 1P2EA 3CPHG 2X99A 3AYLA
chains in the Genus database with same CATH superfamily
2GRTA 4OPIA 3AA6B 4IDZA 1NEKA 1DODA 4H63H 3Q6JA 3ZMUB 4OPLA 4DV0T 5HYAA 4DR2T 2PYJA 2V7LA 4YWOA 2UUCT 3MACA 4EZHA 1D7LA 3ALJA 4TV8E 2AQJA 5CJ5A 5FS8A 4HFEA 4EYUA 3IHMA 5IPYA 4HFIA 1F8SA 4B1BA 2B7SA 5FXWA 1PBEA 5J0ZA 5L3EB 3GWDA 4IE5A 3CVRA 3RP6A 2LJLA 2XAGB 4P0AA 3QFAA 3ZYKA 2WM9A 2CRBA 1YY5A 2KLQA 1T72A 1D4DA 2K3WA 3R84B 5JDLA 5LGUB 2K48A 1ZP0A 2XVHA 5FS9A 4TM0A 5HXRA 3PE0A 1UGOA 4CI2B 3GYJA 3UP4A 2WY2A 4B3MT 3AB3B 3GWHA 2VVMA 4X64T 1W4XA 2EQ6A 2W00A 5IYZE 1Y01A 2WETA 2ZBWA 4K8DA 4CNKA 5H6QB 5KOXA 1NENA 2V6XA 3OC4A 4HKAA 2BS2A 3DP7A 3ADAB 2WDQA 4YHHT 1GQEA 3ZN1B 1NHRA 2VVLA 3II4A 1E1MA 4A56A 2TMDA 2DWGA 2JBVA 4PK4A 2GQFA 2PYXA 4IGUA 2N1GA 2M6IA 4LF8T 2WDRA 4X20E 4GB34 3DGZA 3GDPA 1IUXA 1BZLA 4P09A 4J33A 4AT0A 4AP3A 2KNDA 3IA3A 4ZS2A 4TX5A 1MOKA 3M12A 3N2OA 2YN6A 4DBQA 5FNVE 2XAHB 1S2YA 2QA2A 4N78D 2YOEA 4ADZA 5LCYA 4H4UA 3AEBA 4DIDB 5GSNA 1TDFA 4F6RC 5ABEA 4QH4A 3SFEA 4U2ZA 3RRWA 2V6YB 2V7IA 1DU2A 1YQ3A 5J1GA 2W67A 4BJNA 5EK4A 1CC4A 2XY8B 3VHLA 4PDWD 3PU3A 2KT9A 1XMOT 3UKFA 4U72A 4FDCB 4KBMB 2XQ8A 2PTFA 3SY4A 1TYPA 4P9SA 1SHZC 1K0IA 4HE8A 2HN1A 4DV6T 2BABA 1FMWA 2LOSA 3ONJA 1LVKA 4II2A 5LG3A 1NHQA 3VRBA 3V3NA 3H3AA 2BCGG 1YKJA 1VBA4 2C7GA 2XQ3A 4AOXA 4UELA 2LRLA 4AOSA 5AQFB 4JI8T 1QSDA 5LP6E 3CNJA 3ZMSB 1VRH4 4WNKA 4CN4A 3KINB 2PY5A 4COFA 1W9RA 3N9PA 4O4IE 3CQGB 3ALLA 3PUGA 3UTKA 4J57A 4ZZBA 4DBRA 2ZZ0A 3ZT6A 1MQTD 1UX5A 4A9WA 1J5WA 2HPJA 1ZOYA 3OYZA 1OJDA 4C3XA 3UFEA 5HXCA 3RNMA 2QA7A 4ILCA 4MFRA 4JI0T 1DJQA 3KV9A 4LF9T 3S61A 2HH7A 1GRTA 2YK0A 4RG4A 2YDSA 3KA7A 5LXTE 4ERRA 1KEYA 2X50A 2NTXA 2X66A 3I6DA 3ATRA 2FJEA 4HN9A 4H9PC 4AKIA 3WE0A 2A87A 4U33A 1TDNA 3BHFA 3P4RA 2YM1A 3NHOX 2YR4A 2WEUA 2E4GA 1T7SA 3KVEA 2X9YA 4LFAT 1NHPA 3NTAA 4M52A 4L9IA 4NPPA 4BURA 2UXNB 1N4UA 1XMQT 3NK2X 5LBQB 1J5ET 3AEDA 2OLNA 3HZLA 2I6HA 3C4XA 2WP6A 1PJ6A 1S3BA 5CGMA 3KU9A 3RYIE 4H4ZA 2BVMA 4H4VA 1JRZA 4H7UA 3SGLA 4CI3B 2IIUA 4UV8B 3AAIA 3RHWA 2P9BA 1D0YA 5HEJA 4X62T 2VKOA 4EM4A 2X3NA 1UCUA 2NR4A 4CCRA 4M1PA 1QO8A 3UKHA 3ZJ1A 1L9CA 4A65A 1E1KA 1FL2A 2V1DB 5AQSB 4G9KA 5FP3A 1VBC4 2ACZA 2YLRA 3LZXA 1VRQB 4LF7T 5IUXA 2OALA 3IF9A 3UUNA 4ZI7E 2H7OA 5FKYA 4GR1A 4KI0F 3PUAA 1LQUA 4H4RA 4PK6A 1NG3A 2UXBT 4YSYA 1YQ4A 5HXIA 3RIUC 3C98B 3K8PC 1MIWA 2HPLA 2JRKA 4DR5T 1GERA 2BKOA 5HYMA 4H4TA 2Y6XA 1FIOA 1Z0PA 4OFZA 4EM3A 3VR8A 2VWAA 3BQKA 3P7IA 4A7AA 3UU8A 4H50A 2W0GA 2EHOC 2JAEA 3PURA 4FJOA 2KWHA 4O2BE 2BK4A 4ADWA 2IMLA 3T2KA 3KVBA 3EABA 4OPDA 2XLTA 4CZZB 3SXIA 2JB1A 2R7FA 4EAHA 2X9XA 4FX9A 3KV6A 4EEDA 2E2AA 2LHNA 4LFCT 4B6XA 1Y56A 2LFCA 1AR74 2WPCA 3RC8A 4Q4V4 2B1EA 3CMLA 5CA0E 2VKDA 3Q5XA 3CX7B 4DSGA 4ILUA 4YXDA 1MMNA 4EXTA 1N4WA 2WBLA 5J7XA 4QXCB 5HEHA 2WHDA 1FECA 1GEUA 1ZKQA 2CULA 4OPUA 4EQWA 2UUAT 5LBMA 1LV0A 3NKZA 5HHFA 5L2LA 4Q4Y4 2W62A 3ETVA 1EL5A 4TWFA 1NAFA 2LRKA 2HN2A 2YLZA 2V5CA 1ZK7A 1DOEA 4MLKA 5FVKA 4XBFB 4AQFC 4DUYT 2E1MA 2YR6A 2HQMA 2WU5A 4HFBA 2XVEA 5JH7E 2ZM0A 3FBLA 2YG5A 4RG3A 4GYSA 2DLRA 2YU1A 3E0ZA 3GMIA 3ZYLA 3UKQA 1H82A 2JQQA 4BJYA 5LGNB 3B5MA 3EAOA 2TPRA 2Q9QA 2B7RA 2LKGA 2A72A 3SZFA 4GAPA 4K7ZA 1RUD4 3Q2MA 3VKHA 4NWZA 1E2AA 4TLXA 2N2NA 4UDPA 4DV2T 4E7ZA 1IBMT 3URHA 4DV3T 4FK1C 3IWAA 3HKDE 3M65A 3TLSA 3TKLB 4O8SA 1E1HB 2YDRA 1FJGT 2XFOA 2GR1A 3K7QX 2IVDA 2Y8DA 2LT3A 4H4WA 3AE9A 2JB2A 4NXMT 3DK4A 4JI3T 1AR94 1B7TA 5AQKB 5AQIB 2BS3A 4BK3A 1KF6A 2EHOB 1L0VA 4XAXB 4JY3A 3SX6A 2UU9T 2XFPA 4GKKT 4JI1T 4DGKA 4Y4LA 4ZOLE 4BJMA 2W61A 5LHHB 5IWAT 1WFDA 2IVEA 1IJHA 2C64A 4GDPA 4JI2T 3CNTA 3T0KA 1QUUA 1UUSA 2B9XA 2GQWA 3P50A 4BK2A 1VBE4 2W4XA 4ZS3A 3R6NA 5LGTB 4DV5T 4B66A 3HL6A 2XLRA 2VL0A 2EQ8A 5EK3A 4Y4MA 1SUMB 5ADXL 1GRHA 4PABA 4TM1A 5M0ZA 3NLCA 1P2EA 3CPHG 2X99A 1PBBA 2XDOA 4NXNT 2YVGA 1N33T 3P4PA 3DK8A 5BULA 5JDMA 1Z6LA 3BHKA 5AQQB 3RYFE 1CC6A 1Q1RA 3GRTA 4EZ4A 1XPQA 2XQYA 2J3NA 3L3PA 2XLSA 1JNRA 4RSLA 3ONLC 5KX5E 2BXRA 2ZZCA 2R0GA 4UF0A 3AA1B 1O3XA 1I94T 5LJMA 3SS1A 2R0PA 4ZCDA 1BGJA 2ZZBA 4UR9A 1L9DA 1UK5A 4WYVA 4UDRA 3OTOT 4P1NA 5C2TA 2LLYA 3SFDA 3BI5A 4G6HA 2LOPA 3PO7A 2DHRA 3AAEB 2B9YA 2ARDA 4JN9A 4H4QA 2NW8A 1XI1A 4AQYT 4UVAB 5FY1A 2L9QA 4DR4T 4K2XA 4B3ST 2CHOA 1RSGA 3CGEA 3T14A 2V7JA 4EIPA 3ZSTA 1TDOA 2XCGA 1NG4A 3QSMA 4QH5A 2MBGA 4GUVA 3O4XE 4U8IA 4U8NA 3O1HA 3GA8A 2IDOB 3PVCA 2BG9A 4C90A 1VDCA 4TM3A 2XQAA 1JRXA 4I59A 4UF0B 2WCAA 1IUTA 4TZ4C 3UOVA 4LU6A 3NZQA 3PUXF 5ABFA 2YEVC 4IDOA 1E1LA 2GH5A 3KV5A 2WQYA 5AQJB 5HWYA 2ZM6T 3GQHA 3EI0A 1X31B 1MO9A 2KXPB 1PXCA 1IUUA 1RUC4 3S4UA 2YLXA 2WOIA 2X0YA 4CY8A 1HNXT 4QXBB 4USQA 5CA1E 4NTCA 3AEEA 2JMKA 4Z44A 3KPKA 3OYXA 4O4LE 3LFMA 5HXEA 1PDHA 3O0HA 4CN1A 4HFCA 4ILAA 5HCJA 3AWIA 3M3ZB 1IBLT 4QX7B 3DK9A 3AYJA 3QVPA 3H3MA 2VL8A 4OPGA 4BAYB 2GB0A 1S35A 3UTFA 4BJZA 2VQ7A 2R074 1K0JA 2C5KT 3FZFB 2VQBA 1MIYA 1KFYA 3JD74 5ABFB 1PXBA 3JC6D 3SM8A 1NHSA 3FI7A 5KVHA 4WBOA 2RR14 4YY3T 3BQLA 1M64A 3TLTA 1B37A 3CIRA 1IZNB 2Q6UA 2QGSA 2VKJA 3N5LA 3PJAA 4ZCCA 2PBIA 3LDQB 5J60A 2N9DA 4A97A 4LMLA 2FJBA 1POV0 1ZOVA 1CJ2A 3AE8A 4LF6T 3ZT7A 4YSZA 5KMGP 5AQLB 2C76A 3AAAB 3N9QA 4D04A 1EL9A 3RPUA 3UCLA 1XHCA 4LMKA 3P9UA 3EF6A 2WSSV 1ZMCA 2RM24 3F8DA 1WCRA 5L3FB 1FOHA 2XFUA 4JEUB 2IAKA 1F6MA 4U2YA 1G73A 2YAUA 2K9AA 4ZXLA 4II3A 4IDQA 4CXWA 5HAXA 4OYKA 4HWCA 3IHGA 2WB5A 1LJ1A 3PS9A 5AQOB 1ZDLA 3KKJA 1VCTA 1VOMA 3FXEB 2J1DG 5KMRA 1T98A 5FY0A 3L8RA 2X8GA 1NCQD 2GMJA 4NIQA 3W15B 4AXPA 1N1PA 2GV8A 1OXZA 4Y4NA 1IUVA 2V3AA 3FZMB 2HHHT 1HF8A 4KMCA 3ISHA 4QHOA 1CL0A 2ES0A 5FL1A 2PW9A 3NK0X 1RVF4 4C91A 1TRBA 3FHNA 4U7IA 2A9UA 2CM0A 2ODVA 4KHZF 3NN0X 4LA1A 1IBKT 5AQVB 4KUMB 3L09A 3I3LA 4I43B 1BGNA 1S2QA 3CNSA 3N2GE 2RABA 3D1CA 2WESA 2NPXA 5J2TE 3RKOA 1WR6A 2BC0A 2V60A 3FPZA 1HXS4 4DR6T 5LHGB 1BR2A 4YTMA 4K5RA 1JEHA 4ZZCA 4CXXA 3O9XA 3G5QA 5IQ4A 5JDGA 3T37A 3C96A 3NZPA 3FZKB 3I0QA 3ZMTB 2WU2A 4ISTA 5LNKA 3NNEA 3ZT5A 1NAAA 1NPXA 2VKHA 4IL4A 2CBJA 4X66T 3UKKA 1KSUA 2QVAA 5JDNA 4DR1T 1ZEEA 1XZYA 1COV4 1WYCA 3K30A 2Q0KA 1R084 2JMHA 4X5TA 3L1RA 2J62A 3OZ2A 3DH9A 3JC6C 3QUJA 3SOLA 2YG3A 2YR5A 4CI1B 4U3CA 4IE4A 1AJ3A 1LVLA 1FMVA 3MXZA 2FJAA 4MBQA 5LG4A 1JNZA 2UXDT 4ASKA 2C73A 4C74A 3NBXX 5TAOA 3CN8A 3EHZA 2LSJA 4O5QA 1LVFA 4HFHA 2V6OA 1JOAA 2EHOD 1OOPD 1TDEA 3U3IA 1V9DA 3UU3A 4PAAA 5CKUA 1W09A 3LBXA 5ABHA 3LOVA 4GF7A 3UKPA 1KK7A 3UULA 4OK0A 2GR2A 2DI4A 3AE4A 1IUWA 3PUSA 3EVYA 4Q4X4 2BKPA 4H9RC 3RQWA 1ZY8A 4U7YA 5EB4A 2WPEA 3TLUA 2V7KA 4XWRA 1H8TD 4HFDA 4J36A 5CFBA 1O95A 3CTYA 5EK2A 3DTOA 1COYA 2AXDS 1HTJF 5JR9A 2PG8A 1H83A 4H4YA 5LYJE 2X8CA 3H8IA 5LMUT 5GRTA 4X9NA 4O2AE 4P0BA 3N2KE 2VRMA 1RMU4 2XSAA 3GSIA 2HWC4 3B13A 1YQZA 3H8LA 4Z25A 2BDEA 1CHUA 2APGA 3LBXB 5FXVA 3VRAA 1Z7S4 4JI7T 4CXYA 3FBZA 3RF1A 3NT6A 4CY6A 2QAEA 3ZKRA 4DMVA 2H3RA 2J47A 3AVRA 3VKGA 4EB6E 3NTDA 3ABVA 3JADA 4NTEA 2RGJA 4GAVA 2LEHA 4YSHA 1OEDE 1GESA 5JR9B 4PAGA 1E7PA 2IC6A 2XQ6A 4QXHB 5BRTA 3FZHB 3UU6A 3FB2A 4OX9T 2R4JA 3NH3X 5AQTB 3SWHA 2D0UA 1OJAA 2WMOA 2VZ2A 5HEOA 2YDQA 3OJAA 2W2UA 4A98A 3H4KA 1GSNA 4D03A 4G74A 4U2LA 4JI4T 2NW9A 1D0ZA 3QJ4A 4Z2RA 4PK5A 4I4TE 3VR9A 1HFAA 2CA5A 3CPZA 3TLWA 4HWFA 2WMNA 3RYHE 2ZLYA 4G73A 2X68A 3KV4A 5F5WA 4IHJE 2RGHA 1QLBA 2R064 5JDFA 4ZHQE 2ZM2A 5F3JA 3PUVF 2FJDA 3A7MA 1RUJ4 4F8HA 5HXHA 1E1NA 1AOGA 1XNQT 1W0AA 4Z2UA 3X1DA 1Y64B 3D0TA 2W66A 1OJ9A 1B4VA 2E5LT 4BK1A 3ZDNA 4B3RT 5U25A 3NYFA 3AE6A 2JK6A 5LA6E 3ZN0B 4FI5A 4O4HE 4DV1T 3DGHA 1GRGA 3RRCA 1GXFA 5C8YE 4LMJA 4LF5T 1K5MD 1H7WA 3O1IA 1Q1WA 2YLWA 4CQIA 2Q9QC 1ZKEA 2H88A 2JQ9A 5ETWA 4UIGA 1D1AA 4U8KA 4I0UA 2UZZA 4DMWA 3RX6A 1XDIA 4B67A 1HCIA 3ITJA 3EANA 2R4EA 3OBVE 1FEAA 2JB3A 3ZEFB 2E8IA 5AQMB 1CJ4A 2XM2A 1P2HA 3CNDA 3NYEA 3HKEE 4WCTA 2K5BB 5JCKA 3ZSSA 1X9BA 3S5WA 5KMQA 2RMU4 5L4EA 4Q4W4 1TDKA 4O5UA 2BG9E 4HFVA 4J2CA 3SQPA 3N9MA 2YINA 5ABGA 3GWFA 2CMRA 5IQ1A 3LSVA 3HYWA 4YLHA 1HRI4 5E0OA 3ZYXA 3AXJA 2CE7A 4H9NC 3HI2A 3CQXC 4U8MA 5KMPA 2DNXA 1HNWT 1PN0A 3ANWA 4EYYR 1H84A 3REDA 2YU2A 3KD9A 4TNWA 2RS54 1RUI4 2CBIA 1U4QA 4IE7A 4LF4T 3RP7A 3T31A 4AI6A 1LKXA 3KBUA 5JDQA 4IA6A 3P4SA 5KRQA 1Y56B 1EZ3A 3RC3A 4AP1A 1KNZA 2A3DA 3QNUA 4GKJT 2BACA 4JI6T 1H6VA 4Z26A 3RI5A 1HG5A 1KNPA 2D5UA 2LSIA 3R9UA 4EIWA 3SUCA 2XTLA 4IA5A 1Q9IA 2CWYA 2XQ9A 1DOCA 4I50E 3FMWA 1ZMDA 2LM2A 3AE3A 2XVFA 3G5SA 4EOZB 4ILBA 3B6DA 2KSRA 4IVOB 2VB6A 1VBB4 1X79A 1JRYA 4GIWA 2UXCT 3COXA 1CBOA 3CK6A 3WAKA 1J1JA 2KINB 3UU5A 4PJMA 4A79A 5A1LA 4I58A 3PUQA 1N32T 1OJTA 3A5XA 3HA4A 3RKGA 2D2SA 1WYBA 1OEDA 1VG0A 1D4CA 1B8SA 3LZWA 2CXLA 4ZN0A 2A8XA 3NG7X 2Q9QB 2RGOA 4DNDA 2E9XA 3DJEA 3GDNA 4HTEA 3ZCJA 2LM9A 5FY7A 1PJ7A 2R45A 3M13A 2K24A 4H2NA 2GEWA 4AKGA 1HX1B 3JCFA 4BA9A 3J7Yq 4WX1A 1MXTA 2Y6QA 4U2SA 3HYVA 5HWXA 3C4ZA 2RA1A 5HCMA 4NEWA 3L8KA 4UDQA 1SA0E 2CEAA 1S3EA 2B9WA 1HYUA 2YM2A 3MZKB 4NEVA 1CUNA 4ZI3D 5BVAA 4IIJE 2BG9C 1XANA 3MKDA 3UTHA 3AE2A 3SRZA 4U8LA 4JI5T 1MNEA 3PUWF 4JLEA 4QWNB 2BKNA 1GPEA 4EMIA 1OEDB 2SPCA 3E08A 3NRYA 2XLPA 4PJLA 5BR8T 1CJCA 4WBNE 3FZLB 1D0XA 3IC9A 4U8JA 5FXZA 3SYIA 5LJNA 2C3DA 1BR4A 3M0OA 2E9XB 2YWLA 1YXRA 5JDHA 3CGCA 3I9YA 4L5GA 3BNMA 5JRCA 4NNJA 4QX8B 3VU7H 3AD8B 3ALMA 2BC1A 4J56A 5FXXA 3RYCE 4AKLA 2YG6A 5DABA 1GNDA 5JVDE 2BXSA 4DV4T 2HWB4 3T1HT 2E5VA 2JIWA 5HY5A 4K5SA 4Z43A 4ICYA 3UUMA 2WWVA 3DMEA 1N36T 1HS7A 2DCFA 1ELIA 4U2TA 3CQCB 4HGAA 2UXXB 5JCNA 2A2FX 5JREA 4OPTA 4YHJA 5L46A 3RLFF 2CXFA 5FS6A 2Y48B 2C67A 3DA1A 3C4NA 2WZIA 2NOXA 1PHHA 2BRYA 4PNIA 2DWKA 1DNCA 2QRXA 1R094 3ZPOA 1XDPA 4J34A 3V3OA 1PO14 5CB4E 4B3TT 4A5LA 1SE7A 3J8F4 4ZEYA 5KDMC 5J2UE 4C77A 4TLZA 3V5UA 2M6BA 2WWUA 4GOUA 3CPIG 2XPKA 2XQ7A 1D7YA 3ZC1A 2FUPA 2V5DA 4JUYA 1UURA 4DO0A 1CF3A 3GD4A 3HR0A 2UUBT 1SEZA 4H9OC 2XVIA 3UT5E 5U1OA 3Q9TA 3GQKA 4TNVA 5M10A 2C0SA 4DR3T 4EQXA 3AE1A 2Y6RA 2XVJA 4DR7T 4HWDA 3LJCA 4JQ9A 4KX6A 2BG9B 1GRAA 5C3JA 2AE9A 3JSKA 1PBCA 1M62A 5GONE 1LRZA 3H37A 1ZHCA 4TWHA 3E1TA 2V7MA 4KHPT 3RP8A 1MMGA 4ZI2D 4PW8A 2IUBA 4YSXA 3AYIA 4ZI3C 1D5TA 4J2WA 2ACXA 2QA1A 2CXDA 5KXJA 1XDOA 4REKA 2BRAA 2JPFA 4U74A 5HXSA 4APNA 2CLYB 2XJ7A 2R46A 4EIQA 3JAEA 1PBFA 2X0LB 3GYIA 2WBAA 2L3LA 5FL0A 2XSBA 3BI2A 2XLUA 1KNRA 2XHEB 4QH1A 4AQGA 2CPTA 3DJDA 5JCMA 4X1YE 1BKWA 1GRBA 2YG7A 2X8HA 2LSYA 1VRBA 4YJ3E 3UOZA 3C64A 2C3CA 4UV9B 3HYXA 3LK3B 1VQWA 3UUBA 3KPFA 1E6EA 2C70A 3LADA 4TM4A 1RUH4 2XAQB 3FBSA 3I9WA 2XFQA 3AEAA 4A99A 2GVCA 4LIIA 2D9DA 5FS7A 3IF8B 4L0RA 1HNZT 1O94A 3T2ZA 3U78A 1MMAA 4IREA 4B63A 1US7B 3P4QA 4YTNA 2GF3A 2BK5A 3B3RA 5KVIA 3MK7C 2RS14 4JNQA 1XWMA 1AR84 4A5XA 4EMWA 1XHZA 2PZSA 4OVIA 3NRXA 3DJJA 1F8RA 3UTEA 2XAJB 1U5PA 4H63V 2LSKA 2V6YA 1JU2A 2GR3A 3A8YC 3F57A 1HG2A 3RIFA 4HB9A 1CJ3A 2LHRA 4USRA 3WI3A 3KDSE 2PYLA 4UVBB 4X1IE 1RHI4 1ONFA 3C4AA 3P4WA 2QCUA 3RIAA 4JV5T 1UX4A 4U8OA 4WZXA 3GN5A 4NZHA 1PVC4 3ICRA 4HWHA 2X9HA 4AKHA 4AISA 3EAMA 4B64A 3RHAA 1PXAA 3FXDB 5JR9C 2GMHA 5U63A 2V8SV 3HKCE 3NGCX 2EQ9A 4ECHA 2DKHA 1K0LA 3AVSA 1IAPA 4YT0A 1F8WA 1KDGA 4DSHA 2PLV4 4A6NA 5L3BB 4I55E 3AA7B 1M6IA 1D4M4 3F31A 3PUZF 4ZI2C 4CCQA 2WAUA 2CDUA 4PFPA 2CVJA 2KMFA 1ZV4X 2R6GF 2WS3A 3EDVA 4X1KE 3UFGA 2C65A 1EBDA 3NN6X 2Z5YA 1W0BA 2C66A 4C5OA 1HRV4 3RQUA 3LB8A 3T8OA 3GN5B 3AYLA 2V61A 3CMMA 4K22A 2DL1A 1FEWA 3EPTA 2PFVA 4OCGA 3AA0B 2BS4A 5FYMA 1NA1D 2Q9QD 1YKEB 2XQ5A 1LTXR 2C5JA 2CHNA 2ZMAA 5LV9A 5L3GB 1QJDA 3LJPA 2O9ZA 1D1CA 4BV6A 3WAJA 1DJNA 2VVSA 1PBDA 2Q0LA 5F8PA 5AQHB 1MNDA 4DVDA 2F5ZA 2JJ9A 3DJBA 3QB5A 5L3DB 4HA6A 4A6NB 1N4VA 1RP0A 2C4CA 2L8KA 1FEBA 1IUSA 3ZMVB 1GTEA 2NWBA 3CNPA 1I6ZA 1PIV4 2BCPA 3C51A 3B57A 4NUUA 3C4WA 5DQVA 2WOVA 1D1BA 5DQWA 3BI4A 3Q5WA 3Q5EA 4KP3C 4XXGA 4GDEA 3UU4A 4CBQA 4NTDA 4C3YA 4IV9A 2WDVA 2X9WA 5CQFA 4TWDA 4H9QC 4EV6A 2YVJA 2BBJA 2MOZA 1EV14 4IE0A 5HEGA 4H4PA 2BA9A 4IL9A 4H4XA 2E9XD 4QKNA 3ICTA 3E22E 2BVLA 2BZBA 4Q25A 2A89A 5HEUA 1GREA 1PS9A 1UKVG 4Z8XA 1HX8A 4H9SE 3SZ0A 3NRNA 3MA9A 3AB1A 4Z90A 4H2PA 2OAMA 2GAGB 3VQRA 3BNUA 4ANJA 2CCQA 4IT4A 4CNJA 3N9LA 1BR1A 3LK42 1VG9A 1V59A 1PO24 3I1AA 3LK2B 3I0OA 3ATQA 2C75A 3K7TA 4H4SA 2Z6EA 2R044 4IDPA 2LSGA 3AE5A 3ZC0A 4G2AA 4YKGA 3FG2P 4OYJA 3K7MX 2W0HA 2M67A 2X51A 3AEGA 5JQGE 1F3PA 5KOWA 2OV9A 3UTGA 3CPJG 3HKBE 1O5WA 5FVLA 3KLJA 2VK9A 5EZYE 2XQ4A 1G8XA 5IHYA 3CGBA 1D4EA 5EB5A 1OJCA 3QVRA 4U31A 2IHR1 3NWIA 4UEMA 1HR0T 1YD8G 4K0KT 1NDAA 1REOA 3FIMB 2I59A 2IIDA 3IEEA 4K0UA 1K4QA 3G5RA 4MALA 3L39A 4X9MA 2VRLA 1BF3A 5JCIA 2LKHA 1EL7A 5LB7B 1H7CA 5BUKA 2X67A 1WLXA 1N34T 4OHFA 5AQNB 4UXNB 4JYAT 4JDRA 1H81A 4Z2TA 5KWFA 2MTQA 2C5IT 2V3BA 2IC9A 3P8CD 3TLVA 3OKQA 3OPCA 3LG7A 5FMNA 5M4YA 3N9NA 2BYBA 5L4HA 2AAQA 2J4GA 4IDNA 5LMNT 2Q7VA 2I0MA 2R9ZA 1Z8UA 4DNAA 3EDUA 3KVAA 4X65T 5ER0A 3P1WA 3AD7B 2RP4A 4E7SA 1VCSA 1GRFA 1RUG4 3RIUA 2VURA 3CWZB 2YLSA 4OPCA 2VVLG 1FCDA 2NVKX 3NK1X 1OEDC 2KWIB 3IHRA 3PDYA 2X0HA 4EEBA 4YTPA 3ZMZB 1GV4A 3QFBA 3NIXA 2E9XC 4B68A 2BK3A 5AFUL 1M7KA 3C50A 4E0VA 4IE6A 3JAFA 2V5ZA 2EHOA 4H2QA 2OLTA 2LE8A 2JKCA 4Z91A 2PJQA 1MIVA 4PFOA 2YLTA 4YJ2E 3IBPA 2OLOA 2B76A 3UKLA 2GR0A 1E39A 3GD3A 2KZ7B 1IJ5A 4HWIB 1RYIA 4JY2A 1YKHB 3QK6A 4XZCA 1H86A 3K3QC 1L9EA 1T8BA 3PUYF 5BMVE 3AXJB 3T2YA 1Y0PA 2YG4A 2AR8A 4PJJA 4B69A 4O4JE 2FBWA 3AE7A 3AECA 1ZX9A 4YKFA 3EUHA 3ANWB 1GTHA 3GYXA 1WR0A 1AL24 1BR0A 2OA5A 5KNLA 3BQIA 3T1YT 2JQHA 3VRDB 5L3CB 4JEHB 2EQ7A 3PU8A 4EQSA 2G0UA 3AD9B 3GMCA 4RHV4 3QB5K 2NTYA 2VASA 4G63A 3RH3A 4XWZA 3UOYA 5KMSA 2X5ID 1YW0A 3SZWA 2GAHB 2W63A 4AQFA 2MYSA 3CKDA 2QYWA 2VOUA 4HEAA 3KBTA 1ASJ4 4TV9E 3K3OA 4J31A 4IVMB 1VBD4 2XZEA 4DUZT 4YFSA 3Q5DA 2YQUA 1B5QA 1TYTA 5AQPB 3J9X1 1WRDA 3KFWX 4GRTA 4N9XA 4EMJA 1RUF4 2F4VT 3MJXA 4GK5E 3UUXB 2XUEA 5L47A 3ICSA 5DBJA 5LHIB 3V5SA 3QSSA 3Q9DA 2XYOA 4FK1A 3ZCIA 2VQFT 2PHHA 2RS34 3NKSA 2GK9A 3NVOA 4AKRB 5JCLA 3ZLIA 1KSSA 5EBKA 3N9OA 4TUYE 3UOXA 2NW7A 3D8XA 3ZYMA 2BBHA 1AR64 2RPAA 2IW5B 1LQTA 4G6GA 3ONXA 2V26A 1GALA 5DJQC 2DKIA 3QOFA 3NYCA 2VQET 3F2EA 3K3NA 2Z5XA 1EAH4 1PJ5A 3UP5A 2CLYC 2MAWA 2XM1A 3F8RA 3CX6B 4JNAA 3OVUA 4H2RA 2WPFA 5H6RB 3JBG4 2EX3A 4U8PA 3F8PA 2H7VC 5JTGA 1DOBA 1H7XA 1MMDA 4GYRA 4LFBT 4TN7B 1NWMX 3UKAA 1XNRT 3GMBA 4EQRA 3BK9A 2C72A 2WP5A 3AXBA 3ETUA 1BEV4 4B65A 4PJNA 3PTRB 5JRCB 1GETA 4CN6A 2CFYA 2XFNA 3ZJ2A 4GCMA 1RUE4 4CRTA 2WOWA 3RGLA 3PJAJ 4MJWA 5LOVE 2MPKA 5FMHA 2WP9A 3CGDA 4GK0E 3GRSA 4NUVA 3SZCA 2YKSA 1S94A 2D0TA 2XAFB 1XHXA 4WW0A 5AQUB 3QC9A 4MHCA 4V1Av 5TR3A 3UQ7A 3O1JA 1R8IA 3CX8B 4AIUA 4AT2A 2I0ZA 4JBWF 5AQRB 1GT8A 2H89A 2YVFA 1CC2A 3LXDA 2NP9A 3G06A 4UP3A 1DXLA 4Z24A 3ESLA 1LPFA 3AEFA 3V76A 2JQKA 1GOSA 1EL8A 2ZM8A 1BWCA 1IJ6A 2WZHA 4X4JA 3K1SA 3QSEA 2XASB 2ODUA 4ISSA 3UQ4A 2OA1A 2R0CA 5AQGB 5EOWA 2VVNA 4DV7T 1OWAA 4EGWA 3PV0F 3DJGX 4KPRA 4UVCB 2CWOA
chains in the Genus database with same CATH topology
2GRTA 2V61A 4OPIA 1PBBA 2XDOA 1GXFA 2YVGA 3CMMA 4K22A 4BJZA 1DODA 1NEKA 3P4PA 1H7WA 1Q1WA 2YLWA 3DK8A 3EPTA 5BULA 3Q6JA 4OCGA 4OPLA 2H88A 2BS4A 1Z6LA 3BHKA 1CC6A 1LTXR 4U8KA 1Q1RA 2UZZA 3GRTA 4YWOA 1XDIA 4B67A 1XPQA 5LV9A 2J3NA 1D7LA 3LJPA 1QJDA 3ALJA 2XLSA 3ITJA 2AQJA 2O9ZA 3EANA 2R4EA 4BV6A 1DJNA 1PBDA 1FEAA 2Q0LA 1JNRA 2JB3A 4RSLA 5FS8A 2BXRA 2F5ZA 1CJ4A 1P2HA 2ZZCA 3CNDA 3IHMA 2R0GA 3NYEA 5IPYA 4HA6A 1F8SA 4B1BA 4A6NB 1N4VA 1RP0A 2B7SA 2C4CA 2R0PA 4WCTA 5JCKA 1FEBA 3S5WA 1IUSA 1GTEA 4ZCDA 1BGJA 5KMQA 2ZZBA 1PBEA 1TDKA 4O5UA 1L9DA 3CNPA 3SQPA 3GWFA 2BCPA 3GWDA 4UDRA 5IQ1A 2WOVA 3RP6A 3HYWA 3QFAA 3BI4A 5C2TA 3ZYXA 3SFDA 1YY5A 3BI5A 4G6HA 3PO7A 1D4DA 4GDEA 4XXGA 4CBQA 4U8MA 5KMPA 2B9YA 2ARDA 4JN9A 4NTDA 4C3YA 4IV9A 1ZP0A 2XVHA 1PN0A 2WDVA 4H4QA 5CQFA 5FS9A 1H84A 4TM0A 3REDA 3KD9A 3GYJA 2YVJA 3RP7A 3T31A 3UP4A 4K2XA 3NLCA 4IA6A 3P4SA 1RSGA 3CGEA 3T14A 5KRQA 1Y56B 4H4PA 2VVMA 4EIPA 1TDOA 1W4XA 1NG4A 2BA9A 2EQ6A 2XCGA 3QSMA 2WETA 2ZBWA 4H4XA 4K8DA 4AP1A 4CNKA 3ICTA 4GUVA 5KOXA 4U8IA 2A89A 2BACA 1NENA 1GREA 1PS9A 1UKVG 2BS2A 3OC4A 4U8NA 1H6VA 3PVCA 3ADAB 4Z26A 2WDQA 1VDCA 1KNPA 4TM3A 1NHRA 1JRXA 2VVLA 3SZ0A 3II4A 4I59A 3NRNA 3R9UA 3SUCA 1E1MA 4IA5A 2TMDA 1IUTA 2JBVA 3UOVA 1Q9IA 4LU6A 3AB1A 1DOCA 3FMWA 4H2PA 2GQFA 1E1LA 2OAMA 2GAGB 2PYXA 1ZMDA 3VQRA 2GH5A 3AE3A 2XVFA 3G5SA 2WDRA 3BNUA 3B6DA 2WQYA 4IVOB 4CNJA 3DGZA 1VG9A 3GDPA 1IUXA 1BZLA 1V59A 3GQHA 4J33A 1JRYA 4AT0A 4AP3A 3ATQA 1CBOA 3COXA 2C75A 1X31B 1MO9A 1MOKA 1PXCA 3K7TA 1IUUA 3M12A 4H4SA 2YLXA 2WOIA 4CY8A 3AE5A 1S2YA 2QA2A 4YKGA 3FG2P 4A79A 4I58A 4USQA 1OJTA 3K7MX 2W0HA 4NTCA 4H4UA 3AEEA 4Z44A 3AEBA 1VG0A 1F3PA 3AEGA 1D4CA 3KPKA 5KOWA 1B8SA 3LZWA 5GSNA 1TDFA 3UTGA 1PDHA 4ZN0A 3SFEA 3CPJG 3O0HA 2A8XA 1O5WA 3NG7X 3KLJA 1YQ3A 2RGOA 3AWIA 3DJEA 1CC4A 3GDNA 3CGBA 1D4EA 5EB5A 3DK9A 1OJCA 3AYJA 3QVRA 3QVPA 3UKFA 4OPGA 4FDCB 2GB0A 1PJ7A 2R45A 3M13A 3UTFA 2VQ7A 3SY4A 1NDAA 1REOA 1TYPA 3FIMB 4P9SA 1K0JA 4H2NA 1K0IA 2GEWA 2VQBA 4WX1A 2IIDA 1MXTA 2Y6QA 1KFYA 2BABA 1PXBA 3G5RA 1K4QA 4U2SA 3HYVA 4II2A 1NHSA 4X9MA 1NHQA 3SM8A 3VRBA 2VRLA 3V3NA 2BCGG 5KVHA 1BF3A 1YKJA 4NEWA 2C7GA 3L8KA 4UDQA 1EL7A 5JCIA 1M64A 1S3EA 4AOXA 5BUKA 1B37A 4AOSA 3CIRA 2B9WA 1HYUA 3CNJA 2Q6UA 2YM2A 4NEVA 4ZCCA 5J60A 5BVAA 3UTHA 1XANA 4JDRA 3AE2A 4U8LA 3ALLA 1H81A 4Z2TA 4J57A 2FJBA 1ZOVA 1CJ2A 5KWFA 3AE8A 1GPEA 4EMIA 2ZZ0A 2V3BA 2XLPA 4A9WA 1CJCA 4YSZA 1ZOYA 2BYBA 1OJDA 2C76A 3IC9A 4U8JA 3SYIA 2AAQA 4C3XA 2C3DA 4D04A 1EL9A 2Q7VA 3M0OA 3RNMA 1XHCA 3UCLA 2R9ZA 2YWLA 3EF6A 3P9UA 4DNAA 1ZMCA 3CGCA 3F8DA 3BNMA 1DJQA 1FOHA 3P1WA 3AD7B 5ER0A 2XFUA 4NNJA 1F6MA 3S61A 3AD8B 3ALMA 1GRFA 2BC1A 4J56A 2YAUA 2YG6A 4II3A 1GRTA 4RG4A 2YLSA 1GNDA 3IHGA 4OPCA 2VVLG 1FCDA 2BXSA 3KA7A 1LJ1A 3PS9A 2NVKX 3NK1X 2X50A 2E5VA 1ZDLA 3KKJA 5HY5A 4YTPA 3I6DA 3ATRA 2FJEA 4K5SA 3WE0A 2A87A 5KMRA 1TDNA 2X8GA 1GV4A 3BHFA 4ICYA 4Z43A 3P4RA 2YM1A 3NHOX 3QFBA 2GMJA 3DMEA 2YR4A 3NIXA 1N1PA 2WEUA 4B68A 2E4GA 2GV8A 4Y4NA 2BK3A 1ELIA 1IUVA 3KVEA 4U2TA 1NHPA 2V3AA 3NTAA 4M52A 4E0VA 2V5ZA 5JCNA 4BURA 4H2QA 2JKCA 1N4UA 3NK2X 3ISHA 3AEDA 2OLNA 3HZLA 2YLTA 4OPTA 5L46A 1CL0A 3NK0X 5FS6A 2OLOA 2B76A 3UKLA 2GR0A 2WP6A 1TRBA 1E39A 2C67A 3DA1A 3GD3A 1S3BA 1PJ6A 1RYIA 3C4NA 4JY2A 3KU9A 4H4ZA 4LA1A 1PHHA 3NN0X 2BRYA 4H4VA 1H86A 1JRZA 4H7UA 1DNCA 3I3LA 1L9EA 1BGNA 3SGLA 1S2QA 4J34A 3CNSA 3V3OA 3T2YA 1Y0PA 2YG4A 2RABA 3D1CA 2AR8A 2WESA 4A5LA 4B69A 2FBWA 2NPXA 4C77A 3AE7A 4EM4A 2X3NA 3AECA 4TLZA 2BC0A 1ZX9A 2V60A 3FPZA 3CPIG 4YKFA 4CCRA 4YTMA 4K5RA 1GTHA 1JEHA 3GYXA 1QO8A 1D7YA 3UKHA 1L9CA 4A65A 1CF3A 3GD4A 3VRDB 5KNLA 3G5QA 5IQ4A 1E1KA 1FL2A 3T37A 3C96A 2EQ7A 1SEZA 4G9KA 4EQSA 2WU2A 2XVIA 2ACZA 2YLRA 3AD9B 1VRQB 3LZXA 3NNEA 3Q9TA 5U1OA 3GQKA 1NAAA 2OALA 1NPXA 3GMCA 5M10A 3IF9A 4EQXA 3UOYA 3AE1A 4XWZA 2Y6RA 2XVJA 5KMSA 4GR1A 4H4RA 1LQUA 3SZWA 2GAHB 1NG3A 4KX6A 4JQ9A 2VOUA 1KSUA 3UKKA 4YSYA 1GRAA 1YQ4A 5HXIA 5C3JA 3K30A 2Q0KA 3L1RA 1GERA 3JSKA 3DH9A 3OZ2A 4H4TA 1PBCA 4J31A 4IVMB 5HYMA 2YG3A 2YR5A 2YQUA 1B5QA 3E1TA 4EM3A 1TYTA 3VR8A 1LVLA 3RP8A 2FJAA 1JNZA 2C73A 4C74A 4GRTA 4N9XA 4EMJA 3CN8A 4YSXA 3AYIA 4A7AA 4H50A 4O5QA 1D5TA 2JAEA 3ICSA 5DBJA 4J2WA 2BK4A 2QA1A 2V6OA 4ADWA 1JOAA 1TDEA 3QSSA 5KXJA 3T2KA 4PAAA 4OPDA 5CKUA 2XYOA 3LOVA 4GF7A 4REKA 3UKPA 4FK1A 2XLTA 2BRAA 2GR2A 4APNA 3SXIA 2JB1A 3AE4A 2PHHA 1IUWA 2R46A 4EIQA 3NKSA 4FX9A 1PBFA 1ZY8A 5JCLA 3GYIA 1KSSA 2WBAA 1Y56A 5EBKA 5EB4A 2WPEA 2LFCA 3UOXA 3BI2A 2WPCA 2XLUA 1KNRA 3D8XA 3DJDA 4XWRA 5JCMA 1BKWA 1LQTA 1GRBA 2YG7A 2X8HA 4G6GA 4J36A 1GALA 1O95A 3CTYA 4DSGA 3UOZA 2C3CA 1COYA 4YXDA 1N4WA 3HYXA 1VQWA 3KPFA 2DKIA 1H83A 5J7XA 2WHDA 1E6EA 2C70A 4H4YA 1FECA 1GEUA 1ZKQA 2CULA 2X8CA 3LADA 3NYCA 4OPUA 4EQWA 4TM4A 1LV0A 2Z5XA 3H8IA 5HHFA 1PJ5A 5GRTA 4X9NA 3UP5A 3FBSA 1EL5A 2XFQA 3AEAA 2VRMA 4A99A 2GVCA 3F8RA 4LIIA 3GSIA 4JNAA 1YQZA 2YLZA 5FS7A 1ZK7A 4H2RA 2WPFA 3H8LA 1DOEA 1O94A 3T2ZA 4Z25A 2E1MA 1CHUA 2YR6A 4U8PA 4B63A 3F8PA 3P4QA 4YTNA 1DOBA 1H7XA 2BK5A 2GF3A 2HQMA 2WU5A 3B3RA 5KVIA 2APGA 2XVEA 3VRAA 4JNQA 2YG5A 4EMWA 4RG3A 3NT6A 4CY6A 2QAEA 4OVIA 3DJJA 3UKAA 1F8RA 3UKQA 3GMBA 1H82A 3UTEA 4EQRA 4BJYA 2C72A 3EAOA 2TPRA 3NTDA 1JU2A 3ABVA 2GR3A 2WP5A 2B7RA 4NTEA 3AXBA 2RGJA 4GAVA 4B65A 4YSHA 4HB9A 1CJ3A 1GETA 2CFYA 4USRA 3SZFA 2XFNA 1GESA 4GAPA 4GCMA 4CRTA 2WOWA 4MJWA 4K7ZA 1ONFA 5FMHA 1E7PA 4NWZA 3C4AA 4TLXA 4UDPA 2WP9A 2QCUA 3CGDA 5BRTA 3GRSA 3URHA 3SZCA 2R4JA 4FK1C 3IWAA 4U8OA 3NH3X 2XFOA 1OJAA 2GR1A 3K7QX 2IVDA 2VZ2A 4NZHA 4H4WA 3AE9A 2JB2A 5TR3A 3DK4A 4D03A 3H4KA 1GSNA 4G74A 4U2LA 3ICRA 3QJ4A 4Z2RA 2BS3A 4AT2A 4BK3A 1KF6A 2I0ZA 3VR9A 1L0VA 4B64A 1GT8A 4JY3A 2H89A 3RHAA 1PXAA 3SX6A 4G73A 2GMHA 2YVFA 5U63A 2XFPA 1CC2A 3NGCX 4DGKA 2EQ9A 4ECHA 2RGHA 4Y4LA 2DKHA 1K0LA 3LXDA 1QLBA 4YT0A 1F8WA 1KDGA 2IVEA 1IJHA 2C64A 4GDPA 4DSHA 3CNTA 4UP3A 1DXLA 4Z24A 4A6NA 2FJDA 3AEFA 1LPFA 3T0KA 1M6IA 2GQWA 2B9XA 3V76A 1GOSA 4BK2A 1E1NA 1EL8A 1AOGA 4CCQA 1BWCA 4Z2UA 4B66A 2CDUA 2CVJA 2XLRA 1OJ9A 4X4JA 1B4VA 3QSEA 2WS3A 2EQ8A 4BK1A 3ZDNA 4Y4MA 5U25A 2C65A 2OA1A 3NYFA 1EBDA 2R0CA 3NN6X 2Z5YA 1GRHA 3AE6A 2JK6A 2C66A 4PABA 4TM1A 4C5OA 5EOWA 5M0ZA 3DGHA 3LB8A 3DJGX 1GRGA 4KPRA 1P2EA 3CPHG 2X99A 3AYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRT A;  2V61 A;  4OPI A;  1PBB A;  2XDO A;  1GXF A;  2YVG A;  4K22 A;  1DOD A;  1NEK A;  3P4P A;  1H7W A;  1Q1W A;  2YLW A;  3DK8 A;  3EPT A;  5BUL A;  3Q6J A;  4OCG A;  4OPL A;  2H88 A;  2BS4 A;  1Z6L A;  3BHK A;  1CC6 A;  1LTX R;  4U8K A;  1Q1R A;  2UZZ A;  3GRT A;  4YWO A;  1XDI A;  4B67 A;  1XPQ A;  5LV9 A;  2J3N A;  1D7L A;  3LJP A;  1QJD A;  3ALJ A;  2XLS A;  3ITJ A;  2AQJ A;  2O9Z A;  3EAN A;  2R4E A;  4BV6 A;  1DJN A;  1PBD A;  1FEA A;  2Q0L A;  1JNR A;  2JB3 A;  4RSL A;  5FS8 A;  2BXR A;  2F5Z A;  1CJ4 A;  1P2H A;  2ZZC A;  3CND A;  3IHM A;  2R0G A;  3NYE A;  5IPY A;  4HA6 A;  1F8S A;  4B1B A;  4A6N B;  1N4V A;  1RP0 A;  2B7S A;  4WCT A;  2R0P A;  5JCK A;  1FEB A;  3S5W A;  1IUS A;  1GTE A;  4ZCD A;  1BGJ A;  2ZZB A;  1PBE A;  1TDK A;  4O5U A;  1L9D A;  3CNP A;  3SQP A;  3GWF A;  2BCP A;  3GWD A;  4UDR A;  5IQ1 A;  2WOV A;  3RP6 A;  3QFA A;  3BI4 A;  5C2T A;  3ZYX A;  3SFD A;  1YY5 A;  3BI5 A;  3PO7 A;  1D4D A;  4GDE A;  4XXG A;  4CBQ A;  4U8M A;  2B9Y A;  2ARD A;  4JN9 A;  4NTD A;  4C3Y A;  4IV9 A;  1ZP0 A;  2XVH A;  1PN0 A;  2WDV A;  4H4Q A;  5CQF A;  5FS9 A;  1H84 A;  4TM0 A;  3RED A;  3KD9 A;  3GYJ A;  2YVJ A;  3RP7 A;  3UP4 A;  4K2X A;  3NLC A;  4IA6 A;  3P4S A;  1RSG A;  3CGE A;  5KRQ A;  1Y56 B;  4H4P A;  2VVM A;  4EIP A;  1TDO A;  1W4X A;  1NG4 A;  2BA9 A;  2EQ6 A;  2XCG A;  3QSM A;  2WET A;  2ZBW A;  4H4X A;  4K8D A;  4AP1 A;  4CNK A;  3ICT A;  4GUV A;  5KOX A;  4U8I A;  2A89 A;  2BAC A;  1NEN A;  1GRE A;  1PS9 A;  1UKV G;  2BS2 A;  3OC4 A;  4U8N A;  1H6V A;  3PVC A;  3ADA B;  4Z26 A;  2WDQ A;  1VDC A;  1KNP A;  4TM3 A;  1NHR A;  1JRX A;  2VVL A;  3II4 A;  4I59 A;  3NRN A;  3R9U A;  3SUC A;  1E1M A;  4IA5 A;  2TMD A;  1IUT A;  2JBV A;  3UOV A;  1Q9I A;  4LU6 A;  3AB1 A;  1DOC A;  3FMW A;  4H2P A;  2GQF A;  1E1L A;  2OAM A;  2GAG B;  2PYX A;  1ZMD A;  3VQR A;  2GH5 A;  3AE3 A;  2XVF A;  3G5S A;  2WDR A;  3BNU A;  3B6D A;  2WQY A;  4IVO B;  4CNJ A;  3DGZ A;  1VG9 A;  3GDP A;  1IUX A;  1BZL A;  1V59 A;  3GQH A;  4J33 A;  1JRY A;  4AT0 A;  4AP3 A;  3ATQ A;  1CBO A;  3COX A;  2C75 A;  1X31 B;  1MO9 A;  1MOK A;  1PXC A;  3K7T A;  1IUU A;  3M12 A;  4H4S A;  2YLX A;  2WOI A;  4CY8 A;  3AE5 A;  1S2Y A;  2QA2 A;  4YKG A;  3FG2 P;  4A79 A;  4I58 A;  4USQ A;  1OJT A;  3K7M X;  2W0H A;  4NTC A;  4H4U A;  3AEE A;  4Z44 A;  3AEB A;  1VG0 A;  1F3P A;  3AEG A;  1D4C A;  5KOW A;  1B8S A;  3LZW A;  5GSN A;  1TDF A;  3UTG A;  1PDH A;  4ZN0 A;  3SFE A;  3CPJ G;  3O0H A;  2A8X A;  1O5W A;  3NG7 X;  3KLJ A;  1YQ3 A;  2RGO A;  3AWI A;  3DJE A;  1CC4 A;  3GDN A;  3CGB A;  1D4E A;  5EB5 A;  3DK9 A;  1OJC A;  3AYJ A;  3QVR A;  3QVP A;  3UKF A;  4OPG A;  4FDC B;  2GB0 A;  1PJ7 A;  2R45 A;  3M13 A;  3UTF A;  2VQ7 A;  4BJZ A;  1NDA A;  1REO A;  1TYP A;  3FIM B;  4P9S A;  1K0J A;  4H2N A;  1K0I A;  2GEW A;  2VQB A;  4WX1 A;  2IID A;  1MXT A;  2Y6Q A;  1KFY A;  2BAB A;  1PXB A;  3G5R A;  1K4Q A;  4U2S A;  3SM8 A;  1NHS A;  4X9M A;  1NHQ A;  3V3N A;  3VRB A;  2VRL A;  5KVH A;  2BCG G;  1BF3 A;  1YKJ A;  4NEW A;  2C7G A;  3L8K A;  4UDQ A;  1EL7 A;  5JCI A;  1M64 A;  1S3E A;  4AOX A;  5BUK A;  1B37 A;  4AOS A;  3CIR A;  2B9W A;  1HYU A;  3CNJ A;  2Q6U A;  2YM2 A;  4NEV A;  4ZCC A;  5J60 A;  5BVA A;  3UTH A;  1XAN A;  4JDR A;  3AE2 A;  4U8L A;  3ALL A;  1H81 A;  4Z2T A;  4J57 A;  2FJB A;  1ZOV A;  1CJ2 A;  5KWF A;  3AE8 A;  1GPE A;  4EMI A;  2ZZ0 A;  2V3B A;  2XLP A;  4A9W A;  1CJC A;  4YSZ A;  1ZOY A;  2BYB A;  1OJD A;  2C76 A;  3IC9 A;  4U8J A;  4C3X A;  2AAQ A;  4D04 A;  2C3D A;  1EL9 A;  2Q7V A;  3M0O A;  3RNM A;  1XHC A;  3UCL A;  2R9Z A;  2YWL A;  3EF6 A;  3P9U A;  4DNA A;  1ZMC A;  3CGC A;  3F8D A;  3BNM A;  1DJQ A;  1FOH A;  3P1W A;  3AD7 B;  5ER0 A;  2XFU A;  1F6M A;  3S61 A;  3AD8 B;  3ALM A;  1GRF A;  2BC1 A;  4J56 A;  2YAU A;  2YG6 A;  1GRT A;  4RG4 A;  2YLS A;  1GND A;  3IHG A;  4OPC A;  2VVL G;  1FCD A;  2BXS A;  3KA7 A;  1LJ1 A;  3PS9 A;  2NVK X;  3NK1 X;  2X50 A;  2E5V A;  1ZDL A;  3KKJ A;  5HY5 A;  4YTP A;  3I6D A;  3ATR A;  2FJE A;  4K5S A;  3WE0 A;  2A87 A;  1TDN A;  2X8G A;  1GV4 A;  3BHF A;  4ICY A;  4Z43 A;  3P4R A;  2YM1 A;  3NHO X;  3QFB A;  2GMJ A;  3DME A;  2YR4 A;  3NIX A;  1N1P A;  2WEU A;  4B68 A;  2E4G A;  2GV8 A;  4Y4N A;  2BK3 A;  1ELI A;  1IUV A;  3KVE A;  4U2T A;  1NHP A;  2V3A A;  3NTA A;  4M52 A;  4E0V A;  2V5Z A;  5JCN A;  4BUR A;  4H2Q A;  2JKC A;  1N4U A;  3NK2 X;  3ISH A;  3AED A;  2OLN A;  3HZL A;  2YLT A;  4OPT A;  5L46 A;  1CL0 A;  3NK0 X;  5FS6 A;  2OLO A;  2B76 A;  3UKL A;  2GR0 A;  2WP6 A;  1TRB A;  1E39 A;  2C67 A;  3DA1 A;  3GD3 A;  1S3B A;  1PJ6 A;  1RYI A;  3C4N A;  4JY2 A;  3KU9 A;  4H4Z A;  4LA1 A;  1PHH A;  3NN0 X;  4H4V A;  1H86 A;  1JRZ A;  4H7U A;  1DNC A;  3I3L A;  1L9E A;  1BGN A;  3SGL A;  1S2Q A;  4J34 A;  3CNS A;  3V3O A;  1Y0P A;  2YG4 A;  2RAB A;  3D1C A;  2AR8 A;  2WES A;  4A5L A;  4B69 A;  2FBW A;  2NPX A;  4C77 A;  3AE7 A;  4EM4 A;  2X3N A;  3AEC A;  4TLZ A;  2BC0 A;  1ZX9 A;  2V60 A;  3FPZ A;  3CPI G;  4YKF A;  4CCR A;  4YTM A;  4K5R A;  1GTH A;  1JEH A;  3GYX A;  1QO8 A;  1D7Y A;  3UKH A;  1L9C A;  4A65 A;  1CF3 A;  3GD4 A;  3VRD B;  3G5Q A;  5IQ4 A;  1E1K A;  1FL2 A;  3T37 A;  3C96 A;  2EQ7 A;  1SEZ A;  4EQS A;  2WU2 A;  2XVI A;  2ACZ A;  2YLR A;  3AD9 B;  1VRQ B;  3LZX A;  3NNE A;  3Q9T A;  5U1O A;  3GQK A;  1NAA A;  2OAL A;  1NPX A;  3GMC A;  5M10 A;  3IF9 A;  4EQX A;  3UOY A;  3AE1 A;  4XWZ A;  2Y6R A;  2XVJ A;  4GR1 A;  4H4R A;  1LQU A;  2GAH B;  1NG3 A;  4KX6 A;  4JQ9 A;  2VOU A;  1KSU A;  3UKK A;  4YSY A;  1GRA A;  1YQ4 A;  5HXI A;  5C3J A;  3K30 A;  2Q0K A;  3L1R A;  1GER A;  3JSK A;  3DH9 A;  3OZ2 A;  4H4T A;  1PBC A;  4J31 A;  4IVM B;  5HYM A;  2YG3 A;  2YR5 A;  2YQU A;  1B5Q A;  3E1T A;  4EM3 A;  1TYT A;  3VR8 A;  1LVL A;  3RP8 A;  2FJA A;  1JNZ A;  2C73 A;  4C74 A;  4GRT A;  4N9X A;  4EMJ A;  3CN8 A;  4YSX A;  3AYI A;  4A7A A;  4H50 A;  4O5Q A;  1D5T A;  2JAE A;  3ICS A;  5DBJ A;  4J2W A;  2BK4 A;  2QA1 A;  2V6O A;  4ADW A;  1JOA A;  1TDE A;  3QSS A;  5KXJ A;  4PAA A;  4OPD A;  5CKU A;  2XYO A;  3LOV A;  4GF7 A;  4REK A;  3UKP A;  4FK1 A;  2XLT A;  2GR2 A;  4APN A;  2JB1 A;  3AE4 A;  2PHH A;  1IUW A;  2R46 A;  4EIQ A;  3NKS A;  4FX9 A;  1PBF A;  1ZY8 A;  5JCL A;  3GYI A;  1KSS A;  2WBA A;  1Y56 A;  5EBK A;  5EB4 A;  2WPE A;  2LFC A;  3UOX A;  3BI2 A;  2WPC A;  2XLU A;  1KNR A;  3D8X A;  3DJD A;  4XWR A;  5JCM A;  1BKW A;  1LQT A;  1GRB A;  2YG7 A;  2X8H A;  4J36 A;  1GAL A;  1O95 A;  3CTY A;  4DSG A;  3UOZ A;  2C3C A;  1COY A;  4YXD A;  1N4W A;  1VQW A;  3KPF A;  2DKI A;  1H83 A;  5J7X A;  2WHD A;  1E6E A;  2C70 A;  4H4Y A;  1FEC A;  1GEU A;  1ZKQ A;  2CUL A;  2X8C A;  3LAD A;  3NYC A;  4OPU A;  4EQW A;  4TM4 A;  1LV0 A;  2Z5X A;  3H8I A;  5HHF A;  1PJ5 A;  5GRT A;  4X9N A;  3UP5 A;  3FBS A;  1EL5 A;  2XFQ A;  3AEA A;  2VRM A;  4A99 A;  2GVC A;  3F8R A;  4LII A;  3GSI A;  4JNA A;  1YQZ A;  2YLZ A;  5FS7 A;  1ZK7 A;  4H2R A;  2WPF A;  3H8L A;  1DOE A;  1O94 A;  4Z25 A;  2E1M A;  1CHU A;  2YR6 A;  4U8P A;  4B63 A;  3F8P A;  3P4Q A;  4YTN A;  1DOB A;  1H7X A;  2BK5 A;  2GF3 A;  2HQM A;  2WU5 A;  3B3R A;  5KVI A;  2APG A;  2XVE A;  3VRA A;  4JNQ A;  2YG5 A;  4EMW A;  4RG3 A;  3NT6 A;  4CY6 A;  2QAE A;  4OVI A;  3DJJ A;  3UKA A;  1F8R A;  3UKQ A;  3GMB A;  1H82 A;  3UTE A;  4EQR A;  4BJY A;  2C72 A;  3EAO A;  2TPR A;  3NTD A;  1JU2 A;  3ABV A;  2GR3 A;  2WP5 A;  2B7R A;  4NTE A;  3AXB A;  2RGJ A;  4B65 A;  4YSH A;  4HB9 A;  1CJ3 A;  1GET A;  2CFY A;  4USR A;  2XFN A;  1GES A;  4GCM A;  4CRT A;  2WOW A;  4MJW A;  4K7Z A;  1ONF A;  5FMH A;  1E7P A;  3C4A A;  4TLX A;  4UDP A;  2WP9 A;  2QCU A;  3CGD A;  5BRT A;  3GRS A;  3URH A;  2R4J A;  4FK1 C;  3IWA A;  4U8O A;  3NH3 X;  2XFO A;  1OJA A;  2GR1 A;  3K7Q X;  2IVD A;  2VZ2 A;  4NZH A;  4H4W A;  3AE9 A;  2JB2 A;  5TR3 A;  3DK4 A;  4D03 A;  3H4K A;  1GSN A;  4U2L A;  3ICR A;  3QJ4 A;  4Z2R A;  2BS3 A;  4AT2 A;  4BK3 A;  1KF6 A;  2I0Z A;  3VR9 A;  1L0V A;  4B64 A;  1GT8 A;  4JY3 A;  2H89 A;  3RHA A;  1PXA A;  5U63 A;  2GMH A;  2YVF A;  2XFP A;  1CC2 A;  3NGC X;  4DGK A;  2EQ9 A;  4ECH A;  2RGH A;  4Y4L A;  2DKH A;  1K0L A;  3LXD A;  1QLB A;  4YT0 A;  1F8W A;  1KDG A;  2IVE A;  1IJH A;  2C64 A;  4GDP A;  4DSH A;  3CNT A;  4UP3 A;  1DXL A;  4Z24 A;  4A6N A;  2FJD A;  3AEF A;  1LPF A;  1M6I A;  2GQW A;  2B9X A;  3V76 A;  1GOS A;  4BK2 A;  1E1N A;  1EL8 A;  1AOG A;  4CCQ A;  1BWC A;  4Z2U A;  4B66 A;  2CDU A;  2CVJ A;  2XLR A;  1OJ9 A;  4X4J A;  1B4V A;  3QSE A;  2WS3 A;  2EQ8 A;  4BK1 A;  3ZDN A;  4Y4M A;  5U25 A;  2C65 A;  2OA1 A;  3NYF A;  1EBD A;  2R0C A;  3NN6 X;  2Z5Y A;  1GRH A;  3AE6 A;  2JK6 A;  2C66 A;  4PAB A;  4TM1 A;  4C5O A;  5EOW A;  5M0Z A;  3DGH A;  3LB8 A;  3DJG X;  1GRG A;  4KPR A;  1P2E A;  3CPH G;  2X99 A;  3AYL A; 
#chains in the Genus database with same CATH topology
 2GRT A;  4OPI A;  3AA6 B;  4IDZ A;  1NEK A;  1DOD A;  4H63 H;  3Q6J A;  3ZMU B;  4OPL A;  4DV0 T;  5HYA A;  4DR2 T;  2PYJ A;  2V7L A;  4YWO A;  2UUC T;  3MAC A;  4EZH A;  1D7L A;  3ALJ A;  4TV8 E;  2AQJ A;  5CJ5 A;  5FS8 A;  4HFE A;  4EYU A;  3IHM A;  5IPY A;  4HFI A;  1F8S A;  4B1B A;  2B7S A;  5FXW A;  1PBE A;  5J0Z A;  5L3E B;  3GWD A;  4IE5 A;  3CVR A;  3RP6 A;  2LJL A;  2XAG B;  4P0A A;  3QFA A;  3ZYK A;  2WM9 A;  2CRB A;  1YY5 A;  2KLQ A;  1T72 A;  1D4D A;  2K3W A;  3R84 B;  5JDL A;  5LGU B;  2K48 A;  1ZP0 A;  2XVH A;  5FS9 A;  4TM0 A;  5HXR A;  3PE0 A;  1UGO A;  4CI2 B;  3GYJ A;  3UP4 A;  2WY2 A;  4B3M T;  3AB3 B;  3GWH A;  2VVM A;  4X64 T;  1W4X A;  2EQ6 A;  2W00 A;  5IYZ E;  1Y01 A;  2WET A;  2ZBW A;  4K8D A;  4CNK A;  5H6Q B;  5KOX A;  1NEN A;  2V6X A;  3OC4 A;  4HKA A;  2BS2 A;  3DP7 A;  3ADA B;  2WDQ A;  4YHH T;  1GQE A;  3ZN1 B;  1NHR A;  2VVL A;  3II4 A;  1E1M A;  4A56 A;  2TMD A;  2DWG A;  2JBV A;  4PK4 A;  2GQF A;  2PYX A;  4IGU A;  2N1G A;  2M6I A;  4LF8 T;  2WDR A;  4X20 E;  4GB3 4;  3DGZ A;  3GDP A;  1IUX A;  1BZL A;  4P09 A;  4J33 A;  4AT0 A;  4AP3 A;  2KND A;  3IA3 A;  4ZS2 A;  4TX5 A;  1MOK A;  3M12 A;  3N2O A;  2YN6 A;  4DBQ A;  5FNV E;  2XAH B;  1S2Y A;  2QA2 A;  4N78 D;  2YOE A;  4ADZ A;  5LCY A;  4H4U A;  3AEB A;  4DID B;  5GSN A;  1TDF A;  4F6R C;  5ABE A;  4QH4 A;  3SFE A;  4U2Z A;  3RRW A;  2V6Y B;  2V7I A;  1DU2 A;  1YQ3 A;  5J1G A;  2W67 A;  4BJN A;  5EK4 A;  1CC4 A;  2XY8 B;  3VHL A;  4PDW D;  3PU3 A;  2KT9 A;  1XMO T;  3UKF A;  4U72 A;  4FDC B;  4KBM B;  2XQ8 A;  2PTF A;  3SY4 A;  1TYP A;  4P9S A;  1SHZ C;  1K0I A;  4HE8 A;  2HN1 A;  4DV6 T;  2BAB A;  1FMW A;  2LOS A;  3ONJ A;  1LVK A;  4II2 A;  5LG3 A;  1NHQ A;  3VRB A;  3V3N A;  3H3A A;  2BCG G;  1YKJ A;  1VBA 4;  2C7G A;  2XQ3 A;  4AOX A;  4UEL A;  2LRL A;  4AOS A;  5AQF B;  4JI8 T;  1QSD A;  5LP6 E;  3CNJ A;  3ZMS B;  1VRH 4;  4WNK A;  4CN4 A;  3KIN B;  2PY5 A;  4COF A;  1W9R A;  3N9P A;  4O4I E;  3CQG B;  3ALL A;  3PUG A;  3UTK A;  4J57 A;  4ZZB A;  4DBR A;  2ZZ0 A;  3ZT6 A;  1MQT D;  1UX5 A;  4A9W A;  1J5W A;  2HPJ A;  1ZOY A;  3OYZ A;  1OJD A;  4C3X A;  3UFE A;  5HXC A;  3RNM A;  2QA7 A;  4ILC A;  4MFR A;  4JI0 T;  1DJQ A;  3KV9 A;  4LF9 T;  3S61 A;  2HH7 A;  1GRT A;  2YK0 A;  4RG4 A;  2YDS A;  3KA7 A;  5LXT E;  4ERR A;  1KEY A;  2X50 A;  2NTX A;  2X66 A;  3I6D A;  3ATR A;  2FJE A;  4HN9 A;  4H9P C;  4AKI A;  3WE0 A;  2A87 A;  4U33 A;  1TDN A;  3BHF A;  3P4R A;  2YM1 A;  3NHO X;  2YR4 A;  2WEU A;  2E4G A;  1T7S A;  3KVE A;  2X9Y A;  4LFA T;  1NHP A;  3NTA A;  4M52 A;  4L9I A;  4NPP A;  4BUR A;  2UXN B;  1N4U A;  1XMQ T;  3NK2 X;  5LBQ B;  1J5E T;  3AED A;  2OLN A;  3HZL A;  2I6H A;  3C4X A;  2WP6 A;  1PJ6 A;  1S3B A;  5CGM A;  3KU9 A;  3RYI E;  4H4Z A;  2BVM A;  4H4V A;  1JRZ A;  4H7U A;  3SGL A;  4CI3 B;  2IIU A;  4UV8 B;  3AAI A;  3RHW A;  2P9B A;  1D0Y A;  5HEJ A;  4X62 T;  2VKO A;  4EM4 A;  2X3N A;  1UCU A;  2NR4 A;  4CCR A;  4M1P A;  1QO8 A;  3UKH A;  3ZJ1 A;  1L9C A;  4A65 A;  1E1K A;  1FL2 A;  2V1D B;  5AQS B;  4G9K A;  5FP3 A;  1VBC 4;  2ACZ A;  2YLR A;  3LZX A;  1VRQ B;  4LF7 T;  5IUX A;  2OAL A;  3IF9 A;  3UUN A;  4ZI7 E;  2H7O A;  5FKY A;  4GR1 A;  4KI0 F;  3PUA A;  1LQU A;  4H4R A;  4PK6 A;  1NG3 A;  2UXB T;  4YSY A;  1YQ4 A;  5HXI A;  3RIU C;  3C98 B;  3K8P C;  1MIW A;  2HPL A;  2JRK A;  4DR5 T;  1GER A;  2BKO A;  5HYM A;  4H4T A;  2Y6X A;  1FIO A;  1Z0P A;  4OFZ A;  4EM3 A;  3VR8 A;  2VWA A;  3BQK A;  3P7I A;  4A7A A;  3UU8 A;  4H50 A;  2W0G A;  2EHO C;  2JAE A;  3PUR A;  4FJO A;  2KWH A;  4O2B E;  2BK4 A;  4ADW A;  2IML A;  3T2K A;  3KVB A;  3EAB A;  4OPD A;  2XLT A;  4CZZ B;  3SXI A;  2JB1 A;  2R7F A;  4EAH A;  2X9X A;  4FX9 A;  3KV6 A;  4EED A;  2E2A A;  2LHN A;  4LFC T;  4B6X A;  1Y56 A;  2LFC A;  1AR7 4;  2WPC A;  3RC8 A;  4Q4V 4;  2B1E A;  3CML A;  5CA0 E;  2VKD A;  3Q5X A;  3CX7 B;  4DSG A;  4ILU A;  4YXD A;  1MMN A;  4EXT A;  1N4W A;  2WBL A;  5J7X A;  4QXC B;  5HEH A;  2WHD A;  1FEC A;  1GEU A;  1ZKQ A;  2CUL A;  4OPU A;  4EQW A;  2UUA T;  5LBM A;  1LV0 A;  3NKZ A;  5HHF A;  5L2L A;  4Q4Y 4;  2W62 A;  3ETV A;  1EL5 A;  4TWF A;  1NAF A;  2LRK A;  2HN2 A;  2YLZ A;  2V5C A;  1ZK7 A;  1DOE A;  4MLK A;  5FVK A;  4XBF B;  4AQF C;  4DUY T;  2E1M A;  2YR6 A;  2HQM A;  2WU5 A;  4HFB A;  2XVE A;  5JH7 E;  2ZM0 A;  3FBL A;  2YG5 A;  4RG3 A;  4GYS A;  2DLR A;  2YU1 A;  3E0Z A;  3GMI A;  3ZYL A;  3UKQ A;  1H82 A;  2JQQ A;  4BJY A;  5LGN B;  3B5M A;  3EAO A;  2TPR A;  2Q9Q A;  2B7R A;  2LKG A;  2A72 A;  3SZF A;  4GAP A;  4K7Z A;  1RUD 4;  3Q2M A;  3VKH A;  4NWZ A;  1E2A A;  4TLX A;  2N2N A;  4UDP A;  4DV2 T;  4E7Z A;  1IBM T;  3URH A;  4DV3 T;  4FK1 C;  3IWA A;  3HKD E;  3M65 A;  3TLS A;  3TKL B;  4O8S A;  1E1H B;  2YDR A;  1FJG T;  2XFO A;  2GR1 A;  3K7Q X;  2IVD A;  2Y8D A;  2LT3 A;  4H4W A;  3AE9 A;  2JB2 A;  4NXM T;  3DK4 A;  4JI3 T;  1AR9 4;  1B7T A;  5AQK B;  5AQI B;  2BS3 A;  4BK3 A;  1KF6 A;  2EHO B;  1L0V A;  4XAX B;  4JY3 A;  3SX6 A;  2UU9 T;  2XFP A;  4GKK T;  4JI1 T;  4DGK A;  4Y4L A;  4ZOL E;  4BJM A;  2W61 A;  5LHH B;  5IWA T;  1WFD A;  2IVE A;  1IJH A;  2C64 A;  4GDP A;  4JI2 T;  3CNT A;  3T0K A;  1QUU A;  1UUS A;  2B9X A;  2GQW A;  3P50 A;  4BK2 A;  1VBE 4;  2W4X A;  4ZS3 A;  3R6N A;  5LGT B;  4DV5 T;  4B66 A;  3HL6 A;  2XLR A;  2VL0 A;  2EQ8 A;  5EK3 A;  4Y4M A;  1SUM B;  5ADX L;  1GRH A;  4PAB A;  4TM1 A;  5M0Z A;  3NLC A;  1P2E A;  3CPH G;  2X99 A;  1PBB A;  2XDO A;  4NXN T;  2YVG A;  1N33 T;  3P4P A;  3DK8 A;  5BUL A;  5JDM A;  1Z6L A;  3BHK A;  5AQQ B;  3RYF E;  1CC6 A;  1Q1R A;  3GRT A;  4EZ4 A;  1XPQ A;  2XQY A;  2J3N A;  3L3P A;  2XLS A;  1JNR A;  4RSL A;  3ONL C;  5KX5 E;  2BXR A;  2ZZC A;  2R0G A;  4UF0 A;  3AA1 B;  1O3X A;  1I94 T;  5LJM A;  3SS1 A;  2R0P A;  4ZCD A;  1BGJ A;  2ZZB A;  4UR9 A;  1L9D A;  1UK5 A;  4WYV A;  4UDR A;  3OTO T;  4P1N A;  5C2T A;  2LLY A;  3SFD A;  3BI5 A;  4G6H A;  2LOP A;  3PO7 A;  2DHR A;  3AAE B;  2B9Y A;  2ARD A;  4JN9 A;  4H4Q A;  2NW8 A;  1XI1 A;  4AQY T;  4UVA B;  5FY1 A;  2L9Q A;  4DR4 T;  4K2X A;  4B3S T;  2CHO A;  1RSG A;  3CGE A;  3T14 A;  2V7J A;  4EIP A;  3ZST A;  1TDO A;  2XCG A;  1NG4 A;  3QSM A;  4QH5 A;  2MBG A;  4GUV A;  3O4X E;  4U8I A;  4U8N A;  3O1H A;  3GA8 A;  2IDO B;  3PVC A;  2BG9 A;  4C90 A;  1VDC A;  4TM3 A;  2XQA A;  1JRX A;  4I59 A;  4UF0 B;  2WCA A;  1IUT A;  4TZ4 C;  3UOV A;  4LU6 A;  3NZQ A;  3PUX F;  5ABF A;  2YEV C;  4IDO A;  1E1L A;  2GH5 A;  3KV5 A;  2WQY A;  5AQJ B;  5HWY A;  2ZM6 T;  3GQH A;  3EI0 A;  1X31 B;  1MO9 A;  2KXP B;  1PXC A;  1IUU A;  1RUC 4;  3S4U A;  2YLX A;  2WOI A;  2X0Y A;  4CY8 A;  1HNX T;  4QXB B;  4USQ A;  5CA1 E;  4NTC A;  3AEE A;  2JMK A;  4Z44 A;  3KPK A;  3OYX A;  4O4L E;  3LFM A;  5HXE A;  1PDH A;  3O0H A;  4CN1 A;  4HFC A;  4ILA A;  5HCJ A;  3AWI A;  3M3Z B;  1IBL T;  4QX7 B;  3DK9 A;  3AYJ A;  3QVP A;  3H3M A;  2VL8 A;  4OPG A;  4BAY B;  2GB0 A;  1S35 A;  3UTF A;  4BJZ A;  2VQ7 A;  2R07 4;  1K0J A;  2C5K T;  3FZF B;  2VQB A;  1MIY A;  1KFY A;  3JD7 4;  5ABF B;  1PXB A;  3JC6 D;  3SM8 A;  1NHS A;  3FI7 A;  5KVH A;  4WBO A;  2RR1 4;  4YY3 T;  3BQL A;  1M64 A;  3TLT A;  1B37 A;  3CIR A;  1IZN B;  2Q6U A;  2QGS A;  2VKJ A;  3N5L A;  3PJA A;  4ZCC A;  2PBI A;  3LDQ B;  5J60 A;  2N9D A;  4A97 A;  4LML A;  2FJB A;  1POV 0;  1ZOV A;  1CJ2 A;  3AE8 A;  4LF6 T;  3ZT7 A;  4YSZ A;  5KMG P;  5AQL B;  2C76 A;  3AAA B;  3N9Q A;  4D04 A;  1EL9 A;  3RPU A;  3UCL A;  1XHC A;  4LMK A;  3P9U A;  3EF6 A;  2WSS V;  1ZMC A;  2RM2 4;  3F8D A;  1WCR A;  5L3F B;  1FOH A;  2XFU A;  4JEU B;  2IAK A;  1F6M A;  4U2Y A;  1G73 A;  2YAU A;  2K9A A;  4ZXL A;  4II3 A;  4IDQ A;  4CXW A;  5HAX A;  4OYK A;  4HWC A;  3IHG A;  2WB5 A;  1LJ1 A;  3PS9 A;  5AQO B;  1ZDL A;  3KKJ A;  1VCT A;  1VOM A;  3FXE B;  2J1D G;  5KMR A;  1T98 A;  5FY0 A;  3L8R A;  2X8G A;  1NCQ D;  2GMJ A;  4NIQ A;  3W15 B;  4AXP A;  1N1P A;  2GV8 A;  1OXZ A;  4Y4N A;  1IUV A;  2V3A A;  3FZM B;  2HHH T;  1HF8 A;  4KMC A;  3ISH A;  4QHO A;  1CL0 A;  2ES0 A;  5FL1 A;  2PW9 A;  3NK0 X;  1RVF 4;  4C91 A;  1TRB A;  3FHN A;  4U7I A;  2A9U A;  2CM0 A;  2ODV A;  4KHZ F;  3NN0 X;  4LA1 A;  1IBK T;  5AQV B;  4KUM B;  3L09 A;  3I3L A;  4I43 B;  1BGN A;  1S2Q A;  3CNS A;  3N2G E;  2RAB A;  3D1C A;  2WES A;  2NPX A;  5J2T E;  3RKO A;  1WR6 A;  2BC0 A;  2V60 A;  3FPZ A;  1HXS 4;  4DR6 T;  5LHG B;  1BR2 A;  4YTM A;  4K5R A;  1JEH A;  4ZZC A;  4CXX A;  3O9X A;  3G5Q A;  5IQ4 A;  5JDG A;  3T37 A;  3C96 A;  3NZP A;  3FZK B;  3I0Q A;  3ZMT B;  2WU2 A;  4IST A;  5LNK A;  3NNE A;  3ZT5 A;  1NAA A;  1NPX A;  2VKH A;  4IL4 A;  2CBJ A;  4X66 T;  3UKK A;  1KSU A;  2QVA A;  5JDN A;  4DR1 T;  1ZEE A;  1XZY A;  1COV 4;  1WYC A;  3K30 A;  2Q0K A;  1R08 4;  2JMH A;  4X5T A;  3L1R A;  2J62 A;  3OZ2 A;  3DH9 A;  3JC6 C;  3QUJ A;  3SOL A;  2YG3 A;  2YR5 A;  4CI1 B;  4U3C A;  4IE4 A;  1AJ3 A;  1LVL A;  1FMV A;  3MXZ A;  2FJA A;  4MBQ A;  5LG4 A;  1JNZ A;  2UXD T;  4ASK A;  2C73 A;  4C74 A;  3NBX X;  5TAO A;  3CN8 A;  3EHZ A;  2LSJ A;  4O5Q A;  1LVF A;  4HFH A;  2V6O A;  1JOA A;  2EHO D;  1OOP D;  1TDE A;  3U3I A;  1V9D A;  3UU3 A;  4PAA A;  5CKU A;  1W09 A;  3LBX A;  5ABH A;  3LOV A;  4GF7 A;  3UKP A;  1KK7 A;  3UUL A;  4OK0 A;  2GR2 A;  2DI4 A;  3AE4 A;  1IUW A;  3PUS A;  3EVY A;  4Q4X 4;  2BKP A;  4H9R C;  3RQW A;  1ZY8 A;  4U7Y A;  5EB4 A;  2WPE A;  3TLU A;  2V7K A;  4XWR A;  1H8T D;  4HFD A;  4J36 A;  5CFB A;  1O95 A;  3CTY A;  5EK2 A;  3DTO A;  1COY A;  2AXD S;  1HTJ F;  5JR9 A;  2PG8 A;  1H83 A;  4H4Y A;  5LYJ E;  2X8C A;  3H8I A;  5LMU T;  5GRT A;  4X9N A;  4O2A E;  4P0B A;  3N2K E;  2VRM A;  1RMU 4;  2XSA A;  3GSI A;  2HWC 4;  3B13 A;  1YQZ A;  3H8L A;  4Z25 A;  2BDE A;  1CHU A;  2APG A;  3LBX B;  5FXV A;  3VRA A;  1Z7S 4;  4JI7 T;  4CXY A;  3FBZ A;  3RF1 A;  3NT6 A;  4CY6 A;  2QAE A;  3ZKR A;  4DMV A;  2H3R A;  2J47 A;  3AVR A;  3VKG A;  4EB6 E;  3NTD A;  3ABV A;  3JAD A;  4NTE A;  2RGJ A;  4GAV A;  2LEH A;  4YSH A;  1OED E;  1GES A;  5JR9 B;  4PAG A;  1E7P A;  2IC6 A;  2XQ6 A;  4QXH B;  5BRT A;  3FZH B;  3UU6 A;  3FB2 A;  4OX9 T;  2R4J A;  3NH3 X;  5AQT B;  3SWH A;  2D0U A;  1OJA A;  2WMO A;  2VZ2 A;  5HEO A;  2YDQ A;  3OJA A;  2W2U A;  4A98 A;  3H4K A;  1GSN A;  4D03 A;  4G74 A;  4U2L A;  4JI4 T;  2NW9 A;  1D0Z A;  3QJ4 A;  4Z2R A;  4PK5 A;  4I4T E;  3VR9 A;  1HFA A;  2CA5 A;  3CPZ A;  3TLW A;  4HWF A;  2WMN A;  3RYH E;  2ZLY A;  4G73 A;  2X68 A;  3KV4 A;  5F5W A;  4IHJ E;  2RGH A;  1QLB A;  2R06 4;  5JDF A;  4ZHQ E;  2ZM2 A;  5F3J A;  3PUV F;  2FJD A;  3A7M A;  1RUJ 4;  4F8H A;  5HXH A;  1E1N A;  1AOG A;  1XNQ T;  1W0A A;  4Z2U A;  3X1D A;  1Y64 B;  3D0T A;  2W66 A;  1OJ9 A;  1B4V A;  2E5L T;  4BK1 A;  3ZDN A;  4B3R T;  5U25 A;  3NYF A;  3AE6 A;  2JK6 A;  5LA6 E;  3ZN0 B;  4FI5 A;  4O4H E;  4DV1 T;  3DGH A;  1GRG A;  3RRC A;  1GXF A;  5C8Y E;  4LMJ A;  4LF5 T;  1K5M D;  1H7W A;  3O1I A;  1Q1W A;  2YLW A;  4CQI A;  2Q9Q C;  1ZKE A;  2H88 A;  2JQ9 A;  5ETW A;  4UIG A;  1D1A A;  4U8K A;  4I0U A;  2UZZ A;  4DMW A;  3RX6 A;  1XDI A;  4B67 A;  1HCI A;  3ITJ A;  3EAN A;  2R4E A;  3OBV E;  1FEA A;  2JB3 A;  3ZEF B;  2E8I A;  5AQM B;  1CJ4 A;  2XM2 A;  1P2H A;  3CND A;  3NYE A;  3HKE E;  4WCT A;  2K5B B;  5JCK A;  3ZSS A;  1X9B A;  3S5W A;  5KMQ A;  2RMU 4;  5L4E A;  4Q4W 4;  1TDK A;  4O5U A;  2BG9 E;  4HFV A;  4J2C A;  3SQP A;  3N9M A;  2YIN A;  5ABG A;  3GWF A;  2CMR A;  5IQ1 A;  3LSV A;  3HYW A;  4YLH A;  1HRI 4;  5E0O A;  3ZYX A;  3AXJ A;  2CE7 A;  4H9N C;  3HI2 A;  3CQX C;  4U8M A;  5KMP A;  2DNX A;  1HNW T;  1PN0 A;  3ANW A;  4EYY R;  1H84 A;  3RED A;  2YU2 A;  3KD9 A;  4TNW A;  2RS5 4;  1RUI 4;  2CBI A;  1U4Q A;  4IE7 A;  4LF4 T;  3RP7 A;  3T31 A;  4AI6 A;  1LKX A;  3KBU A;  5JDQ A;  4IA6 A;  3P4S A;  5KRQ A;  1Y56 B;  1EZ3 A;  3RC3 A;  4AP1 A;  1KNZ A;  2A3D A;  3QNU A;  4GKJ T;  2BAC A;  4JI6 T;  1H6V A;  4Z26 A;  3RI5 A;  1HG5 A;  1KNP A;  2D5U A;  2LSI A;  3R9U A;  4EIW A;  3SUC A;  2XTL A;  4IA5 A;  1Q9I A;  2CWY A;  2XQ9 A;  1DOC A;  4I50 E;  3FMW A;  1ZMD A;  2LM2 A;  3AE3 A;  2XVF A;  3G5S A;  4EOZ B;  4ILB A;  3B6D A;  2KSR A;  4IVO B;  2VB6 A;  1VBB 4;  1X79 A;  1JRY A;  4GIW A;  2UXC T;  3COX A;  1CBO A;  3CK6 A;  3WAK A;  1J1J A;  2KIN B;  3UU5 A;  4PJM A;  4A79 A;  5A1L A;  4I58 A;  3PUQ A;  1N32 T;  1OJT A;  3A5X A;  3HA4 A;  3RKG A;  2D2S A;  1WYB A;  1OED A;  1VG0 A;  1D4C A;  1B8S A;  3LZW A;  2CXL A;  4ZN0 A;  2A8X A;  3NG7 X;  2Q9Q B;  2RGO A;  4DND A;  2E9X A;  3DJE A;  3GDN A;  4HTE A;  3ZCJ A;  2LM9 A;  5FY7 A;  1PJ7 A;  2R45 A;  3M13 A;  2K24 A;  4H2N A;  2GEW A;  4AKG A;  1HX1 B;  3JCF A;  4BA9 A;  3J7Y q;  4WX1 A;  1MXT A;  2Y6Q A;  4U2S A;  3HYV A;  5HWX A;  3C4Z A;  2RA1 A;  5HCM A;  4NEW A;  3L8K A;  4UDQ A;  1SA0 E;  2CEA A;  1S3E A;  2B9W A;  1HYU A;  2YM2 A;  3MZK B;  4NEV A;  1CUN A;  4ZI3 D;  5BVA A;  4IIJ E;  2BG9 C;  1XAN A;  3MKD A;  3UTH A;  3AE2 A;  3SRZ A;  4U8L A;  4JI5 T;  1MNE A;  3PUW F;  4JLE A;  4QWN B;  2BKN A;  1GPE A;  4EMI A;  1OED B;  2SPC A;  3E08 A;  3NRY A;  2XLP A;  4PJL A;  5BR8 T;  1CJC A;  4WBN E;  3FZL B;  1D0X A;  3IC9 A;  4U8J A;  5FXZ A;  3SYI A;  5LJN A;  2C3D A;  1BR4 A;  3M0O A;  2E9X B;  2YWL A;  1YXR A;  5JDH A;  3CGC A;  3I9Y A;  4L5G A;  3BNM A;  5JRC A;  4NNJ A;  4QX8 B;  3VU7 H;  3AD8 B;  3ALM A;  2BC1 A;  4J56 A;  5FXX A;  3RYC E;  4AKL A;  2YG6 A;  5DAB A;  1GND A;  5JVD E;  2BXS A;  4DV4 T;  2HWB 4;  3T1H T;  2E5V A;  2JIW A;  5HY5 A;  4K5S A;  4Z43 A;  4ICY A;  3UUM A;  2WWV A;  3DME A;  1N36 T;  1HS7 A;  2DCF A;  1ELI A;  4U2T A;  3CQC B;  4HGA A;  2UXX B;  5JCN A;  2A2F X;  5JRE A;  4OPT A;  4YHJ A;  5L46 A;  3RLF F;  2CXF A;  5FS6 A;  2Y48 B;  2C67 A;  3DA1 A;  3C4N A;  2WZI A;  2NOX A;  1PHH A;  2BRY A;  4PNI A;  2DWK A;  1DNC A;  2QRX A;  1R09 4;  3ZPO A;  1XDP A;  4J34 A;  3V3O A;  1PO1 4;  5CB4 E;  4B3T T;  4A5L A;  1SE7 A;  3J8F 4;  4ZEY A;  5KDM C;  5J2U E;  4C77 A;  4TLZ A;  3V5U A;  2M6B A;  2WWU A;  4GOU A;  3CPI G;  2XPK A;  2XQ7 A;  1D7Y A;  3ZC1 A;  2FUP A;  2V5D A;  4JUY A;  1UUR A;  4DO0 A;  1CF3 A;  3GD4 A;  3HR0 A;  2UUB T;  1SEZ A;  4H9O C;  2XVI A;  3UT5 E;  5U1O A;  3Q9T A;  3GQK A;  4TNV A;  5M10 A;  2C0S A;  4DR3 T;  4EQX A;  3AE1 A;  2Y6R A;  2XVJ A;  4DR7 T;  4HWD A;  3LJC A;  4JQ9 A;  4KX6 A;  2BG9 B;  1GRA A;  5C3J A;  2AE9 A;  3JSK A;  1PBC A;  1M62 A;  5GON E;  1LRZ A;  3H37 A;  1ZHC A;  4TWH A;  3E1T A;  2V7M A;  4KHP T;  3RP8 A;  1MMG A;  4ZI2 D;  4PW8 A;  2IUB A;  4YSX A;  3AYI A;  4ZI3 C;  1D5T A;  4J2W A;  2ACX A;  2QA1 A;  2CXD A;  5KXJ A;  1XDO A;  4REK A;  2BRA A;  2JPF A;  4U74 A;  5HXS A;  4APN A;  2CLY B;  2XJ7 A;  2R46 A;  4EIQ A;  3JAE A;  1PBF A;  2X0L B;  3GYI A;  2WBA A;  2L3L A;  5FL0 A;  2XSB A;  3BI2 A;  2XLU A;  1KNR A;  2XHE B;  4QH1 A;  4AQG A;  2CPT A;  3DJD A;  5JCM A;  4X1Y E;  1BKW A;  1GRB A;  2YG7 A;  2X8H A;  2LSY A;  1VRB A;  4YJ3 E;  3UOZ A;  3C64 A;  2C3C A;  4UV9 B;  3HYX A;  3LK3 B;  1VQW A;  3UUB A;  3KPF A;  1E6E A;  2C70 A;  3LAD A;  4TM4 A;  1RUH 4;  2XAQ B;  3FBS A;  3I9W A;  2XFQ A;  3AEA A;  4A99 A;  2GVC A;  4LII A;  2D9D A;  5FS7 A;  3IF8 B;  4L0R A;  1HNZ T;  1O94 A;  3T2Z A;  3U78 A;  1MMA A;  4IRE A;  4B63 A;  1US7 B;  3P4Q A;  4YTN A;  2GF3 A;  2BK5 A;  3B3R A;  5KVI A;  3MK7 C;  2RS1 4;  4JNQ A;  1XWM A;  1AR8 4;  4A5X A;  4EMW A;  1XHZ A;  2PZS A;  4OVI A;  3NRX A;  3DJJ A;  1F8R A;  3UTE A;  2XAJ B;  1U5P A;  4H63 V;  2LSK A;  2V6Y A;  1JU2 A;  2GR3 A;  3A8Y C;  3F57 A;  1HG2 A;  3RIF A;  4HB9 A;  1CJ3 A;  2LHR A;  4USR A;  3WI3 A;  3KDS E;  2PYL A;  4UVB B;  4X1I E;  1RHI 4;  1ONF A;  3C4A A;  3P4W A;  2QCU A;  3RIA A;  4JV5 T;  1UX4 A;  4U8O A;  4WZX A;  3GN5 A;  4NZH A;  1PVC 4;  3ICR A;  4HWH A;  2X9H A;  4AKH A;  4AIS A;  3EAM A;  4B64 A;  3RHA A;  1PXA A;  3FXD B;  5JR9 C;  2GMH A;  5U63 A;  2V8S V;  3HKC E;  3NGC X;  2EQ9 A;  4ECH A;  2DKH A;  1K0L A;  3AVS A;  1IAP A;  4YT0 A;  1F8W A;  1KDG A;  4DSH A;  2PLV 4;  4A6N A;  5L3B B;  4I55 E;  3AA7 B;  1M6I A;  1D4M 4;  3F31 A;  3PUZ F;  4ZI2 C;  4CCQ A;  2WAU A;  2CDU A;  4PFP A;  2CVJ A;  2KMF A;  1ZV4 X;  2R6G F;  2WS3 A;  3EDV A;  4X1K E;  3UFG A;  2C65 A;  1EBD A;  3NN6 X;  2Z5Y A;  1W0B A;  2C66 A;  4C5O A;  1HRV 4;  3RQU A;  3LB8 A;  3T8O A;  3GN5 B;  3AYL A;  2V61 A;  3CMM A;  4K22 A;  2DL1 A;  1FEW A;  3EPT A;  2PFV A;  4OCG A;  3AA0 B;  2BS4 A;  5FYM A;  1NA1 D;  2Q9Q D;  1YKE B;  2XQ5 A;  1LTX R;  2C5J A;  2CHN A;  2ZMA A;  5LV9 A;  5L3G B;  1QJD A;  3LJP A;  2O9Z A;  1D1C A;  4BV6 A;  3WAJ A;  1DJN A;  2VVS A;  1PBD A;  2Q0L A;  5F8P A;  5AQH B;  1MND A;  4DVD A;  2F5Z A;  2JJ9 A;  3DJB A;  3QB5 A;  5L3D B;  4HA6 A;  4A6N B;  1N4V A;  1RP0 A;  2C4C A;  2L8K A;  1FEB A;  1IUS A;  3ZMV B;  1GTE A;  2NWB A;  3CNP A;  1I6Z A;  1PIV 4;  2BCP A;  3C51 A;  3B57 A;  4NUU A;  3C4W A;  5DQV A;  2WOV A;  1D1B A;  5DQW A;  3BI4 A;  3Q5W A;  3Q5E A;  4KP3 C;  4XXG A;  4GDE A;  3UU4 A;  4CBQ A;  4NTD A;  4C3Y A;  4IV9 A;  2WDV A;  2X9W A;  5CQF A;  4TWD A;  4H9Q C;  4EV6 A;  2YVJ A;  2BBJ A;  2MOZ A;  1EV1 4;  4IE0 A;  5HEG A;  4H4P A;  2BA9 A;  4IL9 A;  4H4X A;  2E9X D;  4QKN A;  3ICT A;  3E22 E;  2BVL A;  2BZB A;  4Q25 A;  2A89 A;  5HEU A;  1GRE A;  1PS9 A;  1UKV G;  4Z8X A;  1HX8 A;  4H9S E;  3SZ0 A;  3NRN A;  3MA9 A;  3AB1 A;  4Z90 A;  4H2P A;  2OAM A;  2GAG B;  3VQR A;  3BNU A;  4ANJ A;  2CCQ A;  4IT4 A;  4CNJ A;  3N9L A;  1BR1 A;  3LK4 2;  1VG9 A;  1V59 A;  1PO2 4;  3I1A A;  3LK2 B;  3I0O A;  3ATQ A;  2C75 A;  3K7T A;  4H4S A;  2Z6E A;  2R04 4;  4IDP A;  2LSG A;  3AE5 A;  3ZC0 A;  4G2A A;  4YKG A;  3FG2 P;  4OYJ A;  3K7M X;  2W0H A;  2M67 A;  2X51 A;  3AEG A;  5JQG E;  1F3P A;  5KOW A;  2OV9 A;  3UTG A;  3CPJ G;  3HKB E;  1O5W A;  5FVL A;  3KLJ A;  2VK9 A;  5EZY E;  2XQ4 A;  1G8X A;  5IHY A;  3CGB A;  1D4E A;  5EB5 A;  1OJC A;  3QVR A;  4U31 A;  2IHR 1;  3NWI A;  4UEM A;  1HR0 T;  1YD8 G;  4K0K T;  1NDA A;  1REO A;  3FIM B;  2I59 A;  2IID A;  3IEE A;  4K0U A;  1K4Q A;  3G5R A;  4MAL A;  3L39 A;  4X9M A;  2VRL A;  1BF3 A;  5JCI A;  2LKH A;  1EL7 A;  5LB7 B;  1H7C A;  5BUK A;  2X67 A;  1WLX A;  1N34 T;  4OHF A;  5AQN B;  4UXN B;  4JYA T;  4JDR A;  1H81 A;  4Z2T A;  5KWF A;  2MTQ A;  2C5I T;  2V3B A;  2IC9 A;  3P8C D;  3TLV A;  3OKQ A;  3OPC A;  3LG7 A;  5FMN A;  5M4Y A;  3N9N A;  2BYB A;  5L4H A;  2AAQ A;  2J4G A;  4IDN A;  5LMN T;  2Q7V A;  2I0M A;  2R9Z A;  1Z8U A;  4DNA A;  3EDU A;  3KVA A;  4X65 T;  5ER0 A;  3P1W A;  3AD7 B;  2RP4 A;  4E7S A;  1VCS A;  1GRF A;  1RUG 4;  3RIU A;  2VUR A;  3CWZ B;  2YLS A;  4OPC A;  2VVL G;  1FCD A;  2NVK X;  3NK1 X;  1OED C;  2KWI B;  3IHR A;  3PDY A;  2X0H A;  4EEB A;  4YTP A;  3ZMZ B;  1GV4 A;  3QFB A;  3NIX A;  2E9X C;  4B68 A;  2BK3 A;  5AFU L;  1M7K A;  3C50 A;  4E0V A;  4IE6 A;  3JAF A;  2V5Z A;  2EHO A;  4H2Q A;  2OLT A;  2LE8 A;  2JKC A;  4Z91 A;  2PJQ A;  1MIV A;  4PFO A;  2YLT A;  4YJ2 E;  3IBP A;  2OLO A;  2B76 A;  3UKL A;  2GR0 A;  1E39 A;  3GD3 A;  2KZ7 B;  1IJ5 A;  4HWI B;  1RYI A;  4JY2 A;  1YKH B;  3QK6 A;  4XZC A;  1H86 A;  3K3Q C;  1L9E A;  1T8B A;  3PUY F;  5BMV E;  3AXJ B;  3T2Y A;  1Y0P A;  2YG4 A;  2AR8 A;  4PJJ A;  4B69 A;  4O4J E;  2FBW A;  3AE7 A;  3AEC A;  1ZX9 A;  4YKF A;  3EUH A;  3ANW B;  1GTH A;  3GYX A;  1WR0 A;  1AL2 4;  1BR0 A;  2OA5 A;  5KNL A;  3BQI A;  3T1Y T;  2JQH A;  3VRD B;  5L3C B;  4JEH B;  2EQ7 A;  3PU8 A;  4EQS A;  2G0U A;  3AD9 B;  3GMC A;  4RHV 4;  3QB5 K;  2NTY A;  2VAS A;  4G63 A;  3RH3 A;  4XWZ A;  3UOY A;  5KMS A;  2X5I D;  1YW0 A;  3SZW A;  2GAH B;  2W63 A;  4AQF A;  2MYS A;  3CKD A;  2QYW A;  2VOU A;  4HEA A;  3KBT A;  1ASJ 4;  4TV9 E;  3K3O A;  4J31 A;  4IVM B;  1VBD 4;  2XZE A;  4DUZ T;  4YFS A;  3Q5D A;  2YQU A;  1B5Q A;  1TYT A;  5AQP B;  3J9X 1;  1WRD A;  3KFW X;  4GRT A;  4N9X A;  4EMJ A;  1RUF 4;  2F4V T;  3MJX A;  4GK5 E;  3UUX B;  2XUE A;  5L47 A;  3ICS A;  5DBJ A;  5LHI B;  3V5S A;  3QSS A;  3Q9D A;  2XYO A;  4FK1 A;  3ZCI A;  2VQF T;  2PHH A;  2RS3 4;  3NKS A;  2GK9 A;  3NVO A;  4AKR B;  5JCL A;  3ZLI A;  1KSS A;  5EBK A;  3N9O A;  4TUY E;  3UOX A;  2NW7 A;  3D8X A;  3ZYM A;  2BBH A;  1AR6 4;  2RPA A;  2IW5 B;  1LQT A;  4G6G A;  3ONX A;  2V26 A;  1GAL A;  5DJQ C;  2DKI A;  3QOF A;  3NYC A;  2VQE T;  3F2E A;  3K3N A;  2Z5X A;  1EAH 4;  1PJ5 A;  3UP5 A;  2CLY C;  2MAW A;  2XM1 A;  3F8R A;  3CX6 B;  4JNA A;  3OVU A;  4H2R A;  2WPF A;  5H6R B;  3JBG 4;  2EX3 A;  4U8P A;  3F8P A;  2H7V C;  5JTG A;  1DOB A;  1H7X A;  1MMD A;  4GYR A;  4LFB T;  4TN7 B;  1NWM X;  3UKA A;  1XNR T;  3GMB A;  4EQR A;  3BK9 A;  2C72 A;  2WP5 A;  3AXB A;  3ETU A;  1BEV 4;  4B65 A;  4PJN A;  3PTR B;  5JRC B;  1GET A;  4CN6 A;  2CFY A;  2XFN A;  3ZJ2 A;  4GCM A;  1RUE 4;  4CRT A;  2WOW A;  3RGL A;  3PJA J;  4MJW A;  5LOV E;  2MPK A;  5FMH A;  2WP9 A;  3CGD A;  4GK0 E;  3GRS A;  4NUV A;  3SZC A;  2YKS A;  1S94 A;  2D0T A;  2XAF B;  1XHX A;  4WW0 A;  5AQU B;  3QC9 A;  4MHC A;  4V1A v;  5TR3 A;  3UQ7 A;  3O1J A;  1R8I A;  3CX8 B;  4AIU A;  4AT2 A;  2I0Z A;  4JBW F;  5AQR B;  1GT8 A;  2H89 A;  2YVF A;  1CC2 A;  3LXD A;  2NP9 A;  3G06 A;  4UP3 A;  1DXL A;  4Z24 A;  3ESL A;  1LPF A;  3AEF A;  3V76 A;  2JQK A;  1GOS A;  1EL8 A;  2ZM8 A;  1BWC A;  1IJ6 A;  2WZH A;  4X4J A;  3K1S A;  3QSE A;  2XAS B;  2ODU A;  4ISS A;  3UQ4 A;  2OA1 A;  2R0C A;  5AQG B;  5EOW A;  2VVN A;  4DV7 T;  1OWA A;  4EGW A;  3PV0 F;  3DJG X;  4KPR A;  4UVC B;  2CWO A; 
#chains in the Genus database with same CATH homology
 2GRT A;  2V61 A;  4OPI A;  1PBB A;  2XDO A;  1GXF A;  2YVG A;  3CMM A;  4K22 A;  4BJZ A;  1DOD A;  1NEK A;  3P4P A;  1H7W A;  1Q1W A;  2YLW A;  3DK8 A;  3EPT A;  5BUL A;  3Q6J A;  4OCG A;  4OPL A;  2H88 A;  2BS4 A;  1Z6L A;  3BHK A;  1CC6 A;  1LTX R;  4U8K A;  1Q1R A;  2UZZ A;  3GRT A;  4YWO A;  1XDI A;  4B67 A;  1XPQ A;  5LV9 A;  2J3N A;  1D7L A;  3LJP A;  1QJD A;  3ALJ A;  2XLS A;  3ITJ A;  2AQJ A;  2O9Z A;  3EAN A;  2R4E A;  4BV6 A;  1DJN A;  1PBD A;  1FEA A;  2Q0L A;  1JNR A;  2JB3 A;  4RSL A;  5FS8 A;  2BXR A;  2F5Z A;  1CJ4 A;  1P2H A;  2ZZC A;  3CND A;  3IHM A;  2R0G A;  3NYE A;  5IPY A;  4HA6 A;  1F8S A;  4B1B A;  4A6N B;  1N4V A;  1RP0 A;  2B7S A;  2C4C A;  2R0P A;  4WCT A;  5JCK A;  1FEB A;  3S5W A;  1IUS A;  1GTE A;  4ZCD A;  1BGJ A;  5KMQ A;  2ZZB A;  1PBE A;  1TDK A;  4O5U A;  1L9D A;  3CNP A;  3SQP A;  3GWF A;  2BCP A;  3GWD A;  4UDR A;  5IQ1 A;  2WOV A;  3RP6 A;  3HYW A;  3QFA A;  3BI4 A;  5C2T A;  3ZYX A;  3SFD A;  1YY5 A;  3BI5 A;  4G6H A;  3PO7 A;  1D4D A;  4GDE A;  4XXG A;  4CBQ A;  4U8M A;  5KMP A;  2B9Y A;  2ARD A;  4JN9 A;  4NTD A;  4C3Y A;  4IV9 A;  1ZP0 A;  2XVH A;  1PN0 A;  2WDV A;  4H4Q A;  5CQF A;  5FS9 A;  1H84 A;  4TM0 A;  3RED A;  3KD9 A;  3GYJ A;  2YVJ A;  3RP7 A;  3T31 A;  3UP4 A;  4K2X A;  3NLC A;  4IA6 A;  3P4S A;  1RSG A;  3CGE A;  3T14 A;  5KRQ A;  1Y56 B;  4H4P A;  2VVM A;  4EIP A;  1TDO A;  1W4X A;  1NG4 A;  2BA9 A;  2EQ6 A;  2XCG A;  3QSM A;  2WET A;  2ZBW A;  4H4X A;  4K8D A;  4AP1 A;  4CNK A;  3ICT A;  4GUV A;  5KOX A;  4U8I A;  2A89 A;  2BAC A;  1NEN A;  1GRE A;  1PS9 A;  1UKV G;  2BS2 A;  3OC4 A;  4U8N A;  1H6V A;  3PVC A;  3ADA B;  4Z26 A;  2WDQ A;  1VDC A;  1KNP A;  4TM3 A;  1NHR A;  1JRX A;  2VVL A;  3SZ0 A;  3II4 A;  4I59 A;  3NRN A;  3R9U A;  3SUC A;  1E1M A;  4IA5 A;  2TMD A;  1IUT A;  2JBV A;  3UOV A;  1Q9I A;  4LU6 A;  3AB1 A;  1DOC A;  3FMW A;  4H2P A;  2GQF A;  1E1L A;  2OAM A;  2GAG B;  2PYX A;  1ZMD A;  3VQR A;  2GH5 A;  3AE3 A;  2XVF A;  3G5S A;  2WDR A;  3BNU A;  3B6D A;  2WQY A;  4IVO B;  4CNJ A;  3DGZ A;  1VG9 A;  3GDP A;  1IUX A;  1BZL A;  1V59 A;  3GQH A;  4J33 A;  1JRY A;  4AT0 A;  4AP3 A;  3ATQ A;  1CBO A;  3COX A;  2C75 A;  1X31 B;  1MO9 A;  1MOK A;  1PXC A;  3K7T A;  1IUU A;  3M12 A;  4H4S A;  2YLX A;  2WOI A;  4CY8 A;  3AE5 A;  1S2Y A;  2QA2 A;  4YKG A;  3FG2 P;  4A79 A;  4I58 A;  4USQ A;  1OJT A;  3K7M X;  2W0H A;  4NTC A;  4H4U A;  3AEE A;  4Z44 A;  3AEB A;  1VG0 A;  1F3P A;  3AEG A;  1D4C A;  3KPK A;  5KOW A;  1B8S A;  3LZW A;  5GSN A;  1TDF A;  3UTG A;  1PDH A;  4ZN0 A;  3SFE A;  3CPJ G;  3O0H A;  2A8X A;  1O5W A;  3NG7 X;  3KLJ A;  1YQ3 A;  2RGO A;  3AWI A;  3DJE A;  1CC4 A;  3GDN A;  3CGB A;  1D4E A;  5EB5 A;  3DK9 A;  1OJC A;  3AYJ A;  3QVR A;  3QVP A;  3UKF A;  4OPG A;  4FDC B;  2GB0 A;  1PJ7 A;  2R45 A;  3M13 A;  3UTF A;  2VQ7 A;  3SY4 A;  1NDA A;  1REO A;  1TYP A;  3FIM B;  4P9S A;  1K0J A;  4H2N A;  1K0I A;  2GEW A;  2VQB A;  4WX1 A;  2IID A;  1MXT A;  2Y6Q A;  1KFY A;  2BAB A;  1PXB A;  3G5R A;  1K4Q A;  4U2S A;  3HYV A;  4II2 A;  1NHS A;  4X9M A;  1NHQ A;  3SM8 A;  3VRB A;  2VRL A;  3V3N A;  2BCG G;  5KVH A;  1BF3 A;  1YKJ A;  4NEW A;  2C7G A;  3L8K A;  4UDQ A;  1EL7 A;  5JCI A;  1M64 A;  1S3E A;  4AOX A;  5BUK A;  1B37 A;  4AOS A;  3CIR A;  2B9W A;  1HYU A;  3CNJ A;  2Q6U A;  2YM2 A;  4NEV A;  4ZCC A;  5J60 A;  5BVA A;  3UTH A;  1XAN A;  4JDR A;  3AE2 A;  4U8L A;  3ALL A;  1H81 A;  4Z2T A;  4J57 A;  2FJB A;  1ZOV A;  1CJ2 A;  5KWF A;  3AE8 A;  1GPE A;  4EMI A;  2ZZ0 A;  2V3B A;  2XLP A;  4A9W A;  1CJC A;  4YSZ A;  1ZOY A;  2BYB A;  1OJD A;  2C76 A;  3IC9 A;  4U8J A;  3SYI A;  2AAQ A;  4C3X A;  2C3D A;  4D04 A;  1EL9 A;  2Q7V A;  3M0O A;  3RNM A;  1XHC A;  3UCL A;  2R9Z A;  2YWL A;  3EF6 A;  3P9U A;  4DNA A;  1ZMC A;  3CGC A;  3F8D A;  3BNM A;  1DJQ A;  1FOH A;  3P1W A;  3AD7 B;  5ER0 A;  2XFU A;  4NNJ A;  1F6M A;  3S61 A;  3AD8 B;  3ALM A;  1GRF A;  2BC1 A;  4J56 A;  2YAU A;  2YG6 A;  4II3 A;  1GRT A;  4RG4 A;  2YLS A;  1GND A;  3IHG A;  4OPC A;  2VVL G;  1FCD A;  2BXS A;  3KA7 A;  1LJ1 A;  3PS9 A;  2NVK X;  3NK1 X;  2X50 A;  2E5V A;  1ZDL A;  3KKJ A;  5HY5 A;  4YTP A;  3I6D A;  3ATR A;  2FJE A;  4K5S A;  3WE0 A;  2A87 A;  5KMR A;  1TDN A;  2X8G A;  1GV4 A;  3BHF A;  4ICY A;  4Z43 A;  3P4R A;  2YM1 A;  3NHO X;  3QFB A;  2GMJ A;  3DME A;  2YR4 A;  3NIX A;  1N1P A;  2WEU A;  4B68 A;  2E4G A;  2GV8 A;  4Y4N A;  2BK3 A;  1ELI A;  1IUV A;  3KVE A;  4U2T A;  1NHP A;  2V3A A;  3NTA A;  4M52 A;  4E0V A;  2V5Z A;  5JCN A;  4BUR A;  4H2Q A;  2JKC A;  1N4U A;  3NK2 X;  3ISH A;  3AED A;  2OLN A;  3HZL A;  2YLT A;  4OPT A;  5L46 A;  1CL0 A;  3NK0 X;  5FS6 A;  2OLO A;  2B76 A;  3UKL A;  2GR0 A;  2WP6 A;  1TRB A;  1E39 A;  2C67 A;  3DA1 A;  3GD3 A;  1S3B A;  1PJ6 A;  1RYI A;  3C4N A;  4JY2 A;  3KU9 A;  4H4Z A;  4LA1 A;  1PHH A;  3NN0 X;  2BRY A;  4H4V A;  1H86 A;  1JRZ A;  4H7U A;  1DNC A;  3I3L A;  1L9E A;  1BGN A;  3SGL A;  1S2Q A;  4J34 A;  3CNS A;  3V3O A;  3T2Y A;  1Y0P A;  2YG4 A;  2RAB A;  3D1C A;  2AR8 A;  2WES A;  4A5L A;  4B69 A;  2FBW A;  2NPX A;  4C77 A;  3AE7 A;  4EM4 A;  2X3N A;  3AEC A;  4TLZ A;  2BC0 A;  1ZX9 A;  2V60 A;  3FPZ A;  3CPI G;  4YKF A;  4CCR A;  4YTM A;  4K5R A;  1GTH A;  1JEH A;  3GYX A;  1QO8 A;  1D7Y A;  3UKH A;  1L9C A;  4A65 A;  1CF3 A;  3GD4 A;  3VRD B;  5KNL A;  3G5Q A;  5IQ4 A;  1E1K A;  1FL2 A;  3T37 A;  3C96 A;  2EQ7 A;  1SEZ A;  4G9K A;  4EQS A;  2WU2 A;  2XVI A;  2ACZ A;  2YLR A;  3AD9 B;  1VRQ B;  3LZX A;  3NNE A;  3Q9T A;  5U1O A;  3GQK A;  1NAA A;  2OAL A;  1NPX A;  3GMC A;  5M10 A;  3IF9 A;  4EQX A;  3UOY A;  3AE1 A;  4XWZ A;  2Y6R A;  2XVJ A;  5KMS A;  4GR1 A;  4H4R A;  1LQU A;  3SZW A;  2GAH B;  1NG3 A;  4KX6 A;  4JQ9 A;  2VOU A;  1KSU A;  3UKK A;  4YSY A;  1GRA A;  1YQ4 A;  5HXI A;  5C3J A;  3K30 A;  2Q0K A;  3L1R A;  1GER A;  3JSK A;  3DH9 A;  3OZ2 A;  4H4T A;  1PBC A;  4J31 A;  4IVM B;  5HYM A;  2YG3 A;  2YR5 A;  2YQU A;  1B5Q A;  3E1T A;  4EM3 A;  1TYT A;  3VR8 A;  1LVL A;  3RP8 A;  2FJA A;  1JNZ A;  2C73 A;  4C74 A;  4GRT A;  4N9X A;  4EMJ A;  3CN8 A;  4YSX A;  3AYI A;  4A7A A;  4H50 A;  4O5Q A;  1D5T A;  2JAE A;  3ICS A;  5DBJ A;  4J2W A;  2BK4 A;  2QA1 A;  2V6O A;  4ADW A;  1JOA A;  1TDE A;  3QSS A;  5KXJ A;  3T2K A;  4PAA A;  4OPD A;  5CKU A;  2XYO A;  3LOV A;  4GF7 A;  4REK A;  3UKP A;  4FK1 A;  2XLT A;  2BRA A;  2GR2 A;  4APN A;  3SXI A;  2JB1 A;  3AE4 A;  2PHH A;  1IUW A;  2R46 A;  4EIQ A;  3NKS A;  4FX9 A;  1PBF A;  1ZY8 A;  5JCL A;  3GYI A;  1KSS A;  2WBA A;  1Y56 A;  5EBK A;  5EB4 A;  2WPE A;  2LFC A;  3UOX A;  3BI2 A;  2WPC A;  2XLU A;  1KNR A;  3D8X A;  3DJD A;  4XWR A;  5JCM A;  1BKW A;  1LQT A;  1GRB A;  2YG7 A;  2X8H A;  4G6G A;  4J36 A;  1GAL A;  1O95 A;  3CTY A;  4DSG A;  3UOZ A;  2C3C A;  1COY A;  4YXD A;  1N4W A;  3HYX A;  1VQW A;  3KPF A;  2DKI A;  1H83 A;  5J7X A;  2WHD A;  1E6E A;  2C70 A;  4H4Y A;  1FEC A;  1GEU A;  1ZKQ A;  2CUL A;  2X8C A;  3LAD A;  3NYC A;  4OPU A;  4EQW A;  4TM4 A;  1LV0 A;  2Z5X A;  3H8I A;  5HHF A;  1PJ5 A;  5GRT A;  4X9N A;  3UP5 A;  3FBS A;  1EL5 A;  2XFQ A;  3AEA A;  2VRM A;  4A99 A;  2GVC A;  3F8R A;  4LII A;  3GSI A;  4JNA A;  1YQZ A;  2YLZ A;  5FS7 A;  1ZK7 A;  4H2R A;  2WPF A;  3H8L A;  1DOE A;  1O94 A;  3T2Z A;  4Z25 A;  2E1M A;  1CHU A;  2YR6 A;  4U8P A;  4B63 A;  3F8P A;  3P4Q A;  4YTN A;  1DOB A;  1H7X A;  2BK5 A;  2GF3 A;  2HQM A;  2WU5 A;  3B3R A;  5KVI A;  2APG A;  2XVE A;  3VRA A;  4JNQ A;  2YG5 A;  4EMW A;  4RG3 A;  3NT6 A;  4CY6 A;  2QAE A;  4OVI A;  3DJJ A;  3UKA A;  1F8R A;  3UKQ A;  3GMB A;  1H82 A;  3UTE A;  4EQR A;  4BJY A;  2C72 A;  3EAO A;  2TPR A;  3NTD A;  1JU2 A;  3ABV A;  2GR3 A;  2WP5 A;  2B7R A;  4NTE A;  3AXB A;  2RGJ A;  4GAV A;  4B65 A;  4YSH A;  4HB9 A;  1CJ3 A;  1GET A;  2CFY A;  4USR A;  3SZF A;  2XFN A;  1GES A;  4GAP A;  4GCM A;  4CRT A;  2WOW A;  4MJW A;  4K7Z A;  1ONF A;  5FMH A;  1E7P A;  4NWZ A;  3C4A A;  4TLX A;  4UDP A;  2WP9 A;  2QCU A;  3CGD A;  5BRT A;  3GRS A;  3URH A;  3SZC A;  2R4J A;  4FK1 C;  3IWA A;  4U8O A;  3NH3 X;  2XFO A;  1OJA A;  2GR1 A;  3K7Q X;  2IVD A;  2VZ2 A;  4NZH A;  4H4W A;  3AE9 A;  2JB2 A;  5TR3 A;  3DK4 A;  4D03 A;  3H4K A;  1GSN A;  4G74 A;  4U2L A;  3ICR A;  3QJ4 A;  4Z2R A;  2BS3 A;  4AT2 A;  4BK3 A;  1KF6 A;  2I0Z A;  3VR9 A;  1L0V A;  4B64 A;  1GT8 A;  4JY3 A;  2H89 A;  3RHA A;  1PXA A;  3SX6 A;  4G73 A;  2GMH A;  2YVF A;  5U63 A;  2XFP A;  1CC2 A;  3NGC X;  4DGK A;  2EQ9 A;  4ECH A;  2RGH A;  4Y4L A;  2DKH A;  1K0L A;  3LXD A;  1QLB A;  4YT0 A;  1F8W A;  1KDG A;  2IVE A;  1IJH A;  2C64 A;  4GDP A;  4DSH A;  3CNT A;  4UP3 A;  1DXL A;  4Z24 A;  4A6N A;  2FJD A;  3AEF A;  1LPF A;  3T0K A;  1M6I A;  2GQW A;  2B9X A;  3V76 A;  1GOS A;  4BK2 A;  1E1N A;  1EL8 A;  1AOG A;  4CCQ A;  1BWC A;  4Z2U A;  4B66 A;  2CDU A;  2CVJ A;  2XLR A;  1OJ9 A;  4X4J A;  1B4V A;  3QSE A;  2WS3 A;  2EQ8 A;  4BK1 A;  3ZDN A;  4Y4M A;  5U25 A;  2C65 A;  2OA1 A;  3NYF A;  1EBD A;  2R0C A;  3NN6 X;  2Z5Y A;  1GRH A;  3AE6 A;  2JK6 A;  2C66 A;  4PAB A;  4TM1 A;  4C5O A;  5EOW A;  5M0Z A;  3DGH A;  3LB8 A;  3DJG X;  1GRG A;  4KPR A;  1P2E A;  3CPH G;  2X99 A;  3AYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...