3VRAA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 192
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vraA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vraA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vraA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vraA04
2XFPA 3GWDA 3R9UA 4A7AA 3KA7A 3T37A 2A8XA 3CGDA 3NYEA 1GOSA 1REOA 2FBWA 4AP3A 2XFOA 1KNRA 3DJEA 5GSNA 3DK8A 4GRTA 3GRTA 1H83A 4H4RA 4CY6A 2XFUA 4ADWA 2C64A 3REDA 3AEEA 4LU6A 1XPQA 2JB2A 3UTFA 4B65A 1GTEA 2WOWA 4EIQA 2CULA 3ATRA 2C66A 4TLZA 1DOCA 1FCDA 1E1MA 5HXIA 4OCGA 4JY2A 1PBBA 2WESA 2YQUA 3CGBA 1F6MA 4EQRA 4IA5A 3UKQA 1DXLA 1V59A 4U8IA 2R0PA 5IQ1A 1HYUA 1JU2A 1LVLA 2BCGG 2W0HA 1ZX9A 5JCNA 4B69A 2WP6A 4H4SA 4K8DA 1PHHA 4Z2TA 3H8IA 2XLSA 1D5TA 1DJNA 2YG4A 3K7TA 4GF7A 4CCQA 3KD9A 1EL8A 2Z5XA 4MJWA 2WQYA 4C3XA 3VR9A 1CJ4A 4WX1A 1IUXA 3AEGA 4JNAA 2HQMA 2E5VA 1NG3A 5M10A 1E1NA 1L9EA 2XLPA 3AE3A 2YVJA 2YWLA 1TRBA 2GQWA 2X50A 4H7UA 1CHUA 4CRTA 4D03A 4PABA 1BGJA 4OPGA 5M0ZA 1E1LA 1Y56B 4A79A 2YLSA 3AE6A 3CTYA 4RG3A 4AOXA 3DK9A 4NEWA 4Z43A 2C72A 1VG9A 4AP1A 3NRNA 4XXGA 3P9UA 4NEVA 4B1BA 4K22A 4YTMA 4H4YA 1H7XA 3QVRA 2R4JA 4O5QA 3UOVA 4NZHA 1PXCA 2Z5YA 4H4QA 2BA9A 4IVOB 2AAQA 3C4NA 1H86A 3RP7A 1LQUA 3KLJA 3DJGX 5KVHA 2WOIA 3LZXA 1BZLA 2Q0KA 3AYJA 2JB1A 4CY8A 3AECA 1K0JA 1K4QA 2BC0A 4B68A 5EBKA 5KXJA 3AE9A 2GQFA 1KFYA 1D4DA 3FMWA 3RNMA 2WU2A 1H84A 2O9ZA 3K7MX 2GR1A 4U2TA 1BKWA 1GALA 3GYIA 4UDQA 2GAHB 3H8LA 3G5RA 4A65A 5GRTA 1MOKA 3KU9A 3K30A 4H4TA 4NTDA 1F8WA 4EIPA 5KRQA 3GD3A 5EOWA 3UKHA 2OAMA 4YXDA 3BHKA 2JB3A 3ZDNA 1EL9A 2R0GA 2RGHA 3LJPA 3AYLA 4AOSA 4EQWA 1KSSA 2A89A 1MXTA 3AE8A 4A99A 3GDPA 3CGEA 4AT0A 2B9WA 2V6OA 3UKLA 1COYA 1PJ6A 3I3LA 3IHMA 1CJ3A 2NPXA 3DH9A 1GRTA 4J36A 1IUTA 2EQ9A 2XCGA 2XYOA 4D04A 4ICYA 3GQHA 1S3EA 2IVDA 2ZZCA 3DA1A 1N4UA 1NHPA 4YSHA 3GSIA 1TDEA 2C76A 2GVCA 2OA1A 1UKVG 3NN0X 4P9SA 4EQSA 3E1TA 3AB1A 1E39A 1RP0A 1TDKA 4Z25A 3NN6X 1GESA 4M52A 4YWOA 1TDOA 4A5LA 2C65A 5KOWA 4DSGA 4J34A 3ATQA 2ZZBA 2AQJA 1GPEA 2DKIA 2X8GA 4UP3A 2GV8A 1IUVA 2YVGA 1IJHA 1B8SA 3NK2X 2XLUA 3CNDA 3AE7A 3P4RA 3VRDB 2YLWA 3AD9B 3AE5A 3BI2A 3BI4A 4J57A 4X9MA 2YLZA 4U8NA 1KDGA 2B7RA 1VQWA 3DGHA 3L1RA 3UP4A 4Z24A 4EM4A 2GR2A 1GSNA 1DODA 1RSGA 3DMEA 3GRSA 1GERA 3PVCA 4X9NA 4XWRA 3VRAA 1YQ4A 5JCMA 4EMIA 2V3BA 5FS6A 2FJBA 3AD7B 4JN9A 2A87A 1S2YA 2IIDA 4E0VA 4H2QA 1DJQA 4HB9A 2X99A 4CNJA 3OZ2A 3IHGA 4GDPA 1XHCA 3FBSA 2BS3A 4UDPA 2BK5A 3CPIG 5BUKA 3OC4A 4HA6A 2Y6QA 1E1KA 1N4VA 3AEAA 2C7GA 1FEAA 3BI5A 1L9CA 5U1OA 3CNSA 3UP5A 3AE4A 2NVKX 3CPJG 5U63A 4ZCCA 3DJDA 1PBCA 1P2EA 1PXAA 3NHOX 4OVIA 1GRGA 3GMBA 2I0ZA 3ITJA 5KVIA 3WE0A 2RGOA 1GT8A 2WP5A 1YY5A 3FIMB 1IUWA 1ZDLA 1QJDA 1NHRA 4B66A 3RP6A 4U8KA 5BRTA 2R45A 3HZLA 1PN0A 1GRFA 3VR8A 2YM1A 2F5ZA 2YLRA 4K7ZA 1LTXR 4LIIA 4J56A 3V76A 2BACA 3QSEA 4H4XA 2WPEA 1EL5A 2UZZA 1O94A 1KNPA 3G5SA 1CC4A 3NT6A 4X4JA 4OPTA 3SFDA 2VRLA 3B3RA 3GMCA 2APGA 1GXFA 5U25A 2WEUA 2YG7A 3AE2A 1CC2A 4U8LA 4B67A 1GTHA 1KF6A 2AR8A 4J2WA 1CBOA 3URHA 3KVEA 1FECA 2JKCA 1LPFA 2X8HA 1ONFA 4U2SA 1JNRA 2BK3A 4BK2A 2X8CA 4I58A 4APNA 2B7SA 2C75A 2CFYA 3CNJA 3NK0X 1NENA 2PHHA 4H4PA 2WDQA 2QCUA 3CPHG 4U8JA 3KKJA 2EQ7A 1N1PA 4BK1A 2XVFA 4C5OA 4K5SA 3V3NA 4C74A 2YAUA 3SQPA 4EQXA 3CGCA 1CL0A 2ZZ0A 3M0OA 4ZCDA 2GEWA 1IUUA 3Q6JA 4YT0A 3IC9A 1OJTA 2OLNA 4N9XA 4C77A 1CF3A 4H50A 1OJ9A 5FMHA 2OLOA 3II4A 1PJ5A 4TM4A 1Q1WA 2H89A 1VDCA 2ARDA 3EF6A 2YLXA 3EAOA 3LXDA 2FJEA 1H6VA 1O95A 2VVLG 1O5WA 1ZOYA 1CJ2A 3QJ4A 1RYIA 3CN8A 5CQFA 2R0CA 4J31A 2XVHA 3NG7X 1EL7A 2WDRA 1VG0A 1ZMDA 3FG2P 5BVAA 3DK4A 4JNQA 3UOYA 3UTEA 2YG5A 3VQRA 4FK1C 3NTDA 5TR3A 1ZK7A 1NAAA 1JRZA 3BHFA 1MO9A 1QLBA 2YLTA 3NGCX 2LFCA 3L8KA 1ZP0A 1Y56A 4UDRA 4DNAA 3P4QA 3IF9A 3H4KA 3F8PA 1DOBA 3NYFA 3B6DA 3GQKA 3D8XA 1VRQB 1B37A 2QAEA 3V3OA 4ZN0A 1B5QA 3UKKA 1DNCA 5KOXA 3ICSA 3PO7A 2BS4A 5BULA 1JEHA 5L46A 5C3JA 3NLCA 3QVPA 1X31B 2FJDA 3NNEA 4U8OA 5IPYA 2C70A 1FL2A 3K7QX 2EQ6A 5J7XA 3ICRA 4OPUA 3P1WA 2OALA 1ELIA 2R4EA 2B76A 3QSSA 3UKFA 3AE1A 3KPFA 4Y4MA 2TPRA 2GMJA 3UCLA 2WDVA 2BC1A 5HY5A 4H4ZA 4YTPA 2YR5A 4RG4A 2XDOA 4IA6A 2EQ8A 1NEKA 2WP9A 2JBVA 3S5WA 3IWAA 2VQBA 3O0HA 4A9WA 5JCKA 4TM3A 4BK3A 2GMHA 5DBJA 4BURA 3RP8A 2YM2A 4NTCA 3UTHA 2XLTA 4ECHA 3ADAB 1W4XA 2XVIA 3ALLA 4FX9A 2J3NA 3JSKA 2DKHA 1YKJA 1D7LA 1ZKQA 4GCMA 1PS9A 4TM0A 4A6NA 4KX6A 2VOUA 2C73A 2WPFA 3DGZA 3I6DA 2GR0A 1PXBA 5KWFA 2WU5A 3ALJA 5HHFA 1KSUA 1PBDA 3LOVA 3QSMA 4RSLA 2GAGB 2R9ZA 3ICTA 5FS7A 4GR1A 4KPRA 1Q1RA 3C4AA 2WPCA 2XVEA 2H88A 1XDIA 4YKGA 4LA1A 1XANA 1AOGA 3M12A 4DGKA 2Q7VA 1IUSA 4EMJA 4K2XA 1JRXA 1ZMCA 3VRBA 4AT2A 1GREA 1BWCA 4GUVA 3BNUA 2BABA 1NHQA 4O5UA 3UKAA 3F8DA 4JQ9A 1PDHA 1BGNA 1YQ3A 2GB0A 2BXSA 4OPIA 4YKFA 3CNPA 2VRMA 2JK6A 1OJDA 1GRAA 3DJJA 4H4VA 1E6EA 3NH3X 4H2NA 2BS2A 4H2RA 4USQA 3COXA 4J33A 5J60A 3UOZA 3C96A 4CNKA 1TDNA 4FDCB 2JAEA 1CJCA 1TYPA 1F8SA 3QFBA 4JDRA 1OJCA 1M6IA 4Z2UA 3ISHA 4H2PA 1LQTA 3SM8A 3ABVA 2BYBA 5IQ4A 4I59A 2V5ZA 1Z6LA 3ZYXA 5LV9A 4USRA 1K0IA 1ZOVA 1M64A 4B63A 1NDAA 4Y4NA 4REKA 4H4WA 5EB4A 2VQ7A 2WOVA 5HYMA 1PBFA 2ZBWA 2XFQA 3FPZA 3EANA 1CC6A 3M13A 3NYCA 1N4WA 3PS9A 5JCLA 5JCIA 4H4UA 2PYXA 1BF3A 2QA2A 1EBDA 1NG4A 4Z44A 2C3CA 2XFNA 1GRBA 3AWIA 3RHAA 2RGJA 1B4VA 2WETA 2QA1A 2VVMA 1L0VA 3Q9TA 2V60A 2YR6A 1GV4A 1TDFA 2RABA 4NTEA 1S3BA 4PAAA 4XWZA 5ER0A 4IVMB 3NK1X 1F3PA 3NKSA 4TLXA 4Z26A 1DOEA 1JNZA 1PBEA 1H7WA 2B9XA 2CVJA 3GD4A 3UTGA 1GEUA 1OJAA 1GRHA 3AEDA 1TYTA 4U2LA 3GYXA 3AYIA 3LADA 1LV0A 2WBAA 3SUCA 4Z2RA 3P4PA 2Q0LA 2YG3A 1D4CA 2XLRA 4U8PA 5FS8A 1JRYA 3NTAA 2WS3A 3GYJA 1YQZA 2IVEA 3NIXA 4YSZA 2GH5A 1K0LA 2BCPA 2YG6A 4EMWA 5C2TA 1FOHA 1H81A 3AD8B 4FK1A 4U8MA 3CIRA 2GF3A 2TMDA 3S61A 4DSHA 3UOXA 3BNMA 4B64A 1F8RA 2E1MA 4C3YA 1JOAA 5CKUA 2WHDA 2E4GA 1GNDA 2V3AA 2B9YA 3LB8A 1NHSA 1S2QA 2XVJA 4BV6A 4CCRA 4Y4LA 3UKPA 3ALMA 4A6NB 4YSXA 2VZ2A 3GDNA 4JY3A 4BJZA 4GDEA 1H82A 1E7PA 4YSYA 1LJ1A 3AXBA 2BXRA 2C67A 1FEBA 2ACZA 2C3DA 3F8RA 2YR4A 1L9DA 1NPXA 4K5RA 4EM3A 2Y6RA 1ZY8A 4OPCA 5FS9A 3GWFA 1Y0PA 2VVLA 2BK4A 2GRTA 3LZWA 4OPLA 1SEZA 1P2HA 2CDUA 2V61A 3QFAA 2Q6UA 3AEFA 2GR3A 4BJYA 1PJ7A 3SFEA 2R46A 2FJAA 4IV9A 3AEBA 4YTNA 1D7YA 3P4SA 3SGLA 1Q9IA 3D1CA 3EPTA 1QO8A 1D4EA 4OPDA 4CBQA 4TM1A 1GETA 2YVFA 3G5QA 2X3NA 4WCTA 3CNTA 5EB5A
chains in the Genus database with same CATH superfamily
5HEGA 4WW0A 3KV4A 2XFPA 3ONXA 4G6HA 2A8XA 3EABA 3CGDA 3NYEA 4LF6T 3E08A 2FBWA 3AA6B 5LNKA 4B3TT 2X67A 4AP3A 2JIWA 1KNRA 3DJEA 3SZ0A 2WZIA 3R84B 5L4HA 5JDMA 2XUEA 3GRTA 4H4RA 5LCYA 4ZI7E 3PU8A 3REDA 2JMKA 2CXLA 4LU6A 1E2AA 4N78D 5HWYA 4TWFA 2CULA 2XM1A 4AI6A 2C66A 4TLZA 5HXHA 1QSDA 4OCGA 1PBBA 3CGBA 3CWZB 3UKQA 2R074 1DXLA 3UFGA 5IUXA 5JR9C 3ZCIA 3RC3A 1ZX9A 3FXDB 3PV0F 5JR9A 2WP6A 1XDOA 3MJXA 4K8DA 3HKCE 3L3PA 4P09A 2YG4A 3K7TA 5J1GA 3KD9A 2X0LB 3OYZA 2KSRA 3LDQB 4G2AA 5H6QB 4C3XA 3FZHB 1CJ4A 3AEGA 4JNAA 2E5VA 1LKXA 4U31A 4U2ZA 5LA6E 3MXZA 4ISSA 4L5GA 3FI7A 1TRBA 2YU1A 2V8SV 4H7UA 1RUE4 5J2UE 4OPGA 4TX5A 3AE6A 3CTYA 5FNVE 4NEWA 4AP1A 3WAJA 4NEVA 3RC8A 2W66A 3NWIA 4WZXA 2CRBA 2E9XB 2XQ4A 3KINB 4YFSA 4KHZF 2AAQA 3RP7A 3CQXC 3B57A 1Z8UA 3DJGX 4DMWA 3RYFE 2LSYA 1WR6A 3LZXA 3FZMB 1RHI4 2PZSA 2BC0A 3DJBA 2B1EA 3HKDE 1EZ3A 1VRBA 3UTKA 2GR1A 3GYIA 4A65A 1BEV4 1MOKA 5AQRB 4PAGA 3RPUA 5LYJE 1F8WA 2JQHA 2WMOA 2V6YA 3JAEA 4H63H 3GD3A 3UU8A 4YXDA 3BHKA 2JB3A 1YW0A 2R0GA 5JDLA 1VBE4 3LJPA 2XSBA 4QXHB 5EK2A 4AT0A 3ETUA 4GK0E 2CHNA 1WCRA 4TNWA 3UKLA 1PJ6A 2NR4A 2XCGA 5KMGP 1S3EA 4GIWA 4ZOLE 3AA7B 3GSIA 2OA1A 2E2AA 2QVAA 4P9SA 5HWXA 4Q4V4 1TDKA 2YDSA 1TDOA 5KOWA 1XNRT 1T7SA 2AQJA 4UP3A 4EZHA 2YVGA 5KMSA 4LF4T 3CNDA 4IE6A 3P4RA 2AE9A 1WLXA 3VRDB 3AD9B 3BI2A 4X1IE 2OV9A 3BI4A 3W15B 4LFAT 1KDGA 4Z24A 1DODA 3LK2B 1LRZA 3PVCA 4XWRA 3VRAA 5JCMA 2D2SA 5FS6A 3AD7B 4JN9A 2UUCT 1XMQT 1HG2A 3EAMA 4GDPA 3IF8B 1XHCA 4UF0A 1WYCA 1N4VA 1VCSA 2PLV4 5U1OA 4EZ4A 3UP5A 5U63A 2D0UA 2J4GA 5CB4E 1HX1B 4OVIA 4EEBA 1MIWA 5KVIA 2RGOA 1GT8A 2WP5A 3FIMB 1IUWA 3ZYKA 2UXCT 5LMUT 1E1HB 3C4XA 2VWAA 3P7IA 3HZLA 3AA1B 5L3FB 2RP4A 3MZKB 2BACA 1IJ5A 1EL5A 4DIDB 5LXTE 3SFDA 2APGA 4M1PA 5ADXL 1MIYA 4QHOA 3T2ZA 2HWC4 1MNEA 2K24A 4B67A 2JJ9A 1CBOA 3URHA 1FECA 1LPFA 1ONFA 1JNRA 2X0HA 2B7SA 1K5MD 2CFYA 5KMRA 2X0YA 2QCUA 5LBMA 3GWHA 4IHJE 2GK9A 2EQ7A 3TLTA 3KKJA 4BK1A 3V3NA 4ILUA 4K0UA 2EHOB 3HKEE 3ZMVB 1RUJ4 4H9SE 4CQIA 2ZZ0A 3DP7A 1IUUA 4JI7T 3IC9A 4N9XA 1CF3A 3OKQA 5FMHA 4ZZCA 3II4A 1MNDA 1VDCA 3EF6A 2RM24 1UCUA 4RHV4 1MMGA 2LOPA 2WBLA 1O5WA 3CN8A 5CQFA 2R0CA 2YN6A 4JI0T 2NW9A 1NWMX 2KINB 3UOYA 3UTEA 2CA5A 5TR3A 2VKHA 3SRZA 5ABGA 2V7LA 1JRZA 1S94A 1MO9A 3IEEA 2X51A 1Y56A 3EUHA 3F8PA 3OYXA 1KNZA 3NYFA 3SZFA 1VRQB 1X79A 3SZCA 5LHIB 4H9QC 3PO7A 3U3IA 5C3JA 3QVPA 2PYLA 3NNEA 2C70A 1FL2A 3K7QX 2ZM0A 3CVRA 2QYWA 2OALA 1FMVA 2CHOA 3QC9A 3SOLA 2L9QA 3QSSA 2TPRA 2GMJA 2WDVA 5HY5A 2NWBA 3RKOA 2YR5A 4IDOA 4RG4A 2YINA 1XMOT 2EQ8A 4ZS3A 1NEKA 2WP9A 2JBVA 5J2TE 2V7KA 3O0HA 1GQEA 2C4CA 1I94T 1EV14 4YHJA 1UURA 2LLYA 3ADAB 2XVIA 3TLWA 1HX8A 2DKHA 1YKJA 1D7LA 1ZKQA 1HRV4 4TM0A 1T72A 2VOUA 3FZLB 5KWFA 2WU5A 3ALJA 3UT5E 1PBDA 4KPRA 5CJ5A 1Q1RA 3C4AA 3ZT5A 3HYWA 4YKGA 4LA1A 4DGKA 4PW8A 3EHZA 1GREA 4NIQA 2XASB 5ABFB 1BWCA 2MTQA 4EXTA 3UKAA 5DJQC 4JQ9A 1PDHA 2D0TA 1BGNA 2GB0A 2YDRA 4OPIA 5FKYA 4C91A 2JK6A 4H4VA 1E6EA 2P9BA 3COXA 2LHRA 1PIV4 5LB7B 2IAKA 5JTGA 1CJCA 1TYPA 4JDRA 2QGSA 3CX6B 1OJCA 5M4YA 5HEOA 4O2AE 2V5ZA 1YXRA 1ZOVA 1H8TD 4B63A 1NDAA 4Y4NA 2N2NA 4REKA 2WOVA 3E0ZA 2JPFA 4IL9A 1CC6A 4I55E 1N4WA 3MA9A 4MALA 1BF3A 1NG4A 2XFNA 2Q9QB 4UVCB 5LG4A 3RHAA 3J7Yq 2QA1A 3J8F4 4CXWA 3Q9TA 2V60A 3MK7C 5FS7A 4NTEA 4XWZA 3F57A 4IVMB 5FY0A 3NKSA 5EK4A 3PUQA 1DOEA 1JNZA 2QA7A 2B9XA 2DI4A 2DHRA 3O1HA 1BR4A 3GYXA 3ZMSB 3LADA 2WBAA 4BAYB 3SUCA 3P4PA 2HPJA 2LHNA 5FS8A 1JRYA 3GYJA 4G6GA 1YQZA 2GH5A 3QB5K 2YG6A 1NAFA 3AD8B 2VVSA 4GYRA 4P0AA 1R094 2TMDA 4NWZA 1KEYA 3JD74 2E4GA 2V3AA 4GAVA 4JI4T 3UKPA 2V1DB 4A6NB 4JY3A 3C4WA 4GDEA 1H82A 4EV6A 1E7PA 3CQGB 3UU3A 5EZYE 4ZHQE 1LJ1A 3BK9A 2BXRA 3T8OA 2C67A 2Y6XA 4FJOA 2LOSA 4K5RA 1N32T 4HFIA 4B3MT 4ZZBA 4OPLA 2RPAA 2Q6UA 2DCFA 1EAH4 5HXRA 2K3WA 4I4TE 4BJYA 2R46A 4IV9A 2UU9T 2IDOB 1D7YA 2CMRA 3ZMUB 1Q9IA 3N9PA 3UU6A 4O4LE 5FYMA 3D1CA 3EPTA 3SX6A 1QO8A 2WMNA 4TM1A 2YVFA 2E5LT 2G0UA 2LRKA 2YDQA 1MMAA 2VKOA 1W09A 4E7SA 3DK8A 3N9MA 4CY6A 3U78A 3C98B 4ADWA 4B65A 1GTEA 2WOWA 4EIQA 4OHFA 3I9YA 3AA0B 5HCJA 1FCDA 1E1MA 4JY2A 2WESA 1OWAA 2YQUA 1F6MA 4EQRA 4IA5A 1V59A 2R0PA 1JU2A 2ACXA 2PJQA 3SWHA 2H3RA 4B69A 1J5ET 1PHHA 4GYSA 4CN4A 5HXSA 4GF7A 2W63A 2WQYA 3VR9A 4WX1A 1IUXA 3RKGA 2XHEB 5M10A 2XLPA 1L9EA 2YWLA 5F8PA 1D4M4 2X50A 4D03A 3ANWA 3RLFF 1BGJA 5LG3A 1E1LA 4A79A 2YLSA 4RG3A 3Q5DA 4Z43A 3OVUA 1VG9A 5L3DB 4XXGA 3EDUA 3P9UA 4B1BA 3KDSE 4H4YA 1UGOA 1H7XA 4H9OC 3UOVA 5FVKA 4NZHA 2ODUA 3I1AA 3O1JA 3C4NA 5KVHA 2W2UA 3AYJA 4L9IA 2XQAA 1MIVA 5KXJA 2GQFA 3OJAA 2WU2A 1H84A 3K7MX 4PK4A 2GAHB 3TKLB 1V9DA 4GKKT 4EIPA 5KRQA 2OAMA 5LBQB 3ZDNA 1EL9A 5FVLA 4AOSA 1SE7A 2PBIA 4EQWA 1VOMA 3S4UA 3ZC0A 4B3ST 4A99A 3CGEA 2B9WA 3B13A 1OEDB 3EDVA 2VL8A 2NPXA 3DH9A 2XQ5A 1GRTA 4J36A 4X62T 1HNZT 4XZCA 2ZZCA 2CE7A 3DA1A 1TDEA 3IA3A 4ZI2D 3NN0X 5KNLA 4EQSA 2D9DA 1E39A 4Z25A 4M52A 4A5LA 4AXPA 3AAAB 4L0RA 4J34A 3ATQA 2BKOA 2ZZBA 2X8GA 4DR7T 2GV8A 1IUVA 1IJHA 1B8SA 3ONLC 4LFCT 3NK2X 3QK6A 2IIUA 1YD8G 3AE5A 3HKBE 2PY5A 2YLZA 1S35A 4KP3C 2KWHA 5JR9B 3ZCJA 2X5ID 4OYKA 2GR2A 1GSNA 3DMEA 3GRSA 2J47A 5JQGE 1GERA 1IJ6A 2LM9A 4X9NA 3QNUA 1B7TA 5HYAA 4H2QA 1DJQA 4HB9A 4NNJA 3WI3A 3ZSSA 5AQLB 1AR94 1O3XA 4AKLA 4PNIA 5L3BB 2BS3A 5LHHB 4UDPA 2BK5A 3CPIG 3RYIE 5BUKA 2OLTA 1E1KA 3LBXA 3BI5A 3CNSA 4JI1T 1Y01A 3A8YC 1ZHCA 4ZCCA 1PXAA 3NHOX 1GRGA 3GMBA 2VKJA 4LMLA 3WE0A 4ZI2C 4ILCA 1ZDLA 4B66A 3RP6A 2BVMA 5BRTA 4U7IA 2K5BB 4TZ4C 5DQWA 3VR8A 2NW7A 2F5ZA 5L2LA 4K7ZA 4IDQA 3QSEA 2CWOA 2UZZA 2LT3A 3NT6A 4OPTA 2VRLA 2V6YB 3GMCA 1HCIA 4U8LA 5DABA 1KF6A 5IYZE 2E9XD 1I6ZA 5JRCB 4U2SA 2BG9B 4I58A 4APNA 2C75A 3G06A 4DR5T 1G8XA 1OEDE 4AKHA 1UK5A 1Z7S4 4DR6T 5AQTB 2XVFA 4K5SA 4ASKA 3QOFA 2R044 4EQXA 3M0OA 3RHWA 2N9DA 4TN7B 4H50A 4AQYT 4TWDA 1PJ5A 4U3CA 4U33A 2W61A 2FJEA 1H6VA 1O95A 2VVLG 2IMLA 1CJ2A 4P1NA 3ZKRA 1RYIA 5L3GB 2XVHA 1VG0A 2ES0A 2W62A 3DK4A 4JNQA 4DV3T 4FK1C 1ZK7A 3JAFA 3O4XE 1QLBA 2CBJA 3Q5XA 4O8SA 2NP9A 2JMHA 3NGCX 3LG7A 4ILBA 1SA0E 2RR14 4DNDA 3IF9A 2E9XC 1CUNA 1PO14 4UF0B 2HWB4 3GQKA 2PW9A 2K48A 1B37A 1B5QA 2JQQA 5L47A 5KOXA 3ZMTB 2W67A 3NLCA 2DWGA 1X31B 3I0QA 4EYYR 4OFZA 1HTJF 2C5JA 3P1WA 2R4EA 3Q5WA 3UKFA 4Y4MA 3UCLA 2PTFA 4H4ZA 3RIAA 2BKPA 5AQQB 5LOVE 4IA6A 4TM3A 4BURA 5AQPB 3CPZA 2RS54 4FX9A 3VKHA 4UVBB 2FUPA 2LKGA 2HH7A 5AQFB 2C73A 3I6DA 5AQHB 2GR0A 2YU2A 2BG9E 1KSUA 5L4EA 3LOVA 4RSLA 1MMDA 2GAGB 1D0ZA 4TUYE 4H9NC 2Z6EA 1XDPA 2X66A 1H7CA 3AXJB 2XVEA 3KV5A 1AOGA 2CBIA 4AISA 4CN6A 1XANA 3PUYF 4K2XA 4DR4T 1JRXA 1N36T 3VRBA 4AT2A 5LJMA 2DNXA 3N2KE 4EAHA 2BABA 3RI5A 1NHQA 2IW5B 3F8DA 4X5TA 1YQ3A 4YKFA 1LVFA 3CNPA 2VRMA 1OJDA 1GRAA 4USQA 2NW8A 4PJLA 3B5MA 3C96A 4CNKA 2L8KA 4FDCB 2XQ6A 3C64A 2BBHA 1XZYA 4JLEA 4GK5E 2KMFA 4QWNB 4H2PA 3ABVA 3SM8A 4HWCA 4IIJE 3ZYXA 1RUI4 4USRA 1M64A 3M65A 2VQFT 1UUSA 4H4WA 3GA8A 2VQ7A 5HYMA 3T31A 4JI5T 5LHGB 2ZBWA 2JQ9A 3LFMA 3FPZA 1NA1D 2R064 3C4ZA 3M13A 5JCIA 4H4UA 2EHOD 4KI0F 2OA5A 2E8IA 5JREA 1B4VA 2VVMA 4WBNE 3P50A 1TDFA 2XQ7A 5ER0A 1VBC4 1F3PA 2XZEA 1PBEA 4X1KE 2CVJA 3DTOA 3UTGA 1RUH4 3K1SA 1GRHA 4HGAA 5LMNT 4CXYA 1LV0A 1VCTA 2Q0LA 3TLSA 2XLRA 2I6HA 4HFDA 2IVEA 3NIXA 3TLVA 1K0LA 3PUGA 2XAGB 5C2TA 4U8MA 5E0OA 2XJ7A 3CIRA 2GF3A 3BNMA 2JRKA 4C3YA 1JOAA 5CKUA 4ZXLA 3LB8A 4LFBT 1LVKA 3SY4A 1ASJ4 3SZWA 2R6GF 1W9RA 2LSJA 2CWYA 4IE7A 3AXBA 4UELA 2CLYC 1AR64 4MHCA 2WM9A 2EHOC 1NPXA 1U5PA 2CXFA 2Y6RA 1BR1A 3I9WA 2EHOA 2YOEA 2J62A 4OPCA 4UEMA 2VVLA 3L39A 2GRTA 3PUAA 5GONE 1P2HA 4YJ2E 2CDUA 2GR3A 3SFEA 3AEBA 3L8RA 3P4SA 4IE5A 1D4EA 4CBQA 3SS1A 5HXCA 3G5QA 2X3NA 4WCTA 3CNTA 3EANA 4Q4W4 4A7AA 2KT9A 2I59A 1WYBA 2SPCA 1GOSA 2BVLA 1REOA 3KVBA 2HPLA 3ESLA 2PFVA 1RMU4 5LGUB 3KBUA 5AQGB 3HR0A 1Z0PA 3ZJ1A 1QUUA 1XPQA 3UTFA 4II2A 3ATRA 1WRDA 1DOCA 4QXBB 1HF8A 2H7VC 4Z90A 2Y8DA 4FI5A 1XI1A 4U8IA 5IQ1A 1HYUA 1HRI4 1LVLA 2BCGG 2W0HA 3CMMA 5JCNA 4LF7T 4H4SA 5F5WA 5FY1A 5BR8T 3H8IA 3P8CD 3Q5EA 3D0TA 1VBA4 1EL8A 3N9NA 3VU7H 2HQMA 1NG3A 1E1NA 4JI6T 2YVJA 4JYAT 5HCMA 4JEHB 2GQWA 1CHUA 5M0ZA 4HE8A 2BBJA 3CQCB 3E22E 3UU5A 3T1YT 3DK9A 4WNKA 5ABEA 2Q9QD 2X9WA 3NRNA 5AQIB 4K22A 3NRXA 3WAKA 4IE4A 2BKNA 4NUUA 3ZJ2A 4DR2T 4H4QA 2BA9A 2VB6A 3KV9A 2VQET 1H86A 4DV2T 3GN5A 3OPCA 4XBFB 4O4JE 1BZLA 2Q0KA 2A9UA 3AECA 1K0JA 4HKAA 2LE8A 1K4QA 4JV5T 1M62A 5EBKA 3AE9A 1KFYA 1D4DA 3RNMA 4UDQA 3H8LA 2XTLA 5GRTA 3KU9A 5CFBA 3JC6D 4LF9T 2Y48B 4TV8E 3FXEB 3VKGA 2RGHA 1VBD4 4PJNA 1KSSA 4HTEA 2A89A 3RX6A 3AE8A 3GDPA 2V6OA 2VL0A 4X66T 5KMPA 2CXDA 3IHMA 1CJ3A 5LGTB 3NVOA 4HEAA 1IUTA 3X1DA 3GQHA 2LSIA 2MAWA 4IDNA 1XWMA 1ZEEA 4A5XA 2IVDA 4EIWA 5EK3A 3CKDA 1N4UA 1NHPA 2Q9QC 2C76A 4WBOA 1J1JA 1RP0A 3PU3A 2Q9QA 1GESA 2C5IT 3NN6X 2CEAA 4ILAA 1GPEA 1XHXA 3K3QC 2XLUA 2YLWA 2ZLYA 5HEHA 1VQWA 3DGHA 3L1RA 1HXS4 4X64T 1RSGA 3V5SA 3JC6C 4MLKA 5AQUB 4EMIA 2FJBA 2A87A 4DV1T 2IIDA 2V6XA 1VRH4 4E0VA 3ANWB 4CNJA 4K0KT 3ZLIA 3OC4A 4HA6A 3IHRA 2WCAA 4UV9B 1FEAA 2C7GA 1FEWA 4LMJA 1L9CA 2XAQB 3LK3B 3AE4A 1R084 3ZN0B 4CI1B 1XNQT 3K3OA 3RQWA 2I0ZA 5JDFA 4C90A 1OXZA 1YY5A 4HFEA 1QJDA 3T2KA 4U2YA 4U8KA 5AQJB 1AR74 2R45A 5A1LA 1PN0A 4EEDA 2YM1A 2YLRA 3ZYLA 5FY7A 4LIIA 4J56A 3V76A 2IHR1 3KVAA 4H4XA 1O94A 5KX5E 3B3RA 2PG8A 1GXFA 2WEUA 3JBG4 1GTHA 2LEHA 2QRXA 5L3CB 3FHNA 3KVEA 4UR9A 3KFWX 3RYCE 2JKCA 4BJNA 5IHYA 2V5CA 4BK2A 2X8CA 4MFRA 4OK0A 4ZI3D 1FMWA 3CNJA 3UUNA 1NENA 4LF5T 3CPHG 4U8JA 1N1PA 2X9HA 3UULA 1SUMB 3SQPA 3CGCA 1AL24 4TNVA 4XAXB 4ZCDA 1T98A 2BDEA 4YT0A 3Q6JA 2XY8B 4C77A 4IT4A 3FZFB 1OJ9A 4PFOA 2CM0A 3PUXF 1Q1WA 4PDWD 2UXBT 3QJ4A 1ZOYA 2UXNB 5L3EB 3PJAJ 1FIOA 1U4QA 4J31A 1EL7A 3FBLA 2WWVA 5BVAA 2YG5A 2HN2A 3M3ZB 3HL6A 4EB6E 3BHFA 1VBB4 5HAXA 2YEVC 4E7ZA 2LFCA 3L8KA 1ZP0A 3ZT7A 4DNAA 1IBKT 3P4QA 2LKHA 3RGLA 2IC9A 3H4KA 3B6DA 3D8XA 2QAEA 4H9PC 4CI3B 4ZI3C 1DNCA 4DR1T 4Q4Y4 3H3MA 5BULA 1JEHA 5L46A 4QH5A 2FJDA 4U8OA 2W4XA 3PUZF 3CX8B 2EQ6A 4ADZA 3ICRA 5AQKB 1US7B 4G74A 1ELIA 2ODVA 3UUBA 3KPFA 5LGNB 3ZT6A 5C8YE 4UVAB 2XDOA 4A9WA 3S5WA 3IWAA 2VQBA 1HNXT 5DBJA 3RRCA 2YM2A 3T2YA 2ZM2A 3UTHA 2XLTA 1N33T 2D5UA 3ZC1A 1W4XA 3ONJA 1OEDC 4EYUA 4JUYA 3RYHE 1PS9A 1G73A 1OEDA 3Q2MA 2J1DG 2X68A 3ZMZB 1D0XA 4QXCB 1PXBA 1UX4A 5HEUA 2L3LA 3QSMA 2VK9A 4B3RT 3ZSTA 4NXNT 4QKNA 1SHZC 2WPCA 4DUYT 2WWUA 2CCQA 1ZMCA 4HWHA 4O5UA 3CMLA 2BXSA 1BR0A 4H2RA 4H2NA 4NXMT 4DV7T 2ZMAA 1TDNA 4G9KA 3FBZA 4JEUB 3K3NA 1M6IA 4Z2UA 3ISHA 4GB34 5IQ4A 4UXNB 2BYBA 3PE0A 1Z6LA 2KWIB 2WZHA 2KLQA 3OTOT 5EB4A 1X9BA 4J2CA 4Z91A 2K9AA 2W00A 5HEJA 5JCLA 1WFDA 3PS9A 2PYXA 3L09A 4CI2B 1EBDA 3AWIA 2WETA 1D1BA 1IZNB 5JDQA 3UOZA 2RABA 5CA1E 2RA1A 4AIUA 4TLXA 4JI2T 4GOUA 1OJAA 1TYTA 2IC6A 3AB3B 5JDGA 4Z2RA 5F3JA 2YG3A 3ZPOA 4U8PA 3HA4A 2WS3A 3BQLA 4EMWA 1FOHA 1H81A 1MQTD 4FK1A 4ZEYA 1HNWT 2KZ7B 4F8HA 2E1MA 3KBTA 2WHDA 1GNDA 2B9YA 2BG9C 1S2QA 1HS7A 2VASA 4BV6A 4CCRA 1RUD4 2E9XA 3UUMA 4Y4LA 5JRCA 4YSXA 2BG9A 3UUXB 3GDNA 2KNDA 2HHHT 5JDNA 2YK0A 1HFAA 2WY2A 4JI3T 1FEBA 4DMVA 2I0MA 2C3DA 3F8RA 2YR4A 2H7OA 1Y0PA 2BK4A 2EX3A 1IAPA 4ERRA 3QFAA 4YTNA 2XQ8A 2M6IA 4OPDA 3UU4A 4NPPA 5BMVE 2A3DA 4AKIA 3GWDA 3R9UA 3KA7A 2DWKA 2R7FA 3T37A 3RF1A 4HFCA 4X65T 2XFOA 3T14A 4LMKA 3CK6A 2UXDT 5GSNA 2KXPB 2HN1A 4GRTA 4HFHA 1H83A 2XFUA 2C64A 3AEEA 1D1AA 4BJMA 2JB2A 4A56A 2XAFB 3R6NA 2MYSA 4ISTA 5HXIA 2XSAA 3MKDA 1OOPD 3PUVF 2XPKA 4IGUA 3TLUA 2M67A 4X20E 2X9YA 4Z2TA 2XLSA 1D5TA 2YKSA 1DJNA 4CCQA 2Z5XA 4MJWA 3RRWA 3AVRA 4KHPT 1D0YA 3AE3A 3ZN1B 2DL1A 4CRTA 4PABA 3N2GE 1Y56B 3PURA 2LM2A 5FXWA 4AOXA 2C72A 4GAPA 2XAHB 5CGMA 4YTMA 3O1IA 5FXZA 5HXEA 3T0KA 3QVRA 2R4JA 4O5QA 5JDHA 4HFBA 4Z8XA 4DV5T 1PXCA 2Z5YA 2C0SA 3LK42 2UUBT 4IVOB 1LQUA 3UFEA 3KLJA 3NZQA 2WOIA 3AXJA 4DV0T 2JB1A 4CY8A 1T8BA 4B68A 2CLYB 4DR3T 3C50A 3PUSA 3FMWA 2BRYA 2O9ZA 4U2TA 1BKWA 1GALA 4AKRB 5FXXA 4EGWA 3G5RA 3GMIA 3O9XA 3K30A 4H4TA 4NTDA 3SYIA 4G63A 3T1HT 3F2EA 3UQ4A 5H6RB 5EOWA 2CPTA 3UKHA 2V5DA 2AXDS 3AYLA 4QX8B 1MXTA 2V7JA 1AR84 2DLRA 1COYA 1BR2A 3I3LA 5LP6E 4DO0A 3N5LA 2EQ9A 4D04A 2XYOA 5FMNA 4ICYA 4TWHA 4UIGA 3P4WA 1W0AA 4YSHA 3HYXA 2GVCA 1UKVG 3E1TA 3AB1A 4YWOA 2C65A 2UUAT 4DSGA 2DKIA 3AE7A 4QH1A 1DU2A 4HN9A 4J57A 4X9MA 1ZKEA 4U8NA 2B7RA 3UP4A 4EM4A 4B6XA 4HWIB 2ZM8A 4IL4A 4OYJA 1YQ4A 2V3BA 3OBVE 5IWAT 1S2YA 1YKHB 2WSSV 4I50E 2XAJB 2V26A 1POV0 2X99A 3OZ2A 3IHGA 5JH7E 3FBSA 4O4HE 4JI8T 4UV8B 2Y6QA 4MBQA 4OX9T 3AEAA 2V7MA 4YLHA 2V7IA 3PTRB 2NVKX 3CPJG 3DJDA 1M7KA 1PBCA 1P2EA 3ITJA 3GN5B 2MOZA 5AQOB 1NHRA 1J5WA 2VKDA 4PJJA 4H63V 2BRAA 1GRFA 5AQNB 4PJMA 4IDPA 1LTXR 3I0OA 3N9OA 2WPEA 2ZM6T 3G5SA 1KNPA 4X4JA 1CC4A 4X1YE 3V5UA 5U25A 3C51A 2YG7A 3AE2A 1CC2A 1MMNA 4AKGA 2AR8A 4J2WA 5TAOA 4NUVA 2A2FX 2X8HA 3RQUA 2BK3A 4U72A 3H3AA 4BA9A 1RUG4 1R8IA 2N1GA 3AAIA 3NK0X 5KMQA 2PHHA 4H4PA 2WDQA 2XM2A 5AQSB 3NZPA 4KUMB 1PO24 4C5OA 4IREA 4C74A 2YAUA 3K8PC 1XHZA 4PK5A 4ZS2A 1AJ3A 1CL0A 2A72A 5J0ZA 3FB2A 2GEWA 5ABFA 1OJTA 2OLNA 3AAEB 2OLOA 4TV9E 4TM4A 3IBPA 2H89A 3LSVA 2ARDA 3A5XA 4CN1A 2NOXA 4JBWF 2YLXA 3NKZA 4DUZT 3EAOA 2RS14 4O2BE 3LXDA 3RH3A 3PDYA 4DV4T 4CXXA 3N9QA 1UX5A 3NG7X 2WDRA 1ZMDA 3FG2P 4I0UA 4A98A 4HFVA 3VQRA 3NTDA 2F4VT 1NAAA 4KBMB 2YLTA 3PJAA 4YJ3E 2XQ3A 4AQGA 5FL0A 4IDZA 3NRYA 4UDRA 1KK7A 1DOBA 1FJGT 3HI2A 4ZN0A 3V3OA 2LSKA 5FL1A 1YKEB 4IE0A 4Q4X4 3UKKA 4KMCA 3ICSA 2BS4A 4F6RC 5IPYA 4CZZB 5J7XA 2NTYA 4OPUA 3RIFA 2B76A 1COV4 3AE1A 2BC1A 4YHHT 4YTPA 2PYJA 1IBLT 3NBXX 2RS34 2RMU4 5JCKA 4Q25A 4BK3A 2LRLA 2GMHA 3RP8A 2LJLA 4NTCA 3BQKA 4ECHA 4GKJT 1WR0A 4PFPA 3ALLA 3H37A 2J3NA 3JSKA 2C5KT 3BQIA 4O4IE 5CA0E 4ANJA 3SXIA 4GCMA 4A6NA 4KX6A 3LJCA 2WPFA 3DGZA 5HHFA 1RUC4 1ZV4X 3JCFA 3MACA 2R9ZA 3KPKA 3ICTA 2VVNA 4GR1A 3HYVA 2H88A 2W0GA 1XDIA 2NTXA 4PK6A 3M12A 3CX7B 2Q7VA 4COFA 1IUSA 1Y64B 4EMJA 2WB5A 3EI0A 4GUVA 3BNUA 5KDMC 2BZBA 3EVYA 4WYVA 3DJJA 3NH3X 2BS2A 4J33A 5J60A 1RUF4 2MPKA 3N9LA 4YY3T 2M6BA 2JAEA 3QFBA 1F8SA 4LF8T 2UXXB 5LJNA 3A7MA 1LQTA 4I59A 2WAUA 5LV9A 5ETWA 1K0IA 3Q9DA 3VHLA 5ABHA 3ZYMA 1PBFA 2XFQA 3NYCA 2IUBA 4I43B 2QA2A 4Z44A 2C3CA 1GRBA 2RGJA 5FXVA 1L0VA 3J9X1 3JADA 2YR6A 1GV4A 4PAAA 4QH4A 1S3BA 4Z26A 3RIUC 3NK1X 1IBMT 4HWDA 1H7WA 3GD4A 2MBGA 3ETVA 1GEUA 3AEDA 3F31A 3RIUA 4U2LA 3AYIA 1W0BA 3KV6A 4DBQA 1N34T 1D4CA 3NTAA 4DV6T 4YSZA 2BCPA 5FP3A 2VURA 3S61A 4DSHA 3UOXA 4B64A 1F8RA 5AQVB 4U74A 1NHSA 4G73A 2XVJA 3FZKB 3LBXB 4EOZB 3ALMA 5DQVA 2VZ2A 4BJZA 5JVDE 2XQYA 4P0BA 4U7YA 1D1CA 4HWFA 1PVC4 4QX7B 4YSYA 2LSGA 2ACZA 3AVSA 4A97A 1L9DA 4EM3A 2JQKA 3ZEFB 3QUJA 1RVF4 4DVDA 1ZY8A 3UQ7A 5FS9A 4AQFC 3PUWF 3GWFA 1HG5A 3LZWA 2XQ9A 1SEZA 2V61A 4II3A 3QB5A 3AEFA 1PJ7A 4AQFA 2FJAA 1NCQD 4DBRA 4V1Av 3SGLA 2X9XA 5AFUL 1HR0T 1GETA 5AQMB 3N2OA 4H9RC 5EB5A
chains in the Genus database with same CATH topology
2XFPA 3GWDA 3R9UA 4A7AA 3KA7A 4G6HA 3T37A 2A8XA 3CGDA 3NYEA 1GOSA 1REOA 2FBWA 4AP3A 2XFOA 3T14A 1KNRA 3DJEA 3SZ0A 5GSNA 3DK8A 4GRTA 3GRTA 1H83A 4H4RA 4CY6A 2XFUA 4ADWA 2C64A 3REDA 3AEEA 4LU6A 1XPQA 2JB2A 3UTFA 4II2A 1GTEA 4B65A 2WOWA 4EIQA 2CULA 3ATRA 2C66A 4TLZA 1DOCA 1FCDA 1E1MA 5HXIA 4OCGA 4JY2A 1PBBA 2WESA 2YQUA 3CGBA 1F6MA 4EQRA 4IA5A 3UKQA 1DXLA 1V59A 4U8IA 2R0PA 5IQ1A 1HYUA 1JU2A 1LVLA 2BCGG 2W0HA 1ZX9A 3CMMA 5JCNA 4B69A 2WP6A 4H4SA 4K8DA 1PHHA 4Z2TA 3H8IA 2XLSA 1D5TA 1DJNA 2YG4A 3K7TA 4GF7A 4CCQA 3KD9A 1EL8A 2Z5XA 4MJWA 2WQYA 4C3XA 3VR9A 1CJ4A 4WX1A 1IUXA 3AEGA 4JNAA 2HQMA 2E5VA 1NG3A 5M10A 1E1NA 1L9EA 2XLPA 3AE3A 2YVJA 2YWLA 1TRBA 2GQWA 2X50A 4H7UA 1CHUA 4CRTA 4D03A 4PABA 1BGJA 4OPGA 5M0ZA 1E1LA 1Y56B 4A79A 2YLSA 3AE6A 3CTYA 4RG3A 4AOXA 3DK9A 4NEWA 4Z43A 2C72A 1VG9A 4GAPA 4AP1A 3NRNA 4XXGA 3P9UA 4NEVA 4B1BA 4K22A 4YTMA 4H4YA 3T0KA 1H7XA 3QVRA 2R4JA 4O5QA 3UOVA 4NZHA 1PXCA 2Z5YA 4H4QA 2BA9A 4IVOB 2AAQA 3C4NA 1H86A 3RP7A 1LQUA 3KLJA 3DJGX 5KVHA 2WOIA 3LZXA 1BZLA 2Q0KA 3AYJA 2JB1A 4CY8A 3AECA 1K0JA 1K4QA 2BC0A 4B68A 5EBKA 5KXJA 3AE9A 2GQFA 1KFYA 1D4DA 3FMWA 2BRYA 2WU2A 1H84A 2O9ZA 3K7MX 3RNMA 2GR1A 4U2TA 1BKWA 1GALA 3GYIA 4UDQA 2GAHB 3H8LA 3G5RA 4A65A 5GRTA 1MOKA 3KU9A 3K30A 4H4TA 4NTDA 3SYIA 1F8WA 4EIPA 5KRQA 3GD3A 5EOWA 3UKHA 2OAMA 4YXDA 3BHKA 2JB3A 3ZDNA 1EL9A 2R0GA 2RGHA 3LJPA 3AYLA 4AOSA 4EQWA 1KSSA 2A89A 1MXTA 3AE8A 4A99A 3GDPA 3CGEA 4AT0A 2B9WA 2V6OA 5KMPA 3UKLA 1COYA 1PJ6A 3I3LA 3IHMA 1CJ3A 2NPXA 3DH9A 1GRTA 4J36A 1IUTA 2EQ9A 2XCGA 2XYOA 4D04A 4ICYA 3GQHA 1S3EA 2IVDA 2ZZCA 3DA1A 1N4UA 1NHPA 3HYXA 4YSHA 3GSIA 1TDEA 2C76A 2GVCA 2OA1A 1UKVG 3NN0X 4P9SA 4EQSA 5KNLA 3E1TA 3AB1A 1E39A 1RP0A 1TDKA 4Z25A 3NN6X 1GESA 4M52A 4YWOA 1TDOA 4A5LA 2C65A 5KOWA 4DSGA 4J34A 3ATQA 2ZZBA 2AQJA 1GPEA 2DKIA 2X8GA 4UP3A 2GV8A 1IUVA 2YVGA 1IJHA 1B8SA 3NK2X 5KMSA 2XLUA 3CNDA 3AE7A 3P4RA 3VRDB 2YLWA 3AD9B 3AE5A 3BI2A 3BI4A 4J57A 4X9MA 2YLZA 4U8NA 1KDGA 2B7RA 1VQWA 3DGHA 3L1RA 3UP4A 4Z24A 4EM4A 2GR2A 1GSNA 1DODA 1RSGA 3DMEA 3GRSA 1GERA 3PVCA 4X9NA 4XWRA 3VRAA 1YQ4A 5JCMA 4EMIA 2V3BA 5FS6A 2FJBA 3AD7B 4JN9A 2A87A 1S2YA 2IIDA 4E0VA 4H2QA 1DJQA 4HB9A 4NNJA 2X99A 4CNJA 3OZ2A 3IHGA 4GDPA 1XHCA 3FBSA 2BS3A 4UDPA 2BK5A 3CPIG 5BUKA 3OC4A 4HA6A 2Y6QA 1E1KA 1N4VA 3AEAA 2C7GA 1FEAA 3BI5A 1L9CA 5U1OA 3CNSA 3UP5A 3AE4A 2NVKX 3CPJG 5U63A 4ZCCA 3DJDA 1PBCA 1P2EA 1PXAA 3NHOX 4OVIA 1GRGA 3GMBA 2I0ZA 3ITJA 5KVIA 3WE0A 2RGOA 1GT8A 2WP5A 1YY5A 3FIMB 1IUWA 1ZDLA 1QJDA 1NHRA 3T2KA 4B66A 3RP6A 4U8KA 5BRTA 2R45A 3HZLA 1PN0A 2BRAA 1GRFA 3VR8A 2YM1A 2F5ZA 2YLRA 4K7ZA 1LTXR 4LIIA 4J56A 3V76A 2BACA 3QSEA 4H4XA 2WPEA 1EL5A 2UZZA 1O94A 1KNPA 3G5SA 1CC4A 3NT6A 4X4JA 4OPTA 3SFDA 2VRLA 3B3RA 3GMCA 2APGA 1GXFA 5U25A 3T2ZA 2WEUA 2YG7A 3AE2A 1CC2A 4U8LA 4B67A 1GTHA 1KF6A 2AR8A 4J2WA 1CBOA 3URHA 3KVEA 1FECA 2JKCA 1LPFA 2X8HA 1ONFA 4U2SA 1JNRA 2BK3A 4BK2A 2X8CA 4I58A 4APNA 2B7SA 2C75A 2CFYA 3CNJA 3NK0X 1NENA 2PHHA 5KMQA 5KMRA 4H4PA 2WDQA 2QCUA 3CPHG 4U8JA 3KKJA 2EQ7A 1N1PA 4BK1A 2XVFA 4C5OA 4K5SA 3V3NA 4C74A 2YAUA 3SQPA 4EQXA 3CGCA 1CL0A 2ZZ0A 3M0OA 4ZCDA 2GEWA 1IUUA 3Q6JA 4YT0A 3IC9A 1OJTA 2OLNA 4N9XA 4C77A 1CF3A 4H50A 1OJ9A 5FMHA 2OLOA 3II4A 1PJ5A 4TM4A 1Q1WA 2H89A 1VDCA 2ARDA 3EF6A 2YLXA 3EAOA 3LXDA 2FJEA 1H6VA 1O95A 2VVLG 1O5WA 1ZOYA 1CJ2A 3QJ4A 1RYIA 3CN8A 5CQFA 2R0CA 4J31A 2XVHA 3NG7X 1EL7A 2WDRA 1VG0A 1ZMDA 3FG2P 5BVAA 3DK4A 4JNQA 3UOYA 3UTEA 2YG5A 3VQRA 4FK1C 3NTDA 5TR3A 1ZK7A 1NAAA 1JRZA 3BHFA 1MO9A 1QLBA 2YLTA 3NGCX 2LFCA 3L8KA 1ZP0A 1Y56A 4UDRA 4DNAA 3P4QA 3IF9A 3H4KA 3F8PA 1DOBA 3NYFA 3B6DA 3SZFA 3GQKA 3D8XA 1VRQB 1B37A 2QAEA 3V3OA 4ZN0A 1B5QA 3UKKA 1DNCA 5KOXA 3SZCA 3ICSA 3PO7A 2BS4A 5BULA 1JEHA 5L46A 5C3JA 3NLCA 3QVPA 1X31B 2FJDA 3NNEA 4U8OA 5IPYA 2C70A 1FL2A 3K7QX 2EQ6A 5J7XA 3ICRA 4OPUA 3P1WA 2OALA 4G74A 1ELIA 2R4EA 2B76A 3QSSA 3UKFA 3AE1A 3KPFA 4Y4MA 2TPRA 2GMJA 3UCLA 2WDVA 2BC1A 5HY5A 4H4ZA 4YTPA 2YR5A 4RG4A 2XDOA 4IA6A 2EQ8A 1NEKA 2WP9A 2JBVA 3S5WA 3IWAA 2VQBA 3O0HA 4A9WA 2C4CA 5JCKA 4TM3A 4BK3A 2GMHA 5DBJA 4BURA 3RP8A 2YM2A 4NTCA 3T2YA 3UTHA 2XLTA 4ECHA 3ADAB 1W4XA 2XVIA 3ALLA 4FX9A 2J3NA 3JSKA 3SXIA 2DKHA 1YKJA 1D7LA 1ZKQA 4GCMA 1PS9A 4TM0A 4A6NA 4KX6A 2VOUA 2C73A 2WPFA 3DGZA 3I6DA 2GR0A 1PXBA 5KWFA 2WU5A 3ALJA 5HHFA 1KSUA 1PBDA 3LOVA 3QSMA 4RSLA 2GAGB 2R9ZA 3ICTA 3KPKA 5FS7A 4GR1A 4KPRA 1Q1RA 3HYVA 3C4AA 2WPCA 2XVEA 3HYWA 2H88A 1XDIA 4YKGA 4LA1A 1XANA 1AOGA 3M12A 4DGKA 2Q7VA 1IUSA 4EMJA 4K2XA 1JRXA 1ZMCA 3VRBA 4AT2A 1GREA 1BWCA 4GUVA 3BNUA 2BABA 1NHQA 4O5UA 3UKAA 3F8DA 4JQ9A 1PDHA 1BGNA 1YQ3A 2GB0A 2BXSA 4OPIA 4YKFA 3CNPA 2VRMA 2JK6A 1OJDA 1GRAA 3DJJA 4H4VA 1E6EA 3NH3X 4H2NA 2BS2A 4H2RA 4USQA 3COXA 4J33A 5J60A 3UOZA 3C96A 4CNKA 1TDNA 4FDCB 4G9KA 2JAEA 1CJCA 1TYPA 1F8SA 3QFBA 4JDRA 1OJCA 1M6IA 4Z2UA 3ISHA 4H2PA 1LQTA 3SM8A 3ABVA 2BYBA 5IQ4A 4I59A 2V5ZA 1Z6LA 3ZYXA 5LV9A 4USRA 1K0IA 1ZOVA 1M64A 4B63A 1NDAA 4Y4NA 4REKA 4H4WA 5EB4A 2VQ7A 2WOVA 5HYMA 3T31A 1PBFA 2ZBWA 2XFQA 3FPZA 3EANA 1CC6A 3M13A 3NYCA 1N4WA 3PS9A 5JCLA 5JCIA 4H4UA 2PYXA 1BF3A 2QA2A 1EBDA 1NG4A 4Z44A 2C3CA 2XFNA 1GRBA 3AWIA 3RHAA 2RGJA 1B4VA 2WETA 2QA1A 2VVMA 1L0VA 3Q9TA 2V60A 2YR6A 1GV4A 1TDFA 2RABA 4NTEA 1S3BA 4PAAA 4XWZA 5ER0A 4IVMB 3NK1X 1F3PA 3NKSA 4TLXA 4Z26A 1DOEA 1JNZA 1PBEA 1H7WA 2B9XA 2CVJA 3GD4A 3UTGA 1GEUA 1OJAA 1GRHA 3AEDA 1TYTA 3GYXA 4U2LA 3AYIA 3LADA 1LV0A 2WBAA 3SUCA 4Z2RA 3P4PA 2Q0LA 2YG3A 1D4CA 2XLRA 4U8PA 5FS8A 1JRYA 3NTAA 2WS3A 3GYJA 1YQZA 2IVEA 3NIXA 4G6GA 4YSZA 2GH5A 1K0LA 2BCPA 2YG6A 4EMWA 5C2TA 1FOHA 1H81A 3AD8B 4FK1A 4U8MA 3CIRA 2GF3A 2TMDA 3S61A 4DSHA 3UOXA 3BNMA 4B64A 1F8RA 2E1MA 4C3YA 1JOAA 5CKUA 4NWZA 2WHDA 2E4GA 1GNDA 2V3AA 2B9YA 3LB8A 1NHSA 4GAVA 1S2QA 4G73A 2XVJA 4BV6A 4CCRA 3SY4A 4Y4LA 3UKPA 3SZWA 3ALMA 4A6NB 4YSXA 2VZ2A 3GDNA 4JY3A 4BJZA 4GDEA 1H82A 1E7PA 4YSYA 1LJ1A 3AXBA 2BXRA 2C67A 1FEBA 2ACZA 2C3DA 3F8RA 2YR4A 1L9DA 1NPXA 4K5RA 4EM3A 2Y6RA 1ZY8A 4OPCA 5FS9A 3GWFA 1Y0PA 2VVLA 2BK4A 2GRTA 3LZWA 4OPLA 1SEZA 1P2HA 2CDUA 2V61A 3QFAA 2Q6UA 4II3A 3AEFA 2GR3A 4BJYA 1PJ7A 3SFEA 2R46A 2FJAA 4IV9A 3AEBA 4YTNA 1D7YA 3P4SA 3SGLA 1Q9IA 3D1CA 3EPTA 3SX6A 1QO8A 1D4EA 4OPDA 4CBQA 4TM1A 1GETA 2YVFA 3G5QA 2X3NA 4WCTA 3CNTA 5EB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFP A;  3GWD A;  3R9U A;  4A7A A;  3KA7 A;  3T37 A;  2A8X A;  3CGD A;  3NYE A;  1GOS A;  1REO A;  2FBW A;  4AP3 A;  2XFO A;  1KNR A;  3DJE A;  5GSN A;  3DK8 A;  4GRT A;  3GRT A;  1H83 A;  4H4R A;  4CY6 A;  2XFU A;  4ADW A;  2C64 A;  3RED A;  3AEE A;  4LU6 A;  1XPQ A;  2JB2 A;  3UTF A;  4B65 A;  1GTE A;  2WOW A;  4EIQ A;  2CUL A;  3ATR A;  2C66 A;  4TLZ A;  1DOC A;  1FCD A;  1E1M A;  5HXI A;  4OCG A;  4JY2 A;  1PBB A;  2WES A;  2YQU A;  3CGB A;  1F6M A;  4EQR A;  4IA5 A;  3UKQ A;  1DXL A;  1V59 A;  4U8I A;  2R0P A;  5IQ1 A;  1HYU A;  1JU2 A;  1LVL A;  2BCG G;  2W0H A;  1ZX9 A;  5JCN A;  4B69 A;  2WP6 A;  4H4S A;  4K8D A;  1PHH A;  4Z2T A;  3H8I A;  2XLS A;  1D5T A;  1DJN A;  2YG4 A;  3K7T A;  4GF7 A;  4CCQ A;  3KD9 A;  1EL8 A;  2Z5X A;  4MJW A;  2WQY A;  4C3X A;  3VR9 A;  1CJ4 A;  4WX1 A;  1IUX A;  3AEG A;  4JNA A;  2HQM A;  2E5V A;  1NG3 A;  5M10 A;  1E1N A;  1L9E A;  2XLP A;  3AE3 A;  2YVJ A;  2YWL A;  1TRB A;  2GQW A;  2X50 A;  4H7U A;  1CHU A;  4CRT A;  4D03 A;  4PAB A;  1BGJ A;  4OPG A;  5M0Z A;  1E1L A;  1Y56 B;  4A79 A;  2YLS A;  3AE6 A;  3CTY A;  4RG3 A;  4AOX A;  3DK9 A;  4NEW A;  4Z43 A;  2C72 A;  1VG9 A;  4AP1 A;  3NRN A;  4XXG A;  3P9U A;  4NEV A;  4B1B A;  4K22 A;  4YTM A;  4H4Y A;  1H7X A;  3QVR A;  2R4J A;  4O5Q A;  3UOV A;  4NZH A;  1PXC A;  2Z5Y A;  4H4Q A;  2BA9 A;  4IVO B;  2AAQ A;  3C4N A;  1H86 A;  3RP7 A;  1LQU A;  3KLJ A;  3DJG X;  5KVH A;  2WOI A;  3LZX A;  1BZL A;  2Q0K A;  3AYJ A;  2JB1 A;  4CY8 A;  3AEC A;  1K0J A;  1K4Q A;  2BC0 A;  4B68 A;  5EBK A;  5KXJ A;  3AE9 A;  2GQF A;  1KFY A;  1D4D A;  3FMW A;  3RNM A;  2WU2 A;  1H84 A;  2O9Z A;  3K7M X;  2GR1 A;  4U2T A;  1BKW A;  1GAL A;  3GYI A;  4UDQ A;  2GAH B;  3H8L A;  3G5R A;  4A65 A;  5GRT A;  1MOK A;  3KU9 A;  3K30 A;  4H4T A;  4NTD A;  1F8W A;  4EIP A;  5KRQ A;  3GD3 A;  5EOW A;  3UKH A;  2OAM A;  4YXD A;  3BHK A;  2JB3 A;  3ZDN A;  1EL9 A;  2R0G A;  2RGH A;  3LJP A;  3AYL A;  4AOS A;  4EQW A;  1KSS A;  2A89 A;  1MXT A;  3AE8 A;  4A99 A;  3GDP A;  3CGE A;  4AT0 A;  2B9W A;  2V6O A;  3UKL A;  1COY A;  1PJ6 A;  3I3L A;  3IHM A;  1CJ3 A;  2NPX A;  3DH9 A;  1GRT A;  4J36 A;  1IUT A;  2EQ9 A;  2XCG A;  2XYO A;  4D04 A;  4ICY A;  3GQH A;  1S3E A;  2IVD A;  2ZZC A;  3DA1 A;  1N4U A;  1NHP A;  4YSH A;  3GSI A;  1TDE A;  2C76 A;  2GVC A;  2OA1 A;  1UKV G;  3NN0 X;  4P9S A;  4EQS A;  3E1T A;  3AB1 A;  1E39 A;  1RP0 A;  1TDK A;  4Z25 A;  3NN6 X;  1GES A;  4M52 A;  4YWO A;  1TDO A;  4A5L A;  2C65 A;  5KOW A;  4DSG A;  4J34 A;  3ATQ A;  2ZZB A;  2AQJ A;  1GPE A;  2DKI A;  2X8G A;  4UP3 A;  2GV8 A;  1IUV A;  2YVG A;  1IJH A;  1B8S A;  3NK2 X;  2XLU A;  3CND A;  3AE7 A;  3P4R A;  3VRD B;  2YLW A;  3AD9 B;  3AE5 A;  3BI2 A;  3BI4 A;  4J57 A;  4X9M A;  2YLZ A;  4U8N A;  1KDG A;  2B7R A;  1VQW A;  3DGH A;  3L1R A;  3UP4 A;  4Z24 A;  4EM4 A;  2GR2 A;  1GSN A;  1DOD A;  1RSG A;  3DME A;  3GRS A;  1GER A;  3PVC A;  4X9N A;  4XWR A;  3VRA A;  1YQ4 A;  5JCM A;  4EMI A;  2V3B A;  5FS6 A;  2FJB A;  3AD7 B;  4JN9 A;  2A87 A;  1S2Y A;  2IID A;  4E0V A;  4H2Q A;  1DJQ A;  4HB9 A;  2X99 A;  4CNJ A;  3OZ2 A;  3IHG A;  4GDP A;  1XHC A;  3FBS A;  2BS3 A;  4UDP A;  2BK5 A;  3CPI G;  5BUK A;  3OC4 A;  4HA6 A;  2Y6Q A;  1E1K A;  1N4V A;  3AEA A;  2C7G A;  1FEA A;  3BI5 A;  1L9C A;  5U1O A;  3CNS A;  3UP5 A;  3AE4 A;  2NVK X;  3CPJ G;  5U63 A;  4ZCC A;  3DJD A;  1PBC A;  1P2E A;  1PXA A;  3NHO X;  4OVI A;  1GRG A;  3GMB A;  2I0Z A;  3ITJ A;  5KVI A;  3WE0 A;  2RGO A;  1GT8 A;  2WP5 A;  1YY5 A;  3FIM B;  1IUW A;  1ZDL A;  1QJD A;  1NHR A;  4B66 A;  3RP6 A;  4U8K A;  5BRT A;  2R45 A;  3HZL A;  1PN0 A;  1GRF A;  3VR8 A;  2YM1 A;  2F5Z A;  2YLR A;  4K7Z A;  1LTX R;  4LII A;  4J56 A;  3V76 A;  2BAC A;  3QSE A;  4H4X A;  2WPE A;  1EL5 A;  2UZZ A;  1O94 A;  1KNP A;  3G5S A;  1CC4 A;  3NT6 A;  4X4J A;  4OPT A;  3SFD A;  2VRL A;  3B3R A;  3GMC A;  2APG A;  1GXF A;  5U25 A;  2WEU A;  2YG7 A;  3AE2 A;  1CC2 A;  4U8L A;  4B67 A;  1GTH A;  1KF6 A;  2AR8 A;  4J2W A;  1CBO A;  3URH A;  3KVE A;  1FEC A;  2JKC A;  1LPF A;  2X8H A;  1ONF A;  4U2S A;  1JNR A;  2BK3 A;  4BK2 A;  2X8C A;  4I58 A;  4APN A;  2B7S A;  2C75 A;  2CFY A;  3CNJ A;  3NK0 X;  1NEN A;  2PHH A;  4H4P A;  2WDQ A;  2QCU A;  3CPH G;  4U8J A;  3KKJ A;  2EQ7 A;  1N1P A;  4BK1 A;  2XVF A;  4C5O A;  4K5S A;  3V3N A;  4C74 A;  2YAU A;  3SQP A;  4EQX A;  3CGC A;  1CL0 A;  2ZZ0 A;  3M0O A;  4ZCD A;  2GEW A;  1IUU A;  3Q6J A;  4YT0 A;  3IC9 A;  1OJT A;  2OLN A;  4N9X A;  4C77 A;  1CF3 A;  4H50 A;  1OJ9 A;  5FMH A;  2OLO A;  3II4 A;  1PJ5 A;  4TM4 A;  1Q1W A;  2H89 A;  1VDC A;  2ARD A;  3EF6 A;  2YLX A;  3EAO A;  3LXD A;  2FJE A;  1H6V A;  1O95 A;  2VVL G;  1O5W A;  1ZOY A;  1CJ2 A;  3QJ4 A;  1RYI A;  3CN8 A;  5CQF A;  2R0C A;  4J31 A;  2XVH A;  3NG7 X;  1EL7 A;  2WDR A;  1VG0 A;  1ZMD A;  3FG2 P;  5BVA A;  3DK4 A;  4JNQ A;  3UOY A;  3UTE A;  2YG5 A;  3VQR A;  4FK1 C;  3NTD A;  5TR3 A;  1ZK7 A;  1NAA A;  1JRZ A;  3BHF A;  1MO9 A;  1QLB A;  2YLT A;  3NGC X;  2LFC A;  3L8K A;  1ZP0 A;  1Y56 A;  4UDR A;  4DNA A;  3P4Q A;  3IF9 A;  3H4K A;  3F8P A;  1DOB A;  3NYF A;  3B6D A;  3GQK A;  3D8X A;  1VRQ B;  1B37 A;  2QAE A;  3V3O A;  4ZN0 A;  1B5Q A;  3UKK A;  1DNC A;  5KOX A;  3ICS A;  3PO7 A;  2BS4 A;  5BUL A;  1JEH A;  5L46 A;  5C3J A;  3NLC A;  3QVP A;  1X31 B;  2FJD A;  3NNE A;  4U8O A;  5IPY A;  2C70 A;  1FL2 A;  3K7Q X;  2EQ6 A;  5J7X A;  3ICR A;  4OPU A;  3P1W A;  2OAL A;  1ELI A;  2R4E A;  2B76 A;  3QSS A;  3UKF A;  3AE1 A;  3KPF A;  4Y4M A;  2TPR A;  2GMJ A;  3UCL A;  2WDV A;  2BC1 A;  5HY5 A;  4H4Z A;  4YTP A;  2YR5 A;  4RG4 A;  2XDO A;  4IA6 A;  2EQ8 A;  1NEK A;  2WP9 A;  2JBV A;  3S5W A;  3IWA A;  2VQB A;  3O0H A;  4A9W A;  5JCK A;  4TM3 A;  4BK3 A;  2GMH A;  5DBJ A;  4BUR A;  3RP8 A;  2YM2 A;  4NTC A;  3UTH A;  2XLT A;  4ECH A;  3ADA B;  1W4X A;  2XVI A;  3ALL A;  4FX9 A;  2J3N A;  3JSK A;  2DKH A;  1YKJ A;  1D7L A;  1ZKQ A;  4GCM A;  1PS9 A;  4TM0 A;  4A6N A;  4KX6 A;  2VOU A;  2C73 A;  2WPF A;  3DGZ A;  3I6D A;  2GR0 A;  1PXB A;  5KWF A;  2WU5 A;  3ALJ A;  5HHF A;  1KSU A;  1PBD A;  3LOV A;  3QSM A;  4RSL A;  2GAG B;  2R9Z A;  3ICT A;  5FS7 A;  4GR1 A;  4KPR A;  1Q1R A;  3C4A A;  2WPC A;  2XVE A;  2H88 A;  1XDI A;  4YKG A;  4LA1 A;  1XAN A;  1AOG A;  3M12 A;  4DGK A;  2Q7V A;  1IUS A;  4EMJ A;  4K2X A;  1JRX A;  1ZMC A;  3VRB A;  4AT2 A;  1GRE A;  1BWC A;  4GUV A;  3BNU A;  2BAB A;  1NHQ A;  4O5U A;  3UKA A;  3F8D A;  4JQ9 A;  1PDH A;  1BGN A;  1YQ3 A;  2GB0 A;  2BXS A;  4OPI A;  4YKF A;  3CNP A;  2VRM A;  2JK6 A;  1OJD A;  1GRA A;  3DJJ A;  4H4V A;  1E6E A;  3NH3 X;  4H2N A;  2BS2 A;  4H2R A;  4USQ A;  3COX A;  4J33 A;  5J60 A;  3UOZ A;  3C96 A;  4CNK A;  1TDN A;  4FDC B;  2JAE A;  1CJC A;  1TYP A;  1F8S A;  3QFB A;  4JDR A;  1OJC A;  1M6I A;  4Z2U A;  3ISH A;  4H2P A;  1LQT A;  3SM8 A;  3ABV A;  2BYB A;  5IQ4 A;  4I59 A;  2V5Z A;  1Z6L A;  3ZYX A;  5LV9 A;  4USR A;  1K0I A;  1ZOV A;  1M64 A;  4B63 A;  1NDA A;  4Y4N A;  4REK A;  4H4W A;  5EB4 A;  2VQ7 A;  2WOV A;  5HYM A;  1PBF A;  2ZBW A;  2XFQ A;  3FPZ A;  3EAN A;  1CC6 A;  3M13 A;  3NYC A;  1N4W A;  3PS9 A;  5JCL A;  5JCI A;  4H4U A;  2PYX A;  1BF3 A;  2QA2 A;  1EBD A;  1NG4 A;  4Z44 A;  2C3C A;  2XFN A;  1GRB A;  3AWI A;  3RHA A;  2RGJ A;  1B4V A;  2WET A;  2QA1 A;  2VVM A;  1L0V A;  3Q9T A;  2V60 A;  2YR6 A;  1GV4 A;  1TDF A;  2RAB A;  4NTE A;  1S3B A;  4PAA A;  4XWZ A;  5ER0 A;  4IVM B;  3NK1 X;  1F3P A;  3NKS A;  4TLX A;  4Z26 A;  1DOE A;  1JNZ A;  1PBE A;  1H7W A;  2B9X A;  2CVJ A;  3GD4 A;  3UTG A;  1GEU A;  1OJA A;  1GRH A;  3AED A;  1TYT A;  4U2L A;  3GYX A;  3AYI A;  3LAD A;  1LV0 A;  2WBA A;  3SUC A;  4Z2R A;  3P4P A;  2Q0L A;  2YG3 A;  1D4C A;  2XLR A;  4U8P A;  5FS8 A;  1JRY A;  3NTA A;  2WS3 A;  3GYJ A;  1YQZ A;  2IVE A;  3NIX A;  4YSZ A;  2GH5 A;  1K0L A;  2BCP A;  2YG6 A;  4EMW A;  5C2T A;  1FOH A;  1H81 A;  3AD8 B;  4FK1 A;  4U8M A;  3CIR A;  2GF3 A;  2TMD A;  3S61 A;  4DSH A;  3UOX A;  3BNM A;  4B64 A;  1F8R A;  2E1M A;  4C3Y A;  1JOA A;  5CKU A;  2WHD A;  2E4G A;  1GND A;  2V3A A;  2B9Y A;  3LB8 A;  1NHS A;  1S2Q A;  2XVJ A;  4BV6 A;  4CCR A;  4Y4L A;  3UKP A;  3ALM A;  4A6N B;  4YSX A;  2VZ2 A;  3GDN A;  4JY3 A;  4BJZ A;  4GDE A;  1H82 A;  1E7P A;  4YSY A;  1LJ1 A;  3AXB A;  2BXR A;  2C67 A;  1FEB A;  2ACZ A;  2C3D A;  3F8R A;  2YR4 A;  1L9D A;  1NPX A;  4K5R A;  4EM3 A;  2Y6R A;  1ZY8 A;  4OPC A;  5FS9 A;  3GWF A;  1Y0P A;  2VVL A;  2BK4 A;  2GRT A;  3LZW A;  4OPL A;  1SEZ A;  1P2H A;  2CDU A;  2V61 A;  3QFA A;  2Q6U A;  3AEF A;  2GR3 A;  4BJY A;  1PJ7 A;  3SFE A;  2R46 A;  2FJA A;  4IV9 A;  3AEB A;  4YTN A;  1D7Y A;  3P4S A;  3SGL A;  1Q9I A;  3D1C A;  3EPT A;  1QO8 A;  1D4E A;  4OPD A;  4CBQ A;  4TM1 A;  1GET A;  2YVF A;  3G5Q A;  2X3N A;  4WCT A;  3CNT A;  5EB5 A; 
#chains in the Genus database with same CATH topology
 5HEG A;  4WW0 A;  3KV4 A;  2XFP A;  3ONX A;  4G6H A;  2A8X A;  3EAB A;  3CGD A;  3NYE A;  4LF6 T;  3E08 A;  2FBW A;  3AA6 B;  5LNK A;  4B3T T;  2X67 A;  4AP3 A;  2JIW A;  1KNR A;  3DJE A;  3SZ0 A;  2WZI A;  3R84 B;  5L4H A;  5JDM A;  2XUE A;  3GRT A;  4H4R A;  5LCY A;  4ZI7 E;  3PU8 A;  3RED A;  2JMK A;  2CXL A;  4LU6 A;  1E2A A;  4N78 D;  5HWY A;  4TWF A;  2CUL A;  2XM1 A;  4AI6 A;  2C66 A;  4TLZ A;  5HXH A;  1QSD A;  4OCG A;  1PBB A;  3CGB A;  3CWZ B;  3UKQ A;  2R07 4;  1DXL A;  3UFG A;  5IUX A;  5JR9 C;  3ZCI A;  3RC3 A;  1ZX9 A;  3FXD B;  3PV0 F;  5JR9 A;  2WP6 A;  1XDO A;  3MJX A;  4K8D A;  3HKC E;  3L3P A;  4P09 A;  2YG4 A;  3K7T A;  5J1G A;  3KD9 A;  2X0L B;  3OYZ A;  2KSR A;  3LDQ B;  4G2A A;  5H6Q B;  4C3X A;  3FZH B;  1CJ4 A;  3AEG A;  4JNA A;  2E5V A;  1LKX A;  4U31 A;  4U2Z A;  5LA6 E;  3MXZ A;  4ISS A;  4L5G A;  3FI7 A;  1TRB A;  2YU1 A;  2V8S V;  4H7U A;  1RUE 4;  5J2U E;  4OPG A;  4TX5 A;  3AE6 A;  3CTY A;  5FNV E;  4NEW A;  4AP1 A;  3WAJ A;  4NEV A;  3RC8 A;  2W66 A;  3NWI A;  4WZX A;  2CRB A;  2E9X B;  2XQ4 A;  3KIN B;  4YFS A;  4KHZ F;  2AAQ A;  3RP7 A;  3CQX C;  3B57 A;  1Z8U A;  3DJG X;  4DMW A;  3RYF E;  2LSY A;  1WR6 A;  3LZX A;  3FZM B;  1RHI 4;  2PZS A;  2BC0 A;  3DJB A;  2B1E A;  3HKD E;  1EZ3 A;  1VRB A;  3UTK A;  2GR1 A;  3GYI A;  4A65 A;  1BEV 4;  1MOK A;  5AQR B;  4PAG A;  3RPU A;  5LYJ E;  1F8W A;  2JQH A;  2WMO A;  2V6Y A;  3JAE A;  4H63 H;  3GD3 A;  3UU8 A;  4YXD A;  3BHK A;  2JB3 A;  1YW0 A;  2R0G A;  5JDL A;  1VBE 4;  3LJP A;  2XSB A;  4QXH B;  5EK2 A;  4AT0 A;  3ETU A;  4GK0 E;  2CHN A;  1WCR A;  4TNW A;  3UKL A;  1PJ6 A;  2NR4 A;  2XCG A;  5KMG P;  1S3E A;  4GIW A;  4ZOL E;  3AA7 B;  3GSI A;  2OA1 A;  2E2A A;  2QVA A;  4P9S A;  5HWX A;  4Q4V 4;  1TDK A;  2YDS A;  1TDO A;  5KOW A;  1XNR T;  1T7S A;  2AQJ A;  4UP3 A;  4EZH A;  2YVG A;  5KMS A;  4LF4 T;  3CND A;  4IE6 A;  3P4R A;  2AE9 A;  1WLX A;  3VRD B;  3AD9 B;  3BI2 A;  4X1I E;  2OV9 A;  3BI4 A;  3W15 B;  4LFA T;  1KDG A;  4Z24 A;  1DOD A;  3LK2 B;  1LRZ A;  3PVC A;  4XWR A;  3VRA A;  5JCM A;  2D2S A;  5FS6 A;  3AD7 B;  4JN9 A;  2UUC T;  1XMQ T;  1HG2 A;  3EAM A;  4GDP A;  3IF8 B;  1XHC A;  4UF0 A;  1WYC A;  1N4V A;  1VCS A;  2PLV 4;  5U1O A;  4EZ4 A;  3UP5 A;  5U63 A;  2D0U A;  2J4G A;  5CB4 E;  1HX1 B;  4OVI A;  4EEB A;  1MIW A;  5KVI A;  2RGO A;  1GT8 A;  2WP5 A;  3FIM B;  1IUW A;  3ZYK A;  2UXC T;  5LMU T;  1E1H B;  3C4X A;  2VWA A;  3P7I A;  3HZL A;  3AA1 B;  5L3F B;  2RP4 A;  3MZK B;  2BAC A;  1IJ5 A;  1EL5 A;  4DID B;  5LXT E;  3SFD A;  2APG A;  4M1P A;  5ADX L;  1MIY A;  4QHO A;  3T2Z A;  2HWC 4;  1MNE A;  2K24 A;  4B67 A;  2JJ9 A;  1CBO A;  3URH A;  1FEC A;  1LPF A;  1ONF A;  1JNR A;  2X0H A;  2B7S A;  1K5M D;  2CFY A;  5KMR A;  2X0Y A;  2QCU A;  5LBM A;  3GWH A;  4IHJ E;  2GK9 A;  2EQ7 A;  3TLT A;  3KKJ A;  4BK1 A;  3V3N A;  4ILU A;  4K0U A;  2EHO B;  3HKE E;  3ZMV B;  1RUJ 4;  4H9S E;  4CQI A;  2ZZ0 A;  3DP7 A;  1IUU A;  4JI7 T;  3IC9 A;  4N9X A;  1CF3 A;  3OKQ A;  5FMH A;  4ZZC A;  3II4 A;  1MND A;  1VDC A;  3EF6 A;  2RM2 4;  1UCU A;  4RHV 4;  1MMG A;  2LOP A;  2WBL A;  1O5W A;  3CN8 A;  5CQF A;  2R0C A;  2YN6 A;  4JI0 T;  2NW9 A;  1NWM X;  2KIN B;  3UOY A;  3UTE A;  2CA5 A;  5TR3 A;  2VKH A;  3SRZ A;  5ABG A;  2V7L A;  1JRZ A;  1S94 A;  1MO9 A;  3IEE A;  2X51 A;  1Y56 A;  3EUH A;  3F8P A;  3OYX A;  1KNZ A;  3NYF A;  3SZF A;  1VRQ B;  1X79 A;  3SZC A;  5LHI B;  4H9Q C;  3PO7 A;  3U3I A;  5C3J A;  3QVP A;  2PYL A;  3NNE A;  2C70 A;  1FL2 A;  3K7Q X;  2ZM0 A;  3CVR A;  2QYW A;  2OAL A;  1FMV A;  2CHO A;  3QC9 A;  3SOL A;  2L9Q A;  3QSS A;  2TPR A;  2GMJ A;  2WDV A;  5HY5 A;  2NWB A;  3RKO A;  2YR5 A;  4IDO A;  4RG4 A;  2YIN A;  1XMO T;  2EQ8 A;  4ZS3 A;  1NEK A;  2WP9 A;  2JBV A;  5J2T E;  2V7K A;  3O0H A;  1GQE A;  2C4C A;  1I94 T;  1EV1 4;  4YHJ A;  1UUR A;  2LLY A;  3ADA B;  2XVI A;  3TLW A;  1HX8 A;  2DKH A;  1YKJ A;  1D7L A;  1ZKQ A;  1HRV 4;  4TM0 A;  1T72 A;  2VOU A;  3FZL B;  5KWF A;  2WU5 A;  3ALJ A;  3UT5 E;  1PBD A;  4KPR A;  5CJ5 A;  1Q1R A;  3C4A A;  3ZT5 A;  3HYW A;  4YKG A;  4LA1 A;  4DGK A;  4PW8 A;  3EHZ A;  1GRE A;  4NIQ A;  2XAS B;  5ABF B;  1BWC A;  2MTQ A;  4EXT A;  3UKA A;  5DJQ C;  4JQ9 A;  1PDH A;  2D0T A;  1BGN A;  2GB0 A;  2YDR A;  4OPI A;  5FKY A;  4C91 A;  2JK6 A;  4H4V A;  1E6E A;  2P9B A;  3COX A;  2LHR A;  1PIV 4;  5LB7 B;  2IAK A;  5JTG A;  1CJC A;  1TYP A;  4JDR A;  2QGS A;  3CX6 B;  1OJC A;  5M4Y A;  5HEO A;  4O2A E;  2V5Z A;  1YXR A;  1ZOV A;  1H8T D;  4B63 A;  1NDA A;  4Y4N A;  2N2N A;  4REK A;  2WOV A;  3E0Z A;  2JPF A;  4IL9 A;  1CC6 A;  4I55 E;  1N4W A;  3MA9 A;  4MAL A;  1BF3 A;  1NG4 A;  2XFN A;  2Q9Q B;  4UVC B;  5LG4 A;  3RHA A;  3J7Y q;  2QA1 A;  3J8F 4;  4CXW A;  3Q9T A;  2V60 A;  3MK7 C;  5FS7 A;  4NTE A;  4XWZ A;  3F57 A;  4IVM B;  5FY0 A;  3NKS A;  5EK4 A;  3PUQ A;  1DOE A;  1JNZ A;  2QA7 A;  2B9X A;  2DI4 A;  2DHR A;  3O1H A;  1BR4 A;  3GYX A;  3ZMS B;  3LAD A;  2WBA A;  4BAY B;  3SUC A;  3P4P A;  2HPJ A;  2LHN A;  5FS8 A;  1JRY A;  3GYJ A;  4G6G A;  1YQZ A;  2GH5 A;  3QB5 K;  2YG6 A;  1NAF A;  3AD8 B;  2VVS A;  4GYR A;  4P0A A;  1R09 4;  2TMD A;  4NWZ A;  1KEY A;  3JD7 4;  2E4G A;  2V3A A;  4GAV A;  4JI4 T;  3UKP A;  2V1D B;  4A6N B;  4JY3 A;  3C4W A;  4GDE A;  1H82 A;  4EV6 A;  1E7P A;  3CQG B;  3UU3 A;  5EZY E;  4ZHQ E;  1LJ1 A;  3BK9 A;  2BXR A;  3T8O A;  2C67 A;  2Y6X A;  4FJO A;  2LOS A;  4K5R A;  1N32 T;  4HFI A;  4B3M T;  4ZZB A;  4OPL A;  2RPA A;  2Q6U A;  2DCF A;  1EAH 4;  5HXR A;  2K3W A;  4I4T E;  4BJY A;  2R46 A;  4IV9 A;  2UU9 T;  2IDO B;  1D7Y A;  2CMR A;  3ZMU B;  1Q9I A;  3N9P A;  3UU6 A;  4O4L E;  5FYM A;  3D1C A;  3EPT A;  3SX6 A;  1QO8 A;  2WMN A;  4TM1 A;  2YVF A;  2E5L T;  2G0U A;  2LRK A;  2YDQ A;  1MMA A;  2VKO A;  1W09 A;  4E7S A;  3DK8 A;  3N9M A;  4CY6 A;  3U78 A;  3C98 B;  4ADW A;  4B65 A;  1GTE A;  2WOW A;  4EIQ A;  4OHF A;  3I9Y A;  3AA0 B;  5HCJ A;  1FCD A;  1E1M A;  4JY2 A;  2WES A;  1OWA A;  2YQU A;  1F6M A;  4EQR A;  4IA5 A;  1V59 A;  2R0P A;  1JU2 A;  2ACX A;  2PJQ A;  3SWH A;  2H3R A;  4B69 A;  1J5E T;  1PHH A;  4GYS A;  4CN4 A;  5HXS A;  4GF7 A;  2W63 A;  2WQY A;  3VR9 A;  4WX1 A;  1IUX A;  3RKG A;  2XHE B;  5M10 A;  2XLP A;  1L9E A;  2YWL A;  5F8P A;  1D4M 4;  2X50 A;  4D03 A;  3ANW A;  3RLF F;  1BGJ A;  5LG3 A;  1E1L A;  4A79 A;  2YLS A;  4RG3 A;  3Q5D A;  4Z43 A;  3OVU A;  1VG9 A;  5L3D B;  4XXG A;  3EDU A;  3P9U A;  4B1B A;  3KDS E;  4H4Y A;  1UGO A;  1H7X A;  4H9O C;  3UOV A;  5FVK A;  4NZH A;  2ODU A;  3I1A A;  3O1J A;  3C4N A;  5KVH A;  2W2U A;  3AYJ A;  4L9I A;  2XQA A;  1MIV A;  5KXJ A;  2GQF A;  3OJA A;  2WU2 A;  1H84 A;  3K7M X;  4PK4 A;  2GAH B;  3TKL B;  1V9D A;  4GKK T;  4EIP A;  5KRQ A;  2OAM A;  5LBQ B;  3ZDN A;  1EL9 A;  5FVL A;  4AOS A;  1SE7 A;  2PBI A;  4EQW A;  1VOM A;  3S4U A;  3ZC0 A;  4B3S T;  4A99 A;  3CGE A;  2B9W A;  3B13 A;  1OED B;  3EDV A;  2VL8 A;  2NPX A;  3DH9 A;  2XQ5 A;  1GRT A;  4J36 A;  4X62 T;  1HNZ T;  4XZC A;  2ZZC A;  2CE7 A;  3DA1 A;  1TDE A;  3IA3 A;  4ZI2 D;  3NN0 X;  5KNL A;  4EQS A;  2D9D A;  1E39 A;  4Z25 A;  4M52 A;  4A5L A;  4AXP A;  3AAA B;  4L0R A;  4J34 A;  3ATQ A;  2BKO A;  2ZZB A;  2X8G A;  4DR7 T;  2GV8 A;  1IUV A;  1IJH A;  1B8S A;  3ONL C;  4LFC T;  3NK2 X;  3QK6 A;  2IIU A;  1YD8 G;  3AE5 A;  3HKB E;  2PY5 A;  2YLZ A;  1S35 A;  4KP3 C;  2KWH A;  5JR9 B;  3ZCJ A;  2X5I D;  4OYK A;  2GR2 A;  1GSN A;  3DME A;  3GRS A;  2J47 A;  5JQG E;  1GER A;  1IJ6 A;  2LM9 A;  4X9N A;  3QNU A;  1B7T A;  5HYA A;  4H2Q A;  1DJQ A;  4HB9 A;  4NNJ A;  3WI3 A;  3ZSS A;  5AQL B;  1AR9 4;  1O3X A;  4AKL A;  4PNI A;  5L3B B;  2BS3 A;  5LHH B;  4UDP A;  2BK5 A;  3CPI G;  3RYI E;  5BUK A;  2OLT A;  1E1K A;  3LBX A;  3BI5 A;  3CNS A;  4JI1 T;  1Y01 A;  3A8Y C;  1ZHC A;  4ZCC A;  1PXA A;  3NHO X;  1GRG A;  3GMB A;  2VKJ A;  4LML A;  3WE0 A;  4ZI2 C;  4ILC A;  1ZDL A;  4B66 A;  3RP6 A;  2BVM A;  5BRT A;  4U7I A;  2K5B B;  4TZ4 C;  5DQW A;  3VR8 A;  2NW7 A;  2F5Z A;  5L2L A;  4K7Z A;  4IDQ A;  3QSE A;  2CWO A;  2UZZ A;  2LT3 A;  3NT6 A;  4OPT A;  2VRL A;  2V6Y B;  3GMC A;  1HCI A;  4U8L A;  5DAB A;  1KF6 A;  5IYZ E;  2E9X D;  1I6Z A;  5JRC B;  4U2S A;  2BG9 B;  4I58 A;  4APN A;  2C75 A;  3G06 A;  4DR5 T;  1G8X A;  1OED E;  4AKH A;  1UK5 A;  1Z7S 4;  4DR6 T;  5AQT B;  2XVF A;  4K5S A;  4ASK A;  3QOF A;  2R04 4;  4EQX A;  3M0O A;  3RHW A;  2N9D A;  4TN7 B;  4H50 A;  4AQY T;  4TWD A;  1PJ5 A;  4U3C A;  4U33 A;  2W61 A;  2FJE A;  1H6V A;  1O95 A;  2VVL G;  2IML A;  1CJ2 A;  4P1N A;  3ZKR A;  1RYI A;  5L3G B;  2XVH A;  1VG0 A;  2ES0 A;  2W62 A;  3DK4 A;  4JNQ A;  4DV3 T;  4FK1 C;  1ZK7 A;  3JAF A;  3O4X E;  1QLB A;  2CBJ A;  3Q5X A;  4O8S A;  2NP9 A;  2JMH A;  3NGC X;  3LG7 A;  4ILB A;  1SA0 E;  2RR1 4;  4DND A;  3IF9 A;  2E9X C;  1CUN A;  1PO1 4;  4UF0 B;  2HWB 4;  3GQK A;  2PW9 A;  2K48 A;  1B37 A;  1B5Q A;  2JQQ A;  5L47 A;  5KOX A;  3ZMT B;  2W67 A;  3NLC A;  2DWG A;  1X31 B;  3I0Q A;  4EYY R;  4OFZ A;  1HTJ F;  2C5J A;  3P1W A;  2R4E A;  3Q5W A;  3UKF A;  4Y4M A;  3UCL A;  2PTF A;  4H4Z A;  3RIA A;  2BKP A;  5AQQ B;  5LOV E;  4IA6 A;  4TM3 A;  4BUR A;  5AQP B;  3CPZ A;  2RS5 4;  4FX9 A;  3VKH A;  4UVB B;  2FUP A;  2LKG A;  2HH7 A;  5AQF B;  2C73 A;  3I6D A;  5AQH B;  2GR0 A;  2YU2 A;  2BG9 E;  1KSU A;  5L4E A;  3LOV A;  4RSL A;  1MMD A;  2GAG B;  1D0Z A;  4TUY E;  4H9N C;  2Z6E A;  1XDP A;  2X66 A;  1H7C A;  3AXJ B;  2XVE A;  3KV5 A;  1AOG A;  2CBI A;  4AIS A;  4CN6 A;  1XAN A;  3PUY F;  4K2X A;  4DR4 T;  1JRX A;  1N36 T;  3VRB A;  4AT2 A;  5LJM A;  2DNX A;  3N2K E;  4EAH A;  2BAB A;  3RI5 A;  1NHQ A;  2IW5 B;  3F8D A;  4X5T A;  1YQ3 A;  4YKF A;  1LVF A;  3CNP A;  2VRM A;  1OJD A;  1GRA A;  4USQ A;  2NW8 A;  4PJL A;  3B5M A;  3C96 A;  4CNK A;  2L8K A;  4FDC B;  2XQ6 A;  3C64 A;  2BBH A;  1XZY A;  4JLE A;  4GK5 E;  2KMF A;  4QWN B;  4H2P A;  3ABV A;  3SM8 A;  4HWC A;  4IIJ E;  3ZYX A;  1RUI 4;  4USR A;  1M64 A;  3M65 A;  2VQF T;  1UUS A;  4H4W A;  3GA8 A;  2VQ7 A;  5HYM A;  3T31 A;  4JI5 T;  5LHG B;  2ZBW A;  2JQ9 A;  3LFM A;  3FPZ A;  1NA1 D;  2R06 4;  3C4Z A;  3M13 A;  5JCI A;  4H4U A;  2EHO D;  4KI0 F;  2OA5 A;  2E8I A;  5JRE A;  1B4V A;  2VVM A;  4WBN E;  3P50 A;  1TDF A;  2XQ7 A;  5ER0 A;  1VBC 4;  1F3P A;  2XZE A;  1PBE A;  4X1K E;  2CVJ A;  3DTO A;  3UTG A;  1RUH 4;  3K1S A;  1GRH A;  4HGA A;  5LMN T;  4CXY A;  1LV0 A;  1VCT A;  2Q0L A;  3TLS A;  2XLR A;  2I6H A;  4HFD A;  2IVE A;  3NIX A;  3TLV A;  1K0L A;  3PUG A;  2XAG B;  5C2T A;  4U8M A;  5E0O A;  2XJ7 A;  3CIR A;  2GF3 A;  3BNM A;  2JRK A;  4C3Y A;  1JOA A;  5CKU A;  4ZXL A;  3LB8 A;  4LFB T;  1LVK A;  3SY4 A;  1ASJ 4;  3SZW A;  2R6G F;  1W9R A;  2LSJ A;  2CWY A;  4IE7 A;  3AXB A;  4UEL A;  2CLY C;  1AR6 4;  4MHC A;  2WM9 A;  2EHO C;  1NPX A;  1U5P A;  2CXF A;  2Y6R A;  1BR1 A;  3I9W A;  2EHO A;  2YOE A;  2J62 A;  4OPC A;  4UEM A;  2VVL A;  3L39 A;  2GRT A;  3PUA A;  5GON E;  1P2H A;  4YJ2 E;  2CDU A;  2GR3 A;  3SFE A;  3AEB A;  3L8R A;  3P4S A;  4IE5 A;  1D4E A;  4CBQ A;  3SS1 A;  5HXC A;  3G5Q A;  2X3N A;  4WCT A;  3CNT A;  3EAN A;  4Q4W 4;  4A7A A;  2KT9 A;  2I59 A;  1WYB A;  2SPC A;  1GOS A;  2BVL A;  1REO A;  3KVB A;  2HPL A;  3ESL A;  2PFV A;  1RMU 4;  5LGU B;  3KBU A;  5AQG B;  3HR0 A;  1Z0P A;  3ZJ1 A;  1QUU A;  1XPQ A;  3UTF A;  4II2 A;  3ATR A;  1WRD A;  1DOC A;  4QXB B;  1HF8 A;  2H7V C;  4Z90 A;  2Y8D A;  4FI5 A;  1XI1 A;  4U8I A;  5IQ1 A;  1HYU A;  1HRI 4;  1LVL A;  2BCG G;  2W0H A;  3CMM A;  5JCN A;  4LF7 T;  4H4S A;  5F5W A;  5FY1 A;  5BR8 T;  3H8I A;  3P8C D;  3Q5E A;  3D0T A;  1VBA 4;  1EL8 A;  3N9N A;  3VU7 H;  2HQM A;  1NG3 A;  1E1N A;  4JI6 T;  2YVJ A;  4JYA T;  5HCM A;  4JEH B;  2GQW A;  1CHU A;  5M0Z A;  4HE8 A;  2BBJ A;  3CQC B;  3E22 E;  3UU5 A;  3T1Y T;  3DK9 A;  4WNK A;  5ABE A;  2Q9Q D;  2X9W A;  3NRN A;  5AQI B;  4K22 A;  3NRX A;  3WAK A;  4IE4 A;  2BKN A;  4NUU A;  3ZJ2 A;  4DR2 T;  4H4Q A;  2BA9 A;  2VB6 A;  3KV9 A;  2VQE T;  1H86 A;  4DV2 T;  3GN5 A;  3OPC A;  4XBF B;  4O4J E;  1BZL A;  2Q0K A;  2A9U A;  3AEC A;  1K0J A;  4HKA A;  2LE8 A;  1K4Q A;  4JV5 T;  1M62 A;  5EBK A;  3AE9 A;  1KFY A;  1D4D A;  3RNM A;  4UDQ A;  3H8L A;  2XTL A;  5GRT A;  3KU9 A;  5CFB A;  3JC6 D;  4LF9 T;  2Y48 B;  4TV8 E;  3FXE B;  3VKG A;  2RGH A;  1VBD 4;  4PJN A;  1KSS A;  4HTE A;  2A89 A;  3RX6 A;  3AE8 A;  3GDP A;  2V6O A;  2VL0 A;  4X66 T;  5KMP A;  2CXD A;  3IHM A;  1CJ3 A;  5LGT B;  3NVO A;  4HEA A;  1IUT A;  3X1D A;  3GQH A;  2LSI A;  2MAW A;  4IDN A;  1XWM A;  1ZEE A;  4A5X A;  2IVD A;  4EIW A;  5EK3 A;  3CKD A;  1N4U A;  1NHP A;  2Q9Q C;  2C76 A;  4WBO A;  1J1J A;  1RP0 A;  3PU3 A;  2Q9Q A;  1GES A;  2C5I T;  3NN6 X;  2CEA A;  4ILA A;  1GPE A;  1XHX A;  3K3Q C;  2XLU A;  2YLW A;  2ZLY A;  5HEH A;  1VQW A;  3DGH A;  3L1R A;  1HXS 4;  4X64 T;  1RSG A;  3V5S A;  3JC6 C;  4MLK A;  5AQU B;  4EMI A;  2FJB A;  2A87 A;  4DV1 T;  2IID A;  2V6X A;  1VRH 4;  4E0V A;  3ANW B;  4CNJ A;  4K0K T;  3ZLI A;  3OC4 A;  4HA6 A;  3IHR A;  2WCA A;  4UV9 B;  1FEA A;  2C7G A;  1FEW A;  4LMJ A;  1L9C A;  2XAQ B;  3LK3 B;  3AE4 A;  1R08 4;  3ZN0 B;  4CI1 B;  1XNQ T;  3K3O A;  3RQW A;  2I0Z A;  5JDF A;  4C90 A;  1OXZ A;  1YY5 A;  4HFE A;  1QJD A;  3T2K A;  4U2Y A;  4U8K A;  5AQJ B;  1AR7 4;  2R45 A;  5A1L A;  1PN0 A;  4EED A;  2YM1 A;  2YLR A;  3ZYL A;  5FY7 A;  4LII A;  4J56 A;  3V76 A;  2IHR 1;  3KVA A;  4H4X A;  1O94 A;  5KX5 E;  3B3R A;  2PG8 A;  1GXF A;  2WEU A;  3JBG 4;  1GTH A;  2LEH A;  2QRX A;  5L3C B;  3FHN A;  3KVE A;  4UR9 A;  3KFW X;  3RYC E;  2JKC A;  4BJN A;  5IHY A;  2V5C A;  4BK2 A;  2X8C A;  4MFR A;  4OK0 A;  4ZI3 D;  1FMW A;  3CNJ A;  3UUN A;  1NEN A;  4LF5 T;  3CPH G;  4U8J A;  1N1P A;  2X9H A;  3UUL A;  1SUM B;  3SQP A;  3CGC A;  1AL2 4;  4TNV A;  4XAX B;  4ZCD A;  1T98 A;  2BDE A;  4YT0 A;  3Q6J A;  2XY8 B;  4C77 A;  4IT4 A;  3FZF B;  1OJ9 A;  4PFO A;  2CM0 A;  3PUX F;  1Q1W A;  4PDW D;  2UXB T;  3QJ4 A;  1ZOY A;  2UXN B;  5L3E B;  3PJA J;  1FIO A;  1U4Q A;  4J31 A;  1EL7 A;  3FBL A;  2WWV A;  5BVA A;  2YG5 A;  2HN2 A;  3M3Z B;  3HL6 A;  4EB6 E;  3BHF A;  1VBB 4;  5HAX A;  2YEV C;  4E7Z A;  2LFC A;  3L8K A;  1ZP0 A;  3ZT7 A;  4DNA A;  1IBK T;  3P4Q A;  2LKH A;  3RGL A;  2IC9 A;  3H4K A;  3B6D A;  3D8X A;  2QAE A;  4H9P C;  4CI3 B;  4ZI3 C;  1DNC A;  4DR1 T;  4Q4Y 4;  3H3M A;  5BUL A;  1JEH A;  5L46 A;  4QH5 A;  2FJD A;  4U8O A;  2W4X A;  3PUZ F;  3CX8 B;  2EQ6 A;  4ADZ A;  3ICR A;  5AQK B;  1US7 B;  4G74 A;  1ELI A;  2ODV A;  3UUB A;  3KPF A;  5LGN B;  3ZT6 A;  5C8Y E;  4UVA B;  2XDO A;  4A9W A;  3S5W A;  3IWA A;  2VQB A;  1HNX T;  5DBJ A;  3RRC A;  2YM2 A;  3T2Y A;  2ZM2 A;  3UTH A;  2XLT A;  1N33 T;  2D5U A;  3ZC1 A;  1W4X A;  3ONJ A;  1OED C;  4EYU A;  4JUY A;  3RYH E;  1PS9 A;  1G73 A;  1OED A;  3Q2M A;  2J1D G;  2X68 A;  3ZMZ B;  1D0X A;  4QXC B;  1PXB A;  1UX4 A;  5HEU A;  2L3L A;  3QSM A;  2VK9 A;  4B3R T;  3ZST A;  4NXN T;  4QKN A;  1SHZ C;  2WPC A;  4DUY T;  2WWU A;  2CCQ A;  1ZMC A;  4HWH A;  4O5U A;  3CML A;  2BXS A;  1BR0 A;  4H2R A;  4H2N A;  4NXM T;  4DV7 T;  2ZMA A;  1TDN A;  4G9K A;  3FBZ A;  4JEU B;  3K3N A;  1M6I A;  4Z2U A;  3ISH A;  4GB3 4;  5IQ4 A;  4UXN B;  2BYB A;  3PE0 A;  1Z6L A;  2KWI B;  2WZH A;  2KLQ A;  3OTO T;  5EB4 A;  1X9B A;  4J2C A;  4Z91 A;  2K9A A;  2W00 A;  5HEJ A;  5JCL A;  1WFD A;  3PS9 A;  2PYX A;  3L09 A;  4CI2 B;  1EBD A;  3AWI A;  2WET A;  1D1B A;  1IZN B;  5JDQ A;  3UOZ A;  2RAB A;  5CA1 E;  2RA1 A;  4AIU A;  4TLX A;  4JI2 T;  4GOU A;  1OJA A;  1TYT A;  2IC6 A;  3AB3 B;  5JDG A;  4Z2R A;  5F3J A;  2YG3 A;  3ZPO A;  4U8P A;  3HA4 A;  2WS3 A;  3BQL A;  4EMW A;  1FOH A;  1H81 A;  1MQT D;  4FK1 A;  4ZEY A;  1HNW T;  2KZ7 B;  4F8H A;  2E1M A;  3KBT A;  2WHD A;  1GND A;  2B9Y A;  2BG9 C;  1S2Q A;  1HS7 A;  2VAS A;  4BV6 A;  4CCR A;  1RUD 4;  2E9X A;  3UUM A;  4Y4L A;  5JRC A;  4YSX A;  2BG9 A;  3UUX B;  3GDN A;  2KND A;  2HHH T;  5JDN A;  2YK0 A;  1HFA A;  2WY2 A;  4JI3 T;  1FEB A;  4DMV A;  2I0M A;  2C3D A;  3F8R A;  2YR4 A;  2H7O A;  1Y0P A;  2BK4 A;  2EX3 A;  1IAP A;  4ERR A;  3QFA A;  4YTN A;  2XQ8 A;  2M6I A;  4OPD A;  3UU4 A;  4NPP A;  5BMV E;  2A3D A;  4AKI A;  3GWD A;  3R9U A;  3KA7 A;  2DWK A;  2R7F A;  3T37 A;  3RF1 A;  4HFC A;  4X65 T;  2XFO A;  3T14 A;  4LMK A;  3CK6 A;  2UXD T;  5GSN A;  2KXP B;  2HN1 A;  4GRT A;  4HFH A;  1H83 A;  2XFU A;  2C64 A;  3AEE A;  1D1A A;  4BJM A;  2JB2 A;  4A56 A;  2XAF B;  3R6N A;  2MYS A;  4IST A;  5HXI A;  2XSA A;  3MKD A;  1OOP D;  3PUV F;  2XPK A;  4IGU A;  3TLU A;  2M67 A;  4X20 E;  2X9Y A;  4Z2T A;  2XLS A;  1D5T A;  2YKS A;  1DJN A;  4CCQ A;  2Z5X A;  4MJW A;  3RRW A;  3AVR A;  4KHP T;  1D0Y A;  3AE3 A;  3ZN1 B;  2DL1 A;  4CRT A;  4PAB A;  3N2G E;  1Y56 B;  3PUR A;  2LM2 A;  5FXW A;  4AOX A;  2C72 A;  4GAP A;  2XAH B;  5CGM A;  4YTM A;  3O1I A;  5FXZ A;  5HXE A;  3T0K A;  3QVR A;  2R4J A;  4O5Q A;  5JDH A;  4HFB A;  4Z8X A;  4DV5 T;  1PXC A;  2Z5Y A;  2C0S A;  3LK4 2;  2UUB T;  4IVO B;  1LQU A;  3UFE A;  3KLJ A;  3NZQ A;  2WOI A;  3AXJ A;  4DV0 T;  2JB1 A;  4CY8 A;  1T8B A;  4B68 A;  2CLY B;  4DR3 T;  3C50 A;  3PUS A;  3FMW A;  2BRY A;  2O9Z A;  4U2T A;  1BKW A;  1GAL A;  4AKR B;  5FXX A;  4EGW A;  3G5R A;  3GMI A;  3O9X A;  3K30 A;  4H4T A;  4NTD A;  3SYI A;  4G63 A;  3T1H T;  3F2E A;  3UQ4 A;  5H6R B;  5EOW A;  2CPT A;  3UKH A;  2V5D A;  2AXD S;  3AYL A;  4QX8 B;  1MXT A;  2V7J A;  1AR8 4;  2DLR A;  1COY A;  1BR2 A;  3I3L A;  5LP6 E;  4DO0 A;  3N5L A;  2EQ9 A;  4D04 A;  2XYO A;  5FMN A;  4ICY A;  4TWH A;  4UIG A;  3P4W A;  1W0A A;  4YSH A;  3HYX A;  2GVC A;  1UKV G;  3E1T A;  3AB1 A;  4YWO A;  2C65 A;  2UUA T;  4DSG A;  2DKI A;  3AE7 A;  4QH1 A;  1DU2 A;  4HN9 A;  4J57 A;  4X9M A;  1ZKE A;  4U8N A;  2B7R A;  3UP4 A;  4EM4 A;  4B6X A;  4HWI B;  2ZM8 A;  4IL4 A;  4OYJ A;  1YQ4 A;  2V3B A;  3OBV E;  5IWA T;  1S2Y A;  1YKH B;  2WSS V;  4I50 E;  2XAJ B;  2V26 A;  1POV 0;  2X99 A;  3OZ2 A;  3IHG A;  5JH7 E;  3FBS A;  4O4H E;  4JI8 T;  4UV8 B;  2Y6Q A;  4MBQ A;  4OX9 T;  3AEA A;  2V7M A;  4YLH A;  2V7I A;  3PTR B;  2NVK X;  3CPJ G;  3DJD A;  1M7K A;  1PBC A;  1P2E A;  3ITJ A;  3GN5 B;  2MOZ A;  5AQO B;  1NHR A;  1J5W A;  2VKD A;  4PJJ A;  4H63 V;  2BRA A;  1GRF A;  5AQN B;  4PJM A;  4IDP A;  1LTX R;  3I0O A;  3N9O A;  2WPE A;  2ZM6 T;  3G5S A;  1KNP A;  4X4J A;  1CC4 A;  4X1Y E;  3V5U A;  5U25 A;  3C51 A;  2YG7 A;  3AE2 A;  1CC2 A;  1MMN A;  4AKG A;  2AR8 A;  4J2W A;  5TAO A;  4NUV A;  2A2F X;  2X8H A;  3RQU A;  2BK3 A;  4U72 A;  3H3A A;  4BA9 A;  1RUG 4;  1R8I A;  2N1G A;  3AAI A;  3NK0 X;  5KMQ A;  2PHH A;  4H4P A;  2WDQ A;  2XM2 A;  5AQS B;  3NZP A;  4KUM B;  1PO2 4;  4C5O A;  4IRE A;  4C74 A;  2YAU A;  3K8P C;  1XHZ A;  4PK5 A;  4ZS2 A;  1AJ3 A;  1CL0 A;  2A72 A;  5J0Z A;  3FB2 A;  2GEW A;  5ABF A;  1OJT A;  2OLN A;  3AAE B;  2OLO A;  4TV9 E;  4TM4 A;  3IBP A;  2H89 A;  3LSV A;  2ARD A;  3A5X A;  4CN1 A;  2NOX A;  4JBW F;  2YLX A;  3NKZ A;  4DUZ T;  3EAO A;  2RS1 4;  4O2B E;  3LXD A;  3RH3 A;  3PDY A;  4DV4 T;  4CXX A;  3N9Q A;  1UX5 A;  3NG7 X;  2WDR A;  1ZMD A;  3FG2 P;  4I0U A;  4A98 A;  4HFV A;  3VQR A;  3NTD A;  2F4V T;  1NAA A;  4KBM B;  2YLT A;  3PJA A;  4YJ3 E;  2XQ3 A;  4AQG A;  5FL0 A;  4IDZ A;  3NRY A;  4UDR A;  1KK7 A;  1DOB A;  1FJG T;  3HI2 A;  4ZN0 A;  3V3O A;  2LSK A;  5FL1 A;  1YKE B;  4IE0 A;  4Q4X 4;  3UKK A;  4KMC A;  3ICS A;  2BS4 A;  4F6R C;  5IPY A;  4CZZ B;  5J7X A;  2NTY A;  4OPU A;  3RIF A;  2B76 A;  1COV 4;  3AE1 A;  2BC1 A;  4YHH T;  4YTP A;  2PYJ A;  1IBL T;  3NBX X;  2RS3 4;  2RMU 4;  5JCK A;  4Q25 A;  4BK3 A;  2LRL A;  2GMH A;  3RP8 A;  2LJL A;  4NTC A;  3BQK A;  4ECH A;  4GKJ T;  1WR0 A;  4PFP A;  3ALL A;  3H37 A;  2J3N A;  3JSK A;  2C5K T;  3BQI A;  4O4I E;  5CA0 E;  4ANJ A;  3SXI A;  4GCM A;  4A6N A;  4KX6 A;  3LJC A;  2WPF A;  3DGZ A;  5HHF A;  1RUC 4;  1ZV4 X;  3JCF A;  3MAC A;  2R9Z A;  3KPK A;  3ICT A;  2VVN A;  4GR1 A;  3HYV A;  2H88 A;  2W0G A;  1XDI A;  2NTX A;  4PK6 A;  3M12 A;  3CX7 B;  2Q7V A;  4COF A;  1IUS A;  1Y64 B;  4EMJ A;  2WB5 A;  3EI0 A;  4GUV A;  3BNU A;  5KDM C;  2BZB A;  3EVY A;  4WYV A;  3DJJ A;  3NH3 X;  2BS2 A;  4J33 A;  5J60 A;  1RUF 4;  2MPK A;  3N9L A;  4YY3 T;  2M6B A;  2JAE A;  3QFB A;  1F8S A;  4LF8 T;  2UXX B;  5LJN A;  3A7M A;  1LQT A;  4I59 A;  2WAU A;  5LV9 A;  5ETW A;  1K0I A;  3Q9D A;  3VHL A;  5ABH A;  3ZYM A;  1PBF A;  2XFQ A;  3NYC A;  2IUB A;  4I43 B;  2QA2 A;  4Z44 A;  2C3C A;  1GRB A;  2RGJ A;  5FXV A;  1L0V A;  3J9X 1;  3JAD A;  2YR6 A;  1GV4 A;  4PAA A;  4QH4 A;  1S3B A;  4Z26 A;  3RIU C;  3NK1 X;  1IBM T;  4HWD A;  1H7W A;  3GD4 A;  2MBG A;  3ETV A;  1GEU A;  3AED A;  3F31 A;  3RIU A;  4U2L A;  3AYI A;  1W0B A;  3KV6 A;  4DBQ A;  1N34 T;  1D4C A;  3NTA A;  4DV6 T;  4YSZ A;  2BCP A;  5FP3 A;  2VUR A;  3S61 A;  4DSH A;  3UOX A;  4B64 A;  1F8R A;  5AQV B;  4U74 A;  1NHS A;  4G73 A;  2XVJ A;  3FZK B;  3LBX B;  4EOZ B;  3ALM A;  5DQV A;  2VZ2 A;  4BJZ A;  5JVD E;  2XQY A;  4P0B A;  4U7Y A;  1D1C A;  4HWF A;  1PVC 4;  4QX7 B;  4YSY A;  2LSG A;  2ACZ A;  3AVS A;  4A97 A;  1L9D A;  4EM3 A;  2JQK A;  3ZEF B;  3QUJ A;  1RVF 4;  4DVD A;  1ZY8 A;  3UQ7 A;  5FS9 A;  4AQF C;  3PUW F;  3GWF A;  1HG5 A;  3LZW A;  2XQ9 A;  1SEZ A;  2V61 A;  4II3 A;  3QB5 A;  3AEF A;  1PJ7 A;  4AQF A;  2FJA A;  1NCQ D;  4DBR A;  4V1A v;  3SGL A;  2X9X A;  5AFU L;  1HR0 T;  1GET A;  5AQM B;  3N2O A;  4H9R C;  5EB5 A; 
#chains in the Genus database with same CATH homology
 2XFP A;  3GWD A;  3R9U A;  4A7A A;  3KA7 A;  4G6H A;  3T37 A;  2A8X A;  3CGD A;  3NYE A;  1GOS A;  1REO A;  2FBW A;  4AP3 A;  2XFO A;  3T14 A;  1KNR A;  3DJE A;  3SZ0 A;  5GSN A;  3DK8 A;  4GRT A;  3GRT A;  1H83 A;  4H4R A;  4CY6 A;  2XFU A;  4ADW A;  2C64 A;  3RED A;  3AEE A;  4LU6 A;  1XPQ A;  2JB2 A;  3UTF A;  4II2 A;  1GTE A;  4B65 A;  2WOW A;  4EIQ A;  2CUL A;  3ATR A;  2C66 A;  4TLZ A;  1DOC A;  1FCD A;  1E1M A;  5HXI A;  4OCG A;  4JY2 A;  1PBB A;  2WES A;  2YQU A;  3CGB A;  1F6M A;  4EQR A;  4IA5 A;  3UKQ A;  1DXL A;  1V59 A;  4U8I A;  2R0P A;  5IQ1 A;  1HYU A;  1JU2 A;  1LVL A;  2BCG G;  2W0H A;  1ZX9 A;  3CMM A;  5JCN A;  4B69 A;  2WP6 A;  4H4S A;  4K8D A;  1PHH A;  4Z2T A;  3H8I A;  2XLS A;  1D5T A;  1DJN A;  2YG4 A;  3K7T A;  4GF7 A;  4CCQ A;  3KD9 A;  1EL8 A;  2Z5X A;  4MJW A;  2WQY A;  4C3X A;  3VR9 A;  1CJ4 A;  4WX1 A;  1IUX A;  3AEG A;  4JNA A;  2HQM A;  2E5V A;  1NG3 A;  5M10 A;  1E1N A;  1L9E A;  2XLP A;  3AE3 A;  2YVJ A;  2YWL A;  1TRB A;  2GQW A;  2X50 A;  4H7U A;  1CHU A;  4CRT A;  4D03 A;  4PAB A;  1BGJ A;  4OPG A;  5M0Z A;  1E1L A;  1Y56 B;  4A79 A;  2YLS A;  3AE6 A;  3CTY A;  4RG3 A;  4AOX A;  3DK9 A;  4NEW A;  4Z43 A;  2C72 A;  1VG9 A;  4GAP A;  4AP1 A;  3NRN A;  4XXG A;  3P9U A;  4NEV A;  4B1B A;  4K22 A;  4YTM A;  4H4Y A;  3T0K A;  1H7X A;  3QVR A;  2R4J A;  4O5Q A;  3UOV A;  4NZH A;  1PXC A;  2Z5Y A;  4H4Q A;  2BA9 A;  4IVO B;  2AAQ A;  3C4N A;  1H86 A;  3RP7 A;  1LQU A;  3KLJ A;  3DJG X;  5KVH A;  2WOI A;  3LZX A;  1BZL A;  2Q0K A;  3AYJ A;  2JB1 A;  4CY8 A;  3AEC A;  1K0J A;  1K4Q A;  2BC0 A;  4B68 A;  5EBK A;  5KXJ A;  3AE9 A;  2GQF A;  1KFY A;  1D4D A;  3FMW A;  2BRY A;  2WU2 A;  1H84 A;  2O9Z A;  3K7M X;  3RNM A;  2GR1 A;  4U2T A;  1BKW A;  1GAL A;  3GYI A;  4UDQ A;  2GAH B;  3H8L A;  3G5R A;  4A65 A;  5GRT A;  1MOK A;  3KU9 A;  3K30 A;  4H4T A;  4NTD A;  3SYI A;  1F8W A;  4EIP A;  5KRQ A;  3GD3 A;  5EOW A;  3UKH A;  2OAM A;  4YXD A;  3BHK A;  2JB3 A;  3ZDN A;  1EL9 A;  2R0G A;  2RGH A;  3LJP A;  3AYL A;  4AOS A;  4EQW A;  1KSS A;  2A89 A;  1MXT A;  3AE8 A;  4A99 A;  3GDP A;  3CGE A;  4AT0 A;  2B9W A;  2V6O A;  5KMP A;  3UKL A;  1COY A;  1PJ6 A;  3I3L A;  3IHM A;  1CJ3 A;  2NPX A;  3DH9 A;  1GRT A;  4J36 A;  1IUT A;  2EQ9 A;  2XCG A;  2XYO A;  4D04 A;  4ICY A;  3GQH A;  1S3E A;  2IVD A;  2ZZC A;  3DA1 A;  1N4U A;  1NHP A;  3HYX A;  4YSH A;  3GSI A;  1TDE A;  2C76 A;  2GVC A;  2OA1 A;  1UKV G;  3NN0 X;  4P9S A;  4EQS A;  5KNL A;  3E1T A;  3AB1 A;  1E39 A;  1RP0 A;  1TDK A;  4Z25 A;  3NN6 X;  1GES A;  4M52 A;  4YWO A;  1TDO A;  4A5L A;  2C65 A;  5KOW A;  4DSG A;  4J34 A;  3ATQ A;  2ZZB A;  2AQJ A;  1GPE A;  2DKI A;  2X8G A;  4UP3 A;  2GV8 A;  1IUV A;  2YVG A;  1IJH A;  1B8S A;  3NK2 X;  5KMS A;  2XLU A;  3CND A;  3AE7 A;  3P4R A;  3VRD B;  2YLW A;  3AD9 B;  3AE5 A;  3BI2 A;  3BI4 A;  4J57 A;  4X9M A;  2YLZ A;  4U8N A;  1KDG A;  2B7R A;  1VQW A;  3DGH A;  3L1R A;  3UP4 A;  4Z24 A;  4EM4 A;  2GR2 A;  1GSN A;  1DOD A;  1RSG A;  3DME A;  3GRS A;  1GER A;  3PVC A;  4X9N A;  4XWR A;  3VRA A;  1YQ4 A;  5JCM A;  4EMI A;  2V3B A;  5FS6 A;  2FJB A;  3AD7 B;  4JN9 A;  2A87 A;  1S2Y A;  2IID A;  4E0V A;  4H2Q A;  1DJQ A;  4HB9 A;  4NNJ A;  2X99 A;  4CNJ A;  3OZ2 A;  3IHG A;  4GDP A;  1XHC A;  3FBS A;  2BS3 A;  4UDP A;  2BK5 A;  3CPI G;  5BUK A;  3OC4 A;  4HA6 A;  2Y6Q A;  1E1K A;  1N4V A;  3AEA A;  2C7G A;  1FEA A;  3BI5 A;  1L9C A;  5U1O A;  3CNS A;  3UP5 A;  3AE4 A;  2NVK X;  3CPJ G;  5U63 A;  4ZCC A;  3DJD A;  1PBC A;  1P2E A;  1PXA A;  3NHO X;  4OVI A;  1GRG A;  3GMB A;  2I0Z A;  3ITJ A;  5KVI A;  3WE0 A;  2RGO A;  1GT8 A;  2WP5 A;  1YY5 A;  3FIM B;  1IUW A;  1ZDL A;  1QJD A;  1NHR A;  3T2K A;  4B66 A;  3RP6 A;  4U8K A;  5BRT A;  2R45 A;  3HZL A;  1PN0 A;  2BRA A;  1GRF A;  3VR8 A;  2YM1 A;  2F5Z A;  2YLR A;  4K7Z A;  1LTX R;  4LII A;  4J56 A;  3V76 A;  2BAC A;  3QSE A;  4H4X A;  2WPE A;  1EL5 A;  2UZZ A;  1O94 A;  1KNP A;  3G5S A;  1CC4 A;  3NT6 A;  4X4J A;  4OPT A;  3SFD A;  2VRL A;  3B3R A;  3GMC A;  2APG A;  1GXF A;  5U25 A;  3T2Z A;  2WEU A;  2YG7 A;  3AE2 A;  1CC2 A;  4U8L A;  4B67 A;  1GTH A;  1KF6 A;  2AR8 A;  4J2W A;  1CBO A;  3URH A;  3KVE A;  1FEC A;  2JKC A;  1LPF A;  2X8H A;  1ONF A;  4U2S A;  1JNR A;  2BK3 A;  4BK2 A;  2X8C A;  4I58 A;  4APN A;  2B7S A;  2C75 A;  2CFY A;  3CNJ A;  3NK0 X;  1NEN A;  2PHH A;  5KMQ A;  5KMR A;  4H4P A;  2WDQ A;  2QCU A;  3CPH G;  4U8J A;  3KKJ A;  2EQ7 A;  1N1P A;  4BK1 A;  2XVF A;  4C5O A;  4K5S A;  3V3N A;  4C74 A;  2YAU A;  3SQP A;  4EQX A;  3CGC A;  1CL0 A;  2ZZ0 A;  3M0O A;  4ZCD A;  2GEW A;  1IUU A;  3Q6J A;  4YT0 A;  3IC9 A;  1OJT A;  2OLN A;  4N9X A;  4C77 A;  1CF3 A;  4H50 A;  1OJ9 A;  5FMH A;  2OLO A;  3II4 A;  1PJ5 A;  4TM4 A;  1Q1W A;  2H89 A;  1VDC A;  2ARD A;  3EF6 A;  2YLX A;  3EAO A;  3LXD A;  2FJE A;  1H6V A;  1O95 A;  2VVL G;  1O5W A;  1ZOY A;  1CJ2 A;  3QJ4 A;  1RYI A;  3CN8 A;  5CQF A;  2R0C A;  4J31 A;  2XVH A;  3NG7 X;  1EL7 A;  2WDR A;  1VG0 A;  1ZMD A;  3FG2 P;  5BVA A;  3DK4 A;  4JNQ A;  3UOY A;  3UTE A;  2YG5 A;  3VQR A;  4FK1 C;  3NTD A;  5TR3 A;  1ZK7 A;  1NAA A;  1JRZ A;  3BHF A;  1MO9 A;  1QLB A;  2YLT A;  3NGC X;  2LFC A;  3L8K A;  1ZP0 A;  1Y56 A;  4UDR A;  4DNA A;  3P4Q A;  3IF9 A;  3H4K A;  3F8P A;  1DOB A;  3NYF A;  3B6D A;  3SZF A;  3GQK A;  3D8X A;  1VRQ B;  1B37 A;  2QAE A;  3V3O A;  4ZN0 A;  1B5Q A;  3UKK A;  1DNC A;  5KOX A;  3SZC A;  3ICS A;  3PO7 A;  2BS4 A;  5BUL A;  1JEH A;  5L46 A;  5C3J A;  3NLC A;  3QVP A;  1X31 B;  2FJD A;  3NNE A;  4U8O A;  5IPY A;  2C70 A;  1FL2 A;  3K7Q X;  2EQ6 A;  5J7X A;  3ICR A;  4OPU A;  3P1W A;  2OAL A;  4G74 A;  1ELI A;  2R4E A;  2B76 A;  3QSS A;  3UKF A;  3AE1 A;  3KPF A;  4Y4M A;  2TPR A;  2GMJ A;  3UCL A;  2WDV A;  2BC1 A;  5HY5 A;  4H4Z A;  4YTP A;  2YR5 A;  4RG4 A;  2XDO A;  4IA6 A;  2EQ8 A;  1NEK A;  2WP9 A;  2JBV A;  3S5W A;  3IWA A;  2VQB A;  3O0H A;  4A9W A;  2C4C A;  5JCK A;  4TM3 A;  4BK3 A;  2GMH A;  5DBJ A;  4BUR A;  3RP8 A;  2YM2 A;  4NTC A;  3T2Y A;  3UTH A;  2XLT A;  4ECH A;  3ADA B;  1W4X A;  2XVI A;  3ALL A;  4FX9 A;  2J3N A;  3JSK A;  3SXI A;  2DKH A;  1YKJ A;  1D7L A;  1ZKQ A;  4GCM A;  1PS9 A;  4TM0 A;  4A6N A;  4KX6 A;  2VOU A;  2C73 A;  2WPF A;  3DGZ A;  3I6D A;  2GR0 A;  1PXB A;  5KWF A;  2WU5 A;  3ALJ A;  5HHF A;  1KSU A;  1PBD A;  3LOV A;  3QSM A;  4RSL A;  2GAG B;  2R9Z A;  3ICT A;  3KPK A;  5FS7 A;  4GR1 A;  4KPR A;  1Q1R A;  3HYV A;  3C4A A;  2WPC A;  2XVE A;  3HYW A;  2H88 A;  1XDI A;  4YKG A;  4LA1 A;  1XAN A;  1AOG A;  3M12 A;  4DGK A;  2Q7V A;  1IUS A;  4EMJ A;  4K2X A;  1JRX A;  1ZMC A;  3VRB A;  4AT2 A;  1GRE A;  1BWC A;  4GUV A;  3BNU A;  2BAB A;  1NHQ A;  4O5U A;  3UKA A;  3F8D A;  4JQ9 A;  1PDH A;  1BGN A;  1YQ3 A;  2GB0 A;  2BXS A;  4OPI A;  4YKF A;  3CNP A;  2VRM A;  2JK6 A;  1OJD A;  1GRA A;  3DJJ A;  4H4V A;  1E6E A;  3NH3 X;  4H2N A;  2BS2 A;  4H2R A;  4USQ A;  3COX A;  4J33 A;  5J60 A;  3UOZ A;  3C96 A;  4CNK A;  1TDN A;  4FDC B;  4G9K A;  2JAE A;  1CJC A;  1TYP A;  1F8S A;  3QFB A;  4JDR A;  1OJC A;  1M6I A;  4Z2U A;  3ISH A;  4H2P A;  1LQT A;  3SM8 A;  3ABV A;  2BYB A;  5IQ4 A;  4I59 A;  2V5Z A;  1Z6L A;  3ZYX A;  5LV9 A;  4USR A;  1K0I A;  1ZOV A;  1M64 A;  4B63 A;  1NDA A;  4Y4N A;  4REK A;  4H4W A;  5EB4 A;  2VQ7 A;  2WOV A;  5HYM A;  3T31 A;  1PBF A;  2ZBW A;  2XFQ A;  3FPZ A;  3EAN A;  1CC6 A;  3M13 A;  3NYC A;  1N4W A;  3PS9 A;  5JCL A;  5JCI A;  4H4U A;  2PYX A;  1BF3 A;  2QA2 A;  1EBD A;  1NG4 A;  4Z44 A;  2C3C A;  2XFN A;  1GRB A;  3AWI A;  3RHA A;  2RGJ A;  1B4V A;  2WET A;  2QA1 A;  2VVM A;  1L0V A;  3Q9T A;  2V60 A;  2YR6 A;  1GV4 A;  1TDF A;  2RAB A;  4NTE A;  1S3B A;  4PAA A;  4XWZ A;  5ER0 A;  4IVM B;  3NK1 X;  1F3P A;  3NKS A;  4TLX A;  4Z26 A;  1DOE A;  1JNZ A;  1PBE A;  1H7W A;  2B9X A;  2CVJ A;  3GD4 A;  3UTG A;  1GEU A;  1OJA A;  1GRH A;  3AED A;  1TYT A;  3GYX A;  4U2L A;  3AYI A;  3LAD A;  1LV0 A;  2WBA A;  3SUC A;  4Z2R A;  3P4P A;  2Q0L A;  2YG3 A;  1D4C A;  2XLR A;  4U8P A;  5FS8 A;  1JRY A;  3NTA A;  2WS3 A;  3GYJ A;  1YQZ A;  2IVE A;  3NIX A;  4G6G A;  4YSZ A;  2GH5 A;  1K0L A;  2BCP A;  2YG6 A;  4EMW A;  5C2T A;  1FOH A;  1H81 A;  3AD8 B;  4FK1 A;  4U8M A;  3CIR A;  2GF3 A;  2TMD A;  3S61 A;  4DSH A;  3UOX A;  3BNM A;  4B64 A;  1F8R A;  2E1M A;  4C3Y A;  1JOA A;  5CKU A;  4NWZ A;  2WHD A;  2E4G A;  1GND A;  2V3A A;  2B9Y A;  3LB8 A;  1NHS A;  4GAV A;  1S2Q A;  4G73 A;  2XVJ A;  4BV6 A;  4CCR A;  3SY4 A;  4Y4L A;  3UKP A;  3SZW A;  3ALM A;  4A6N B;  4YSX A;  2VZ2 A;  3GDN A;  4JY3 A;  4BJZ A;  4GDE A;  1H82 A;  1E7P A;  4YSY A;  1LJ1 A;  3AXB A;  2BXR A;  2C67 A;  1FEB A;  2ACZ A;  2C3D A;  3F8R A;  2YR4 A;  1L9D A;  1NPX A;  4K5R A;  4EM3 A;  2Y6R A;  1ZY8 A;  4OPC A;  5FS9 A;  3GWF A;  1Y0P A;  2VVL A;  2BK4 A;  2GRT A;  3LZW A;  4OPL A;  1SEZ A;  1P2H A;  2CDU A;  2V61 A;  3QFA A;  2Q6U A;  4II3 A;  3AEF A;  2GR3 A;  4BJY A;  1PJ7 A;  3SFE A;  2R46 A;  2FJA A;  4IV9 A;  3AEB A;  4YTN A;  1D7Y A;  3P4S A;  3SGL A;  1Q9I A;  3D1C A;  3EPT A;  3SX6 A;  1QO8 A;  1D4E A;  4OPD A;  4CBQ A;  4TM1 A;  1GET A;  2YVF A;  3G5Q A;  2X3N A;  4WCT A;  3CNT A;  5EB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...