3VRAA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
613
structure length
613
Chain Sequence
b'AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 192
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vraA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vraA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vraA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vraA04
1CBOA 2W0HA 3GSIA 4B65A 4H7UA 1GRHA 2WPFA 1GV4A 3DH9A 3LZXA 4J31A 2QA2A 2YG5A 2WU2A 4OVIA 1JNRA 1NDAA 1B5QA 3DJJA 2YLXA 4I58A 4DNAA 4BK1A 3CGEA 3NYFA 4U2TA 2BYBA 3BHFA 1S2YA 4J2WA 3K7QX 4H2RA 3CGBA 2ZZBA 4FK1A 2JBVA 2R0GA 2Z5YA 4IVOB 4U8NA 4U2SA 2BK4A 1K0IA 3SM8A 2YAUA 4EIQA 1D4EA 1OJ9A 4EMIA 3OC4A 2GV8A 5BUKA 4CY8A 2B9XA 4NEVA 1COYA 5TR3A 2ACZA 1S3EA 1BGJA 1TDOA 1IJHA 2CVJA 1E1LA 1S3BA 4UDRA 1NG3A 4XWRA 2C76A 2GR1A 2J3NA 1NENA 4USRA 3P4QA 3B6DA 1RYIA 1PN0A 1PJ6A 1KF6A 4YXDA 3DJDA 4YKGA 2RGOA 4A5LA 4RSLA 3IHGA 4J56A 1VDCA 3AE5A 3GWDA 4Y4NA 2VOUA 4U8IA 1H86A 1FOHA 4K5RA 3AWIA 3RP6A 2V3BA 1CL0A 1DJQA 3NTAA 1MOKA 4NZHA 5FS7A 4B68A 2VRMA 3BI2A 3FPZA 1DOBA 1Y56A 1H84A 3NK1X 3AD9B 1Q1RA 3DK4A 2R9ZA 2GMHA 1NAAA 1ONFA 3D1CA 1TRBA 3C96A 2WU5A 4AT0A 3PS9A 1TDNA 2A8XA 2WOWA 5IPYA 3PO7A 3H8IA 3NK0X 4J34A 4KX6A 1BKWA 1E1NA 2NPXA 4WX1A 3IHMA 1H6VA 1XPQA 3DA1A 4H4QA 1NEKA 3UKHA 2V61A 2DKHA 3SUCA 3UOYA 1LJ1A 5HXIA 1PJ7A 3B3RA 3I6DA 2C73A 2JAEA 1IUSA 3QSMA 2CDUA 3AEEA 2V60A 2YWLA 1L0VA 2EQ6A 2IVDA 1P2EA 4K2XA 1N4VA 1GOSA 1IUTA 5CQFA 4AP1A 1GRAA 2C65A 2GB0A 3NYEA 2B9WA 2BS3A 4LU6A 4APNA 2JB2A 3AE1A 2Y6QA 5EOWA 2DKIA 3AXBA 1EBDA 1ZMDA 2WDRA 1Y56B 2YG6A 2WESA 3UTFA 4ZCDA 4I59A 4TM0A 3SQPA 2X8HA 2XFPA 2ZZ0A 4LA1A 5KXJA 5U1OA 4NTEA 2VQ7A 2R4EA 5DBJA 1XHCA 3VR9A 3COXA 3GRTA 4BJZA 4Z2TA 2QAEA 4GR1A 5HY5A 2E5VA 3P1WA 1VG9A 3IWAA 2ZZCA 2OA1A 3F8DA 1RP0A 1B4VA 3UP4A 2FJBA 2XLRA 2GAGB 5FMHA 1LTXR 2XLSA 3CN8A 5EB5A 2PHHA 4Z2RA 4H4RA 2B76A 2NVKX 1DODA 3EPTA 4GCMA 5BRTA 2BS4A 4YSHA 2BC0A 4IA6A 1L9DA 1RSGA 3R9UA 1JRZA 3GD3A 5ER0A 3H4KA 2R45A 4U8PA 3NGCX 1GERA 1JU2A 1VG0A 2WP6A 4NTCA 3EF6A 1CC2A 3ISHA 1ZMCA 2GMJA 1DOEA 3BHKA 3UKKA 4EQWA 1GETA 4TM4A 5JCMA 2YLTA 4YSZA 1L9EA 2BS2A 2B9YA 2C75A 2WHDA 3AE8A 3DK8A 3LB8A 4GF7A 4C74A 4EQXA 4DGKA 3GQKA 1QLBA 1BF3A 5KVIA 4PABA 3AE7A 1TDKA 2X3NA 2HQMA 3ICSA 3JSKA 1F8WA 1YKJA 4H4ZA 4E0VA 5J60A 1M64A 3LZWA 4H4YA 1EL5A 3UTGA 1GRGA 1LPFA 1S2QA 1NG4A 2GQWA 4B64A 2XVEA 4JN9A 3UKAA 5JCIA 1NHSA 1IUUA 3GDNA 2XYOA 1CJCA 2IVEA 4OPUA 2XLTA 1W4XA 4U8LA 3ALJA 2Q0KA 4H50A 2VVLG 3QVPA 1JRYA 3AE6A 2V3AA 2C70A 4USQA 1TYPA 2RABA 3CNPA 2R0CA 1OJDA 1D4CA 3DK9A 2GR3A 3NTDA 3UCLA 2GEWA 2QCUA 4J33A 2EQ9A 1ZY8A 1FEBA 1IUVA 1ZKQA 1EL9A 2YVGA 4CCRA 1X31B 3AECA 1H82A 4IV9A 2WPCA 2FBWA 2GVCA 4H4TA 1ZOVA 3VQRA 3P4RA 4BURA 3ABVA 5J7XA 3KLJA 2OLOA 3ZYXA 4OPTA 3GDPA 2XVJA 4H4PA 3FMWA 3UKPA 1DOCA 4K5SA 2E1MA 3NNEA 1FL2A 1JNZA 1GTEA 1BGNA 3BNMA 4DSHA 1PJ5A 2XFOA 1GRFA 2A89A 4AT2A 1KNPA 3AE2A 5CKUA 3QFBA 5C2TA 2JB1A 1QO8A 3ATQA 3FBSA 3BNUA 4P9SA 5JCNA 1GEUA 4TM3A 2XLUA 4U8OA 2H88A 4YSXA 2CULA 2RGJA 4EM4A 2BCGG 2BK3A 4RG3A 4JNAA 4AOSA 1O95A 1E39A 2GRTA 4HB9A 1ZOYA 1ZX9A 4B67A 1E6EA 4B63A 3C4NA 1JOAA 2XFQA 1XANA 3G5QA 4JQ9A 1JRXA 1EL8A 1F6MA 3CNDA 3OZ2A 4U2LA 3DJGX 2XLPA 3CGCA 4Z43A 3NH3X 3AEFA 3AEDA 3ICTA 3ZDNA 3UKQA 1Y0PA 3IC9A 4CBQA 3Q6JA 1ZP0A 1SEZA 2B7SA 2OALA 2XFUA 3NG7X 4H2NA 3CNJA 1AOGA 2AR8A 1NHPA 2XFNA 1O5WA 2WDVA 1H7XA 3SGLA 1KDGA 2YQUA 3KD9A 3DGZA 1REOA 4H4SA 3M13A 1O94A 4DSGA 2EQ7A 4Z2UA 2GAHB 4A65A 1PBFA 4XXGA 4EQSA 1GALA 2BK5A 2LFCA 3NT6A 3ALLA 2ARDA 4HA6A 3GQHA 4RG4A 2X8GA 2VQBA 1GTHA 4D04A 2YLWA 2JKCA 1P2HA 2VVLA 4C3XA 2O9ZA 1PS9A 2XDOA 2YVFA 4Y4LA 3RP7A 3HZLA 1GXFA 1XDIA 1H7WA 1TDFA 4EMJA 1GSNA 4U8KA 2GF3A 2YLZA 1L9CA 1KFYA 3NKSA 2WPEA 4EIPA 4ECHA 3GYXA 4YSYA 4Z25A 4B66A 4BJYA 1M6IA 2X99A 3AD7B 4J57A 1V59A 5HYMA 4YWOA 2RGHA 1E1MA 4CNKA 1MO9A 4K7ZA 1PXCA 4OPGA 4IVMB 4YTMA 4M52A 2C72A 3P9UA 4AOXA 1H81A 4GDEA 4J36A 2IIDA 3UOZA 1UKVG 1IUXA 1GRTA 1PBBA 2OAMA 3UOVA 4CRTA 1GNDA 1PHHA 2CFYA 3KKJA 4GRTA 3UTEA 5KRQA 5GRTA 2YR5A 4EMWA 2OLNA 3T37A 1B8SA 4A79A 2Z5XA 3NK2X 2VRLA 4XWZA 3ADAB 3RHAA 2A87A 2R46A 3NRNA 2YG3A 4JDRA 4GUVA 4YKFA 5U63A 1QJDA 4EM3A 1LQTA 3AD8B 3LXDA 1PBCA 1Q9IA 4Z26A 1E7PA 4UP3A 4H4VA 2WOVA 5EB4A 1YQ4A 2GH5A 1N1PA 3AYLA 2PYXA 4TLXA 5FS9A 1F8RA 5U25A 4EQRA 5KOWA 4NEWA 1CC6A 1KNRA 2V6OA 1K4QA 4O5UA 3V3NA 3M12A 4GDPA 3LJPA 3URHA 1PBEA 4TM1A 1D7YA 4AP3A 1CJ4A 4JY3A 1GREA 3D8XA 1KSSA 4K22A 4CY6A 1OJAA 3DMEA 4H4UA 1YQZA 3GYJA 2GQFA 3VRBA 3AEBA 1ZDLA 3V3OA 4B69A 5JCLA 2Q0LA 2BA9A 2YG7A 3VRDB 3VR8A 3NYCA 3SFDA 3FG2P 5KOXA 1DJNA 1F3PA 4BV6A 1HYUA 1JEHA 1K0LA 1GESA 3AEAA 2BACA 2AQJA 3CNSA 3REDA 4A9WA 3Q9TA 5HHFA 4A7AA 5M10A 3CTYA 1TDEA 3KVEA 3PVCA 1PXAA 1BWCA 2C67A 3E1TA 1OJTA 2YM2A 3NN6X 3EANA 2WOIA 3BI5A 1PXBA 3QJ4A 1N4UA 1VRQB 2YM1A 2BC1A 3GD4A 5JCKA 4OCGA 4Y4MA 3C4AA 1IUWA 4C3YA 1CC4A 3NN0X 4FDCB 4Z44A 1ELIA 4H4WA 2GR2A 4OPCA 1LQUA 4CCQA 3K7MX 1CHUA 3KU9A 2WETA 4CNJA 2GR0A 3NIXA 3P4SA 1YQ3A 2AAQA 4UDQA 4ADWA 3UTHA 3II4A 4N9XA 2R4JA 4ZCCA 4C77A 5L46A 1D4DA 3LADA 4MJWA 3RNMA 2XVHA 1FCDA 2C7GA 2WP5A 2APGA 3V76A 2I0ZA 1NPXA 2C64A 2JK6A 2TPRA 4YTPA 2TMDA 3ATRA 3GWFA 3QSEA 2FJDA 1K0JA 2Q7VA 4H4XA 2BXRA 3GRSA 2WS3A 1CJ3A 4OPLA 4A6NA 3GMBA 4ZN0A 4BK2A 4JY2A 3S61A 3UKFA 3I3LA 2R0PA 3BI4A 3K30A 3AE4A 1DXLA 2C3DA 5KVHA 2WBAA 3O0HA 1FECA 2H89A 1OJCA 4UDPA 2WQYA 3UKLA 3K7TA 4X9NA 5IQ4A 1PBDA 5EBKA 3L8KA 4YTNA 3NHOX 4U8MA 3SFEA 2XVIA 3GMCA 5KWFA 2YLSA 1Q1WA 1VQWA 3QVRA 4Z24A 3AE9A 2BCPA 3F8RA 4REKA 2JB3A 2X8CA 1KSUA 2B7RA 1F8SA 3QSSA 4D03A 4K8DA 4KPRA 4FX9A 1LVLA 3RP8A 3H8LA 4U8JA 2YLRA 3S5WA 5GSNA 1B37A 2YG4A 3AB1A 5BVAA 3AE3A 1E1KA 3CPIG 4NTDA 3ITJA 2UZZA 3ALMA 3CNTA 4X9MA 1LV0A 2Y6RA 3EAOA 3KA7A 2ZBWA 4IA5A 2WEUA 3M0OA 4A6NB 4H2QA 3DGHA 1CJ2A 1GRBA 2YVJA 1GT8A 4X4JA 3VRAA 5C3JA 2X50A 5M0ZA 3CIRA 3G5SA 3FIMB 5FS6A 5LV9A 3CGDA 2BXSA 3IF9A 1TYTA 4JNQA 2C66A 4PAAA 3AEGA 4TLZA 5IQ1A 4O5QA 1MXTA 3DJEA 4A99A 4B1BA 1YY5A 2FJEA 2V5ZA 1BZLA 1FEAA 1GPEA 5FS8A 1ZK7A 2VZ2A 3UOXA 1EL7A 2YR4A 4WCTA 3GYIA 2VVMA 4FK1C 1H83A 2E4GA 5BULA 1DNCA 4C5OA 1CF3A 2BABA 2QA1A 3WE0A 2XVFA 2EQ8A 1Z6LA 2F5ZA 3ICRA 3P4PA 3KPFA 3LOVA 4OPDA 1N4WA 1D7LA 3G5RA 4ICYA 4BK3A 1D5TA 3CPHG 3NLCA 3AYIA 1NHQA 2YR6A 4OPIA 4H2PA 3AYJA 2WDQA 3CPJG 3F8PA 2C3CA 4LIIA 4YT0A 3UP5A 2WP9A 2Q6UA 2FJAA 1PDHA 1NHRA 3L1RA 2XCGA 3QFAA
chains in the Genus database with same CATH superfamily
4B65A 5JR9B 2HWC4 4JI2T 2WPFA 3FZHB 3DH9A 3LZXA 2YG5A 2WU2A 4HFDA 4EZHA 2NOXA 1B5QA 3DJJA 1VCSA 4DNAA 3NZQA 4YY3T 4U2TA 4O4JE 1AR94 3BHFA 4J2WA 1S94A 3ZMVB 4H2RA 4AKLA 5JDFA 3C4ZA 4FK1A 2R0GA 4IVOB 4U8NA 4U2SA 2BK4A 3SM8A 1K5MD 4EIQA 3KPKA 1D4EA 1OJ9A 2GV8A 5BUKA 5JTGA 1S3EA 2H7VC 2WB5A 5AQFB 1E1LA 4UVAB 4G73A 4UDRA 3JAFA 3ZMZB 1SHZC 2GR1A 3ZMUB 4DNDA 3DTOA 4U74A 2MBGA 1PN0A 4YXDA 2RGOA 4RSLA 4JI3T 4J56A 2WZHA 1VDCA 2WMOA 4ISTA 1MIWA 4ISSA 3GWDA 1OEDE 2WMNA 3AWIA 3NTAA 5FS7A 4NZHA 3MA9A 2VRMA 3IA3A 2WAUA 3KINB 2CHOA 1RUE4 1Q1RA 1ONFA 3D1CA 1TRBA 2CE7A 3EABA 1X9BA 2WCAA 3KBUA 1TDNA 3H8IA 4DR6T 5HAXA 1H6VA 3DA1A 2Y6XA 2PBIA 2KINB 2V61A 3ETUA 4GAPA 3CX8B 1PJ7A 5L3GB 3I6DA 3NRXA 3VHLA 4EEDA 2V60A 2IVDA 5AQNB 4IDZA 4PFPA 4UF0A 2V5DA 3ZCIA 1GRAA 2GB0A 3NYEA 2B9WA 1NAFA 4MFRA 3HKBE 3AE1A 2BKPA 2DKIA 3E08A 2J1DG 3AXBA 4Q4Y4 2RR14 5BMVE 3SRZA 1J1JA 2PG8A 2XFPA 3K1SA 3RKGA 5U1OA 5JQGE 1WYBA 2E5VA 1VG9A 3IWAA 2CM0A 4WNKA 4DR2T 2XLRA 4ZI3D 1E2AA 2GAGB 2WZIA 1MNDA 2PHHA 2W66A 1G8XA 2NVKX 1DODA 5LG4A 4YSHA 2VASA 3R9UA 3GD3A 3Q5DA 4HWDA 3A5XA 2WSSV 1GERA 3N9PA 1CC2A 3ISHA 3SZ0A 1DOEA 3CQGB 5KMQA 5JCMA 4DVDA 2BS2A 3LB8A 4KUMB 3J7Yq 1BF3A 1TDKA 3ICSA 3JSKA 3UU3A 1M64A 3LZWA 3P4WA 4H4YA 2XVEA 4HWFA 4HKAA 3PTRB 4JEHB 2VVSA 3N9QA 2X0LB 1BR2A 3ALJA 1YD8G 2Q0KA 1UX4A 2VVLG 4ZHQE 1WRDA 2M6IA 3QVPA 1JRYA 3QB5A 5AQQB 1UK5A 5HWYA 4J33A 2PW9A 1ZY8A 1ZKQA 1X31B 4PFOA 4IV9A 2J47A 2GVCA 3CWZB 5L4EA 3TLWA 4BURA 5J7XA 4IE4A 2LHNA 2VKOA 2CMRA 4CN4A 2OLOA 4HWIB 4II2A 1WFDA 4H4PA 5LG3A 3UKPA 1DOCA 2H3RA 3NNEA 3JADA 1BGNA 3FI7A 3B5MA 2A89A 5CKUA 3QFBA 2EX3A 5LB7B 3BQKA 3LBXA 3FBSA 5JCNA 4TM3A 4U8OA 2BCGG 1ZHCA 2BK3A 3ZC1A 2DNXA 2C5JA 1BR1A 5FYMA 3IEEA 3FBZA 3C4NA 1JOAA 4L0RA 5ABEA 3A7MA 3UTKA 5FY7A 1EL8A 3OZ2A 3IHRA 4Z43A 3ZDNA 1Y0PA 5CJ5A 3IC9A 2L9QA 3NG7X 4ILAA 5EK3A 4H2NA 4IDPA 2VB6A 2AR8A 2WDVA 5JRCB 3SGLA 2VKHA 3KD9A 4ILCA 5FY1A 1WCRA 5CA0E 4NUVA 5CFBA 1HG2A 3NZPA 2ZM2A 3RQUA 4ZS2A 1UGOA 4HA6A 5LHIB 2VVLA 4C3XA 4L5GA 3ZN0B 4OHFA 3OTOT 1MQTD 4C91A 2XDOA 2D5UA 4DO0A 1NCQD 1GXFA 3F2EA 2Y8DA 3OPCA 4YHHT 3KV9A 4YSYA 4UELA 3AD7B 2BKNA 1V59A 2RGHA 4EOZB 3CX6B 5KDMC 4KBMB 3ZYMA 4IVMB 4OPGA 4M52A 4AOXA 4U72A 4GDEA 2XPKA 1ZEEA 1GRTA 1PBBA 1HS7A 2XAQB 2CFYA 4JI4T 1E1HB 4G6GA 2CWOA 2YR5A 4EMWA 3ONXA 3NK2X 3UT5E 4XWZA 2CCQA 4QWNB 2BG9E 4JLEA 4ASKA 2YG3A 5HYAA 3FB2A 5HXEA 1BR4A 5JDGA 3LXDA 1KEYA 4H4VA 2WOVA 2CXDA 2GH5A 4EQRA 5U25A 4KHZF 1CC6A 4H9RC 2YINA 4O5UA 3M12A 2V5CA 3OKQA 3LJPA 4GDPA 3URHA 2IIUA 5AQPB 4TM1A 3S4UA 1D7YA 4AP3A 4JY3A 4LF9T 2HPLA 2F4VT 3V3OA 2CHNA 1ZDLA 5FXWA 4YJ2E 4LFAT 3VR8A 2VQFT 3VKHA 5FY0A 3F31A 1PO24 3ZYLA 4GOUA 1JEHA 2LLYA 5M10A 5H6RB 5HHFA 3KVEA 3PVCA 1W0BA 3ZT6A 1PXAA 1OJTA 1RUG4 3CQXC 1PO14 2DLRA 4HFEA 4OCGA 2V8SV 5HXCA 1S35A 1CC4A 4FDCB 3L39A 4OPCA 1CUNA 3K7MX 5IYZE 2QYWA 2JJ9A 3NIXA 3P4SA 4ADWA 2MTQA 4DV1T 3II4A 4N9XA 3ZJ2A 3SYIA 2YDQA 4ZCCA 4C77A 1D4DA 2BBHA 1IJ6A 4CXXA 1W9RA 3V76A 2TMDA 3UUNA 2FJDA 2CLYB 3HKCE 4GK5E 4X62T 4OPLA 4HFVA 4BK2A 4JY2A 3UKFA 2YU2A 4Z8XA 3AE4A 4OFZA 2UUCT 2WBAA 5ABFB 5EK4A 4X9NA 3P50A 3T2YA 4XZCA 4E7ZA 4DV4T 2XVIA 5KWFA 3C64A 3JC6D 5AQIB 1Q1WA 4Z24A 2R6GF 2BCPA 2LHRA 2YDRA 4H9SE 3F8RA 1D1CA 1F8SA 4UXNB 3DJBA 1EZ3A 4H9PC 1VBB4 4LF7T 4JUYA 4X1KE 1XI1A 3AE3A 3CPIG 1Y01A 1AL24 2YKSA 4H9QC 3TLUA 4X9MA 4CI3B 4QH5A 3D0TA 3KA7A 4DR1T 5LP6E 2ZBWA 4ZI2C 4OK0A 3N2GE 4X4JA 2IC6A 3HKEE 4OYKA 4HN9A 5C3JA 4O4HE 3A8YC 4DMVA 4UEMA 4PAAA 4TLZA 5JDMA 4B1BA 1MXTA 4A99A 5EZYE 2FJEA 3X1DA 2V5ZA 5FS8A 1GPEA 1ZK7A 2YR4A 4WCTA 2IHR1 2VVMA 4FK1C 5BULA 3UU6A 2EQ8A 3P4PA 2HN2A 4BK3A 2Q9QA 3AYIA 4BJMA 2PYLA 4H2PA 2WDQA 1U5PA 4YT0A 3UP5A 1FJGT 2Q6UA 2L8KA 4EYUA 4KP3C 1CBOA 3GSIA 4H7UA 1GV4A 3L8RA 1JNRA 2YLXA 4I58A 4BK1A 3CGEA 5IUXA 2XQ7A 4YFSA 2BYBA 4HTEA 2KWIB 4ZOLE 4QX7B 3CGBA 4QH4A 5FL1A 5LYJE 2E8IA 4NIQA 4AISA 4NEVA 5TR3A 3FHNA 2ACZA 3JCFA 3FXDB 3FZFB 2QA7A 1IJHA 4LMLA 4J2CA 1S3BA 2CVJA 3R6NA 4XWRA 3L3PA 4USRA 1KF6A 3PUWF 4A5LA 4IREA 4IIJE 2HH7A 3ONJA 4KMCA 4K5RA 1RHI4 1CL0A 1DJQA 1IBLT 4AQFA 3PUXF 3FPZA 1DOBA 4P09A 2GMHA 2EHOA 1NAAA 2LOSA 3C96A 3AXJA 2WU5A 4LF6T 4X5TA 3PS9A 2UUBT 2XQAA 3OYZA 2WOWA 3PJAA 3RX6A 1BKWA 5AQMB 3I0QA 3V5SA 4H4QA 2V1DB 1D1AA 2DKHA 3LK3B 3SUCA 3UOYA 1LJ1A 5HXIA 2BDEA 3I0OA 2JAEA 1IUSA 2JMHA 2CDUA 3AEEA 4AKRB 2YWLA 4XAXB 1L0VA 4UV9B 2VKDA 4K2XA 3PUQA 4LU6A 4DR5T 3UUBA 5LHGB 2Y6QA 2VK9A 4U2YA 1ZMDA 3QC9A 3UTFA 4ZCDA 5GONE 4RHV4 4TM0A 4JBWF 1XMQT 2X8HA 4PJJA 3MK7C 2WBLA 2R4EA 4HWHA 4TNVA 3COXA 3GRTA 2QAEA 3P1WA 2OA1A 3RRWA 1B4VA 2FJBA 4DV3T 1LVFA 2E9XA 1HNWT 3CN8A 5EB5A 2RS34 4Z2RA 4C90A 2KZ7B 2WWUA 2BC0A 3RI5A 3AAEB 3H4KA 3AVSA 3NGCX 4EIWA 3QK6A 3ESLA 4ZI7E 1JU2A 3CPZA 1VG0A 2WP6A 4IHJE 1ZMCA 3BHKA 3PUAA 4EQWA 2DHRA 4YSZA 1MMGA 1L9EA 4JI0T 2YLTA 5FMNA 2VL0A 3GQKA 1QLBA 4PABA 3T2ZA 4F6RC 4A56A 1YKJA 3SZCA 2CEAA 1GRGA 1LPFA 2QVAA 1S2QA 3ANWB 3CQCB 4II3A 4IDOA 1NHSA 3WAKA 4NWZA 2DCFA 3SOLA 2IVEA 5AQGB 4ZI3C 4U8LA 2XQ9A 4H50A 4IE0A 2ODUA 2PLV4 1TYPA 3CNPA 2R0CA 1OJDA 1D4CA 2GR3A 3NTDA 3UCLA 2QCUA 2HN1A 2D9DA 1H82A 3EHZA 2WPCA 3VQRA 4UR9A 3ZSTA 4PJMA 1R084 1O3XA 3KLJA 5FP3A 2D0TA 1YXRA 3C51A 4K5SA 1JNZA 1GTEA 3T1YT 1GRFA 3B13A 3GN5A 1DU2A 2UXDT 3ZEFB 1GEUA 1VRH4 2PY5A 1YKEB 2CULA 3EVYA 4Q4X4 2W67A 5JDLA 1E6EA 4NPPA 2KLQA 1JRXA 3CNDA 1F6MA 4U2ZA 2XLPA 3CGCA 3ETVA 4MHCA 4CBQA 3Q6JA 2CPTA 1XHZA 2BG9B 4QH1A 3PU8A 4QHOA 2OALA 4Z91A 1POV0 4HGAA 3QOFA 1H7XA 1KDGA 2YQUA 5ABGA 2LSYA 2YDSA 3W15B 4Z2UA 3M13A 3RC3A 4EQSA 1VBA4 3LBXB 2ARDA 2R044 3GQHA 3U78A 4RG4A 4GK0E 1GTHA 4D04A 1COV4 4DR7T 1P2HA 2LRLA 5L3FB 4Y4LA 3RP7A 2CRBA 1XDIA 2IDOB 1H7WA 3CMLA 4EMJA 1GSNA 4U8KA 1L9CA 3J8F4 4EIPA 2WPEA 4U7YA 4B66A 3SXIA 1M6IA 2X99A 1W09A 3IBPA 5HYMA 1HTJF 2KWHA 1MO9A 2RS14 3RH3A 2C72A 4GB34 3UOZA 4J36A 5LXTE 1UKVG 3I9YA 5FXVA 4AQYT 3UOVA 1RUH4 1RVF4 4UV8B 3CVRA 1VBE4 1PHHA 2KT9A 3UTEA 4EAHA 2UXXB 3IF8B 2OLNA 3T37A 2Z5XA 5LGNB 1U4QA 4KI0F 5U63A 4A98A 2KSRA 3AD8B 4LF4T 1PBCA 4Z26A 1E7PA 2FUPA 3O1IA 4TLXA 3N9NA 3ZJ1A 1K4QA 4M1PA 2V7JA 4K22A 1UUSA 4CY6A 3DMEA 4H4UA 3OYXA 1T8BA 5FVKA 2IW5B 2BA9A 2X9HA 3RLFF 2K3WA 3SFDA 5KOXA 5FKYA 3KFWX 4BV6A 2BACA 1GESA 3AEAA 4NXMT 1J5WA 1TDEA 3CTYA 1XNRT 3NN6X 3PE0A 5F3JA 2LKHA 3BI5A 2R7FA 2YM1A 1MIYA 2BC1A 3HYVA 5LJMA 4I4TE 1IUWA 4C3YA 3NN0X 4Z44A 4H9NC 1ELIA 2V6YA 2YEVC 1N33T 4I0UA 4QX8B 4NXNT 5HXSA 4CCQA 4CXYA 1CHUA 5HCMA 1HX8A 4AIUA 2GR0A 1YQ3A 2X9XA 3UTHA 4G74A 2IC9A 2YN6A 2ZLYA 2R4JA 4MJWA 3RNMA 2DL1A 5AQSB 2NW8A 2C7GA 3C4WA 2LOPA 3UUMA 1NPXA 2C64A 3TLTA 3QSEA 2BXRA 1N36T 3PDYA 4A6NA 2XQ3A 4ZN0A 3MJXA 2XAFB 3K30A 1DXLA 2C3DA 1WLXA 2XAHB 5KVHA 3PUGA 3O0HA 4B3TT 2X0YA 1AJ3A 3UKLA 2LJLA 2ZM0A 4AKIA 5IQ4A 4B3ST 2YK0A 3GMCA 4GKJT 4PK4A 1RUJ4 5JDQA 1KSUA 1ASJ4 4D03A 2L3LA 3CX7B 2XZEA 3KBTA 2R074 3H8LA 3PV0F 5E0OA 2Q9QC 2A9UA 2KMFA 3O1HA 3P7IA 5BVAA 2HWB4 2K48A 4NTDA 3ITJA 4KHPT 2UZZA 1LV0A 2R064 3M0OA 2RS54 4GAVA 4H2QA 1YKHB 1GT8A 5KMSA 2K9AA 2NWBA 3VRAA 1XMOT 2MAWA 3KDSE 4OX9T 5LV9A 2E5LT 3CGDA 4G2AA 2ZMAA 5IQ1A 2A2FX 3ZLIA 1YY5A 3NBXX 1FEAA 4LFBT 2LM2A 4IE6A 5LBQB 1H83A 2DI4A 4C5OA 2BABA 4L9IA 4WBOA 2X67A 2XVFA 4P0BA 4O4IE 2F5ZA 1T7SA 2D0UA 1D7LA 1N4WA 3G5RA 4ICYA 2YR6A 3AYJA 3ZSSA 2C3CA 4LIIA 3OJAA 2LSKA 2NP9A 5JH7E 3KV5A 4TN7B 2K5BB 1GRHA 2D2SA 2C0SA 4AQFC 2QA2A 4OVIA 1EV14 5LMNT 2BBJA 1NDAA 5L3DB 2EHOC 5LJNA 3K7QX 3VKGA 3K3OA 3C4XA 2UXBT 1K0IA 2YAUA 2PYJA 4CY8A 1HRI4 5L47A 1BGJA 1TDOA 3Q5WA 2RP4A 3SS1A 3FZMB 1NG3A 1XDOA 2C76A 2J3NA 3O1JA 1NENA 3B6DA 3KV4A 2V7KA 3QNUA 3DJDA 4YKGA 3IHGA 4YJ3E 4Y4NA 2VOUA 4U8IA 1H86A 4IL9A 3BI2A 1Y56A 1H84A 2OV9A 3NK1X 3AD9B 3DK4A 4AQGA 3ZT5A 5HWXA 2BRAA 3UUXB 4MLKA 4AT0A 3T8OA 2RM24 3NK0X 5F5WA 4KX6A 1E1NA 2G0UA 3K3QC 2NPXA 2E9XC 2W4XA 2KXPB 4QXCB 1XPQA 1RUC4 1NEKA 1LRZA 3AA0B 2W62A 2XAJB 3ZMTB 3QSMA 5KMPA 3ONLC 4AKHA 3LDQB 3AAAB 4AP1A 2LSJA 1Z8UA 2I6HA 2C65A 4APNA 2BS3A 3AB3B 2JB2A 5HEGA 1KK7A 5JVDE 3BQLA 5L3CB 3JAEA 2WDRA 2YG6A 2WESA 5AQTB 4X66T 1AR74 4I59A 3SQPA 4IT4A 2ZZ0A 3AXJB 5KXJA 4NTEA 2X9WA 1XHCA 3VR9A 4BJZA 4Z2TA 4GR1A 5HY5A 3F8DA 2H7OA 1RP0A 4B3MT 5FMHA 1LTXR 4QXHB 2XLSA 2RA1A 4TWFA 2HHHT 1D1BA 3RHWA 2VL8A 4PK5A 1D0ZA 4H63H 4H4RA 5TAOA 5BRTA 1NA1D 4IA6A 1L9DA 1RSGA 2VURA 4UVBB 2WY2A 2R45A 4U8PA 3PU3A 2OLTA 4X1YE 3EF6A 4HFIA 3UKKA 1GETA 4TM4A 2XM1A 2XSBA 2C75A 4C74A 4GF7A 3CMMA 3T14A 2P9BA 5JREA 2HQMA 2X3NA 2OA5A 4H4ZA 3AVRA 2XAGB 3I9WA 3ZT7A 5IWAT 3UTGA 3VU7H 2GQWA 5DJQC 4B64A 4X64T 1HNZT 5JCIA 4JEUB 5LGTB 1IUUA 3Q5EA 3R84B 2XYOA 1CJCA 2XLTA 2JQ9A 1LVKA 4ZEYA 2C70A 4F8HA 3N9OA 4UIGA 4WBNE 2GEWA 3GMIA 4U33A 4TV8E 1IUVA 2YVGA 5BR8T 1EL9A 3AECA 5LBMA 2ZM6T 3HI2A 4H4TA 3KVBA 4EV6A 4Q4V4 4OPTA 5LGUB 2X0HA 2XVJA 2C4CA 4JYAT 2LT3A 2QGSA 4CQIA 3BNMA 3ZN1B 1PJ5A 2NW7A 4HFHA 4AT2A 5ABFA 5C2TA 1HXS4 2JB1A 4QXBB 4P9SA 2XQ8A 3H37A 2XLUA 2RGJA 5C8YE 4FI5A 4RG3A 2MOZA 4AOSA 5AQOB 1E39A 4HB9A 4I50E 4O8SA 4B63A 5FL0A 1VRBA 2XFQA 4G9KA 3G5QA 4IE5A 3RYCE 3CKDA 3DP7A 3M3ZB 3FBLA 3NH3X 3AEFA 3AEDA 1BR0A 3ICTA 3K8PC 4A5XA 4G6HA 1SEZA 2B7SA 3CNJA 1NHPA 4Q25A 3NRYA 3OBVE 4PDWD 4TZ4C 4H4SA 4DSGA 3FXEB 4A65A 4XXGA 2CWYA 2LFCA 5LHHB 3NT6A 3ALLA 1D4M4 2X8GA 2YLWA 2JKCA 2O9ZA 3HR0A 1H7CA 1VOMA 4K0KT 1TDFA 5AFUL 2GF3A 2YLZA 1OOPD 1OEDA 5FXZA 3NKSA 4ECHA 4CI1B 4IL4A 4CN6A 2W61A 4BJYA 2YU1A 4IDQA 4CNKA 3PJAJ 3N2OA 4UF0B 3KVAA 3L09A 3MKDA 5HEHA 3U3IA 1PXCA 1OWAA 3P9UA 4ADZA 1Y64B 3CK6A 2HPJA 5DQWA 1IUXA 4CRTA 1WR0A 1VBC4 1GNDA 4DR4T 2QRXA 4GRTA 3FZKB 2CBJA 5GRTA 5KNLA 4DV5T 4A79A 1B8SA 3EAMA 2VRLA 5J2UE 3ADAB 1UX5A 2JIWA 2A87A 4JDRA 2JQQA 4YKFA 1UCUA 1QJDA 5AQVB 1LQTA 2W63A 4UP3A 5EB4A 4IGUA 1N1PA 3AYLA 5FS9A 5KOWA 4U7IA 4NEWA 1KNRA 2V6OA 4Q4W4 4DBRA 1LKXA 4EXTA 4TV9E 4DV7T 3AA6B 2WWVA 1SA0E 2BZBA 2V6XA 4DUYT 5JDNA 1GREA 1KSSA 3D8XA 4JI6T 2GQFA 5JCLA 2Q0LA 3E0ZA 3FG2P 4BAYB 5LA6E 2YOEA 4HWCA 4GYSA 1HYUA 4A9WA 3REDA 3Q9TA 4A7AA 2C67A 4PW8A 3E1TA 3UFGA 2NTXA 3NKZA 2WOIA 3QJ4A 1VRQB 4AI6A 2JRKA 5JCKA 2XQ5A 4Y4MA 4U3CA 3Q5XA 5LOVE 1AR64 2N2NA 5CGMA 1FEWA 3TLVA 3SWHA 2WM9A 4CNJA 4P1NA 2AAQA 5KMGP 3RGLA 3N9MA 5L46A 4DV6T 3MACA 1X79A 4HFCA 1FCDA 2WP5A 2XVHA 4ILBA 2JK6A 1IJ5A 3ATRA 3GWFA 4DV2T 1CJ3A 2ES0A 3O4XE 4P0AA 3S61A 1HCIA 4ERRA 4IE7A 3BI4A 2UXNB 1FECA 2X66A 1OJCA 3UQ4A 2WQYA 1HFAA 3K7TA 2V6YB 3L8KA 4YTNA 3NHOX 4U8MA 3SFEA 2YLSA 3QVRA 2RPAA 2IAKA 2M67A 3AE9A 3PURA 4REKA 1HF8A 3QSSA 2B7RA 5LMUT 2DWGA 3MZKB 3UULA 5KX5E 1RMU4 4HFBA 2YLRA 3S5WA 3SZFA 5GSNA 1B37A 3RC8A 4LF8T 4WZXA 3CNTA 4JI8T 1M7KA 1J5ET 3LK2B 1HR0T 3EAOA 4Z90A 4IA5A 3SZWA 1YW0A 4A6NB 1PVC4 2XASB 3FZLB 3AAIA 1GRBA 3PUZF 2PTFA 1WR6A 3Q9DA 2YVJA 2X50A 3CIRA 5JR9A 3ANWA 3NVOA 3IF9A 1H8TD 2XM2A 4JNQA 3AEGA 1Z7S4 4B6XA 4O5QA 1FMVA 4ZS3A 1BZLA 3UOXA 3GYIA 3J9X1 2Z6EA 2E4GA 4HEAA 2KNDA 4PJLA 3RIUC 1Z6LA 3ICRA 5L2LA 3KPFA 4OPDA 3B57A 4AKGA 1D5TA 3CPHG 4WW0A 1NHQA 4LMKA 5AQHB 3CPJG 4O2BE 3F8PA 4U31A 2FJAA 4TX5A 1PDHA 3L1RA 1HNXT 1MIVA 2JPFA 5JDHA 2MYSA 2W0HA 5HEOA 4LMJA 3ZPOA 4J31A 2NW9A 3NWIA 1XZYA 2V26A 2XUEA 4AXPA 3NYFA 5FNVE 1S2YA 2W2UA 1OXZA 3K3NA 2LEHA 2A3DA 2W0GA 3HL6A 2J62A 1D0XA 2UUAT 2ZZBA 3EUHA 4TNWA 2JBVA 2Z5YA 3UQ7A 3ZMSB 4EMIA 1HX1B 3OC4A 5J2TE 2B9XA 1COYA 3RQWA 1RUF4 1BEV4 2J4GA 4CXWA 1IZNB 3HKDE 4B3RT 2BG9A 3P4QA 1RYIA 1PJ6A 4PJNA 3AE5A 5HXHA 4JI7T 2JQHA 3C50A 2GK9A 1FOHA 3RP6A 2V3BA 1MOKA 4B68A 5AQLB 4LF5T 4DIDB 2PJQA 3PUVF 2R9ZA 2BVMA 2A8XA 4EYYR 4JI1T 5IPYA 2XSAA 3PO7A 4J34A 2N9DA 4WX1A 3RYHE 3IHMA 4TUYE 3UKHA 4JI5T 4HE8A 1R094 4PK6A 1I94T 3B3RA 4I55E 2C73A 2M6BA 2EQ6A 1MMAA 4DUZT 1P2EA 1N4VA 1GOSA 5HEJA 1IUTA 5CQFA 1W0AA 2XQ6A 4MBQA 5EOWA 3LFMA 3Q2MA 2XY8B 1EBDA 4XBFB 1M62A 1Y56B 2C5IT 4LA1A 2PFVA 1FIOA 3HYXA 2VQ7A 5DBJA 2ZZCA 3UP4A 2X51A 3ZKRA 4DBQA 3BQIA 2B76A 3P8CD 3EPTA 4GCMA 2BS4A 3PUYF 3JBG4 1JRZA 3T0KA 5ER0A 3JC6C 2CXFA 2BKOA 2XQ4A 2RMU4 1T72A 4NTCA 1MMDA 1XWMA 2GMJA 3PUSA 2JQKA 2WHDA 2B9YA 3DK8A 3AE8A 4EQXA 2CLYC 4DGKA 5CA1E 1MNEA 5KVIA 2B1EA 3AE7A 3EDVA 1F8WA 4EZ4A 4E0VA 5J60A 4CI2B 2V7MA 1G73A 1EL5A 4EB6E 1NG4A 4GIWA 4JN9A 3UKAA 5AQJB 3GDNA 4ZZBA 1UURA 4OPUA 1SUMB 3ZC0A 1W4XA 5AQKB 4N78D 3TKLB 2XTLA 3AE6A 3I1AA 2V3AA 2LKGA 4USQA 2RABA 5L4HA 5H6QB 3AA7B 4V1Av 3RIUA 3DK9A 5LCYA 1HG5A 4DMWA 2Q9QB 2EQ9A 1RUI4 1FEBA 4CCRA 3BK9A 2FBWA 2DWKA 1ZOVA 3P4RA 4PNIA 3ABVA 2AE9A 2CBIA 2IMLA 4ILUA 3HA4A 3ZYXA 3GDPA 4I43B 3FMWA 5JRCA 2E1MA 1FL2A 1WYCA 4DSHA 2XFOA 5FVLA 1ZV4X 1KNPA 2ZM8A 3AE2A 3RYIE 3C98B 3N5LA 1QO8A 3ATQA 4PAGA 2E2AA 4X1IE 3BNUA 4LFCT 2H88A 4YSXA 1PIV4 4EM4A 4COFA 2LSGA 3EI0A 4JNAA 1O95A 2Q9QD 2GRTA 1ZOYA 1ZX9A 4B67A 5J1GA 1OEDC 2UU9T 3RIFA 1XANA 2I59A 4JQ9A 4UVCB 4U2LA 1N32T 3DJGX 5LNKA 4FJOA 3UKQA 3EDUA 4OYJA 1ZP0A 3LJCA 2XFUA 5DQVA 3QUJA 1AOGA 2XFNA 1O5WA 4DR3T 2X68A 3DGZA 1REOA 1XNQT 1O94A 2EQ7A 3G06A 2GAHB 4DV0T 5IHYA 1R8IA 1PBFA 3QB5K 2BRYA 1GALA 2BK5A 2EHOB 2VQBA 2N1GA 2V7IA 1PS9A 2YVFA 3HZLA 4NUUA 1KFYA 4CN1A 3GYXA 4Z25A 4J57A 1NWMX 4YWOA 1E1MA 3RPUA 3SY4A 5ADXL 2CA5A 1V9DA 2AXDS 1D0YA 5F8PA 3HYWA 4K7ZA 2V7LA 4YTMA 3ZYKA 1IBMT 4YLHA 2MPKA 1H81A 2IIDA 3KV6A 1RUD4 2EHOD 2OAMA 1VCTA 4ZXLA 4WYVA 3KKJA 3JD74 3GA8A 5KRQA 5ETWA 5L3BB 3WAJA 2PZSA 3UU8A 3RHAA 2R46A 5HEUA 3NRNA 4GUVA 2LE8A 4EM3A 1OEDB 4K0UA 1Q9IA 2JMKA 1FMWA 2E9XB 5KMRA 1XDPA 1YQ4A 3H3MA 2PYXA 1F8RA 3M65A 5FXXA 3OVUA 4TWHA 5DABA 3V3NA 1IAPA 3RRCA 1QUUA 1PBEA 1CJ4A 5HCJA 3RF1A 1OJAA 3N2KE 1YQZA 3GYJA 3VRBA 3AEBA 1IBKT 4B69A 2YG7A 3VRDB 4BJNA 1I6ZA 4ZZCA 3NYCA 3LK42 1XHXA 2LSIA 5AQRB 2A72A 4O2AE 1DJNA 1F3PA 1QSDA 2LM9A 1K0LA 3CNSA 2ODVA 4CZZB 2AQJA 5EK2A 1BWCA 2YM2A 3E22E 3LSVA 2E9XD 3EANA 4ANJA 1PXBA 4G63A 1N4UA 2X9YA 3GD4A 3C4AA 1KNZA 4H4WA 3UU4A 5A1LA 1N34T 1GQEA 2GR2A 1LQUA 2XJ7A 3UU5A 4A97A 3KU9A 3V5UA 2WETA 3T2KA 4UDQA 2SPCA 1B7TA 1US7B 1VBD4 3AA1B 3LADA 4YHJA 2APGA 2BVLA 4ZI2D 2I0ZA 5M4YA 2TPRA 3SX6A 4YTPA 1K0JA 2Q7VA 4H4XA 3GRSA 4H63V 2WS3A 3GMBA 1HRV4 3N9LA 5JR9C 3I3LA 2R0PA 1SE7A 5J0ZA 2VKJA 1ZKEA 3RYFE 4X20E 5ABHA 3GN5B 2H89A 2XQYA 5CB4E 4UDPA 4GKKT 3RKOA 4IDNA 1PBDA 3RIAA 4GYRA 5EBKA 3MXZA 4O4LE 3H3AA 1VQWA 1MMNA 2VVNA 2JB3A 2X8CA 4H9OC 4K8DA 4E7SA 5HXRA 4FX9A 4KPRA 1LVLA 3RP8A 2NR4A 4EEBA 4EGWA 4U8JA 2YG4A 3AB1A 4JV5T 1E1KA 3GWHA 3ALMA 4QKNA 2ACXA 2Y6RA 3ZCJA 2WEUA 1EAH4 3DGHA 1CJ2A 1AR84 3O9XA 4MALA 5M0ZA 3G5SA 2Y48B 4TWDA 3FIMB 5FS6A 2W00A 2X5ID 3WI3A 2BXSA 1TYTA 2C5KT 2C66A 3UFEA 4X65T 2VWAA 3DJEA 3F57A 5L3EB 2VQET 2VZ2A 1EL7A 3TLSA 2NTYA 2UXCT 5AQUB 1DNCA 1CF3A 2QA1A 3WE0A 3LG7A 3T1HT 3T31A 2LRKA 4BA9A 3LOVA 2XHEB 2CXLA 1T98A 3NLCA 2IUBA 4OPIA 1Z0PA 2I0MA 4NNJA 2BG9C 2WP9A 1NHRA 2K24A 2XCGA 3QFAA
chains in the Genus database with same CATH topology
1CBOA 2W0HA 3GSIA 4B65A 4H7UA 1GRHA 2WPFA 1GV4A 3DH9A 3LZXA 4J31A 2QA2A 2YG5A 2WU2A 4OVIA 1JNRA 1NDAA 1B5QA 3DJJA 2YLXA 4I58A 4DNAA 4BK1A 3CGEA 3NYFA 4U2TA 2BYBA 3BHFA 1S2YA 4J2WA 3K7QX 4H2RA 3CGBA 2ZZBA 4FK1A 2JBVA 2R0GA 2Z5YA 4IVOB 4U8NA 4U2SA 2BK4A 1K0IA 3SM8A 2YAUA 4EIQA 3KPKA 1D4EA 1OJ9A 4EMIA 3OC4A 2GV8A 5BUKA 4CY8A 2B9XA 4NEVA 1COYA 5TR3A 2ACZA 1S3EA 1BGJA 1TDOA 1IJHA 2CVJA 1E1LA 1S3BA 4G73A 4UDRA 1NG3A 4XWRA 2C76A 2GR1A 2J3NA 1NENA 4USRA 3P4QA 3B6DA 1RYIA 1PN0A 1PJ6A 1KF6A 4YXDA 3DJDA 4YKGA 2RGOA 4A5LA 4RSLA 3IHGA 4J56A 1VDCA 3AE5A 3GWDA 4Y4NA 2VOUA 4U8IA 1H86A 1FOHA 4K5RA 3AWIA 3RP6A 2V3BA 1CL0A 1DJQA 3NTAA 1MOKA 4NZHA 5FS7A 4B68A 2VRMA 3BI2A 3FPZA 1DOBA 1Y56A 1H84A 3NK1X 3AD9B 1Q1RA 3DK4A 2R9ZA 2GMHA 1NAAA 1ONFA 3D1CA 1TRBA 3C96A 2BRAA 2WU5A 4AT0A 3PS9A 1TDNA 2A8XA 2WOWA 5IPYA 3PO7A 3H8IA 3NK0X 4J34A 4KX6A 1BKWA 1E1NA 2NPXA 4WX1A 3IHMA 1H6VA 1XPQA 3DA1A 4H4QA 1NEKA 3UKHA 2V61A 2DKHA 3SUCA 4GAPA 3UOYA 1LJ1A 5HXIA 1PJ7A 3B3RA 3I6DA 2C73A 2JAEA 1IUSA 3QSMA 5KMPA 2CDUA 3AEEA 2V60A 2YWLA 1L0VA 2EQ6A 2IVDA 1P2EA 4K2XA 1N4VA 1GOSA 1IUTA 5CQFA 4AP1A 1GRAA 2C65A 2GB0A 3NYEA 2B9WA 2BS3A 4LU6A 4APNA 2JB2A 3AE1A 2Y6QA 5EOWA 2DKIA 3AXBA 1EBDA 1ZMDA 2WDRA 1Y56B 2YG6A 2WESA 3UTFA 4ZCDA 4I59A 4TM0A 3SQPA 2X8HA 2XFPA 2ZZ0A 4LA1A 5KXJA 3HYXA 5U1OA 4NTEA 2VQ7A 2R4EA 5DBJA 1XHCA 3VR9A 3COXA 3GRTA 4BJZA 4Z2TA 2QAEA 4GR1A 5HY5A 2E5VA 3P1WA 1VG9A 3IWAA 2ZZCA 2OA1A 3F8DA 1RP0A 1B4VA 3UP4A 2FJBA 2XLRA 2GAGB 5FMHA 1LTXR 2XLSA 3CN8A 5EB5A 2PHHA 4Z2RA 4H4RA 2B76A 2NVKX 1DODA 3EPTA 4GCMA 5BRTA 2BS4A 4YSHA 2BC0A 4IA6A 1L9DA 1RSGA 3R9UA 1JRZA 3GD3A 3T0KA 5ER0A 3H4KA 2R45A 4U8PA 3NGCX 1GERA 1JU2A 1VG0A 2WP6A 4NTCA 3EF6A 1CC2A 3ISHA 1ZMCA 2GMJA 3SZ0A 1DOEA 3BHKA 3UKKA 4EQWA 1GETA 4TM4A 5KMQA 5JCMA 2YLTA 4YSZA 1L9EA 2BS2A 2B9YA 2C75A 2WHDA 3AE8A 3DK8A 3LB8A 4GF7A 4C74A 4EQXA 4DGKA 3CMMA 3GQKA 1QLBA 1BF3A 5KVIA 4PABA 3T14A 3AE7A 1TDKA 2X3NA 2HQMA 3ICSA 3JSKA 1F8WA 1YKJA 3T2ZA 4H4ZA 4E0VA 5J60A 1M64A 3LZWA 3SZCA 4H4YA 1EL5A 3UTGA 1GRGA 1LPFA 1S2QA 1NG4A 2GQWA 4B64A 2XVEA 4II3A 4JN9A 3UKAA 5JCIA 1NHSA 1IUUA 3GDNA 4NWZA 2XYOA 1CJCA 2IVEA 4OPUA 2XLTA 1W4XA 4U8LA 3ALJA 2Q0KA 4H50A 2VVLG 3QVPA 1JRYA 3AE6A 2V3AA 2C70A 4USQA 1TYPA 2RABA 3CNPA 2R0CA 1OJDA 1D4CA 3DK9A 2GR3A 3NTDA 3UCLA 2GEWA 2QCUA 4J33A 2EQ9A 1ZY8A 1FEBA 1IUVA 1ZKQA 1EL9A 2YVGA 4CCRA 1X31B 3AECA 1H82A 4IV9A 2WPCA 2FBWA 2GVCA 4H4TA 1ZOVA 3VQRA 3P4RA 4BURA 3ABVA 5J7XA 3KLJA 2OLOA 3ZYXA 4II2A 4OPTA 3GDPA 2XVJA 4H4PA 3FMWA 2C4CA 3UKPA 1DOCA 4K5SA 2E1MA 3NNEA 1FL2A 1JNZA 1GTEA 1BGNA 3BNMA 4DSHA 1PJ5A 2XFOA 1GRFA 2A89A 4AT2A 1KNPA 3AE2A 5CKUA 3QFBA 5C2TA 2JB1A 1QO8A 3ATQA 3FBSA 3BNUA 4P9SA 5JCNA 1GEUA 4TM3A 2XLUA 4U8OA 2H88A 4YSXA 2CULA 2RGJA 4EM4A 2BCGG 2BK3A 4RG3A 4JNAA 4AOSA 1O95A 1E39A 2GRTA 4HB9A 1ZOYA 1ZX9A 4B67A 1E6EA 4B63A 3C4NA 1JOAA 2XFQA 4G9KA 1XANA 3G5QA 4JQ9A 1JRXA 1EL8A 1F6MA 3CNDA 3OZ2A 4U2LA 3DJGX 2XLPA 3CGCA 4Z43A 3NH3X 3AEFA 3AEDA 3ICTA 3ZDNA 3UKQA 1Y0PA 3IC9A 4CBQA 3Q6JA 4G6HA 1ZP0A 1SEZA 2B7SA 2OALA 2XFUA 3NG7X 4H2NA 3CNJA 1AOGA 2AR8A 1NHPA 2XFNA 1O5WA 2WDVA 1H7XA 3SGLA 1KDGA 2YQUA 3KD9A 3DGZA 1REOA 4H4SA 3M13A 1O94A 4DSGA 2EQ7A 4Z2UA 2GAHB 4A65A 1PBFA 4XXGA 4EQSA 2BRYA 1GALA 2BK5A 2LFCA 3NT6A 3ALLA 2ARDA 4HA6A 3GQHA 4RG4A 2X8GA 2VQBA 1GTHA 4D04A 2YLWA 2JKCA 1P2HA 2VVLA 4C3XA 2O9ZA 1PS9A 2XDOA 2YVFA 4Y4LA 3RP7A 3HZLA 1GXFA 1XDIA 1H7WA 1TDFA 4EMJA 1GSNA 4U8KA 2GF3A 2YLZA 1L9CA 1KFYA 3NKSA 2WPEA 4EIPA 4ECHA 3GYXA 4YSYA 4Z25A 4B66A 3SXIA 1M6IA 4BJYA 2X99A 3AD7B 4J57A 1V59A 5HYMA 4YWOA 2RGHA 1E1MA 3SY4A 4CNKA 1MO9A 3HYWA 4K7ZA 1PXCA 4OPGA 4IVMB 4YTMA 4M52A 2C72A 3P9UA 4AOXA 1H81A 4GDEA 4J36A 2IIDA 3UOZA 1UKVG 1IUXA 1GRTA 1PBBA 2OAMA 3UOVA 4CRTA 1GNDA 1PHHA 2CFYA 3KKJA 4GRTA 3UTEA 5KRQA 4G6GA 5GRTA 5KNLA 2YR5A 4EMWA 2OLNA 3T37A 1B8SA 4A79A 2Z5XA 3NK2X 2VRLA 4XWZA 3ADAB 3RHAA 2A87A 2R46A 3NRNA 2YG3A 4JDRA 4GUVA 4YKFA 5U63A 1QJDA 4EM3A 1LQTA 3AD8B 3LXDA 1PBCA 1Q9IA 4Z26A 1E7PA 4UP3A 4H4VA 2WOVA 5EB4A 5KMRA 1YQ4A 2GH5A 1N1PA 3AYLA 2PYXA 4TLXA 5FS9A 1F8RA 5U25A 4EQRA 5KOWA 4NEWA 1CC6A 1KNRA 2V6OA 1K4QA 4O5UA 3V3NA 3M12A 4GDPA 3LJPA 3URHA 1PBEA 4TM1A 1D7YA 4AP3A 1CJ4A 4JY3A 1GREA 3D8XA 1KSSA 4K22A 4CY6A 1OJAA 3DMEA 4H4UA 1YQZA 3GYJA 2GQFA 3VRBA 3AEBA 1ZDLA 3V3OA 4B69A 5JCLA 2Q0LA 2BA9A 2YG7A 3VRDB 3VR8A 3NYCA 3SFDA 3FG2P 5KOXA 1DJNA 1F3PA 4BV6A 1HYUA 1JEHA 1K0LA 1GESA 3AEAA 2BACA 2AQJA 3CNSA 3REDA 4A9WA 3Q9TA 5HHFA 4A7AA 5M10A 3CTYA 1TDEA 3KVEA 3PVCA 1PXAA 1BWCA 2C67A 3E1TA 1OJTA 2YM2A 3NN6X 3EANA 2WOIA 3BI5A 1PXBA 3QJ4A 1N4UA 1VRQB 2YM1A 2BC1A 3GD4A 5JCKA 3HYVA 4OCGA 4Y4MA 3C4AA 1IUWA 4C3YA 1CC4A 3NN0X 4FDCB 4Z44A 1ELIA 4H4WA 2GR2A 4OPCA 1LQUA 4CCQA 3K7MX 1CHUA 3KU9A 2WETA 4CNJA 2GR0A 3NIXA 3P4SA 1YQ3A 2AAQA 4UDQA 3T2KA 4ADWA 3UTHA 3II4A 4G74A 4N9XA 3SYIA 2R4JA 4ZCCA 4C77A 5L46A 1D4DA 3LADA 4MJWA 3RNMA 2XVHA 1FCDA 2C7GA 2WP5A 2APGA 3V76A 2I0ZA 1NPXA 2C64A 2JK6A 2TPRA 3SX6A 4YTPA 2TMDA 3ATRA 3GWFA 3QSEA 2FJDA 1K0JA 2Q7VA 4H4XA 2BXRA 3GRSA 2WS3A 1CJ3A 4OPLA 4A6NA 3GMBA 4ZN0A 4BK2A 4JY2A 3S61A 3UKFA 3I3LA 2R0PA 3BI4A 3K30A 3AE4A 1DXLA 2C3DA 5KVHA 2WBAA 3O0HA 1FECA 2H89A 1OJCA 4UDPA 2WQYA 3UKLA 3K7TA 4X9NA 3T2YA 5IQ4A 1PBDA 5EBKA 3L8KA 4YTNA 3NHOX 4U8MA 3SFEA 2XVIA 3GMCA 5KWFA 2YLSA 1Q1WA 1VQWA 3QVRA 4Z24A 3AE9A 2BCPA 3F8RA 4REKA 2JB3A 2X8CA 1KSUA 2B7RA 1F8SA 3QSSA 4D03A 4K8DA 4KPRA 4FX9A 1LVLA 3RP8A 3H8LA 4U8JA 2YLRA 3S5WA 3SZFA 5GSNA 1B37A 2YG4A 3AB1A 5BVAA 3AE3A 1E1KA 3CPIG 4NTDA 3ITJA 2UZZA 3ALMA 3CNTA 4X9MA 1LV0A 2Y6RA 3EAOA 3KA7A 2ZBWA 4IA5A 3SZWA 2WEUA 3M0OA 4A6NB 4GAVA 4H2QA 3DGHA 1CJ2A 1GRBA 2YVJA 1GT8A 4X4JA 5KMSA 3VRAA 5C3JA 2X50A 5M0ZA 3CIRA 3G5SA 3FIMB 5FS6A 5LV9A 3CGDA 2BXSA 3IF9A 1TYTA 4JNQA 2C66A 4PAAA 3AEGA 4TLZA 5IQ1A 4O5QA 1MXTA 3DJEA 4A99A 4B1BA 1YY5A 2FJEA 2V5ZA 1BZLA 1FEAA 1GPEA 5FS8A 1ZK7A 2VZ2A 3UOXA 1EL7A 2YR4A 4WCTA 3GYIA 2VVMA 4FK1C 1H83A 2E4GA 5BULA 1DNCA 4C5OA 1CF3A 2BABA 2QA1A 3WE0A 2XVFA 3T31A 2EQ8A 1Z6LA 2F5ZA 3ICRA 3P4PA 3KPFA 3LOVA 4OPDA 1N4WA 1D7LA 3G5RA 4ICYA 4BK3A 1D5TA 3CPHG 3NLCA 3AYIA 1NHQA 2YR6A 4OPIA 4NNJA 4H2PA 3AYJA 2WDQA 3CPJG 3F8PA 2C3CA 4LIIA 4YT0A 3UP5A 2WP9A 2Q6UA 2FJAA 1PDHA 1NHRA 3L1RA 2XCGA 3QFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CBO A;  2W0H A;  3GSI A;  4B65 A;  4H7U A;  1GRH A;  2WPF A;  1GV4 A;  3DH9 A;  3LZX A;  4J31 A;  2QA2 A;  2YG5 A;  2WU2 A;  4OVI A;  1JNR A;  1NDA A;  1B5Q A;  3DJJ A;  2YLX A;  4I58 A;  4DNA A;  4BK1 A;  3CGE A;  3NYF A;  4U2T A;  2BYB A;  3BHF A;  1S2Y A;  4J2W A;  3K7Q X;  4H2R A;  3CGB A;  2ZZB A;  4FK1 A;  2JBV A;  2R0G A;  2Z5Y A;  4IVO B;  4U8N A;  4U2S A;  2BK4 A;  1K0I A;  3SM8 A;  2YAU A;  4EIQ A;  1D4E A;  1OJ9 A;  4EMI A;  3OC4 A;  2GV8 A;  5BUK A;  4CY8 A;  2B9X A;  4NEV A;  1COY A;  5TR3 A;  2ACZ A;  1S3E A;  1BGJ A;  1TDO A;  1IJH A;  2CVJ A;  1E1L A;  1S3B A;  4UDR A;  1NG3 A;  4XWR A;  2C76 A;  2GR1 A;  2J3N A;  1NEN A;  4USR A;  3P4Q A;  3B6D A;  1RYI A;  1PN0 A;  1PJ6 A;  1KF6 A;  4YXD A;  3DJD A;  4YKG A;  2RGO A;  4A5L A;  4RSL A;  3IHG A;  4J56 A;  1VDC A;  3AE5 A;  3GWD A;  4Y4N A;  2VOU A;  4U8I A;  1H86 A;  1FOH A;  4K5R A;  3AWI A;  3RP6 A;  2V3B A;  1CL0 A;  1DJQ A;  3NTA A;  1MOK A;  4NZH A;  5FS7 A;  4B68 A;  2VRM A;  3BI2 A;  3FPZ A;  1DOB A;  1Y56 A;  1H84 A;  3NK1 X;  3AD9 B;  1Q1R A;  3DK4 A;  2R9Z A;  2GMH A;  1NAA A;  1ONF A;  3D1C A;  1TRB A;  3C96 A;  2WU5 A;  4AT0 A;  3PS9 A;  1TDN A;  2A8X A;  2WOW A;  5IPY A;  3PO7 A;  3H8I A;  3NK0 X;  4J34 A;  4KX6 A;  1BKW A;  1E1N A;  2NPX A;  4WX1 A;  3IHM A;  1H6V A;  1XPQ A;  3DA1 A;  4H4Q A;  1NEK A;  3UKH A;  2V61 A;  2DKH A;  3SUC A;  3UOY A;  1LJ1 A;  5HXI A;  1PJ7 A;  3B3R A;  3I6D A;  2C73 A;  2JAE A;  1IUS A;  3QSM A;  2CDU A;  3AEE A;  2V60 A;  2YWL A;  1L0V A;  2EQ6 A;  2IVD A;  1P2E A;  4K2X A;  1N4V A;  1GOS A;  1IUT A;  5CQF A;  4AP1 A;  1GRA A;  2C65 A;  2GB0 A;  3NYE A;  2B9W A;  2BS3 A;  4LU6 A;  4APN A;  2JB2 A;  3AE1 A;  2Y6Q A;  5EOW A;  2DKI A;  3AXB A;  1EBD A;  1ZMD A;  2WDR A;  1Y56 B;  2YG6 A;  2WES A;  3UTF A;  4ZCD A;  4I59 A;  4TM0 A;  3SQP A;  2X8H A;  2XFP A;  2ZZ0 A;  4LA1 A;  5KXJ A;  5U1O A;  4NTE A;  2VQ7 A;  2R4E A;  5DBJ A;  1XHC A;  3VR9 A;  3COX A;  3GRT A;  4BJZ A;  4Z2T A;  2QAE A;  4GR1 A;  5HY5 A;  2E5V A;  3P1W A;  1VG9 A;  3IWA A;  2ZZC A;  2OA1 A;  3F8D A;  1RP0 A;  1B4V A;  3UP4 A;  2FJB A;  2XLR A;  2GAG B;  5FMH A;  1LTX R;  2XLS A;  3CN8 A;  5EB5 A;  2PHH A;  4Z2R A;  4H4R A;  2B76 A;  2NVK X;  1DOD A;  3EPT A;  4GCM A;  5BRT A;  2BS4 A;  4YSH A;  2BC0 A;  4IA6 A;  1L9D A;  1RSG A;  3R9U A;  1JRZ A;  3GD3 A;  5ER0 A;  3H4K A;  2R45 A;  4U8P A;  3NGC X;  1GER A;  1JU2 A;  1VG0 A;  2WP6 A;  4NTC A;  3EF6 A;  1CC2 A;  3ISH A;  1ZMC A;  2GMJ A;  1DOE A;  3BHK A;  3UKK A;  4EQW A;  1GET A;  4TM4 A;  5JCM A;  2YLT A;  4YSZ A;  1L9E A;  2BS2 A;  2B9Y A;  2C75 A;  2WHD A;  3AE8 A;  3DK8 A;  3LB8 A;  4GF7 A;  4C74 A;  4EQX A;  4DGK A;  3GQK A;  1QLB A;  1BF3 A;  5KVI A;  4PAB A;  3AE7 A;  1TDK A;  2X3N A;  2HQM A;  3ICS A;  3JSK A;  1F8W A;  1YKJ A;  4H4Z A;  4E0V A;  5J60 A;  1M64 A;  3LZW A;  4H4Y A;  1EL5 A;  3UTG A;  1GRG A;  1LPF A;  1S2Q A;  1NG4 A;  2GQW A;  4B64 A;  2XVE A;  4JN9 A;  3UKA A;  5JCI A;  1NHS A;  1IUU A;  3GDN A;  2XYO A;  1CJC A;  2IVE A;  4OPU A;  2XLT A;  1W4X A;  4U8L A;  3ALJ A;  2Q0K A;  4H50 A;  2VVL G;  3QVP A;  1JRY A;  3AE6 A;  2V3A A;  2C70 A;  4USQ A;  1TYP A;  2RAB A;  3CNP A;  2R0C A;  1OJD A;  1D4C A;  3DK9 A;  2GR3 A;  3NTD A;  3UCL A;  2GEW A;  2QCU A;  4J33 A;  2EQ9 A;  1ZY8 A;  1FEB A;  1IUV A;  1ZKQ A;  1EL9 A;  2YVG A;  4CCR A;  1X31 B;  3AEC A;  1H82 A;  4IV9 A;  2WPC A;  2FBW A;  2GVC A;  4H4T A;  1ZOV A;  3VQR A;  3P4R A;  4BUR A;  3ABV A;  5J7X A;  3KLJ A;  2OLO A;  3ZYX A;  4OPT A;  3GDP A;  2XVJ A;  4H4P A;  3FMW A;  3UKP A;  1DOC A;  4K5S A;  2E1M A;  3NNE A;  1FL2 A;  1JNZ A;  1GTE A;  1BGN A;  3BNM A;  4DSH A;  1PJ5 A;  2XFO A;  1GRF A;  2A89 A;  4AT2 A;  1KNP A;  3AE2 A;  5CKU A;  3QFB A;  5C2T A;  2JB1 A;  1QO8 A;  3ATQ A;  3FBS A;  3BNU A;  4P9S A;  5JCN A;  1GEU A;  4TM3 A;  2XLU A;  4U8O A;  2H88 A;  4YSX A;  2CUL A;  2RGJ A;  4EM4 A;  2BCG G;  2BK3 A;  4RG3 A;  4JNA A;  4AOS A;  1O95 A;  1E39 A;  2GRT A;  4HB9 A;  1ZOY A;  1ZX9 A;  4B67 A;  1E6E A;  4B63 A;  3C4N A;  1JOA A;  2XFQ A;  1XAN A;  3G5Q A;  4JQ9 A;  1JRX A;  1EL8 A;  1F6M A;  3CND A;  3OZ2 A;  4U2L A;  3DJG X;  2XLP A;  3CGC A;  4Z43 A;  3NH3 X;  3AEF A;  3AED A;  3ICT A;  3ZDN A;  3UKQ A;  1Y0P A;  3IC9 A;  4CBQ A;  3Q6J A;  1ZP0 A;  1SEZ A;  2B7S A;  2OAL A;  2XFU A;  3NG7 X;  4H2N A;  3CNJ A;  1AOG A;  2AR8 A;  1NHP A;  2XFN A;  1O5W A;  2WDV A;  1H7X A;  3SGL A;  1KDG A;  2YQU A;  3KD9 A;  3DGZ A;  1REO A;  4H4S A;  3M13 A;  1O94 A;  4DSG A;  2EQ7 A;  4Z2U A;  2GAH B;  4A65 A;  1PBF A;  4XXG A;  4EQS A;  1GAL A;  2BK5 A;  2LFC A;  3NT6 A;  3ALL A;  2ARD A;  4HA6 A;  3GQH A;  4RG4 A;  2X8G A;  2VQB A;  1GTH A;  4D04 A;  2YLW A;  2JKC A;  1P2H A;  2VVL A;  4C3X A;  2O9Z A;  1PS9 A;  2XDO A;  2YVF A;  4Y4L A;  3RP7 A;  3HZL A;  1GXF A;  1XDI A;  1H7W A;  1TDF A;  4EMJ A;  1GSN A;  4U8K A;  2GF3 A;  2YLZ A;  1L9C A;  1KFY A;  3NKS A;  2WPE A;  4EIP A;  4ECH A;  3GYX A;  4YSY A;  4Z25 A;  4B66 A;  4BJY A;  1M6I A;  2X99 A;  3AD7 B;  4J57 A;  1V59 A;  5HYM A;  4YWO A;  2RGH A;  1E1M A;  4CNK A;  1MO9 A;  4K7Z A;  1PXC A;  4OPG A;  4IVM B;  4YTM A;  4M52 A;  2C72 A;  3P9U A;  4AOX A;  1H81 A;  4GDE A;  4J36 A;  2IID A;  3UOZ A;  1UKV G;  1IUX A;  1GRT A;  1PBB A;  2OAM A;  3UOV A;  4CRT A;  1GND A;  1PHH A;  2CFY A;  3KKJ A;  4GRT A;  3UTE A;  5KRQ A;  5GRT A;  2YR5 A;  4EMW A;  2OLN A;  3T37 A;  1B8S A;  4A79 A;  2Z5X A;  3NK2 X;  2VRL A;  4XWZ A;  3ADA B;  3RHA A;  2A87 A;  2R46 A;  3NRN A;  2YG3 A;  4JDR A;  4GUV A;  4YKF A;  5U63 A;  1QJD A;  4EM3 A;  1LQT A;  3AD8 B;  3LXD A;  1PBC A;  1Q9I A;  4Z26 A;  1E7P A;  4UP3 A;  4H4V A;  2WOV A;  5EB4 A;  1YQ4 A;  2GH5 A;  1N1P A;  3AYL A;  2PYX A;  4TLX A;  5FS9 A;  1F8R A;  5U25 A;  4EQR A;  5KOW A;  4NEW A;  1CC6 A;  1KNR A;  2V6O A;  1K4Q A;  4O5U A;  3V3N A;  3M12 A;  4GDP A;  3LJP A;  3URH A;  1PBE A;  4TM1 A;  1D7Y A;  4AP3 A;  1CJ4 A;  4JY3 A;  1GRE A;  3D8X A;  1KSS A;  4K22 A;  4CY6 A;  1OJA A;  3DME A;  4H4U A;  1YQZ A;  3GYJ A;  2GQF A;  3VRB A;  3AEB A;  1ZDL A;  3V3O A;  4B69 A;  5JCL A;  2Q0L A;  2BA9 A;  2YG7 A;  3VRD B;  3VR8 A;  3NYC A;  3SFD A;  3FG2 P;  5KOX A;  1DJN A;  1F3P A;  4BV6 A;  1HYU A;  1JEH A;  1K0L A;  1GES A;  3AEA A;  2BAC A;  2AQJ A;  3CNS A;  3RED A;  4A9W A;  3Q9T A;  5HHF A;  4A7A A;  5M10 A;  3CTY A;  1TDE A;  3KVE A;  3PVC A;  1PXA A;  1BWC A;  2C67 A;  3E1T A;  1OJT A;  2YM2 A;  3NN6 X;  3EAN A;  2WOI A;  3BI5 A;  1PXB A;  3QJ4 A;  1N4U A;  1VRQ B;  2YM1 A;  2BC1 A;  3GD4 A;  5JCK A;  4OCG A;  4Y4M A;  3C4A A;  1IUW A;  4C3Y A;  1CC4 A;  3NN0 X;  4FDC B;  4Z44 A;  1ELI A;  4H4W A;  2GR2 A;  4OPC A;  1LQU A;  4CCQ A;  3K7M X;  1CHU A;  3KU9 A;  2WET A;  4CNJ A;  2GR0 A;  3NIX A;  3P4S A;  1YQ3 A;  2AAQ A;  4UDQ A;  4ADW A;  3UTH A;  3II4 A;  4N9X A;  2R4J A;  4ZCC A;  4C77 A;  5L46 A;  1D4D A;  3LAD A;  4MJW A;  3RNM A;  2XVH A;  1FCD A;  2C7G A;  2WP5 A;  2APG A;  3V76 A;  2I0Z A;  1NPX A;  2C64 A;  2JK6 A;  2TPR A;  4YTP A;  2TMD A;  3ATR A;  3GWF A;  3QSE A;  2FJD A;  1K0J A;  2Q7V A;  4H4X A;  2BXR A;  3GRS A;  2WS3 A;  1CJ3 A;  4OPL A;  4A6N A;  3GMB A;  4ZN0 A;  4BK2 A;  4JY2 A;  3S61 A;  3UKF A;  3I3L A;  2R0P A;  3BI4 A;  3K30 A;  3AE4 A;  1DXL A;  2C3D A;  5KVH A;  2WBA A;  3O0H A;  1FEC A;  2H89 A;  1OJC A;  4UDP A;  2WQY A;  3UKL A;  3K7T A;  4X9N A;  5IQ4 A;  1PBD A;  5EBK A;  3L8K A;  4YTN A;  3NHO X;  4U8M A;  3SFE A;  2XVI A;  3GMC A;  5KWF A;  2YLS A;  1Q1W A;  1VQW A;  3QVR A;  4Z24 A;  3AE9 A;  2BCP A;  3F8R A;  4REK A;  2JB3 A;  2X8C A;  1KSU A;  2B7R A;  1F8S A;  3QSS A;  4D03 A;  4K8D A;  4KPR A;  4FX9 A;  1LVL A;  3RP8 A;  3H8L A;  4U8J A;  2YLR A;  3S5W A;  5GSN A;  1B37 A;  2YG4 A;  3AB1 A;  5BVA A;  3AE3 A;  1E1K A;  3CPI G;  4NTD A;  3ITJ A;  2UZZ A;  3ALM A;  3CNT A;  4X9M A;  1LV0 A;  2Y6R A;  3EAO A;  3KA7 A;  2ZBW A;  4IA5 A;  2WEU A;  3M0O A;  4A6N B;  4H2Q A;  3DGH A;  1CJ2 A;  1GRB A;  2YVJ A;  1GT8 A;  4X4J A;  3VRA A;  5C3J A;  2X50 A;  5M0Z A;  3CIR A;  3G5S A;  3FIM B;  5FS6 A;  5LV9 A;  3CGD A;  2BXS A;  3IF9 A;  1TYT A;  4JNQ A;  2C66 A;  4PAA A;  3AEG A;  4TLZ A;  5IQ1 A;  4O5Q A;  1MXT A;  3DJE A;  4A99 A;  4B1B A;  1YY5 A;  2FJE A;  2V5Z A;  1BZL A;  1FEA A;  1GPE A;  5FS8 A;  1ZK7 A;  2VZ2 A;  3UOX A;  1EL7 A;  2YR4 A;  4WCT A;  3GYI A;  2VVM A;  4FK1 C;  1H83 A;  2E4G A;  5BUL A;  1DNC A;  4C5O A;  1CF3 A;  2BAB A;  2QA1 A;  3WE0 A;  2XVF A;  2EQ8 A;  1Z6L A;  2F5Z A;  3ICR A;  3P4P A;  3KPF A;  3LOV A;  4OPD A;  1N4W A;  1D7L A;  3G5R A;  4ICY A;  4BK3 A;  1D5T A;  3CPH G;  3NLC A;  3AYI A;  1NHQ A;  2YR6 A;  4OPI A;  4H2P A;  3AYJ A;  2WDQ A;  3CPJ G;  3F8P A;  2C3C A;  4LII A;  4YT0 A;  3UP5 A;  2WP9 A;  2Q6U A;  2FJA A;  1PDH A;  1NHR A;  3L1R A;  2XCG A;  3QFA A; 
#chains in the Genus database with same CATH topology
 4B65 A;  5JR9 B;  2HWC 4;  4JI2 T;  2WPF A;  3FZH B;  3DH9 A;  3LZX A;  2YG5 A;  2WU2 A;  4HFD A;  4EZH A;  2NOX A;  1B5Q A;  3DJJ A;  1VCS A;  4DNA A;  3NZQ A;  4YY3 T;  4U2T A;  4O4J E;  1AR9 4;  3BHF A;  4J2W A;  1S94 A;  3ZMV B;  4H2R A;  4AKL A;  5JDF A;  3C4Z A;  4FK1 A;  2R0G A;  4IVO B;  4U8N A;  4U2S A;  2BK4 A;  3SM8 A;  1K5M D;  4EIQ A;  3KPK A;  1D4E A;  1OJ9 A;  2GV8 A;  5BUK A;  5JTG A;  1S3E A;  2H7V C;  2WB5 A;  5AQF B;  1E1L A;  4UVA B;  4G73 A;  4UDR A;  3JAF A;  3ZMZ B;  1SHZ C;  2GR1 A;  3ZMU B;  4DND A;  3DTO A;  4U74 A;  2MBG A;  1PN0 A;  4YXD A;  2RGO A;  4RSL A;  4JI3 T;  4J56 A;  2WZH A;  1VDC A;  2WMO A;  4IST A;  1MIW A;  4ISS A;  3GWD A;  1OED E;  2WMN A;  3AWI A;  3NTA A;  5FS7 A;  4NZH A;  3MA9 A;  2VRM A;  3IA3 A;  2WAU A;  3KIN B;  2CHO A;  1RUE 4;  1Q1R A;  1ONF A;  3D1C A;  1TRB A;  2CE7 A;  3EAB A;  1X9B A;  2WCA A;  3KBU A;  1TDN A;  3H8I A;  4DR6 T;  5HAX A;  1H6V A;  3DA1 A;  2Y6X A;  2PBI A;  2KIN B;  2V61 A;  3ETU A;  4GAP A;  3CX8 B;  1PJ7 A;  5L3G B;  3I6D A;  3NRX A;  3VHL A;  4EED A;  2V60 A;  2IVD A;  5AQN B;  4IDZ A;  4PFP A;  4UF0 A;  2V5D A;  3ZCI A;  1GRA A;  2GB0 A;  3NYE A;  2B9W A;  1NAF A;  4MFR A;  3HKB E;  3AE1 A;  2BKP A;  2DKI A;  3E08 A;  2J1D G;  3AXB A;  4Q4Y 4;  2RR1 4;  5BMV E;  3SRZ A;  1J1J A;  2PG8 A;  2XFP A;  3K1S A;  3RKG A;  5U1O A;  5JQG E;  1WYB A;  2E5V A;  1VG9 A;  3IWA A;  2CM0 A;  4WNK A;  4DR2 T;  2XLR A;  4ZI3 D;  1E2A A;  2GAG B;  2WZI A;  1MND A;  2PHH A;  2W66 A;  1G8X A;  2NVK X;  1DOD A;  5LG4 A;  4YSH A;  2VAS A;  3R9U A;  3GD3 A;  3Q5D A;  4HWD A;  3A5X A;  2WSS V;  1GER A;  3N9P A;  1CC2 A;  3ISH A;  3SZ0 A;  1DOE A;  3CQG B;  5KMQ A;  5JCM A;  4DVD A;  2BS2 A;  3LB8 A;  4KUM B;  3J7Y q;  1BF3 A;  1TDK A;  3ICS A;  3JSK A;  3UU3 A;  1M64 A;  3LZW A;  3P4W A;  4H4Y A;  2XVE A;  4HWF A;  4HKA A;  3PTR B;  4JEH B;  2VVS A;  3N9Q A;  2X0L B;  1BR2 A;  3ALJ A;  1YD8 G;  2Q0K A;  1UX4 A;  2VVL G;  4ZHQ E;  1WRD A;  2M6I A;  3QVP A;  1JRY A;  3QB5 A;  5AQQ B;  1UK5 A;  5HWY A;  4J33 A;  2PW9 A;  1ZY8 A;  1ZKQ A;  1X31 B;  4PFO A;  4IV9 A;  2J47 A;  2GVC A;  3CWZ B;  5L4E A;  3TLW A;  4BUR A;  5J7X A;  4IE4 A;  2LHN A;  2VKO A;  2CMR A;  4CN4 A;  2OLO A;  4HWI B;  4II2 A;  1WFD A;  4H4P A;  5LG3 A;  3UKP A;  1DOC A;  2H3R A;  3NNE A;  3JAD A;  1BGN A;  3FI7 A;  3B5M A;  2A89 A;  5CKU A;  3QFB A;  2EX3 A;  5LB7 B;  3BQK A;  3LBX A;  3FBS A;  5JCN A;  4TM3 A;  4U8O A;  2BCG G;  1ZHC A;  2BK3 A;  3ZC1 A;  2DNX A;  2C5J A;  1BR1 A;  5FYM A;  3IEE A;  3FBZ A;  3C4N A;  1JOA A;  4L0R A;  5ABE A;  3A7M A;  3UTK A;  5FY7 A;  1EL8 A;  3OZ2 A;  3IHR A;  4Z43 A;  3ZDN A;  1Y0P A;  5CJ5 A;  3IC9 A;  2L9Q A;  3NG7 X;  4ILA A;  5EK3 A;  4H2N A;  4IDP A;  2VB6 A;  2AR8 A;  2WDV A;  5JRC B;  3SGL A;  2VKH A;  3KD9 A;  4ILC A;  5FY1 A;  1WCR A;  5CA0 E;  4NUV A;  5CFB A;  1HG2 A;  3NZP A;  2ZM2 A;  3RQU A;  4ZS2 A;  1UGO A;  4HA6 A;  5LHI B;  2VVL A;  4C3X A;  4L5G A;  3ZN0 B;  4OHF A;  3OTO T;  1MQT D;  4C91 A;  2XDO A;  2D5U A;  4DO0 A;  1NCQ D;  1GXF A;  3F2E A;  2Y8D A;  3OPC A;  4YHH T;  3KV9 A;  4YSY A;  4UEL A;  3AD7 B;  2BKN A;  1V59 A;  2RGH A;  4EOZ B;  3CX6 B;  5KDM C;  4KBM B;  3ZYM A;  4IVM B;  4OPG A;  4M52 A;  4AOX A;  4U72 A;  4GDE A;  2XPK A;  1ZEE A;  1GRT A;  1PBB A;  1HS7 A;  2XAQ B;  2CFY A;  4JI4 T;  1E1H B;  4G6G A;  2CWO A;  2YR5 A;  4EMW A;  3ONX A;  3NK2 X;  3UT5 E;  4XWZ A;  2CCQ A;  4QWN B;  2BG9 E;  4JLE A;  4ASK A;  2YG3 A;  5HYA A;  3FB2 A;  5HXE A;  1BR4 A;  5JDG A;  3LXD A;  1KEY A;  4H4V A;  2WOV A;  2CXD A;  2GH5 A;  4EQR A;  5U25 A;  4KHZ F;  1CC6 A;  4H9R C;  2YIN A;  4O5U A;  3M12 A;  2V5C A;  3OKQ A;  3LJP A;  4GDP A;  3URH A;  2IIU A;  5AQP B;  4TM1 A;  3S4U A;  1D7Y A;  4AP3 A;  4JY3 A;  4LF9 T;  2HPL A;  2F4V T;  3V3O A;  2CHN A;  1ZDL A;  5FXW A;  4YJ2 E;  4LFA T;  3VR8 A;  2VQF T;  3VKH A;  5FY0 A;  3F31 A;  1PO2 4;  3ZYL A;  4GOU A;  1JEH A;  2LLY A;  5M10 A;  5H6R B;  5HHF A;  3KVE A;  3PVC A;  1W0B A;  3ZT6 A;  1PXA A;  1OJT A;  1RUG 4;  3CQX C;  1PO1 4;  2DLR A;  4HFE A;  4OCG A;  2V8S V;  5HXC A;  1S35 A;  1CC4 A;  4FDC B;  3L39 A;  4OPC A;  1CUN A;  3K7M X;  5IYZ E;  2QYW A;  2JJ9 A;  3NIX A;  3P4S A;  4ADW A;  2MTQ A;  4DV1 T;  3II4 A;  4N9X A;  3ZJ2 A;  3SYI A;  2YDQ A;  4ZCC A;  4C77 A;  1D4D A;  2BBH A;  1IJ6 A;  4CXX A;  1W9R A;  3V76 A;  2TMD A;  3UUN A;  2FJD A;  2CLY B;  3HKC E;  4GK5 E;  4X62 T;  4OPL A;  4HFV A;  4BK2 A;  4JY2 A;  3UKF A;  2YU2 A;  4Z8X A;  3AE4 A;  4OFZ A;  2UUC T;  2WBA A;  5ABF B;  5EK4 A;  4X9N A;  3P50 A;  3T2Y A;  4XZC A;  4E7Z A;  4DV4 T;  2XVI A;  5KWF A;  3C64 A;  3JC6 D;  5AQI B;  1Q1W A;  4Z24 A;  2R6G F;  2BCP A;  2LHR A;  2YDR A;  4H9S E;  3F8R A;  1D1C A;  1F8S A;  4UXN B;  3DJB A;  1EZ3 A;  4H9P C;  1VBB 4;  4LF7 T;  4JUY A;  4X1K E;  1XI1 A;  3AE3 A;  3CPI G;  1Y01 A;  1AL2 4;  2YKS A;  4H9Q C;  3TLU A;  4X9M A;  4CI3 B;  4QH5 A;  3D0T A;  3KA7 A;  4DR1 T;  5LP6 E;  2ZBW A;  4ZI2 C;  4OK0 A;  3N2G E;  4X4J A;  2IC6 A;  3HKE E;  4OYK A;  4HN9 A;  5C3J A;  4O4H E;  3A8Y C;  4DMV A;  4UEM A;  4PAA A;  4TLZ A;  5JDM A;  4B1B A;  1MXT A;  4A99 A;  5EZY E;  2FJE A;  3X1D A;  2V5Z A;  5FS8 A;  1GPE A;  1ZK7 A;  2YR4 A;  4WCT A;  2IHR 1;  2VVM A;  4FK1 C;  5BUL A;  3UU6 A;  2EQ8 A;  3P4P A;  2HN2 A;  4BK3 A;  2Q9Q A;  3AYI A;  4BJM A;  2PYL A;  4H2P A;  2WDQ A;  1U5P A;  4YT0 A;  3UP5 A;  1FJG T;  2Q6U A;  2L8K A;  4EYU A;  4KP3 C;  1CBO A;  3GSI A;  4H7U A;  1GV4 A;  3L8R A;  1JNR A;  2YLX A;  4I58 A;  4BK1 A;  3CGE A;  5IUX A;  2XQ7 A;  4YFS A;  2BYB A;  4HTE A;  2KWI B;  4ZOL E;  4QX7 B;  3CGB A;  4QH4 A;  5FL1 A;  5LYJ E;  2E8I A;  4NIQ A;  4AIS A;  4NEV A;  5TR3 A;  3FHN A;  2ACZ A;  3JCF A;  3FXD B;  3FZF B;  2QA7 A;  1IJH A;  4LML A;  4J2C A;  1S3B A;  2CVJ A;  3R6N A;  4XWR A;  3L3P A;  4USR A;  1KF6 A;  3PUW F;  4A5L A;  4IRE A;  4IIJ E;  2HH7 A;  3ONJ A;  4KMC A;  4K5R A;  1RHI 4;  1CL0 A;  1DJQ A;  1IBL T;  4AQF A;  3PUX F;  3FPZ A;  1DOB A;  4P09 A;  2GMH A;  2EHO A;  1NAA A;  2LOS A;  3C96 A;  3AXJ A;  2WU5 A;  4LF6 T;  4X5T A;  3PS9 A;  2UUB T;  2XQA A;  3OYZ A;  2WOW A;  3PJA A;  3RX6 A;  1BKW A;  5AQM B;  3I0Q A;  3V5S A;  4H4Q A;  2V1D B;  1D1A A;  2DKH A;  3LK3 B;  3SUC A;  3UOY A;  1LJ1 A;  5HXI A;  2BDE A;  3I0O A;  2JAE A;  1IUS A;  2JMH A;  2CDU A;  3AEE A;  4AKR B;  2YWL A;  4XAX B;  1L0V A;  4UV9 B;  2VKD A;  4K2X A;  3PUQ A;  4LU6 A;  4DR5 T;  3UUB A;  5LHG B;  2Y6Q A;  2VK9 A;  4U2Y A;  1ZMD A;  3QC9 A;  3UTF A;  4ZCD A;  5GON E;  4RHV 4;  4TM0 A;  4JBW F;  1XMQ T;  2X8H A;  4PJJ A;  3MK7 C;  2WBL A;  2R4E A;  4HWH A;  4TNV A;  3COX A;  3GRT A;  2QAE A;  3P1W A;  2OA1 A;  3RRW A;  1B4V A;  2FJB A;  4DV3 T;  1LVF A;  2E9X A;  1HNW T;  3CN8 A;  5EB5 A;  2RS3 4;  4Z2R A;  4C90 A;  2KZ7 B;  2WWU A;  2BC0 A;  3RI5 A;  3AAE B;  3H4K A;  3AVS A;  3NGC X;  4EIW A;  3QK6 A;  3ESL A;  4ZI7 E;  1JU2 A;  3CPZ A;  1VG0 A;  2WP6 A;  4IHJ E;  1ZMC A;  3BHK A;  3PUA A;  4EQW A;  2DHR A;  4YSZ A;  1MMG A;  1L9E A;  4JI0 T;  2YLT A;  5FMN A;  2VL0 A;  3GQK A;  1QLB A;  4PAB A;  3T2Z A;  4F6R C;  4A56 A;  1YKJ A;  3SZC A;  2CEA A;  1GRG A;  1LPF A;  2QVA A;  1S2Q A;  3ANW B;  3CQC B;  4II3 A;  4IDO A;  1NHS A;  3WAK A;  4NWZ A;  2DCF A;  3SOL A;  2IVE A;  5AQG B;  4ZI3 C;  4U8L A;  2XQ9 A;  4H50 A;  4IE0 A;  2ODU A;  2PLV 4;  1TYP A;  3CNP A;  2R0C A;  1OJD A;  1D4C A;  2GR3 A;  3NTD A;  3UCL A;  2QCU A;  2HN1 A;  2D9D A;  1H82 A;  3EHZ A;  2WPC A;  3VQR A;  4UR9 A;  3ZST A;  4PJM A;  1R08 4;  1O3X A;  3KLJ A;  5FP3 A;  2D0T A;  1YXR A;  3C51 A;  4K5S A;  1JNZ A;  1GTE A;  3T1Y T;  1GRF A;  3B13 A;  3GN5 A;  1DU2 A;  2UXD T;  3ZEF B;  1GEU A;  1VRH 4;  2PY5 A;  1YKE B;  2CUL A;  3EVY A;  4Q4X 4;  2W67 A;  5JDL A;  1E6E A;  4NPP A;  2KLQ A;  1JRX A;  3CND A;  1F6M A;  4U2Z A;  2XLP A;  3CGC A;  3ETV A;  4MHC A;  4CBQ A;  3Q6J A;  2CPT A;  1XHZ A;  2BG9 B;  4QH1 A;  3PU8 A;  4QHO A;  2OAL A;  4Z91 A;  1POV 0;  4HGA A;  3QOF A;  1H7X A;  1KDG A;  2YQU A;  5ABG A;  2LSY A;  2YDS A;  3W15 B;  4Z2U A;  3M13 A;  3RC3 A;  4EQS A;  1VBA 4;  3LBX B;  2ARD A;  2R04 4;  3GQH A;  3U78 A;  4RG4 A;  4GK0 E;  1GTH A;  4D04 A;  1COV 4;  4DR7 T;  1P2H A;  2LRL A;  5L3F B;  4Y4L A;  3RP7 A;  2CRB A;  1XDI A;  2IDO B;  1H7W A;  3CML A;  4EMJ A;  1GSN A;  4U8K A;  1L9C A;  3J8F 4;  4EIP A;  2WPE A;  4U7Y A;  4B66 A;  3SXI A;  1M6I A;  2X99 A;  1W09 A;  3IBP A;  5HYM A;  1HTJ F;  2KWH A;  1MO9 A;  2RS1 4;  3RH3 A;  2C72 A;  4GB3 4;  3UOZ A;  4J36 A;  5LXT E;  1UKV G;  3I9Y A;  5FXV A;  4AQY T;  3UOV A;  1RUH 4;  1RVF 4;  4UV8 B;  3CVR A;  1VBE 4;  1PHH A;  2KT9 A;  3UTE A;  4EAH A;  2UXX B;  3IF8 B;  2OLN A;  3T37 A;  2Z5X A;  5LGN B;  1U4Q A;  4KI0 F;  5U63 A;  4A98 A;  2KSR A;  3AD8 B;  4LF4 T;  1PBC A;  4Z26 A;  1E7P A;  2FUP A;  3O1I A;  4TLX A;  3N9N A;  3ZJ1 A;  1K4Q A;  4M1P A;  2V7J A;  4K22 A;  1UUS A;  4CY6 A;  3DME A;  4H4U A;  3OYX A;  1T8B A;  5FVK A;  2IW5 B;  2BA9 A;  2X9H A;  3RLF F;  2K3W A;  3SFD A;  5KOX A;  5FKY A;  3KFW X;  4BV6 A;  2BAC A;  1GES A;  3AEA A;  4NXM T;  1J5W A;  1TDE A;  3CTY A;  1XNR T;  3NN6 X;  3PE0 A;  5F3J A;  2LKH A;  3BI5 A;  2R7F A;  2YM1 A;  1MIY A;  2BC1 A;  3HYV A;  5LJM A;  4I4T E;  1IUW A;  4C3Y A;  3NN0 X;  4Z44 A;  4H9N C;  1ELI A;  2V6Y A;  2YEV C;  1N33 T;  4I0U A;  4QX8 B;  4NXN T;  5HXS A;  4CCQ A;  4CXY A;  1CHU A;  5HCM A;  1HX8 A;  4AIU A;  2GR0 A;  1YQ3 A;  2X9X A;  3UTH A;  4G74 A;  2IC9 A;  2YN6 A;  2ZLY A;  2R4J A;  4MJW A;  3RNM A;  2DL1 A;  5AQS B;  2NW8 A;  2C7G A;  3C4W A;  2LOP A;  3UUM A;  1NPX A;  2C64 A;  3TLT A;  3QSE A;  2BXR A;  1N36 T;  3PDY A;  4A6N A;  2XQ3 A;  4ZN0 A;  3MJX A;  2XAF B;  3K30 A;  1DXL A;  2C3D A;  1WLX A;  2XAH B;  5KVH A;  3PUG A;  3O0H A;  4B3T T;  2X0Y A;  1AJ3 A;  3UKL A;  2LJL A;  2ZM0 A;  4AKI A;  5IQ4 A;  4B3S T;  2YK0 A;  3GMC A;  4GKJ T;  4PK4 A;  1RUJ 4;  5JDQ A;  1KSU A;  1ASJ 4;  4D03 A;  2L3L A;  3CX7 B;  2XZE A;  3KBT A;  2R07 4;  3H8L A;  3PV0 F;  5E0O A;  2Q9Q C;  2A9U A;  2KMF A;  3O1H A;  3P7I A;  5BVA A;  2HWB 4;  2K48 A;  4NTD A;  3ITJ A;  4KHP T;  2UZZ A;  1LV0 A;  2R06 4;  3M0O A;  2RS5 4;  4GAV A;  4H2Q A;  1YKH B;  1GT8 A;  5KMS A;  2K9A A;  2NWB A;  3VRA A;  1XMO T;  2MAW A;  3KDS E;  4OX9 T;  5LV9 A;  2E5L T;  3CGD A;  4G2A A;  2ZMA A;  5IQ1 A;  2A2F X;  3ZLI A;  1YY5 A;  3NBX X;  1FEA A;  4LFB T;  2LM2 A;  4IE6 A;  5LBQ B;  1H83 A;  2DI4 A;  4C5O A;  2BAB A;  4L9I A;  4WBO A;  2X67 A;  2XVF A;  4P0B A;  4O4I E;  2F5Z A;  1T7S A;  2D0U A;  1D7L A;  1N4W A;  3G5R A;  4ICY A;  2YR6 A;  3AYJ A;  3ZSS A;  2C3C A;  4LII A;  3OJA A;  2LSK A;  2NP9 A;  5JH7 E;  3KV5 A;  4TN7 B;  2K5B B;  1GRH A;  2D2S A;  2C0S A;  4AQF C;  2QA2 A;  4OVI A;  1EV1 4;  5LMN T;  2BBJ A;  1NDA A;  5L3D B;  2EHO C;  5LJN A;  3K7Q X;  3VKG A;  3K3O A;  3C4X A;  2UXB T;  1K0I A;  2YAU A;  2PYJ A;  4CY8 A;  1HRI 4;  5L47 A;  1BGJ A;  1TDO A;  3Q5W A;  2RP4 A;  3SS1 A;  3FZM B;  1NG3 A;  1XDO A;  2C76 A;  2J3N A;  3O1J A;  1NEN A;  3B6D A;  3KV4 A;  2V7K A;  3QNU A;  3DJD A;  4YKG A;  3IHG A;  4YJ3 E;  4Y4N A;  2VOU A;  4U8I A;  1H86 A;  4IL9 A;  3BI2 A;  1Y56 A;  1H84 A;  2OV9 A;  3NK1 X;  3AD9 B;  3DK4 A;  4AQG A;  3ZT5 A;  5HWX A;  2BRA A;  3UUX B;  4MLK A;  4AT0 A;  3T8O A;  2RM2 4;  3NK0 X;  5F5W A;  4KX6 A;  1E1N A;  2G0U A;  3K3Q C;  2NPX A;  2E9X C;  2W4X A;  2KXP B;  4QXC B;  1XPQ A;  1RUC 4;  1NEK A;  1LRZ A;  3AA0 B;  2W62 A;  2XAJ B;  3ZMT B;  3QSM A;  5KMP A;  3ONL C;  4AKH A;  3LDQ B;  3AAA B;  4AP1 A;  2LSJ A;  1Z8U A;  2I6H A;  2C65 A;  4APN A;  2BS3 A;  3AB3 B;  2JB2 A;  5HEG A;  1KK7 A;  5JVD E;  3BQL A;  5L3C B;  3JAE A;  2WDR A;  2YG6 A;  2WES A;  5AQT B;  4X66 T;  1AR7 4;  4I59 A;  3SQP A;  4IT4 A;  2ZZ0 A;  3AXJ B;  5KXJ A;  4NTE A;  2X9W A;  1XHC A;  3VR9 A;  4BJZ A;  4Z2T A;  4GR1 A;  5HY5 A;  3F8D A;  2H7O A;  1RP0 A;  4B3M T;  5FMH A;  1LTX R;  4QXH B;  2XLS A;  2RA1 A;  4TWF A;  2HHH T;  1D1B A;  3RHW A;  2VL8 A;  4PK5 A;  1D0Z A;  4H63 H;  4H4R A;  5TAO A;  5BRT A;  1NA1 D;  4IA6 A;  1L9D A;  1RSG A;  2VUR A;  4UVB B;  2WY2 A;  2R45 A;  4U8P A;  3PU3 A;  2OLT A;  4X1Y E;  3EF6 A;  4HFI A;  3UKK A;  1GET A;  4TM4 A;  2XM1 A;  2XSB A;  2C75 A;  4C74 A;  4GF7 A;  3CMM A;  3T14 A;  2P9B A;  5JRE A;  2HQM A;  2X3N A;  2OA5 A;  4H4Z A;  3AVR A;  2XAG B;  3I9W A;  3ZT7 A;  5IWA T;  3UTG A;  3VU7 H;  2GQW A;  5DJQ C;  4B64 A;  4X64 T;  1HNZ T;  5JCI A;  4JEU B;  5LGT B;  1IUU A;  3Q5E A;  3R84 B;  2XYO A;  1CJC A;  2XLT A;  2JQ9 A;  1LVK A;  4ZEY A;  2C70 A;  4F8H A;  3N9O A;  4UIG A;  4WBN E;  2GEW A;  3GMI A;  4U33 A;  4TV8 E;  1IUV A;  2YVG A;  5BR8 T;  1EL9 A;  3AEC A;  5LBM A;  2ZM6 T;  3HI2 A;  4H4T A;  3KVB A;  4EV6 A;  4Q4V 4;  4OPT A;  5LGU B;  2X0H A;  2XVJ A;  2C4C A;  4JYA T;  2LT3 A;  2QGS A;  4CQI A;  3BNM A;  3ZN1 B;  1PJ5 A;  2NW7 A;  4HFH A;  4AT2 A;  5ABF A;  5C2T A;  1HXS 4;  2JB1 A;  4QXB B;  4P9S A;  2XQ8 A;  3H37 A;  2XLU A;  2RGJ A;  5C8Y E;  4FI5 A;  4RG3 A;  2MOZ A;  4AOS A;  5AQO B;  1E39 A;  4HB9 A;  4I50 E;  4O8S A;  4B63 A;  5FL0 A;  1VRB A;  2XFQ A;  4G9K A;  3G5Q A;  4IE5 A;  3RYC E;  3CKD A;  3DP7 A;  3M3Z B;  3FBL A;  3NH3 X;  3AEF A;  3AED A;  1BR0 A;  3ICT A;  3K8P C;  4A5X A;  4G6H A;  1SEZ A;  2B7S A;  3CNJ A;  1NHP A;  4Q25 A;  3NRY A;  3OBV E;  4PDW D;  4TZ4 C;  4H4S A;  4DSG A;  3FXE B;  4A65 A;  4XXG A;  2CWY A;  2LFC A;  5LHH B;  3NT6 A;  3ALL A;  1D4M 4;  2X8G A;  2YLW A;  2JKC A;  2O9Z A;  3HR0 A;  1H7C A;  1VOM A;  4K0K T;  1TDF A;  5AFU L;  2GF3 A;  2YLZ A;  1OOP D;  1OED A;  5FXZ A;  3NKS A;  4ECH A;  4CI1 B;  4IL4 A;  4CN6 A;  2W61 A;  4BJY A;  2YU1 A;  4IDQ A;  4CNK A;  3PJA J;  3N2O A;  4UF0 B;  3KVA A;  3L09 A;  3MKD A;  5HEH A;  3U3I A;  1PXC A;  1OWA A;  3P9U A;  4ADZ A;  1Y64 B;  3CK6 A;  2HPJ A;  5DQW A;  1IUX A;  4CRT A;  1WR0 A;  1VBC 4;  1GND A;  4DR4 T;  2QRX A;  4GRT A;  3FZK B;  2CBJ A;  5GRT A;  5KNL A;  4DV5 T;  4A79 A;  1B8S A;  3EAM A;  2VRL A;  5J2U E;  3ADA B;  1UX5 A;  2JIW A;  2A87 A;  4JDR A;  2JQQ A;  4YKF A;  1UCU A;  1QJD A;  5AQV B;  1LQT A;  2W63 A;  4UP3 A;  5EB4 A;  4IGU A;  1N1P A;  3AYL A;  5FS9 A;  5KOW A;  4U7I A;  4NEW A;  1KNR A;  2V6O A;  4Q4W 4;  4DBR A;  1LKX A;  4EXT A;  4TV9 E;  4DV7 T;  3AA6 B;  2WWV A;  1SA0 E;  2BZB A;  2V6X A;  4DUY T;  5JDN A;  1GRE A;  1KSS A;  3D8X A;  4JI6 T;  2GQF A;  5JCL A;  2Q0L A;  3E0Z A;  3FG2 P;  4BAY B;  5LA6 E;  2YOE A;  4HWC A;  4GYS A;  1HYU A;  4A9W A;  3RED A;  3Q9T A;  4A7A A;  2C67 A;  4PW8 A;  3E1T A;  3UFG A;  2NTX A;  3NKZ A;  2WOI A;  3QJ4 A;  1VRQ B;  4AI6 A;  2JRK A;  5JCK A;  2XQ5 A;  4Y4M A;  4U3C A;  3Q5X A;  5LOV E;  1AR6 4;  2N2N A;  5CGM A;  1FEW A;  3TLV A;  3SWH A;  2WM9 A;  4CNJ A;  4P1N A;  2AAQ A;  5KMG P;  3RGL A;  3N9M A;  5L46 A;  4DV6 T;  3MAC A;  1X79 A;  4HFC A;  1FCD A;  2WP5 A;  2XVH A;  4ILB A;  2JK6 A;  1IJ5 A;  3ATR A;  3GWF A;  4DV2 T;  1CJ3 A;  2ES0 A;  3O4X E;  4P0A A;  3S61 A;  1HCI A;  4ERR A;  4IE7 A;  3BI4 A;  2UXN B;  1FEC A;  2X66 A;  1OJC A;  3UQ4 A;  2WQY A;  1HFA A;  3K7T A;  2V6Y B;  3L8K A;  4YTN A;  3NHO X;  4U8M A;  3SFE A;  2YLS A;  3QVR A;  2RPA A;  2IAK A;  2M67 A;  3AE9 A;  3PUR A;  4REK A;  1HF8 A;  3QSS A;  2B7R A;  5LMU T;  2DWG A;  3MZK B;  3UUL A;  5KX5 E;  1RMU 4;  4HFB A;  2YLR A;  3S5W A;  3SZF A;  5GSN A;  1B37 A;  3RC8 A;  4LF8 T;  4WZX A;  3CNT A;  4JI8 T;  1M7K A;  1J5E T;  3LK2 B;  1HR0 T;  3EAO A;  4Z90 A;  4IA5 A;  3SZW A;  1YW0 A;  4A6N B;  1PVC 4;  2XAS B;  3FZL B;  3AAI A;  1GRB A;  3PUZ F;  2PTF A;  1WR6 A;  3Q9D A;  2YVJ A;  2X50 A;  3CIR A;  5JR9 A;  3ANW A;  3NVO A;  3IF9 A;  1H8T D;  2XM2 A;  4JNQ A;  3AEG A;  1Z7S 4;  4B6X A;  4O5Q A;  1FMV A;  4ZS3 A;  1BZL A;  3UOX A;  3GYI A;  3J9X 1;  2Z6E A;  2E4G A;  4HEA A;  2KND A;  4PJL A;  3RIU C;  1Z6L A;  3ICR A;  5L2L A;  3KPF A;  4OPD A;  3B57 A;  4AKG A;  1D5T A;  3CPH G;  4WW0 A;  1NHQ A;  4LMK A;  5AQH B;  3CPJ G;  4O2B E;  3F8P A;  4U31 A;  2FJA A;  4TX5 A;  1PDH A;  3L1R A;  1HNX T;  1MIV A;  2JPF A;  5JDH A;  2MYS A;  2W0H A;  5HEO A;  4LMJ A;  3ZPO A;  4J31 A;  2NW9 A;  3NWI A;  1XZY A;  2V26 A;  2XUE A;  4AXP A;  3NYF A;  5FNV E;  1S2Y A;  2W2U A;  1OXZ A;  3K3N A;  2LEH A;  2A3D A;  2W0G A;  3HL6 A;  2J62 A;  1D0X A;  2UUA T;  2ZZB A;  3EUH A;  4TNW A;  2JBV A;  2Z5Y A;  3UQ7 A;  3ZMS B;  4EMI A;  1HX1 B;  3OC4 A;  5J2T E;  2B9X A;  1COY A;  3RQW A;  1RUF 4;  1BEV 4;  2J4G A;  4CXW A;  1IZN B;  3HKD E;  4B3R T;  2BG9 A;  3P4Q A;  1RYI A;  1PJ6 A;  4PJN A;  3AE5 A;  5HXH A;  4JI7 T;  2JQH A;  3C50 A;  2GK9 A;  1FOH A;  3RP6 A;  2V3B A;  1MOK A;  4B68 A;  5AQL B;  4LF5 T;  4DID B;  2PJQ A;  3PUV F;  2R9Z A;  2BVM A;  2A8X A;  4EYY R;  4JI1 T;  5IPY A;  2XSA A;  3PO7 A;  4J34 A;  2N9D A;  4WX1 A;  3RYH E;  3IHM A;  4TUY E;  3UKH A;  4JI5 T;  4HE8 A;  1R09 4;  4PK6 A;  1I94 T;  3B3R A;  4I55 E;  2C73 A;  2M6B A;  2EQ6 A;  1MMA A;  4DUZ T;  1P2E A;  1N4V A;  1GOS A;  5HEJ A;  1IUT A;  5CQF A;  1W0A A;  2XQ6 A;  4MBQ A;  5EOW A;  3LFM A;  3Q2M A;  2XY8 B;  1EBD A;  4XBF B;  1M62 A;  1Y56 B;  2C5I T;  4LA1 A;  2PFV A;  1FIO A;  3HYX A;  2VQ7 A;  5DBJ A;  2ZZC A;  3UP4 A;  2X51 A;  3ZKR A;  4DBQ A;  3BQI A;  2B76 A;  3P8C D;  3EPT A;  4GCM A;  2BS4 A;  3PUY F;  3JBG 4;  1JRZ A;  3T0K A;  5ER0 A;  3JC6 C;  2CXF A;  2BKO A;  2XQ4 A;  2RMU 4;  1T72 A;  4NTC A;  1MMD A;  1XWM A;  2GMJ A;  3PUS A;  2JQK A;  2WHD A;  2B9Y A;  3DK8 A;  3AE8 A;  4EQX A;  2CLY C;  4DGK A;  5CA1 E;  1MNE A;  5KVI A;  2B1E A;  3AE7 A;  3EDV A;  1F8W A;  4EZ4 A;  4E0V A;  5J60 A;  4CI2 B;  2V7M A;  1G73 A;  1EL5 A;  4EB6 E;  1NG4 A;  4GIW A;  4JN9 A;  3UKA A;  5AQJ B;  3GDN A;  4ZZB A;  1UUR A;  4OPU A;  1SUM B;  3ZC0 A;  1W4X A;  5AQK B;  4N78 D;  3TKL B;  2XTL A;  3AE6 A;  3I1A A;  2V3A A;  2LKG A;  4USQ A;  2RAB A;  5L4H A;  5H6Q B;  3AA7 B;  4V1A v;  3RIU A;  3DK9 A;  5LCY A;  1HG5 A;  4DMW A;  2Q9Q B;  2EQ9 A;  1RUI 4;  1FEB A;  4CCR A;  3BK9 A;  2FBW A;  2DWK A;  1ZOV A;  3P4R A;  4PNI A;  3ABV A;  2AE9 A;  2CBI A;  2IML A;  4ILU A;  3HA4 A;  3ZYX A;  3GDP A;  4I43 B;  3FMW A;  5JRC A;  2E1M A;  1FL2 A;  1WYC A;  4DSH A;  2XFO A;  5FVL A;  1ZV4 X;  1KNP A;  2ZM8 A;  3AE2 A;  3RYI E;  3C98 B;  3N5L A;  1QO8 A;  3ATQ A;  4PAG A;  2E2A A;  4X1I E;  3BNU A;  4LFC T;  2H88 A;  4YSX A;  1PIV 4;  4EM4 A;  4COF A;  2LSG A;  3EI0 A;  4JNA A;  1O95 A;  2Q9Q D;  2GRT A;  1ZOY A;  1ZX9 A;  4B67 A;  5J1G A;  1OED C;  2UU9 T;  3RIF A;  1XAN A;  2I59 A;  4JQ9 A;  4UVC B;  4U2L A;  1N32 T;  3DJG X;  5LNK A;  4FJO A;  3UKQ A;  3EDU A;  4OYJ A;  1ZP0 A;  3LJC A;  2XFU A;  5DQV A;  3QUJ A;  1AOG A;  2XFN A;  1O5W A;  4DR3 T;  2X68 A;  3DGZ A;  1REO A;  1XNQ T;  1O94 A;  2EQ7 A;  3G06 A;  2GAH B;  4DV0 T;  5IHY A;  1R8I A;  1PBF A;  3QB5 K;  2BRY A;  1GAL A;  2BK5 A;  2EHO B;  2VQB A;  2N1G A;  2V7I A;  1PS9 A;  2YVF A;  3HZL A;  4NUU A;  1KFY A;  4CN1 A;  3GYX A;  4Z25 A;  4J57 A;  1NWM X;  4YWO A;  1E1M A;  3RPU A;  3SY4 A;  5ADX L;  2CA5 A;  1V9D A;  2AXD S;  1D0Y A;  5F8P A;  3HYW A;  4K7Z A;  2V7L A;  4YTM A;  3ZYK A;  1IBM T;  4YLH A;  2MPK A;  1H81 A;  2IID A;  3KV6 A;  1RUD 4;  2EHO D;  2OAM A;  1VCT A;  4ZXL A;  4WYV A;  3KKJ A;  3JD7 4;  3GA8 A;  5KRQ A;  5ETW A;  5L3B B;  3WAJ A;  2PZS A;  3UU8 A;  3RHA A;  2R46 A;  5HEU A;  3NRN A;  4GUV A;  2LE8 A;  4EM3 A;  1OED B;  4K0U A;  1Q9I A;  2JMK A;  1FMW A;  2E9X B;  5KMR A;  1XDP A;  1YQ4 A;  3H3M A;  2PYX A;  1F8R A;  3M65 A;  5FXX A;  3OVU A;  4TWH A;  5DAB A;  3V3N A;  1IAP A;  3RRC A;  1QUU A;  1PBE A;  1CJ4 A;  5HCJ A;  3RF1 A;  1OJA A;  3N2K E;  1YQZ A;  3GYJ A;  3VRB A;  3AEB A;  1IBK T;  4B69 A;  2YG7 A;  3VRD B;  4BJN A;  1I6Z A;  4ZZC A;  3NYC A;  3LK4 2;  1XHX A;  2LSI A;  5AQR B;  2A72 A;  4O2A E;  1DJN A;  1F3P A;  1QSD A;  2LM9 A;  1K0L A;  3CNS A;  2ODV A;  4CZZ B;  2AQJ A;  5EK2 A;  1BWC A;  2YM2 A;  3E22 E;  3LSV A;  2E9X D;  3EAN A;  4ANJ A;  1PXB A;  4G63 A;  1N4U A;  2X9Y A;  3GD4 A;  3C4A A;  1KNZ A;  4H4W A;  3UU4 A;  5A1L A;  1N34 T;  1GQE A;  2GR2 A;  1LQU A;  2XJ7 A;  3UU5 A;  4A97 A;  3KU9 A;  3V5U A;  2WET A;  3T2K A;  4UDQ A;  2SPC A;  1B7T A;  1US7 B;  1VBD 4;  3AA1 B;  3LAD A;  4YHJ A;  2APG A;  2BVL A;  4ZI2 D;  2I0Z A;  5M4Y A;  2TPR A;  3SX6 A;  4YTP A;  1K0J A;  2Q7V A;  4H4X A;  3GRS A;  4H63 V;  2WS3 A;  3GMB A;  1HRV 4;  3N9L A;  5JR9 C;  3I3L A;  2R0P A;  1SE7 A;  5J0Z A;  2VKJ A;  1ZKE A;  3RYF E;  4X20 E;  5ABH A;  3GN5 B;  2H89 A;  2XQY A;  5CB4 E;  4UDP A;  4GKK T;  3RKO A;  4IDN A;  1PBD A;  3RIA A;  4GYR A;  5EBK A;  3MXZ A;  4O4L E;  3H3A A;  1VQW A;  1MMN A;  2VVN A;  2JB3 A;  2X8C A;  4H9O C;  4K8D A;  4E7S A;  5HXR A;  4FX9 A;  4KPR A;  1LVL A;  3RP8 A;  2NR4 A;  4EEB A;  4EGW A;  4U8J A;  2YG4 A;  3AB1 A;  4JV5 T;  1E1K A;  3GWH A;  3ALM A;  4QKN A;  2ACX A;  2Y6R A;  3ZCJ A;  2WEU A;  1EAH 4;  3DGH A;  1CJ2 A;  1AR8 4;  3O9X A;  4MAL A;  5M0Z A;  3G5S A;  2Y48 B;  4TWD A;  3FIM B;  5FS6 A;  2W00 A;  2X5I D;  3WI3 A;  2BXS A;  1TYT A;  2C5K T;  2C66 A;  3UFE A;  4X65 T;  2VWA A;  3DJE A;  3F57 A;  5L3E B;  2VQE T;  2VZ2 A;  1EL7 A;  3TLS A;  2NTY A;  2UXC T;  5AQU B;  1DNC A;  1CF3 A;  2QA1 A;  3WE0 A;  3LG7 A;  3T1H T;  3T31 A;  2LRK A;  4BA9 A;  3LOV A;  2XHE B;  2CXL A;  1T98 A;  3NLC A;  2IUB A;  4OPI A;  1Z0P A;  2I0M A;  4NNJ A;  2BG9 C;  2WP9 A;  1NHR A;  2K24 A;  2XCG A;  3QFA A; 
#chains in the Genus database with same CATH homology
 1CBO A;  2W0H A;  3GSI A;  4B65 A;  4H7U A;  1GRH A;  2WPF A;  1GV4 A;  3DH9 A;  3LZX A;  4J31 A;  2QA2 A;  2YG5 A;  2WU2 A;  4OVI A;  1JNR A;  1NDA A;  1B5Q A;  3DJJ A;  2YLX A;  4I58 A;  4DNA A;  4BK1 A;  3CGE A;  3NYF A;  4U2T A;  2BYB A;  3BHF A;  1S2Y A;  4J2W A;  3K7Q X;  4H2R A;  3CGB A;  2ZZB A;  4FK1 A;  2JBV A;  2R0G A;  2Z5Y A;  4IVO B;  4U8N A;  4U2S A;  2BK4 A;  1K0I A;  3SM8 A;  2YAU A;  4EIQ A;  3KPK A;  1D4E A;  1OJ9 A;  4EMI A;  3OC4 A;  2GV8 A;  5BUK A;  4CY8 A;  2B9X A;  4NEV A;  1COY A;  5TR3 A;  2ACZ A;  1S3E A;  1BGJ A;  1TDO A;  1IJH A;  2CVJ A;  1E1L A;  1S3B A;  4G73 A;  4UDR A;  1NG3 A;  4XWR A;  2C76 A;  2GR1 A;  2J3N A;  1NEN A;  4USR A;  3P4Q A;  3B6D A;  1RYI A;  1PN0 A;  1PJ6 A;  1KF6 A;  4YXD A;  3DJD A;  4YKG A;  2RGO A;  4A5L A;  4RSL A;  3IHG A;  4J56 A;  1VDC A;  3AE5 A;  3GWD A;  4Y4N A;  2VOU A;  4U8I A;  1H86 A;  1FOH A;  4K5R A;  3AWI A;  3RP6 A;  2V3B A;  1CL0 A;  1DJQ A;  3NTA A;  1MOK A;  4NZH A;  5FS7 A;  4B68 A;  2VRM A;  3BI2 A;  3FPZ A;  1DOB A;  1Y56 A;  1H84 A;  3NK1 X;  3AD9 B;  1Q1R A;  3DK4 A;  2R9Z A;  2GMH A;  1NAA A;  1ONF A;  3D1C A;  1TRB A;  3C96 A;  2BRA A;  2WU5 A;  4AT0 A;  3PS9 A;  1TDN A;  2A8X A;  2WOW A;  5IPY A;  3PO7 A;  3H8I A;  3NK0 X;  4J34 A;  4KX6 A;  1BKW A;  1E1N A;  2NPX A;  4WX1 A;  3IHM A;  1H6V A;  1XPQ A;  3DA1 A;  4H4Q A;  1NEK A;  3UKH A;  2V61 A;  2DKH A;  3SUC A;  4GAP A;  3UOY A;  1LJ1 A;  5HXI A;  1PJ7 A;  3B3R A;  3I6D A;  2C73 A;  2JAE A;  1IUS A;  3QSM A;  5KMP A;  2CDU A;  3AEE A;  2V60 A;  2YWL A;  1L0V A;  2EQ6 A;  2IVD A;  1P2E A;  4K2X A;  1N4V A;  1GOS A;  1IUT A;  5CQF A;  4AP1 A;  1GRA A;  2C65 A;  2GB0 A;  3NYE A;  2B9W A;  2BS3 A;  4LU6 A;  4APN A;  2JB2 A;  3AE1 A;  2Y6Q A;  5EOW A;  2DKI A;  3AXB A;  1EBD A;  1ZMD A;  2WDR A;  1Y56 B;  2YG6 A;  2WES A;  3UTF A;  4ZCD A;  4I59 A;  4TM0 A;  3SQP A;  2X8H A;  2XFP A;  2ZZ0 A;  4LA1 A;  5KXJ A;  3HYX A;  5U1O A;  4NTE A;  2VQ7 A;  2R4E A;  5DBJ A;  1XHC A;  3VR9 A;  3COX A;  3GRT A;  4BJZ A;  4Z2T A;  2QAE A;  4GR1 A;  5HY5 A;  2E5V A;  3P1W A;  1VG9 A;  3IWA A;  2ZZC A;  2OA1 A;  3F8D A;  1RP0 A;  1B4V A;  3UP4 A;  2FJB A;  2XLR A;  2GAG B;  5FMH A;  1LTX R;  2XLS A;  3CN8 A;  5EB5 A;  2PHH A;  4Z2R A;  4H4R A;  2B76 A;  2NVK X;  1DOD A;  3EPT A;  4GCM A;  5BRT A;  2BS4 A;  4YSH A;  2BC0 A;  4IA6 A;  1L9D A;  1RSG A;  3R9U A;  1JRZ A;  3GD3 A;  3T0K A;  5ER0 A;  3H4K A;  2R45 A;  4U8P A;  3NGC X;  1GER A;  1JU2 A;  1VG0 A;  2WP6 A;  4NTC A;  3EF6 A;  1CC2 A;  3ISH A;  1ZMC A;  2GMJ A;  3SZ0 A;  1DOE A;  3BHK A;  3UKK A;  4EQW A;  1GET A;  4TM4 A;  5KMQ A;  5JCM A;  2YLT A;  4YSZ A;  1L9E A;  2BS2 A;  2B9Y A;  2C75 A;  2WHD A;  3AE8 A;  3DK8 A;  3LB8 A;  4GF7 A;  4C74 A;  4EQX A;  4DGK A;  3CMM A;  3GQK A;  1QLB A;  1BF3 A;  5KVI A;  4PAB A;  3T14 A;  3AE7 A;  1TDK A;  2X3N A;  2HQM A;  3ICS A;  3JSK A;  1F8W A;  1YKJ A;  3T2Z A;  4H4Z A;  4E0V A;  5J60 A;  1M64 A;  3LZW A;  3SZC A;  4H4Y A;  1EL5 A;  3UTG A;  1GRG A;  1LPF A;  1S2Q A;  1NG4 A;  2GQW A;  4B64 A;  2XVE A;  4II3 A;  4JN9 A;  3UKA A;  5JCI A;  1NHS A;  1IUU A;  3GDN A;  4NWZ A;  2XYO A;  1CJC A;  2IVE A;  4OPU A;  2XLT A;  1W4X A;  4U8L A;  3ALJ A;  2Q0K A;  4H50 A;  2VVL G;  3QVP A;  1JRY A;  3AE6 A;  2V3A A;  2C70 A;  4USQ A;  1TYP A;  2RAB A;  3CNP A;  2R0C A;  1OJD A;  1D4C A;  3DK9 A;  2GR3 A;  3NTD A;  3UCL A;  2GEW A;  2QCU A;  4J33 A;  2EQ9 A;  1ZY8 A;  1FEB A;  1IUV A;  1ZKQ A;  1EL9 A;  2YVG A;  4CCR A;  1X31 B;  3AEC A;  1H82 A;  4IV9 A;  2WPC A;  2FBW A;  2GVC A;  4H4T A;  1ZOV A;  3VQR A;  3P4R A;  4BUR A;  3ABV A;  5J7X A;  3KLJ A;  2OLO A;  3ZYX A;  4II2 A;  4OPT A;  3GDP A;  2XVJ A;  4H4P A;  3FMW A;  2C4C A;  3UKP A;  1DOC A;  4K5S A;  2E1M A;  3NNE A;  1FL2 A;  1JNZ A;  1GTE A;  1BGN A;  3BNM A;  4DSH A;  1PJ5 A;  2XFO A;  1GRF A;  2A89 A;  4AT2 A;  1KNP A;  3AE2 A;  5CKU A;  3QFB A;  5C2T A;  2JB1 A;  1QO8 A;  3ATQ A;  3FBS A;  3BNU A;  4P9S A;  5JCN A;  1GEU A;  4TM3 A;  2XLU A;  4U8O A;  2H88 A;  4YSX A;  2CUL A;  2RGJ A;  4EM4 A;  2BCG G;  2BK3 A;  4RG3 A;  4JNA A;  4AOS A;  1O95 A;  1E39 A;  2GRT A;  4HB9 A;  1ZOY A;  1ZX9 A;  4B67 A;  1E6E A;  4B63 A;  3C4N A;  1JOA A;  2XFQ A;  4G9K A;  1XAN A;  3G5Q A;  4JQ9 A;  1JRX A;  1EL8 A;  1F6M A;  3CND A;  3OZ2 A;  4U2L A;  3DJG X;  2XLP A;  3CGC A;  4Z43 A;  3NH3 X;  3AEF A;  3AED A;  3ICT A;  3ZDN A;  3UKQ A;  1Y0P A;  3IC9 A;  4CBQ A;  3Q6J A;  4G6H A;  1ZP0 A;  1SEZ A;  2B7S A;  2OAL A;  2XFU A;  3NG7 X;  4H2N A;  3CNJ A;  1AOG A;  2AR8 A;  1NHP A;  2XFN A;  1O5W A;  2WDV A;  1H7X A;  3SGL A;  1KDG A;  2YQU A;  3KD9 A;  3DGZ A;  1REO A;  4H4S A;  3M13 A;  1O94 A;  4DSG A;  2EQ7 A;  4Z2U A;  2GAH B;  4A65 A;  1PBF A;  4XXG A;  4EQS A;  2BRY A;  1GAL A;  2BK5 A;  2LFC A;  3NT6 A;  3ALL A;  2ARD A;  4HA6 A;  3GQH A;  4RG4 A;  2X8G A;  2VQB A;  1GTH A;  4D04 A;  2YLW A;  2JKC A;  1P2H A;  2VVL A;  4C3X A;  2O9Z A;  1PS9 A;  2XDO A;  2YVF A;  4Y4L A;  3RP7 A;  3HZL A;  1GXF A;  1XDI A;  1H7W A;  1TDF A;  4EMJ A;  1GSN A;  4U8K A;  2GF3 A;  2YLZ A;  1L9C A;  1KFY A;  3NKS A;  2WPE A;  4EIP A;  4ECH A;  3GYX A;  4YSY A;  4Z25 A;  4B66 A;  3SXI A;  1M6I A;  4BJY A;  2X99 A;  3AD7 B;  4J57 A;  1V59 A;  5HYM A;  4YWO A;  2RGH A;  1E1M A;  3SY4 A;  4CNK A;  1MO9 A;  3HYW A;  4K7Z A;  1PXC A;  4OPG A;  4IVM B;  4YTM A;  4M52 A;  2C72 A;  3P9U A;  4AOX A;  1H81 A;  4GDE A;  4J36 A;  2IID A;  3UOZ A;  1UKV G;  1IUX A;  1GRT A;  1PBB A;  2OAM A;  3UOV A;  4CRT A;  1GND A;  1PHH A;  2CFY A;  3KKJ A;  4GRT A;  3UTE A;  5KRQ A;  4G6G A;  5GRT A;  5KNL A;  2YR5 A;  4EMW A;  2OLN A;  3T37 A;  1B8S A;  4A79 A;  2Z5X A;  3NK2 X;  2VRL A;  4XWZ A;  3ADA B;  3RHA A;  2A87 A;  2R46 A;  3NRN A;  2YG3 A;  4JDR A;  4GUV A;  4YKF A;  5U63 A;  1QJD A;  4EM3 A;  1LQT A;  3AD8 B;  3LXD A;  1PBC A;  1Q9I A;  4Z26 A;  1E7P A;  4UP3 A;  4H4V A;  2WOV A;  5EB4 A;  5KMR A;  1YQ4 A;  2GH5 A;  1N1P A;  3AYL A;  2PYX A;  4TLX A;  5FS9 A;  1F8R A;  5U25 A;  4EQR A;  5KOW A;  4NEW A;  1CC6 A;  1KNR A;  2V6O A;  1K4Q A;  4O5U A;  3V3N A;  3M12 A;  4GDP A;  3LJP A;  3URH A;  1PBE A;  4TM1 A;  1D7Y A;  4AP3 A;  1CJ4 A;  4JY3 A;  1GRE A;  3D8X A;  1KSS A;  4K22 A;  4CY6 A;  1OJA A;  3DME A;  4H4U A;  1YQZ A;  3GYJ A;  2GQF A;  3VRB A;  3AEB A;  1ZDL A;  3V3O A;  4B69 A;  5JCL A;  2Q0L A;  2BA9 A;  2YG7 A;  3VRD B;  3VR8 A;  3NYC A;  3SFD A;  3FG2 P;  5KOX A;  1DJN A;  1F3P A;  4BV6 A;  1HYU A;  1JEH A;  1K0L A;  1GES A;  3AEA A;  2BAC A;  2AQJ A;  3CNS A;  3RED A;  4A9W A;  3Q9T A;  5HHF A;  4A7A A;  5M10 A;  3CTY A;  1TDE A;  3KVE A;  3PVC A;  1PXA A;  1BWC A;  2C67 A;  3E1T A;  1OJT A;  2YM2 A;  3NN6 X;  3EAN A;  2WOI A;  3BI5 A;  1PXB A;  3QJ4 A;  1N4U A;  1VRQ B;  2YM1 A;  2BC1 A;  3GD4 A;  5JCK A;  3HYV A;  4OCG A;  4Y4M A;  3C4A A;  1IUW A;  4C3Y A;  1CC4 A;  3NN0 X;  4FDC B;  4Z44 A;  1ELI A;  4H4W A;  2GR2 A;  4OPC A;  1LQU A;  4CCQ A;  3K7M X;  1CHU A;  3KU9 A;  2WET A;  4CNJ A;  2GR0 A;  3NIX A;  3P4S A;  1YQ3 A;  2AAQ A;  4UDQ A;  3T2K A;  4ADW A;  3UTH A;  3II4 A;  4G74 A;  4N9X A;  3SYI A;  2R4J A;  4ZCC A;  4C77 A;  5L46 A;  1D4D A;  3LAD A;  4MJW A;  3RNM A;  2XVH A;  1FCD A;  2C7G A;  2WP5 A;  2APG A;  3V76 A;  2I0Z A;  1NPX A;  2C64 A;  2JK6 A;  2TPR A;  3SX6 A;  4YTP A;  2TMD A;  3ATR A;  3GWF A;  3QSE A;  2FJD A;  1K0J A;  2Q7V A;  4H4X A;  2BXR A;  3GRS A;  2WS3 A;  1CJ3 A;  4OPL A;  4A6N A;  3GMB A;  4ZN0 A;  4BK2 A;  4JY2 A;  3S61 A;  3UKF A;  3I3L A;  2R0P A;  3BI4 A;  3K30 A;  3AE4 A;  1DXL A;  2C3D A;  5KVH A;  2WBA A;  3O0H A;  1FEC A;  2H89 A;  1OJC A;  4UDP A;  2WQY A;  3UKL A;  3K7T A;  4X9N A;  3T2Y A;  5IQ4 A;  1PBD A;  5EBK A;  3L8K A;  4YTN A;  3NHO X;  4U8M A;  3SFE A;  2XVI A;  3GMC A;  5KWF A;  2YLS A;  1Q1W A;  1VQW A;  3QVR A;  4Z24 A;  3AE9 A;  2BCP A;  3F8R A;  4REK A;  2JB3 A;  2X8C A;  1KSU A;  2B7R A;  1F8S A;  3QSS A;  4D03 A;  4K8D A;  4KPR A;  4FX9 A;  1LVL A;  3RP8 A;  3H8L A;  4U8J A;  2YLR A;  3S5W A;  3SZF A;  5GSN A;  1B37 A;  2YG4 A;  3AB1 A;  5BVA A;  3AE3 A;  1E1K A;  3CPI G;  4NTD A;  3ITJ A;  2UZZ A;  3ALM A;  3CNT A;  4X9M A;  1LV0 A;  2Y6R A;  3EAO A;  3KA7 A;  2ZBW A;  4IA5 A;  3SZW A;  2WEU A;  3M0O A;  4A6N B;  4GAV A;  4H2Q A;  3DGH A;  1CJ2 A;  1GRB A;  2YVJ A;  1GT8 A;  4X4J A;  5KMS A;  3VRA A;  5C3J A;  2X50 A;  5M0Z A;  3CIR A;  3G5S A;  3FIM B;  5FS6 A;  5LV9 A;  3CGD A;  2BXS A;  3IF9 A;  1TYT A;  4JNQ A;  2C66 A;  4PAA A;  3AEG A;  4TLZ A;  5IQ1 A;  4O5Q A;  1MXT A;  3DJE A;  4A99 A;  4B1B A;  1YY5 A;  2FJE A;  2V5Z A;  1BZL A;  1FEA A;  1GPE A;  5FS8 A;  1ZK7 A;  2VZ2 A;  3UOX A;  1EL7 A;  2YR4 A;  4WCT A;  3GYI A;  2VVM A;  4FK1 C;  1H83 A;  2E4G A;  5BUL A;  1DNC A;  4C5O A;  1CF3 A;  2BAB A;  2QA1 A;  3WE0 A;  2XVF A;  3T31 A;  2EQ8 A;  1Z6L A;  2F5Z A;  3ICR A;  3P4P A;  3KPF A;  3LOV A;  4OPD A;  1N4W A;  1D7L A;  3G5R A;  4ICY A;  4BK3 A;  1D5T A;  3CPH G;  3NLC A;  3AYI A;  1NHQ A;  2YR6 A;  4OPI A;  4NNJ A;  4H2P A;  3AYJ A;  2WDQ A;  3CPJ G;  3F8P A;  2C3C A;  4LII A;  4YT0 A;  3UP5 A;  2WP9 A;  2Q6U A;  2FJA A;  1PDH A;  1NHR A;  3L1R A;  2XCG A;  3QFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...