3VRAA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
total genus 192
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vraA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vraA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vraA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vraA04
3IWAA 3B6DA 3FG2P 2XVHA 4H2RA 2GB0A 3IC9A 2GR3A 4X9NA 1PJ5A 4NTCA 3QJ4A 3AE6A 4M52A 4J31A 2YVJA 3F8RA 3ITJA 3CPIG 4J56A 4IV9A 3PVCA 1FEBA 1PS9A 1NHSA 2XCGA 3S61A 2GR0A 3OZ2A 3KU9A 4Z25A 5FS6A 4YT0A 2ZZBA 1XANA 3AD8B 3IF9A 1KF6A 1FCDA 2WDQA 2Z5XA 3Q6JA 3CGEA 4C74A 4WCTA 2BXSA 1W4XA 3CGDA 3ATQA 2YAUA 4UDRA 4Z44A 3IHMA 2DKHA 5DBJA 2GQWA 1MXTA 1B4VA 1L9DA 1UKVG 4DSHA 3DGZA 3NG7X 2R4JA 5IQ4A 1E6EA 4H4SA 3UOYA 5FS7A 4AOXA 1N4UA 2JAEA 2UZZA 2X50A 2WBAA 4YXDA 2WETA 4H2NA 2YLWA 4CBQA 3M12A 3GQHA 2YR4A 4OPGA 2YG4A 2YLTA 2XFOA 2YWLA 1JOAA 2BABA 5JCIA 5LV9A 2FJDA 2R9ZA 3F8PA 4A5LA 1GTHA 4ADWA 3NLCA 5KRQA 1JRZA 2BC1A 3AE1A 2EQ7A 1FOHA 3LJPA 1VG9A 3KPFA 2WU5A 2ZZ0A 4OPTA 1TDKA 4GR1A 4OPUA 5EBKA 3II4A 1CF3A 3M0OA 5FS8A 2VQ7A 4B1BA 4BURA 4NEVA 1BKWA 2WU2A 1NHPA 4H4TA 4USRA 4GF7A 5U25A 2C65A 1QLBA 1GRAA 1ELIA 1V59A 4IA6A 1XPQA 3QSMA 3NK0X 4LIIA 2WP5A 4BK1A 4B63A 1LQTA 1K0LA 3NK1X 2C73A 3SM8A 1DOEA 3CNDA 1PDHA 1IUWA 2XVIA 2VVLA 2H89A 1N1PA 2OLNA 3C96A 1S2QA 5HYMA 1S3BA 3QSSA 3GDNA 2FJAA 1QJDA 3I3LA 1CJ3A 4U8KA 2AAQA 2B9YA 1TYPA 1BF3A 4K5RA 1EL9A 3P4QA 1NDAA 3JSKA 4TLZA 2QA1A 1VG0A 2QAEA 5HXIA 4USQA 1D4CA 5CKUA 4A79A 1DOCA 1PHHA 1LPFA 2X8HA 1D5TA 1H83A 1Y56B 1NENA 1GERA 4O5UA 3HZLA 2F5ZA 5TR3A 4TLXA 1IUSA 2GH5A 4UDQA 4ZN0A 2XYOA 2WP6A 4YSZA 2WPFA 3BHFA 4AT0A 4E0VA 1F8RA 1DXLA 1L9EA 4H4PA 1YY5A 1LTXR 4H4QA 4EM3A 2JBVA 3L8KA 1E1KA 3DJGX 4B68A 2Y6QA 4X9MA 4YWOA 1OJ9A 1E1MA 3DJJA 3DA1A 4OPDA 1X31B 3KD9A 1JEHA 3AE7A 4GUVA 3RHAA 1OJDA 2FJEA 1PXCA 2H88A 3AE4A 2OAMA 3KKJA 4H2PA 2BACA 1CJCA 2YR6A 2YVGA 3F8DA 3ATRA 3NHOX 1XDIA 4Z2UA 4EMJA 5JCNA 2C66A 1TDOA 2FBWA 2Q0KA 3QFBA 3VRAA 3K7TA 3BNMA 1ONFA 1YQ3A 5ER0A 4X4JA 3DK8A 3NGCX 1E1NA 2B7RA 3O0HA 1GNDA 4APNA 3PO7A 3L1RA 4B69A 2YLSA 4CNJA 1GEUA 2DKIA 1O94A 3UCLA 2BS2A 1GTEA 3ALMA 2C64A 3AEGA 1GREA 4H4WA 4K8DA 5GRTA 3UP4A 3UTGA 4P9SA 3DK9A 3D1CA 1GRGA 4EMIA 5C2TA 5KVIA 5JCMA 2WOIA 3K7QX 4BK2A 4EIPA 3GWDA 4CNKA 1REOA 1NHRA 1TDFA 4U8MA 2CFYA 4FX9A 5GSNA 2NPXA 5M10A 3WE0A 4HB9A 4BJZA 2C3CA 3H8IA 1JU2A 1LVLA 2LFCA 4EQSA 3FBSA 4ZCDA 2O9ZA 4REKA 2YG7A 3LZXA 3AE8A 2V3BA 2JB3A 3DMEA 3EAOA 4UDPA 4A7AA 3S5WA 3GMCA 2JB2A 2R0CA 2YG5A 1K0JA 2HQMA 2R4EA 4H4RA 2XVFA 4TM1A 2R0GA 3LXDA 2YVFA 2WHDA 1CC6A 1DNCA 2GAGB 1ZK7A 3NYEA 1IUVA 1GESA 4GDEA 1FECA 1GV4A 2B76A 1B5QA 3EANA 1N4WA 2A87A 3ISHA 3P4SA 1LQUA 4AT2A 4MJWA 4B66A 5BUKA 3AXBA 2TPRA 4JN9A 3ZYXA 3GWFA 2ZBWA 2V5ZA 4A9WA 3GRTA 1VDCA 2GV8A 4NZHA 3LB8A 4K5SA 1GRTA 3AEAA 1IJHA 2WPCA 3NN6X 3FMWA 3AD9B 2PYXA 1CHUA 1PBFA 2GRTA 3ICRA 3QSEA 3EF6A 3UKFA 1PXAA 3H8LA 1YKJA 2WDVA 3Q9TA 2EQ9A 3ICSA 4CCRA 3GRSA 3UP5A 5KOWA 2ACZA 1O5WA 1KSSA 2B9XA 1BWCA 3CNJA 4J57A 2XFQA 2GVCA 2WQYA 4U8LA 5U1OA 2Q7VA 2YQUA 5FMHA 1ZY8A 1VQWA 2C76A 5J60A 2EQ6A 4YSHA 3DJEA 3NRNA 4Y4LA 1JNRA 2V3AA 3GD4A 1LJ1A 4TM4A 3CNPA 2AR8A 1N4VA 3AEDA 5C3JA 2YR5A 1CC4A 1Y0PA 2CVJA 2R0PA 3PS9A 4H4ZA 1S3EA 4LA1A 2WP9A 1CJ2A 4JY3A 3GQKA 2CULA 4U8OA 3CPJG 3NKSA 4KPRA 3AYJA 4BK3A 3ZDNA 4JDRA 3ABVA 4U8JA 1D7YA 2GQFA 3UKLA 5BULA 5M0ZA 2X8CA 4K7ZA 4YSXA 3K30A 4D03A 3AE2A 1DJNA 5U63A 2R45A 4I59A 1H84A 4Y4NA 1H7WA 2W0HA 2BXRA 1M64A 4Z26A 3EPTA 3SFDA 2E4GA 5HHFA 1Q1WA 2J3NA 3H4KA 5KOXA 3R9UA 4XWRA 3UTHA 4CCQA 5JCLA 2JK6A 2CDUA 2XFUA 4GDPA 3AYIA 3AE5A 3ADAB 1PBBA 3CGCA 2GR2A 3P4PA 1ZKQA 4PAAA 2X99A 1GPEA 3GMBA 1NG4A 1Z6LA 1XHCA 3FIMB 4EIQA 4Z2RA 1D4DA 2OA1A 2XVEA 4BJYA 2GAHB 1S2YA 2RGHA 2V61A 5HY5A 5L46A 5EB5A 1F8SA 2X3NA 1ZMCA 3LOVA 1RSGA 3B3RA 1L9CA 2E5VA 5CQFA 1KNPA 3REDA 3ALJA 2XLRA 3SGLA 2YLXA 4A6NB 2WS3A 4FK1A 2YG3A 4H7UA 2BYBA 3K7MX 5KWFA 2V6OA 2BK4A 3BHKA 4TM3A 3NYCA 4OPLA 3ALLA 2V60A 2PHHA 2QA2A 1NHQA 3GSIA 2IVDA 5JCKA 3SFEA 3GDPA 4OCGA 3COXA 4CRTA 4OPCA 1IUTA 4K2XA 4U2TA 2C67A 2WOWA 4H4YA 4EMWA 4J34A 1O95A 2GF3A 3DJDA 2B9WA 1MOKA 1TDEA 1EL5A 4H4VA 4AP1A 2IIDA 4BV6A 1KDGA 3UKHA 1PJ7A 3BI5A 1H6VA 1GALA 3VR9A 1ZOVA 3UTFA 3V3OA 3C4NA 4NTEA 1OJCA 3NK2X 1F8WA 4YTPA 1CL0A 1PBCA 1ZMDA 1CC2A 2R46A 1D4EA 3KLJA 2APGA 1EL7A 3P4RA 2XLSA 1PN0A 3UKAA 4H4UA 4XWZA 3BNUA 4D04A 1PBDA 3AECA 4RG4A 1GT8A 4U8NA 4IVMB 1GRBA 1PBEA 2TMDA 2C7GA 3QFAA 1K0IA 3NN0X 4Z2TA 5EB4A 3GYXA 1Q1RA 2BK3A 1JRXA 3BI2A 1YQZA 3NIXA 2XFNA 4GCMA 1Y56A 2AQJA 2JKCA 3G5QA 3P1WA 1IUUA 1LV0A 1GSNA 2JB1A 3I6DA 3SUCA 2FJBA 1QO8A 1RP0A 1KFYA 3CN8A 3GYIA 3LZWA 3P9UA 1YQ4A 1SEZA 2XLPA 1GRHA 1AOGA 3UOZA 4DGKA 2BC0A 1BGNA 3LADA 4EQRA 4B65A 4C3YA 5KVHA 4FK1C 2BCGG 3T37A 3CTYA 3KVEA 2OLOA 3NTAA 4GRTA 4NEWA 3URHA 1GRFA 4N9XA 4J36A 2YG6A 4YTNA 3VQRA 4DSGA 3CNSA 3BI4A 4CY8A 1BZLA 4TM0A 4ECHA 2NVKX 2GMJA 2WEUA 4YKGA 4YTMA 2YLRA 4NTDA 4HA6A 3M13A 4JNAA 1OJAA 4AP3A 2YM1A 2WDRA 4YSYA 3QVPA 3AE3A 1NPXA 4YKFA 4OVIA 1RYIA 2X8GA 4JNQA 2VVMA 2VRMA 2GEWA 5KXJA 2IVEA 1ZP0A 2WPEA 1E39A 4U2LA 2WOVA 1CJ4A 4J2WA 2OALA 4U8IA 4C3XA 1FL2A 1E1LA 1COYA 4H4XA 1NEKA 1H86A 1TRBA 1TYTA 3V76A 2BS4A 1KSUA 4A99A 4WX1A 1DOBA 1MO9A 2RGOA 5BRTA 3VRBA 1HYUA 5J7XA 3V3NA 2QCUA 3DK4A 4I58A 4Y4MA 4DNAA 4J33A 1D7LA 1CBOA 1PXBA 4K22A 3E1TA 3G5RA 4RG3A 3GD3A 1EBDA 1E7PA 2XVJA 2C72A 2Q6UA 2WESA 3AWIA 3UKQA 3ICTA 5IQ1A 3IHGA 1EL8A 5FS9A 1NG3A 1GOSA 2I0ZA 3NTDA 3CNTA 1P2EA 3RP6A 1GXFA 3NYFA 1DJQA 2EQ8A 2XLTA 2ARDA 3AB1A 4CY6A 1F6MA 4RSLA 1KNRA 3UKKA 3VRDB 3CGBA 1Q9IA 2VVLG 3UOXA 3AEEA 3AEFA 4U2SA 2RABA 4FDCB 4KX6A 4ICYA 4XXGA 3RNMA 3VR8A 2VZ2A 4IA5A 3NNEA 4O5QA 2Z5YA 3DGHA 1H82A 1OJTA 4B67A 2B7SA 3CPHG 4AOSA 4OPIA 3GYJA 3UKPA 4H2QA 1BGJA 4H50A 5IPYA 1L0VA 2C70A 2VRLA 2C75A 1ZDLA 2VOUA 4EM4A 1VRQB 3AE9A 3AD7B 3D8XA 4EQXA 3DH9A 1H81A 1P2HA 2XDOA 2YLZA 2A8XA 1K4QA 4LU6A 3RP8A 2GMHA 1ZOYA 2BA9A 1B37A 4UP3A 2GR1A 4PABA 1F3PA 4A6NA 1JRYA 4C77A 4B64A 1NAAA 2E1MA 3QVRA 5EOWA 4ZCCA 4U8PA 3OC4A 4Z43A 2BCPA 3C4AA 3AEBA 2BK5A 3RP7A 2VQBA 3UOVA 1B8SA 1DODA 3SQPA 1ZX9A 3FPZA 2XFPA 4EQWA 1IUXA 4JQ9A 1M6IA 3AYLA 2Y6RA 1TDNA 1FEAA 2ZZCA 4A65A 3UTEA 1H7XA 5BVAA 3CIRA 3NT6A 1GETA 1JNZA 4Z24A 2Q0LA 2XLUA 2A89A 2C3DA 3NH3X 3G5SA 2BS3A 2RGJA 2YM2A 4IVOB 3KA7A 4C5OA 4JY2A 1PJ6A
chains in the Genus database with same CATH superfamily
4G6GA 4DV1T 2XVHA 4H2RA 1RUF4 2GB0A 4NTCA 3M65A 2D0UA 4NNJA 4J31A 2LM9A 1Z0PA 3CPIG 4J56A 4IV9A 3SX6A 3F31A 1FEBA 1PS9A 2XCGA 3S61A 4KBMB 2UUCT 5FY1A 2ZZBA 3AD8B 3IF9A 3T31A 3PTRB 2WDQA 2Z5XA 4C74A 2CXLA 3K1SA 3CGDA 5KMRA 4ZI2C 1L9DA 3NG7X 2R4JA 1ZV4X 1E6EA 4H4SA 4BJMA 2BKNA 5AQNB 2UZZA 2X50A 4GAPA 3GA8A 4NPPA 3KINB 4CI3B 2OV9A 4ILCA 4YHHT 3X1DA 4L0RA 2YLWA 1HXS4 3GQHA 4MLKA 4DVDA 2V7IA 4EEDA 2XFOA 5JCIA 2ODVA 3P50A 4ADWA 1HTJF 1GTHA 3D0TA 3CQXC 2L8KA 1W09A 5ABEA 3LJPA 3L39A 2XM1A 3EDVA 3JBG4 4GR1A 4B1BA 3M0OA 4NEVA 1BKWA 3FI7A 4GF7A 5JREA 1XMOT 3F57A 3RH3A 1ELIA 3R6NA 3HKDE 3NK0X 4IDZA 4B63A 5HYAA 1DOEA 1PDHA 4I50E 2VVLA 1XNRT 2CBIA 2HH7A 4ANJA 2OLNA 3UUMA 1R8IA 3R84B 1BR0A 4GOUA 2QA1A 5LGNB 5HXIA 1D4CA 1DOCA 1LPFA 1GQEA 5CA1E 1Y01A 2N2NA 1NENA 1GERA 4AISA 3TLVA 5DJQC 4MFRA 1IUSA 2GH5A 4UVCB 2LOPA 3CWZB 4NUUA 4LF4T 3BHFA 4E0VA 1D0ZA 3NZPA 4EOZB 3A8YC 4YWOA 3DJJA 1JEHA 4HFVA 3AE4A 2PBIA 3F8DA 2YVGA 3NRXA 4CQIA 2C66A 1TDOA 3JCFA 2Q0KA 3VRAA 2V26A 4PJNA 2R7FA 3LJCA 4I55E 2ACXA 3NGCX 5JDHA 3HYXA 4APNA 3CMMA 2CA5A 3T0KA 3L1RA 2YLSA 1RUJ4 2CLYC 5HCJA 3ALMA 3TLWA 5GRTA 3FZFB 2Q9QD 2A72A 3KBTA 3DK9A 4P9SA 3TLSA 1OEDB 4EMIA 4JEUB 5JCMA 1REOA 1NHRA 2CFYA 4FX9A 5GSNA 4HFCA 3WE0A 4BJZA 3U78A 2X0LB 1VCTA 1MMAA 3PUVF 3RI5A 1JU2A 2O9ZA 2JQQA 4IE6A 2V3BA 2V7KA 4UDPA 4A7AA 3FZLB 2X51A 1K0JA 2HQMA 3SRZA 2R4EA 1IJ6A 2LHRA 3JADA 5JDGA 2R0GA 3LXDA 4TM1A 2QVAA 3E22E 2GAGB 1GV4A 1J5WA 1B5QA 1LQUA 5BUKA 1LVFA 2V5ZA 2DHRA 3GRTA 3LB8A 4K5SA 3UUNA 2HN1A 3AEAA 2WPCA 3NN6X 5L3DB 3NRYA 3FMWA 2PYXA 4Q4Y4 1XHZA 1I6ZA 4TN7B 4DR7T 1HFAA 3UKFA 3AA6B 3Q9TA 3ZMVB 4B6XA 2ACZA 1LRZA 2E9XB 1O5WA 1HRI4 1PO24 2GVCA 4NUVA 2Q7VA 1ZY8A 1KNZA 1JNRA 5LBMA 4WBOA 2H3RA 4TM4A 4JBWF 1N4VA 2AR8A 3AEDA 1WR0A 2NTYA 3ZSTA 2E9XC 1S3EA 4LA1A 1CJ2A 2SPCA 2CULA 2DLRA 2RPAA 1VBE4 2K3WA 2UU9T 3ZDNA 1D7YA 3UKLA 5BULA 1R094 4B3MT 1XDOA 5HEOA 3AAEB 1S35A 5JH7E 4YSXA 3V5UA 3RYFE 4IE0A 4MHCA 2JPFA 5ETWA 2E4GA 1Q1WA 3PDYA 5JCLA 1ZKEA 2CDUA 1ZEEA 4EYYR 4YLHA 5CJ5A 3CGCA 3HKEE 2GR2A 3P4PA 1AJ3A 1NG4A 4PFOA 1XHCA 3FIMB 4EIQA 1D4DA 2X66A 2CLYB 5HY5A 1RSGA 3JAFA 4H9NC 3QB5A 2YLXA 4A6NB 2WS3A 3EI0A 2YG3A 3L09A 3BHKA 4OPLA 4P0BA 4ISSA 3COXA 1WYBA 4K2XA 4U2TA 2WOWA 2CXDA 3MK7C 4C91A 1O95A 4AQFA 2GF3A 3DJDA 2IUBA 3N9NA 4ERRA 1EL5A 1KDGA 3RIUA 1H7CA 3SWHA 1GALA 3VR9A 3V3OA 3NZQA 4NTEA 1OJCA 3NK2X 1F8WA 1CL0A 1D4EA 2CBJA 3T8OA 3P7IA 3UKAA 3Q2MA 4Q25A 4DMWA 4IVMB 1RUC4 2XQ4A 3UFEA 2LKGA 3NIXA 4C90A 2XFNA 1S94A 3FZHB 4AQFC 3G5QA 3P1WA 3QUJA 3C4XA 3T14A 2FJBA 1QO8A 3JAEA 1RP0A 3GYIA 1POV0 2EHOB 1SEZA 1HF8A 1UX4A 1GRHA 1W9RA 4DGKA 2MTQA 2QYWA 4C3YA 4FK1C 4GRTA 2M67A 4KHZF 5L3CB 2JIWA 4U72A 2VASA 2YG6A 4H9SE 3HI2A 4UEMA 1BZLA 2Y8DA 4ECHA 2RR14 2NW7A 2NVKX 4U2YA 4YKGA 2YLRA 3RIAA 2YDSA 5ABGA 2HHHT 1PIV4 4YKFA 1UUSA 2VVMA 2GEWA 4P09A 3KVBA 5JRCB 2WOVA 4C3XA 1E1LA 3JC6C 1H86A 2RGOA 3VHLA 2UXNB 2VK9A 2JQHA 2ZM6T 1D7LA 4RG3A 2KSRA 4P1NA 3GD3A 1E7PA 2WESA 4IE7A 4A56A 5IQ1A 3ZSSA 3NTDA 1GOSA 2I0ZA 4GK5E 4EZ4A 2V6YB 2XASB 2XM2A 4N78D 5JDNA 2XLTA 2ARDA 3OBVE 4CZZB 4CY6A 2C5KT 2Q9QB 5AQOB 3AEEA 4HWHA 1FMWA 2RABA 4XXGA 5JQGE 4PJJA 3VR8A 4IGUA 4O5QA 3EVYA 3DGHA 3OKQA 5CFBA 1H82A 4QH5A 4B67A 2AXDS 4AOSA 3CK6A 2XAHB 1J5ET 4H2QA 3GN5A 3F2EA 3FXEB 2DWKA 1VRQB 3AE9A 3ZYMA 3AD7B 3D8XA 1P2HA 2XDOA 2M6IA 3MXZA 2A8XA 3P4WA 4ASKA 4GYRA 1B37A 1F3PA 1JRYA 2KZ7B 5EOWA 4FJOA 2LM2A 1LVKA 1WR6A 5LBQB 4Z43A 1RVF4 2BCPA 2WMOA 1N36T 5KMGP 3QK6A 2VQBA 3ZJ2A 1B8SA 3SQPA 1ZX9A 3FPZA 2XFPA 1YD8G 1IUXA 4DNDA 1M6IA 3AYLA 5LOVE 1FEAA 4A65A 4X1IE 1MIYA 1H7XA 3PUZF 1GETA 2XLUA 3VKHA 2XTLA 3GMIA 1AR64 2BS3A 4IVOB 3KV9A 4UXNB 3IHRA 3AA0B 3AXJA 4M52A 1SHZC 2W66A 3F8RA 3UFGA 3PVCA 5KX5E 4PK4A 2GR0A 3KU9A 1G73A 2VWAA 5FNVE 1XANA 1MMGA 2XQ7A 3C4ZA 5DQVA 5FMNA 5AQTB 3CX8B 3CGEA 4WCTA 2BXSA 1W4XA 4YHJA 4UDRA 2WZHA 4IIJE 2DKHA 5DBJA 2MBGA 4PJMA 1UKVG 5HXSA 4UF0B 3DGZA 2LT3A 4AOXA 1YW0A 5FS7A 3UU4A 1N4UA 3MA9A 5DQWA 5LGTB 3GWHA 2IDOB 2WETA 4H2NA 3NKZA 2RM24 2HN2A 4BAYB 3O9XA 1JOAA 2BABA 2FJDA 1HG5A 3WI3A 4A5LA 2LOSA 3UUXB 2EQ7A 1RUG4 2BRAA 4ZZBA 4G9KA 1VBB4 2RS54 4OHFA 5EBKA 4K0KT 1XDPA 4HKAA 2WU2A 4H4TA 3HKBE 1GRAA 1U4QA 1V59A 4O4JE 4DBRA 4WZXA 1LQTA 1K0LA 3NK1X 3C4WA 4JI3T 4G63A 2H89A 1QUUA 2B9YA 1TYPA 2VL8A 4U31A 1EL9A 2LSKA 3P4QA 4GYSA 5CKUA 4A79A 1PHHA 4DUZT 4E7ZA 5TR3A 2JQKA 2XYOA 2J4GA 5LGUB 2WP6A 1B7TA 2C5JA 1DXLA 4H4PA 1YY5A 3ONLC 4NWZA 1E1KA 2PY5A 4H63H 3NBXX 2UXDT 1OJ9A 4V1Av 3DA1A 4OPDA 2B1EA 2IIUA 3AE7A 2OAMA 4CXWA 3KKJA 2BACA 1FMVA 3KBUA 3ATRA 3NHOX 1XDIA 2JMHA 4Z2UA 4EMJA 5JCNA 2FBWA 2CM0A 4DV4T 5EK2A 3DK8A 1BEV4 1UURA 2RMU4 3O0HA 1GNDA 5JDFA 1H8TD 1RMU4 3P8CD 2RP4A 1GTEA 3UT5E 3UP4A 4EQRA 4K8DA 2ZMAA 1D0YA 3D1CA 4HFBA 2YDQA 1KEYA 4CNKA 1HNXT 5EK4A 1TDFA 2NPXA 2FUPA 3SZFA 1LVLA 4EQSA 3FBSA 4ZCDA 4REKA 3PUQA 2YG7A 3LZXA 2A2FX 3DMEA 5HWXA 2V7LA 5F8PA 2JB2A 2R0CA 3C51A 5AQPB 2WAUA 5EK3A 4DR1T 4X65T 2R074 1DNCA 1MIWA 2VB6A 1FECA 2B76A 3EANA 5KDMC 3ISHA 4UF0A 2TPRA 4UELA 3ZYXA 4PW8A 2WWVA 1VDCA 4NZHA 5DABA 2I0MA 2Q9QC 1HX8A 2GK9A 4F6RC 1CHUA 3Q5WA 2GRTA 3ICRA 2XQ3A 1PXAA 3H8LA 4DV6T 2WDVA 1YKJA 3ICSA 1T72A 3ZT5A 3UP5A 3FXDB 1KSSA 4J57A 1BWCA 1IBKT 3CMLA 5FMHA 2A9UA 2YEVC 3DJEA 3NRNA 1LJ1A 2YR5A 1CC4A 3SXIA 4AQYT 3PS9A 3QOFA 3UQ4A 5J2TE 4JI4T 2MPKA 2VKDA 4ZS3A 1OEDE 3ZKRA 1YXRA 1HR0T 4QHOA 5M0ZA 2X8CA 4K7ZA 3RLFF 4IT4A 3AE2A 1H84A 2MAWA 4Y4NA 2W0HA 2KNDA 4LMKA 3IEEA 3EPTA 5HHFA 2YU1A 3H4KA 1XI1A 4A97A 4DBQA 3R9UA 3UU5A 1FEWA 3PURA 4JI1T 4GDPA 5FYMA 1PBBA 3RQUA 2CHNA 4TX5A 4Q4V4 4LMLA 2X68A 2X99A 1GPEA 3GMBA 5FL1A 2LRKA 2OA1A 1MMDA 3OTOT 2V61A 4ZS2A 4WBNE 5EB5A 2LHNA 1F8SA 3LOVA 3B3RA 1L9CA 4UVAB 4PK5A 4X1YE 4FK1A 4H7UA 3WAJA 4AKHA 3K7MX 3PU3A 4ADZA 3OPCA 4ZI7E 3CPZA 2PHHA 2BG9B 2IVDA 3GDPA 4OPCA 2VQET 3K8PC 2NW8A 4Z90A 4LFBT 5ABFA 3B13A 3N5LA 3RYIE 2BG9C 4AP1A 4BV6A 4TUYE 4HGAA 4TNVA 2YK0A 3ONJA 4HN9A 4TNWA 3CQCB 5H6QB 1CC2A 3KLJA 2APGA 2DWGA 5FY0A 3P4RA 4ZZCA 4WYVA 4AXPA 4D04A 1AL24 3TLUA 1VBD4 4RG4A 4UV9B 1PBEA 2N9DA 4KMCA 4LF8T 3GYXA 3N2OA 3BI2A 4LF7T 3CKDA 4GCMA 3RC8A 3CVRA 2LKHA 1IUUA 3SUCA 4G6HA 4NIQA 2X5ID 3HKCE 2XLPA 1AOGA 5LMUT 4JV5T 1BGNA 3LADA 4B65A 4IE5A 2V8SV 5KVHA 3T37A 2BCGG 4JLEA 3NTAA 2OLOA 5FP3A 4NEWA 3URHA 4ZXLA 3O1HA 3RHWA 4YJ3E 5L47A 3VQRA 1HX1B 4CY8A 1RUE4 1U5PA 2XSBA 4LF9T 4ZEYA 3T1YT 2GMJA 4EZHA 4YTMA 3KPKA 1D4M4 4JNAA 2R064 1OJAA 2YM1A 2WDRA 3ETVA 4YSYA 4AKGA 1NPXA 4OVIA 3K3NA 2VRMA 1LKXA 5KXJA 2IVEA 1ZP0A 2YOEA 4HWIB 4U2LA 3O1IA 2H7VC 3OJAA 4PK6A 3J8F4 4U8IA 1COYA 4H4XA 1NEKA 2XY8B 2BS4A 1KSUA 4Z8XA 5FVKA 5BRTA 4AKLA 1HYUA 3DK4A 2BG9E 4DNAA 1CUNA 1T7SA 4DV3T 1CBOA 1PXBA 3T2YA 4UV8B 2W63A 5L4HA 3FB2A 2BRYA 1NG3A 4G73A 3DJBA 1V9DA 3CNTA 5LG4A 3NYFA 2E9XA 3PE0A 3H37A 4O2BE 3AA7B 1EV14 1KNRA 5HXHA 3UKKA 4O8SA 5AQIB 2AE9A 2VVLG 3S4UA 3QNUA 3PUYF 3AXJB 1E2AA 2ZM8A 4KX6A 4ICYA 3ZC1A 2VZ2A 2D9DA 2Z5YA 1XWMA 1OJTA 3PU8A 2E9XD 3EABA 4O4IE 4XAXB 5IWAT 2B7SA 3CPHG 4QXHB 3GYJA 1FIOA 2BBHA 4XZCA 5FY7A 1ZDLA 4EM4A 2QA7A 4EQXA 3RP8A 1T8BA 2BA9A 4PJLA 4A6NA 4PABA 3UULA 2X9WA 2UUBT 2DNXA 2X0HA 2E1MA 4ZCCA 4DR3T 2V1DB 2NW9A 2LRLA 1XMQT 4EAHA 3RP7A 3UOVA 3OVUA 3NWIA 4EQWA 4JQ9A 2Y6RA 3T2ZA 2ZZCA 3UTEA 1UK5A 5BVAA 2XAFB 2P9BA 5L3FB 4GKJT 2Q0LA 2A89A 2CHOA 5AQGB 4JI8T 3RC3A 1RUI4 2YM2A 2WSSV 4JY2A 3IWAA 3B6DA 3PJAA 3IC9A 4X9NA 1VOMA 3QJ4A 3AE6A 3LK2B 3UTKA 3SY4A 2YVJA 5AQJB 3ITJA 1XZYA 1R084 3RQWA 2XQYA 4U33A 2JQ9A 2C5IT 3OZ2A 4Z25A 5FS6A 1KF6A 4OX9T 4AQGA 2GQWA 3TKLB 5AQMB 1B4VA 4YFSA 3RF1A 5IQ4A 2DI4A 5LXTE 2JAEA 4YXDA 4PNIA 5HXEA 3HYWA 4ILUA 4A5XA 3M12A 4CBQA 3RYHE 4J2CA 2YWLA 3B5MA 2R9ZA 2CWOA 3SZWA 3NLCA 2ES0A 2BC1A 3AE1A 5LMNT 1OEDC 2RA1A 1FOHA 3KPFA 2WU5A 3QC9A 2XJ7A 2VURA 4PAGA 2KT9A 1TDKA 3JD74 3II4A 5FS8A 3WAKA 1US7B 2VQ7A 1NHPA 4USRA 5U25A 1QLBA 4PDWD 5TAOA 2WP5A 4BK1A 3Q5DA 2WCAA 3UU8A 2NWBA 5KMQA 3AB3B 2RS14 5FXZA 4U74A 3H3MA 4BA9A 1S2QA 3IA3A 5HYMA 1S3BA 4Q4W4 4XBFB 5AQLB 3QSSA 2FJAA 1QJDA 4U8KA 5GONE 1D1CA 4TLZA 4M1PA 2L3LA 4USQA 2KWIB 1MIVA 4JYAT 1D5TA 1MQTD 1Y56B 4U7YA 4O5UA 2UXCT 2F5ZA 4TLXA 4GKKT 3E08A 2ZM0A 3SZ0A 4UDQA 4ZN0A 1HG2A 4UR9A 4YSZA 2WPFA 4AT0A 2CRBA 1L9EA 2J62A 1RUD4 1LTXR 5L3GB 4H4QA 2IC6A 5H6RB 5F5WA 3DJGX 4UVBB 3SS1A 4B68A 2NTXA 2C0SA 2IHR1 5AQQB 5JRCA 2XQAA 2FJEA 3RYCE 1NAFA 4GIWA 3VKGA 1CJCA 3NVOA 2YDRA 3EAMA 3K7TA 3V5SA 2LJLA 2MOZA 2N1GA 1N32T 3BNMA 1YQ3A 4CN4A 1SE7A 4BJNA 4TZ4C 1E1NA 2R6GF 5FXXA 2B7RA 2CWYA 3PO7A 2XQ9A 4B69A 2CMRA 4CNJA 3LBXB 2DKIA 2BBJA 2E8IA 4H4WA 1GREA 3UTGA 3ESLA 3BQLA 2DCFA 1GRGA 4QX8B 3AA1B 3AAAB 1WFDA 3ZMUB 3ZT6A 4HFDA 2XSAA 5M10A 1M62A 4HB9A 3ONXA 3H8IA 4EYUA 5J1GA 4DR4T 2LFCA 4DR2T 2RS34 3EDUA 5LYJE 3OYZA 4EXTA 2WWUA 3S5WA 3ZCIA 3GMCA 4H4RA 2XVFA 1D1AA 1T98A 5LG3A 3RIUC 1CC6A 2W00A 4JI7T 2BG9A 3NYEA 1IUVA 1GESA 2QGSA 4AI6A 4B66A 4MJWA 4ZI3C 3AXBA 3LFMA 2BVLA 3GWFA 2ZBWA 1O3XA 3RRCA 5CB4E 2V7MA 4LF5T 2GV8A 1Z8UA 4UIGA 3PUAA 3IBPA 1GRTA 1PO14 2LSYA 3QSEA 3EF6A 1UX5A 4CCRA 3ZEFB 3GRSA 4Q4X4 2B9XA 2YN6A 4U8LA 2WQYA 5U1OA 5J0ZA 1WYCA 5J60A 2EQ6A 2V3AA 3GD4A 3CNPA 4H4ZA 2R0PA 2Z6EA 2WP9A 1XNQT 2WBLA 2VKOA 4HWDA 4U3CA 4ZOLE 5EZYE 5JR9B 3CPJG 4JY3A 4U8OA 3NKSA 1PVC4 3FBLA 4JDRA 3ABVA 3A7MA 2VL0A 3Q9DA 5HCMA 1YKEB 4L5GA 2IAKA 3O4XE 4U7IA 4D03A 3K30A 3KV5A 3Q5EA 4DR5T 1DJNA 5U63A 3C64A 4GK0E 2K9AA 1W0AA 3EHZA 2Y48B 4G74A 2BXRA 2J3NA 1COV4 1W0BA 2ZLYA 4IHJE 4XWRA 3ZN1B 3RKGA 2XFUA 4DV0T 4X20E 3ZPOA 3AYIA 3AE5A 4KI0F 2CPTA 3BQKA 5KMPA 2CE7A 1ZKQA 3EUHA 3Q5XA 4IE4A 2WB5A 4IL4A 3OYXA 2XVEA 2GAHB 1S2YA 2RGHA 2R044 1SUMB 2X3NA 5JDQA 5HEHA 2E5VA 5CQFA 4DUYT 3REDA 3ALJA 3SGLA 3T2KA 4AIUA 5M4YA 5KWFA 4QXCB 4TM3A 5JR9A 3NYCA 2QA2A 2M6BA 5JCKA 4OCGA 5HXRA 3C50A 1EZ3A 5L4EA 2C67A 4LFCT 3IF8B 4H4YA 4TWDA 4EMWA 2XUEA 1MOKA 4L9IA 5HEJA 1Y64B 4H4VA 1XHXA 3E0ZA 2IIDA 1K5MD 2LE8A 3BI5A 4CN1A 3L8RA 1H6VA 3N2KE 5KNLA 4H9QC 4HWFA 3UTFA 1ZOVA 3KV4A 3UQ7A 3PV0F 4QKNA 2D5UA 4TWHA 5HAXA 2WMNA 3N9LA 1I94T 4IDQA 3RRWA 1ZMDA 2XLSA 1PN0A 5LHGB 2X9XA 4XWZA 3BNUA 2VKHA 5BMVE 1PBDA 3U3IA 2KMFA 3AECA 4I43B 1GT8A 4U8NA 1WRDA 2TMDA 2C7GA 2V6YA 3QFAA 5ADXL 3I0OA 1K0IA 4PFPA 5EB4A 3L3PA 2JKCA 5LNKA 2AQJA 4CXXA 1LV0A 1GSNA 2JB1A 2PYJA 5F3JA 3P9UA 1IJ5A 4MBQA 4IDOA 5JR9C 4KP3C 4MALA 2ODUA 3KVEA 1GRFA 4N9XA 3DP7A 5AQUB 4QH1A 2W61A 2PFVA 3CNSA 3LDQB 1VBA4 2CCQA 2K5BB 3BK9A 4HA6A 3M13A 4EEBA 1RHI4 3CX7B 3M3ZB 4AP3A 3FHNA 1RYIA 2X8GA 1BR1A 4GB34 2WPEA 4X62T 4J2WA 1TRBA 3V76A 2W0GA 4WX1A 5AQKB 2IC9A 4I58A 4Y4MA 3QB5K 4A98A 2J47A 3I9WA 3E1TA 3G5RA 3KV6A 2DL1A 1BR2A 2W62A 1EBDA 2XVJA 2Q6UA 3AWIA 3GQKA 4TWFA 3ICTA 4LMJA 5FS9A 5CGMA 3AAIA 2XPKA 1GXFA 2WZIA 2XAGB 4RSLA 2F4VT 3VRDB 1IBMT 1Q9IA 3AEFA 4U2SA 3RNMA 1QSDA 5J2UE 3NNEA 1HNWT 2W2UA 2K24A 5HEUA 4OPIA 5IPYA 1BGJA 4H50A 1L0VA 4IL9A 2C70A 2VRLA 2VOUA 4DV5T 4LU6A 2PJQA 2GMHA 3VU7H 4B64A 3QVRA 4AKRB 4U8PA 3CX6B 1VRH4 2YU2A 1DODA 2V7JA 4JI5T 2X0YA 1KK7A 2H7OA 2KINB 5C8YE 3CIRA 3RGLA 2I59A 1JNZA 4ILBA 3NT6A 4Z24A 4CXYA 2C3DA 3NH3X 1BR4A 5HXCA 3ZYLA 3G5SA 3J7Yq 4B3ST 2V5DA 3FBZA 4G2AA 4C5OA 2LSGA 3FG2P 3AVRA 2GR3A 1PJ5A 2Y6XA 1NCQD 2PG8A 4YY3T 1NHSA 4IDNA 4AKIA 4YT0A 1FCDA 3Q6JA 4WNKA 5IHYA 3ATQA 2WM9A 2YAUA 4COFA 4Z44A 1ASJ4 3IHMA 3KFWX 4B3RT 1MXTA 4DSHA 3UOYA 1SA0E 5LHHB 1HS7A 5JVDE 2W4XA 3MJXA 4OFZA 2WBAA 5ABFB 3PUGA 4I0UA 5L2LA 2E5LT 2YR4A 4OPGA 2YG4A 2JRKA 2YLTA 4HE8A 5LV9A 4K0UA 2L9QA 3F8PA 1G8XA 5KRQA 1JRZA 3PUWF 3BQIA 1IAPA 1VG9A 5JDMA 2ZZ0A 4OPTA 1N33T 5A1LA 4OPUA 5LP6E 1CF3A 4BURA 4H9PC 2LSIA 1OXZA 2C65A 1VBC4 4IA6A 4NXMT 1XPQA 3QSMA 4LIIA 4QX7B 3ANWA 2C73A 3SM8A 5LJNA 3CNDA 1IUWA 2XVIA 4HFIA 2E2AA 5L3BB 1N1PA 3C96A 2PYLA 3HR0A 3GDNA 3I3LA 1CJ3A 2AAQA 5L3EB 4JUYA 4OYKA 5ABHA 3N9OA 1FJGT 1M7KA 2CEAA 1BF3A 4K5RA 4KUMB 3FZKB 1NDAA 3JSKA 1VG0A 2QAEA 3LK3B 4EV6A 2MYSA 2X8HA 2HWC4 1H83A 3KVAA 4NXNT 1OEDA 3HZLA 4JI0T 4HWCA 3LSVA 2A3DA 1F8RA 4Z91A 4ZI2D 4ISTA 4EM3A 2JBVA 4EIWA 3L8KA 4O4HE 4X5TA 2Y6QA 4X9MA 2NP9A 1E1MA 1X31B 3KD9A 3I0QA 5AQVB 1HNZT 4GUVA 3RHAA 1OWAA 1OJDA 1PXCA 2H88A 2G0UA 4H2PA 2YR6A 2UXXB 4JI6T 5JDLA 3QFBA 5FXWA 4B3TT 1ONFA 2UUAT 5ER0A 4X4JA 3ZT7A 3LK42 4JEHB 4GAVA 2PLV4 3C98B 4X64T 1NA1D 1GEUA 1O94A 3UCLA 2BS2A 3N2GE 3AEGA 5AQHB 2C64A 1AR84 3ZMZB 4ILAA 1RUH4 2PW9A 5C2TA 4FI5A 4I4TE 5KVIA 2VVSA 5HWYA 2W67A 2WOIA 2EX3A 3K7QX 4BK2A 3CQGB 4EIPA 3GWDA 5AQFB 1Z7S4 4U8MA 2OLTA 4DV7T 3N9PA 1X79A 2J1DG 2C3CA 3AE8A 3HL6A 2JB3A 3EAOA 1WCRA 2YG5A 2YVFA 2WHDA 2KXPB 1OOPD 3H3AA 1ZK7A 1DU2A 4GDEA 1N4WA 2A87A 4AT2A 3P4SA 4JN9A 3LG7A 5IYZE 4A9WA 4DIDB 4LFAT 1UGOA 1IJHA 3AD9B 2BKPA 3K3QC 1PBFA 3HA4A 2EHOD 2EQ9A 2YKSA 5KOWA 3CNJA 2XFQA 2YQUA 2C76A 1VQWA 4U2ZA 4YSHA 2K48A 4Y4LA 4O2AE 3B57A 1HRV4 4ZHQE 5C3JA 2QRXA 1N34T 1Y0PA 4QWNB 2CVJA 2EHOA 4CI1B 5FVLA 4KPRA 3AYJA 4BK3A 5AQSB 4U8JA 4RHV4 2GQFA 5LA6E 5AFUL 4YJ2E 2X67A 2R45A 4I59A 3PUSA 1H7WA 5LCYA 4DV2T 2I6HA 1M64A 1MNEA 3SYIA 4Z26A 3SFDA 2OA5A 5KOXA 4CI2B 4HEAA 3N9QA 3I9YA 3UTHA 4OK0A 3KDSE 4CCQA 2JK6A 1YKHB 1MMNA 3RIFA 3ZC0A 3ADAB 2PTFA 2EHOC 2VVNA 2XQ8A 4DMVA 4TV9E 2BKOA 5LHIB 2BZBA 3W15B 4PAAA 4Z2RA 1MNDA 1Z6LA 2IW5B 1D1BA 4BJYA 5L46A 3ZMTB 1ZMCA 4ZI3D 3T1HT 2PZSA 1KNPA 1D0XA 2XLRA 4IDPA 2BYBA 2XAJB 3ETUA 3TLTA 2BK4A 2V6OA 4II2A 2KLQA 2V60A 3ALLA 1NHQA 3GSIA 1E1HB 3SFEA 4DR6T 3ZCJA 4CRTA 1IUTA 3LBXA 3ANWB 2WY2A 4J34A 2B9WA 1TDEA 5FKYA 3FZMB 5E0OA 3JC6D 3UKHA 1PJ7A 1HCIA 2YINA 2V5CA 3UUBA 3C4NA 2NR4A 3SOLA 4YTPA 4QXBB 1PBCA 3SZCA 5KMSA 3O1JA 4JI2T 2R46A 5LB7B 3J9X1 3ZMSB 1EL7A 3RKOA 4H4UA 1VCSA 4OYJA 1GRBA 4HTEA 1EAH4 3NN0X 3DTOA 4DO0A 4Z2TA 1Q1RA 2BK3A 2HWB4 5JTGA 1JRXA 1YQZA 3MKDA 3ZLIA 4WW0A 1Y56A 1UCUA 3I6DA 1NWMX 2VKJA 2HPJA 2VQFT 4CN6A 1KFYA 3CN8A 3UU3A 2XHEB 5FXVA 1WLXA 3LZWA 1YQ4A 3UOZA 2BC0A 2LEHA 3CTYA 4J36A 4YTNA 4DSGA 3BI4A 3PUXF 4TM0A 2XAQB 2WEUA 3ZYKA 4NTDA 1VRBA 2NOXA 4P0AA 4HFEA 3G06A 2CXFA 3MZKB 3AVSA 3QVPA 3AE3A 5FL0A 5BR8T 2XZEA 4JNQA 5AQRB 4E7SA 3GN5B 1AR74 1E39A 3A5XA 1CJ4A 4HFHA 2OALA 1FL2A 1TYTA 2C4CA 5CA0E 2D2SA 4H9RC 4A99A 1DOBA 2BDEA 4X66T 1MO9A 3VRBA 4EGWA 5J7XA 3V3NA 2QCUA 4J33A 3I1AA 4K22A 3UKQA 2C72A 4EB6E 2IMLA 3ZJ1A 2XQ5A 3IHGA 1EL8A 1IBLT 4F8HA 1P2EA 3RP6A 2JJ9A 1DJQA 2EQ8A 3UU6A 4II3A 3AB1A 1F6MA 4IREA 3CGBA 3UOXA 4FDCB 3N9MA 4IA5A 4X1KE 3MACA 2UXBT 4LF6T 3UKPA 2ZM2A 3RX6A 3RPUA 2C75A 1X9BA 2BVMA 2KWHA 2Q9QA 1J1JA 3DH9A 1H81A 2YLZA 1K4QA 1ZOYA 2JMKA 2X9HA 5LJMA 2GR1A 4UP3A 4C77A 1NAAA 5HEGA 2D0TA 3OC4A 1AR94 3C4AA 2X9YA 3ZN0B 3AEBA 4KHPT 2BK5A 5IUXA 3K3OA 4O4LE 4H63V 1IZNB 3PJAJ 4QH4A 1ZHCA 1TDNA 2LSJA 2V6XA 2LLYA 2XQ6A 2RGJA 4TV8E 3HYVA 2HPLA 3KA7A 4H9OC 1PJ6A
chains in the Genus database with same CATH topology
3IWAA 4G6GA 3B6DA 3FG2P 2XVHA 4H2RA 2GB0A 3IC9A 2GR3A 4X9NA 1PJ5A 4NTCA 3QJ4A 3AE6A 4M52A 4NNJA 4J31A 2YVJA 3SY4A 3F8RA 3ITJA 3CPIG 4J56A 4IV9A 3SX6A 3PVCA 1FEBA 1PS9A 1NHSA 2XCGA 3S61A 2GR0A 3OZ2A 3KU9A 4Z25A 5FS6A 4YT0A 2ZZBA 1XANA 3AD8B 3IF9A 1KF6A 1FCDA 3T31A 2WDQA 2Z5XA 3Q6JA 3CGEA 4C74A 4WCTA 2BXSA 1W4XA 3CGDA 3ATQA 2YAUA 4UDRA 5KMRA 4Z44A 3IHMA 2DKHA 5DBJA 2GQWA 1MXTA 1B4VA 1L9DA 1UKVG 4DSHA 3DGZA 3NG7X 2R4JA 5IQ4A 1E6EA 4H4SA 3UOYA 5FS7A 4AOXA 1N4UA 2JAEA 2UZZA 2X50A 4GAPA 2WBAA 4YXDA 2WETA 3HYWA 4H2NA 2YLWA 4CBQA 3M12A 3GQHA 2YR4A 4OPGA 2YG4A 2YLTA 2XFOA 2YWLA 1JOAA 2BABA 5JCIA 5LV9A 2FJDA 2R9ZA 3F8PA 3SZWA 1GTHA 4A5LA 4ADWA 3NLCA 5KRQA 1JRZA 2BC1A 3AE1A 2EQ7A 1FOHA 3LJPA 2BRAA 1VG9A 3KPFA 2WU5A 4G9KA 2ZZ0A 4OPTA 1TDKA 4GR1A 4OPUA 5EBKA 3II4A 1CF3A 3M0OA 5FS8A 2VQ7A 4B1BA 4BURA 4NEVA 1BKWA 2WU2A 1NHPA 4H4TA 4USRA 4GF7A 5U25A 2C65A 1QLBA 1GRAA 1ELIA 1V59A 4IA6A 1XPQA 3QSMA 3NK0X 4LIIA 2WP5A 4BK1A 4B63A 1LQTA 1K0LA 3NK1X 2C73A 3SM8A 5KMQA 1DOEA 3CNDA 1PDHA 1IUWA 2XVIA 2VVLA 2H89A 1N1PA 2OLNA 3C96A 1S2QA 5HYMA 1S3BA 3QSSA 3GDNA 2FJAA 1QJDA 3I3LA 1CJ3A 4U8KA 2AAQA 2B9YA 1TYPA 1BF3A 4K5RA 1EL9A 3P4QA 1NDAA 3JSKA 4TLZA 2QA1A 1VG0A 2QAEA 5HXIA 4USQA 1D4CA 5CKUA 4A79A 1DOCA 1PHHA 1LPFA 2X8HA 1D5TA 1H83A 1Y56B 1NENA 1GERA 4O5UA 3HZLA 2F5ZA 5TR3A 4TLXA 3SZ0A 1IUSA 2GH5A 4UDQA 4ZN0A 2XYOA 2WP6A 4YSZA 2WPFA 3BHFA 4AT0A 4E0VA 1F8RA 1DXLA 1L9EA 4H4PA 1YY5A 1LTXR 4H4QA 4EM3A 2JBVA 3L8KA 1E1KA 4NWZA 3DJGX 4B68A 2Y6QA 4X9MA 4YWOA 1OJ9A 1E1MA 3DJJA 3DA1A 4OPDA 1X31B 3KD9A 1JEHA 3AE7A 4GUVA 3RHAA 1OJDA 2FJEA 1PXCA 2H88A 3AE4A 2OAMA 3KKJA 4H2PA 2BACA 1CJCA 2YR6A 2YVGA 3F8DA 3ATRA 3NHOX 1XDIA 4Z2UA 4EMJA 5JCNA 2C66A 1TDOA 2FBWA 2Q0KA 3QFBA 3VRAA 3K7TA 3BNMA 1ONFA 1YQ3A 5ER0A 4X4JA 3DK8A 3NGCX 1E1NA 4GAVA 3HYXA 2B7RA 3O0HA 1GNDA 4APNA 3CMMA 3PO7A 3T0KA 3L1RA 4B69A 2YLSA 4CNJA 1GEUA 2DKIA 1O94A 3UCLA 2BS2A 1GTEA 3ALMA 2C64A 3AEGA 1GREA 4H4WA 4K8DA 5GRTA 3UP4A 3UTGA 4P9SA 3DK9A 3D1CA 1GRGA 4EMIA 5C2TA 5KVIA 5JCMA 2WOIA 3K7QX 4BK2A 4EIPA 3GWDA 4CNKA 1REOA 1NHRA 1TDFA 4U8MA 2CFYA 4FX9A 5GSNA 2NPXA 5M10A 3WE0A 4HB9A 4BJZA 3SZFA 2C3CA 3H8IA 1JU2A 1LVLA 2LFCA 4EQSA 3FBSA 4ZCDA 2O9ZA 4REKA 2YG7A 3LZXA 3AE8A 2V3BA 2JB3A 3DMEA 3EAOA 4UDPA 4A7AA 3S5WA 3GMCA 2JB2A 2R0CA 2YG5A 1K0JA 2HQMA 2R4EA 4H4RA 2XVFA 4TM1A 2R0GA 3LXDA 2YVFA 2WHDA 1CC6A 1DNCA 2GAGB 1ZK7A 3NYEA 1IUVA 1GESA 4GDEA 1FECA 1GV4A 2B76A 1B5QA 3EANA 1N4WA 2A87A 3ISHA 3P4SA 1LQUA 4AT2A 4MJWA 4B66A 5BUKA 3AXBA 2TPRA 4JN9A 3ZYXA 3GWFA 2ZBWA 2V5ZA 4A9WA 3GRTA 1VDCA 2GV8A 4NZHA 3LB8A 4K5SA 1GRTA 3AEAA 1IJHA 2WPCA 3NN6X 3FMWA 3AD9B 2PYXA 1CHUA 1PBFA 2GRTA 3ICRA 3QSEA 3EF6A 3UKFA 1PXAA 3H8LA 1YKJA 2WDVA 3Q9TA 2EQ9A 3ICSA 4CCRA 3GRSA 3UP5A 5KOWA 2ACZA 1O5WA 1KSSA 2B9XA 1BWCA 3CNJA 4J57A 2XFQA 2GVCA 2WQYA 4U8LA 5U1OA 2Q7VA 2YQUA 5FMHA 1ZY8A 1VQWA 2C76A 5J60A 2EQ6A 4YSHA 3DJEA 3NRNA 4Y4LA 1JNRA 2V3AA 3GD4A 1LJ1A 4TM4A 3CNPA 2AR8A 1N4VA 3AEDA 5C3JA 2YR5A 1CC4A 3SXIA 1Y0PA 2CVJA 2R0PA 3PS9A 4H4ZA 1S3EA 4LA1A 2WP9A 1CJ2A 4JY3A 3GQKA 2CULA 4U8OA 3CPJG 3NKSA 4KPRA 3AYJA 4BK3A 3ZDNA 4JDRA 3ABVA 4U8JA 1D7YA 2GQFA 3UKLA 5BULA 5M0ZA 2X8CA 4K7ZA 4YSXA 3K30A 4D03A 3AE2A 1DJNA 5U63A 2R45A 4I59A 1H84A 4Y4NA 1H7WA 2W0HA 4G74A 2BXRA 1M64A 3SYIA 4Z26A 3EPTA 3SFDA 2E4GA 5HHFA 1Q1WA 2J3NA 3H4KA 5KOXA 3R9UA 4XWRA 3UTHA 4CCQA 5JCLA 2JK6A 2CDUA 2XFUA 4GDPA 3AYIA 3AE5A 3ADAB 1PBBA 3CGCA 2GR2A 5KMPA 3P4PA 1ZKQA 4PAAA 2X99A 1GPEA 3GMBA 1NG4A 1Z6LA 1XHCA 3FIMB 4EIQA 4Z2RA 1D4DA 2OA1A 2XVEA 4BJYA 2GAHB 1S2YA 2RGHA 2V61A 5HY5A 5L46A 5EB5A 1F8SA 2X3NA 1ZMCA 3LOVA 1RSGA 3B3RA 1L9CA 2E5VA 5CQFA 1KNPA 3REDA 3ALJA 2XLRA 3SGLA 3T2KA 2YLXA 4A6NB 2WS3A 4FK1A 2YG3A 4H7UA 2BYBA 3K7MX 5KWFA 2V6OA 2BK4A 3BHKA 4TM3A 3NYCA 4II2A 3ALLA 2V60A 2PHHA 2QA2A 4OPLA 1NHQA 3GSIA 2IVDA 5JCKA 3SFEA 3GDPA 4OCGA 3COXA 4CRTA 4OPCA 1IUTA 4K2XA 4U2TA 2C67A 2WOWA 4H4YA 4EMWA 4J34A 1O95A 2GF3A 3DJDA 2B9WA 1MOKA 1TDEA 1EL5A 4H4VA 4AP1A 2IIDA 4BV6A 1KDGA 3UKHA 1PJ7A 3BI5A 1H6VA 5KNLA 1GALA 3VR9A 1ZOVA 3UTFA 3V3OA 3C4NA 4NTEA 1OJCA 3NK2X 1F8WA 4YTPA 1CL0A 3SZCA 1PBCA 5KMSA 1ZMDA 1CC2A 2R46A 1D4EA 3KLJA 2APGA 1EL7A 3P4RA 2XLSA 1PN0A 3UKAA 4H4UA 4XWZA 3BNUA 4D04A 1PBDA 3AECA 4RG4A 1GT8A 4U8NA 4IVMB 1GRBA 1PBEA 2TMDA 2C7GA 3QFAA 1K0IA 3NN0X 4Z2TA 5EB4A 3GYXA 1Q1RA 2BK3A 1JRXA 3BI2A 1YQZA 3NIXA 2XFNA 4GCMA 1Y56A 2AQJA 2JKCA 3G5QA 3P1WA 1IUUA 1LV0A 1GSNA 2JB1A 3I6DA 3T14A 4G6HA 3SUCA 2FJBA 1QO8A 1RP0A 1KFYA 3CN8A 3GYIA 3LZWA 3P9UA 1YQ4A 1SEZA 2XLPA 1GRHA 1AOGA 3UOZA 4DGKA 2BC0A 1BGNA 3LADA 4EQRA 4B65A 4C3YA 5KVHA 4FK1C 2BCGG 3T37A 3CTYA 3KVEA 2OLOA 3NTAA 4GRTA 4NEWA 3URHA 1GRFA 4N9XA 4J36A 2YG6A 4YTNA 3VQRA 4DSGA 3CNSA 3BI4A 4CY8A 1BZLA 4TM0A 4ECHA 2NVKX 2GMJA 2WEUA 4YKGA 4YTMA 2YLRA 4NTDA 4HA6A 3M13A 3KPKA 4JNAA 1OJAA 4AP3A 2YM1A 2WDRA 4YSYA 3QVPA 3AE3A 1NPXA 4YKFA 4OVIA 1RYIA 2X8GA 4JNQA 2VVMA 2VRMA 2GEWA 5KXJA 2IVEA 1ZP0A 2WPEA 1E39A 4U2LA 2WOVA 1CJ4A 4J2WA 2OALA 4U8IA 4C3XA 1FL2A 1E1LA 1COYA 4H4XA 1NEKA 2C4CA 1H86A 1TRBA 1TYTA 3V76A 2BS4A 1KSUA 4A99A 4WX1A 1DOBA 1MO9A 2RGOA 5BRTA 3VRBA 1HYUA 5J7XA 3V3NA 2QCUA 3DK4A 4I58A 4Y4MA 4DNAA 4J33A 1D7LA 1CBOA 1PXBA 4K22A 3E1TA 3G5RA 4RG3A 3T2YA 3GD3A 1EBDA 1E7PA 2XVJA 2C72A 2Q6UA 2WESA 3AWIA 3UKQA 3ICTA 5IQ1A 3IHGA 1EL8A 2BRYA 5FS9A 1NG3A 1GOSA 2I0ZA 3NTDA 4G73A 3CNTA 1P2EA 3RP6A 1GXFA 3NYFA 1DJQA 2EQ8A 4II3A 2XLTA 2ARDA 3AB1A 4CY6A 1F6MA 4RSLA 1KNRA 3UKKA 3VRDB 3CGBA 1Q9IA 2VVLG 3UOXA 3AEEA 3AEFA 4U2SA 2RABA 4FDCB 4KX6A 4ICYA 4XXGA 3RNMA 3VR8A 2VZ2A 4IA5A 3NNEA 4O5QA 2Z5YA 3DGHA 1H82A 1OJTA 4B67A 2B7SA 3CPHG 4AOSA 4OPIA 3GYJA 3UKPA 4H2QA 1BGJA 4H50A 5IPYA 1L0VA 2C70A 2VRLA 2C75A 1ZDLA 2VOUA 4EM4A 1VRQB 3AE9A 3AD7B 3D8XA 4EQXA 3DH9A 1H81A 1P2HA 2XDOA 2YLZA 2A8XA 1K4QA 4LU6A 3RP8A 2GMHA 1ZOYA 2BA9A 1B37A 4UP3A 2GR1A 4PABA 1F3PA 4A6NA 1JRYA 4C77A 4B64A 1NAAA 2E1MA 3QVRA 5EOWA 4ZCCA 4U8PA 3OC4A 4Z43A 2BCPA 3C4AA 3AEBA 2BK5A 3RP7A 2VQBA 3UOVA 1B8SA 1DODA 3SQPA 1ZX9A 3FPZA 2XFPA 4EQWA 1IUXA 4JQ9A 1M6IA 3AYLA 2Y6RA 1TDNA 1FEAA 2ZZCA 3T2ZA 4A65A 3UTEA 1H7XA 5BVAA 3CIRA 3NT6A 1GETA 1JNZA 4Z24A 2Q0LA 2XLUA 2A89A 2C3DA 3NH3X 3G5SA 2BS3A 2RGJA 2YM2A 3HYVA 4IVOB 3KA7A 4C5OA 4JY2A 1PJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWA A;  3B6D A;  3FG2 P;  2XVH A;  4H2R A;  2GB0 A;  3IC9 A;  2GR3 A;  4X9N A;  1PJ5 A;  4NTC A;  3QJ4 A;  3AE6 A;  4M52 A;  4J31 A;  2YVJ A;  3F8R A;  3ITJ A;  3CPI G;  4J56 A;  4IV9 A;  3PVC A;  1FEB A;  1PS9 A;  1NHS A;  2XCG A;  3S61 A;  2GR0 A;  3OZ2 A;  3KU9 A;  4Z25 A;  5FS6 A;  4YT0 A;  2ZZB A;  1XAN A;  3AD8 B;  3IF9 A;  1KF6 A;  1FCD A;  2WDQ A;  2Z5X A;  3Q6J A;  3CGE A;  4C74 A;  4WCT A;  2BXS A;  1W4X A;  3CGD A;  3ATQ A;  2YAU A;  4UDR A;  4Z44 A;  3IHM A;  2DKH A;  5DBJ A;  2GQW A;  1MXT A;  1B4V A;  1L9D A;  1UKV G;  4DSH A;  3DGZ A;  3NG7 X;  2R4J A;  5IQ4 A;  1E6E A;  4H4S A;  3UOY A;  5FS7 A;  4AOX A;  1N4U A;  2JAE A;  2UZZ A;  2X50 A;  2WBA A;  4YXD A;  2WET A;  4H2N A;  2YLW A;  4CBQ A;  3M12 A;  3GQH A;  2YR4 A;  4OPG A;  2YG4 A;  2YLT A;  2XFO A;  2YWL A;  1JOA A;  2BAB A;  5JCI A;  5LV9 A;  2FJD A;  2R9Z A;  3F8P A;  4A5L A;  1GTH A;  4ADW A;  3NLC A;  5KRQ A;  1JRZ A;  2BC1 A;  3AE1 A;  2EQ7 A;  1FOH A;  3LJP A;  1VG9 A;  3KPF A;  2WU5 A;  2ZZ0 A;  4OPT A;  1TDK A;  4GR1 A;  4OPU A;  5EBK A;  3II4 A;  1CF3 A;  3M0O A;  5FS8 A;  2VQ7 A;  4B1B A;  4BUR A;  4NEV A;  1BKW A;  2WU2 A;  1NHP A;  4H4T A;  4USR A;  4GF7 A;  5U25 A;  2C65 A;  1QLB A;  1GRA A;  1ELI A;  1V59 A;  4IA6 A;  1XPQ A;  3QSM A;  3NK0 X;  4LII A;  2WP5 A;  4BK1 A;  4B63 A;  1LQT A;  1K0L A;  3NK1 X;  2C73 A;  3SM8 A;  1DOE A;  3CND A;  1PDH A;  1IUW A;  2XVI A;  2VVL A;  2H89 A;  1N1P A;  2OLN A;  3C96 A;  1S2Q A;  5HYM A;  1S3B A;  3QSS A;  3GDN A;  2FJA A;  1QJD A;  3I3L A;  1CJ3 A;  4U8K A;  2AAQ A;  2B9Y A;  1TYP A;  1BF3 A;  4K5R A;  1EL9 A;  3P4Q A;  1NDA A;  3JSK A;  4TLZ A;  2QA1 A;  1VG0 A;  2QAE A;  5HXI A;  4USQ A;  1D4C A;  5CKU A;  4A79 A;  1DOC A;  1PHH A;  1LPF A;  2X8H A;  1D5T A;  1H83 A;  1Y56 B;  1NEN A;  1GER A;  4O5U A;  3HZL A;  2F5Z A;  5TR3 A;  4TLX A;  1IUS A;  2GH5 A;  4UDQ A;  4ZN0 A;  2XYO A;  2WP6 A;  4YSZ A;  2WPF A;  3BHF A;  4AT0 A;  4E0V A;  1F8R A;  1DXL A;  1L9E A;  4H4P A;  1YY5 A;  1LTX R;  4H4Q A;  4EM3 A;  2JBV A;  3L8K A;  1E1K A;  3DJG X;  4B68 A;  2Y6Q A;  4X9M A;  4YWO A;  1OJ9 A;  1E1M A;  3DJJ A;  3DA1 A;  4OPD A;  1X31 B;  3KD9 A;  1JEH A;  3AE7 A;  4GUV A;  3RHA A;  1OJD A;  2FJE A;  1PXC A;  2H88 A;  3AE4 A;  2OAM A;  3KKJ A;  4H2P A;  2BAC A;  1CJC A;  2YR6 A;  2YVG A;  3F8D A;  3ATR A;  3NHO X;  1XDI A;  4Z2U A;  4EMJ A;  5JCN A;  2C66 A;  1TDO A;  2FBW A;  2Q0K A;  3QFB A;  3VRA A;  3K7T A;  3BNM A;  1ONF A;  1YQ3 A;  5ER0 A;  4X4J A;  3DK8 A;  3NGC X;  1E1N A;  2B7R A;  3O0H A;  1GND A;  4APN A;  3PO7 A;  3L1R A;  4B69 A;  2YLS A;  4CNJ A;  1GEU A;  2DKI A;  1O94 A;  3UCL A;  2BS2 A;  1GTE A;  3ALM A;  2C64 A;  3AEG A;  1GRE A;  4H4W A;  4K8D A;  5GRT A;  3UP4 A;  3UTG A;  4P9S A;  3DK9 A;  3D1C A;  1GRG A;  4EMI A;  5C2T A;  5KVI A;  5JCM A;  2WOI A;  3K7Q X;  4BK2 A;  4EIP A;  3GWD A;  4CNK A;  1REO A;  1NHR A;  1TDF A;  4U8M A;  2CFY A;  4FX9 A;  5GSN A;  2NPX A;  5M10 A;  3WE0 A;  4HB9 A;  4BJZ A;  2C3C A;  3H8I A;  1JU2 A;  1LVL A;  2LFC A;  4EQS A;  3FBS A;  4ZCD A;  2O9Z A;  4REK A;  2YG7 A;  3LZX A;  3AE8 A;  2V3B A;  2JB3 A;  3DME A;  3EAO A;  4UDP A;  4A7A A;  3S5W A;  3GMC A;  2JB2 A;  2R0C A;  2YG5 A;  1K0J A;  2HQM A;  2R4E A;  4H4R A;  2XVF A;  4TM1 A;  2R0G A;  3LXD A;  2YVF A;  2WHD A;  1CC6 A;  1DNC A;  2GAG B;  1ZK7 A;  3NYE A;  1IUV A;  1GES A;  4GDE A;  1FEC A;  1GV4 A;  2B76 A;  1B5Q A;  3EAN A;  1N4W A;  2A87 A;  3ISH A;  3P4S A;  1LQU A;  4AT2 A;  4MJW A;  4B66 A;  5BUK A;  3AXB A;  2TPR A;  4JN9 A;  3ZYX A;  3GWF A;  2ZBW A;  2V5Z A;  4A9W A;  3GRT A;  1VDC A;  2GV8 A;  4NZH A;  3LB8 A;  4K5S A;  1GRT A;  3AEA A;  1IJH A;  2WPC A;  3NN6 X;  3FMW A;  3AD9 B;  2PYX A;  1CHU A;  1PBF A;  2GRT A;  3ICR A;  3QSE A;  3EF6 A;  3UKF A;  1PXA A;  3H8L A;  1YKJ A;  2WDV A;  3Q9T A;  2EQ9 A;  3ICS A;  4CCR A;  3GRS A;  3UP5 A;  5KOW A;  2ACZ A;  1O5W A;  1KSS A;  2B9X A;  1BWC A;  3CNJ A;  4J57 A;  2XFQ A;  2GVC A;  2WQY A;  4U8L A;  5U1O A;  2Q7V A;  2YQU A;  5FMH A;  1ZY8 A;  1VQW A;  2C76 A;  5J60 A;  2EQ6 A;  4YSH A;  3DJE A;  3NRN A;  4Y4L A;  1JNR A;  2V3A A;  3GD4 A;  1LJ1 A;  4TM4 A;  3CNP A;  2AR8 A;  1N4V A;  3AED A;  5C3J A;  2YR5 A;  1CC4 A;  1Y0P A;  2CVJ A;  2R0P A;  3PS9 A;  4H4Z A;  1S3E A;  4LA1 A;  2WP9 A;  1CJ2 A;  4JY3 A;  3GQK A;  2CUL A;  4U8O A;  3CPJ G;  3NKS A;  4KPR A;  3AYJ A;  4BK3 A;  3ZDN A;  4JDR A;  3ABV A;  4U8J A;  1D7Y A;  2GQF A;  3UKL A;  5BUL A;  5M0Z A;  2X8C A;  4K7Z A;  4YSX A;  3K30 A;  4D03 A;  3AE2 A;  1DJN A;  5U63 A;  2R45 A;  4I59 A;  1H84 A;  4Y4N A;  1H7W A;  2W0H A;  2BXR A;  1M64 A;  4Z26 A;  3EPT A;  3SFD A;  2E4G A;  5HHF A;  1Q1W A;  2J3N A;  3H4K A;  5KOX A;  3R9U A;  4XWR A;  3UTH A;  4CCQ A;  5JCL A;  2JK6 A;  2CDU A;  2XFU A;  4GDP A;  3AYI A;  3AE5 A;  3ADA B;  1PBB A;  3CGC A;  2GR2 A;  3P4P A;  1ZKQ A;  4PAA A;  2X99 A;  1GPE A;  3GMB A;  1NG4 A;  1Z6L A;  1XHC A;  3FIM B;  4EIQ A;  4Z2R A;  1D4D A;  2OA1 A;  2XVE A;  4BJY A;  2GAH B;  1S2Y A;  2RGH A;  2V61 A;  5HY5 A;  5L46 A;  5EB5 A;  1F8S A;  2X3N A;  1ZMC A;  3LOV A;  1RSG A;  3B3R A;  1L9C A;  2E5V A;  5CQF A;  1KNP A;  3RED A;  3ALJ A;  2XLR A;  3SGL A;  2YLX A;  4A6N B;  2WS3 A;  4FK1 A;  2YG3 A;  4H7U A;  2BYB A;  3K7M X;  5KWF A;  2V6O A;  2BK4 A;  3BHK A;  4TM3 A;  3NYC A;  4OPL A;  3ALL A;  2V60 A;  2PHH A;  2QA2 A;  1NHQ A;  3GSI A;  2IVD A;  5JCK A;  3SFE A;  3GDP A;  4OCG A;  3COX A;  4CRT A;  4OPC A;  1IUT A;  4K2X A;  4U2T A;  2C67 A;  2WOW A;  4H4Y A;  4EMW A;  4J34 A;  1O95 A;  2GF3 A;  3DJD A;  2B9W A;  1MOK A;  1TDE A;  1EL5 A;  4H4V A;  4AP1 A;  2IID A;  4BV6 A;  1KDG A;  3UKH A;  1PJ7 A;  3BI5 A;  1H6V A;  1GAL A;  3VR9 A;  1ZOV A;  3UTF A;  3V3O A;  3C4N A;  4NTE A;  1OJC A;  3NK2 X;  1F8W A;  4YTP A;  1CL0 A;  1PBC A;  1ZMD A;  1CC2 A;  2R46 A;  1D4E A;  3KLJ A;  2APG A;  1EL7 A;  3P4R A;  2XLS A;  1PN0 A;  3UKA A;  4H4U A;  4XWZ A;  3BNU A;  4D04 A;  1PBD A;  3AEC A;  4RG4 A;  1GT8 A;  4U8N A;  4IVM B;  1GRB A;  1PBE A;  2TMD A;  2C7G A;  3QFA A;  1K0I A;  3NN0 X;  4Z2T A;  5EB4 A;  3GYX A;  1Q1R A;  2BK3 A;  1JRX A;  3BI2 A;  1YQZ A;  3NIX A;  2XFN A;  4GCM A;  1Y56 A;  2AQJ A;  2JKC A;  3G5Q A;  3P1W A;  1IUU A;  1LV0 A;  1GSN A;  2JB1 A;  3I6D A;  3SUC A;  2FJB A;  1QO8 A;  1RP0 A;  1KFY A;  3CN8 A;  3GYI A;  3LZW A;  3P9U A;  1YQ4 A;  1SEZ A;  2XLP A;  1GRH A;  1AOG A;  3UOZ A;  4DGK A;  2BC0 A;  1BGN A;  3LAD A;  4EQR A;  4B65 A;  4C3Y A;  5KVH A;  4FK1 C;  2BCG G;  3T37 A;  3CTY A;  3KVE A;  2OLO A;  3NTA A;  4GRT A;  4NEW A;  3URH A;  1GRF A;  4N9X A;  4J36 A;  2YG6 A;  4YTN A;  3VQR A;  4DSG A;  3CNS A;  3BI4 A;  4CY8 A;  1BZL A;  4TM0 A;  4ECH A;  2NVK X;  2GMJ A;  2WEU A;  4YKG A;  4YTM A;  2YLR A;  4NTD A;  4HA6 A;  3M13 A;  4JNA A;  1OJA A;  4AP3 A;  2YM1 A;  2WDR A;  4YSY A;  3QVP A;  3AE3 A;  1NPX A;  4YKF A;  4OVI A;  1RYI A;  2X8G A;  4JNQ A;  2VVM A;  2VRM A;  2GEW A;  5KXJ A;  2IVE A;  1ZP0 A;  2WPE A;  1E39 A;  4U2L A;  2WOV A;  1CJ4 A;  4J2W A;  2OAL A;  4U8I A;  4C3X A;  1FL2 A;  1E1L A;  1COY A;  4H4X A;  1NEK A;  1H86 A;  1TRB A;  1TYT A;  3V76 A;  2BS4 A;  1KSU A;  4A99 A;  4WX1 A;  1DOB A;  1MO9 A;  2RGO A;  5BRT A;  3VRB A;  1HYU A;  5J7X A;  3V3N A;  2QCU A;  3DK4 A;  4I58 A;  4Y4M A;  4DNA A;  4J33 A;  1D7L A;  1CBO A;  1PXB A;  4K22 A;  3E1T A;  3G5R A;  4RG3 A;  3GD3 A;  1EBD A;  1E7P A;  2XVJ A;  2C72 A;  2Q6U A;  2WES A;  3AWI A;  3UKQ A;  3ICT A;  5IQ1 A;  3IHG A;  1EL8 A;  5FS9 A;  1NG3 A;  1GOS A;  2I0Z A;  3NTD A;  3CNT A;  1P2E A;  3RP6 A;  1GXF A;  3NYF A;  1DJQ A;  2EQ8 A;  2XLT A;  2ARD A;  3AB1 A;  4CY6 A;  1F6M A;  4RSL A;  1KNR A;  3UKK A;  3VRD B;  3CGB A;  1Q9I A;  2VVL G;  3UOX A;  3AEE A;  3AEF A;  4U2S A;  2RAB A;  4FDC B;  4KX6 A;  4ICY A;  4XXG A;  3RNM A;  3VR8 A;  2VZ2 A;  4IA5 A;  3NNE A;  4O5Q A;  2Z5Y A;  3DGH A;  1H82 A;  1OJT A;  4B67 A;  2B7S A;  3CPH G;  4AOS A;  4OPI A;  3GYJ A;  3UKP A;  4H2Q A;  1BGJ A;  4H50 A;  5IPY A;  1L0V A;  2C70 A;  2VRL A;  2C75 A;  1ZDL A;  2VOU A;  4EM4 A;  1VRQ B;  3AE9 A;  3AD7 B;  3D8X A;  4EQX A;  3DH9 A;  1H81 A;  1P2H A;  2XDO A;  2YLZ A;  2A8X A;  1K4Q A;  4LU6 A;  3RP8 A;  2GMH A;  1ZOY A;  2BA9 A;  1B37 A;  4UP3 A;  2GR1 A;  4PAB A;  1F3P A;  4A6N A;  1JRY A;  4C77 A;  4B64 A;  1NAA A;  2E1M A;  3QVR A;  5EOW A;  4ZCC A;  4U8P A;  3OC4 A;  4Z43 A;  2BCP A;  3C4A A;  3AEB A;  2BK5 A;  3RP7 A;  2VQB A;  3UOV A;  1B8S A;  1DOD A;  3SQP A;  1ZX9 A;  3FPZ A;  2XFP A;  4EQW A;  1IUX A;  4JQ9 A;  1M6I A;  3AYL A;  2Y6R A;  1TDN A;  1FEA A;  2ZZC A;  4A65 A;  3UTE A;  1H7X A;  5BVA A;  3CIR A;  3NT6 A;  1GET A;  1JNZ A;  4Z24 A;  2Q0L A;  2XLU A;  2A89 A;  2C3D A;  3NH3 X;  3G5S A;  2BS3 A;  2RGJ A;  2YM2 A;  4IVO B;  3KA7 A;  4C5O A;  4JY2 A;  1PJ6 A; 
#chains in the Genus database with same CATH topology
 4G6G A;  4DV1 T;  2XVH A;  4H2R A;  1RUF 4;  2GB0 A;  4NTC A;  3M65 A;  2D0U A;  4NNJ A;  4J31 A;  2LM9 A;  1Z0P A;  3CPI G;  4J56 A;  4IV9 A;  3SX6 A;  3F31 A;  1FEB A;  1PS9 A;  2XCG A;  3S61 A;  4KBM B;  2UUC T;  5FY1 A;  2ZZB A;  3AD8 B;  3IF9 A;  3T31 A;  3PTR B;  2WDQ A;  2Z5X A;  4C74 A;  2CXL A;  3K1S A;  3CGD A;  5KMR A;  4ZI2 C;  1L9D A;  3NG7 X;  2R4J A;  1ZV4 X;  1E6E A;  4H4S A;  4BJM A;  2BKN A;  5AQN B;  2UZZ A;  2X50 A;  4GAP A;  3GA8 A;  4NPP A;  3KIN B;  4CI3 B;  2OV9 A;  4ILC A;  4YHH T;  3X1D A;  4L0R A;  2YLW A;  1HXS 4;  3GQH A;  4MLK A;  4DVD A;  2V7I A;  4EED A;  2XFO A;  5JCI A;  2ODV A;  3P50 A;  4ADW A;  1HTJ F;  1GTH A;  3D0T A;  3CQX C;  2L8K A;  1W09 A;  5ABE A;  3LJP A;  3L39 A;  2XM1 A;  3EDV A;  3JBG 4;  4GR1 A;  4B1B A;  3M0O A;  4NEV A;  1BKW A;  3FI7 A;  4GF7 A;  5JRE A;  1XMO T;  3F57 A;  3RH3 A;  1ELI A;  3R6N A;  3HKD E;  3NK0 X;  4IDZ A;  4B63 A;  5HYA A;  1DOE A;  1PDH A;  4I50 E;  2VVL A;  1XNR T;  2CBI A;  2HH7 A;  4ANJ A;  2OLN A;  3UUM A;  1R8I A;  3R84 B;  1BR0 A;  4GOU A;  2QA1 A;  5LGN B;  5HXI A;  1D4C A;  1DOC A;  1LPF A;  1GQE A;  5CA1 E;  1Y01 A;  2N2N A;  1NEN A;  1GER A;  4AIS A;  3TLV A;  5DJQ C;  4MFR A;  1IUS A;  2GH5 A;  4UVC B;  2LOP A;  3CWZ B;  4NUU A;  4LF4 T;  3BHF A;  4E0V A;  1D0Z A;  3NZP A;  4EOZ B;  3A8Y C;  4YWO A;  3DJJ A;  1JEH A;  4HFV A;  3AE4 A;  2PBI A;  3F8D A;  2YVG A;  3NRX A;  4CQI A;  2C66 A;  1TDO A;  3JCF A;  2Q0K A;  3VRA A;  2V26 A;  4PJN A;  2R7F A;  3LJC A;  4I55 E;  2ACX A;  3NGC X;  5JDH A;  3HYX A;  4APN A;  3CMM A;  2CA5 A;  3T0K A;  3L1R A;  2YLS A;  1RUJ 4;  2CLY C;  5HCJ A;  3ALM A;  3TLW A;  5GRT A;  3FZF B;  2Q9Q D;  2A72 A;  3KBT A;  3DK9 A;  4P9S A;  3TLS A;  1OED B;  4EMI A;  4JEU B;  5JCM A;  1REO A;  1NHR A;  2CFY A;  4FX9 A;  5GSN A;  4HFC A;  3WE0 A;  4BJZ A;  3U78 A;  2X0L B;  1VCT A;  1MMA A;  3PUV F;  3RI5 A;  1JU2 A;  2O9Z A;  2JQQ A;  4IE6 A;  2V3B A;  2V7K A;  4UDP A;  4A7A A;  3FZL B;  2X51 A;  1K0J A;  2HQM A;  3SRZ A;  2R4E A;  1IJ6 A;  2LHR A;  3JAD A;  5JDG A;  2R0G A;  3LXD A;  4TM1 A;  2QVA A;  3E22 E;  2GAG B;  1GV4 A;  1J5W A;  1B5Q A;  1LQU A;  5BUK A;  1LVF A;  2V5Z A;  2DHR A;  3GRT A;  3LB8 A;  4K5S A;  3UUN A;  2HN1 A;  3AEA A;  2WPC A;  3NN6 X;  5L3D B;  3NRY A;  3FMW A;  2PYX A;  4Q4Y 4;  1XHZ A;  1I6Z A;  4TN7 B;  4DR7 T;  1HFA A;  3UKF A;  3AA6 B;  3Q9T A;  3ZMV B;  4B6X A;  2ACZ A;  1LRZ A;  2E9X B;  1O5W A;  1HRI 4;  1PO2 4;  2GVC A;  4NUV A;  2Q7V A;  1ZY8 A;  1KNZ A;  1JNR A;  5LBM A;  4WBO A;  2H3R A;  4TM4 A;  4JBW F;  1N4V A;  2AR8 A;  3AED A;  1WR0 A;  2NTY A;  3ZST A;  2E9X C;  1S3E A;  4LA1 A;  1CJ2 A;  2SPC A;  2CUL A;  2DLR A;  2RPA A;  1VBE 4;  2K3W A;  2UU9 T;  3ZDN A;  1D7Y A;  3UKL A;  5BUL A;  1R09 4;  4B3M T;  1XDO A;  5HEO A;  3AAE B;  1S35 A;  5JH7 E;  4YSX A;  3V5U A;  3RYF E;  4IE0 A;  4MHC A;  2JPF A;  5ETW A;  2E4G A;  1Q1W A;  3PDY A;  5JCL A;  1ZKE A;  2CDU A;  1ZEE A;  4EYY R;  4YLH A;  5CJ5 A;  3CGC A;  3HKE E;  2GR2 A;  3P4P A;  1AJ3 A;  1NG4 A;  4PFO A;  1XHC A;  3FIM B;  4EIQ A;  1D4D A;  2X66 A;  2CLY B;  5HY5 A;  1RSG A;  3JAF A;  4H9N C;  3QB5 A;  2YLX A;  4A6N B;  2WS3 A;  3EI0 A;  2YG3 A;  3L09 A;  3BHK A;  4OPL A;  4P0B A;  4ISS A;  3COX A;  1WYB A;  4K2X A;  4U2T A;  2WOW A;  2CXD A;  3MK7 C;  4C91 A;  1O95 A;  4AQF A;  2GF3 A;  3DJD A;  2IUB A;  3N9N A;  4ERR A;  1EL5 A;  1KDG A;  3RIU A;  1H7C A;  3SWH A;  1GAL A;  3VR9 A;  3V3O A;  3NZQ A;  4NTE A;  1OJC A;  3NK2 X;  1F8W A;  1CL0 A;  1D4E A;  2CBJ A;  3T8O A;  3P7I A;  3UKA A;  3Q2M A;  4Q25 A;  4DMW A;  4IVM B;  1RUC 4;  2XQ4 A;  3UFE A;  2LKG A;  3NIX A;  4C90 A;  2XFN A;  1S94 A;  3FZH B;  4AQF C;  3G5Q A;  3P1W A;  3QUJ A;  3C4X A;  3T14 A;  2FJB A;  1QO8 A;  3JAE A;  1RP0 A;  3GYI A;  1POV 0;  2EHO B;  1SEZ A;  1HF8 A;  1UX4 A;  1GRH A;  1W9R A;  4DGK A;  2MTQ A;  2QYW A;  4C3Y A;  4FK1 C;  4GRT A;  2M67 A;  4KHZ F;  5L3C B;  2JIW A;  4U72 A;  2VAS A;  2YG6 A;  4H9S E;  3HI2 A;  4UEM A;  1BZL A;  2Y8D A;  4ECH A;  2RR1 4;  2NW7 A;  2NVK X;  4U2Y A;  4YKG A;  2YLR A;  3RIA A;  2YDS A;  5ABG A;  2HHH T;  1PIV 4;  4YKF A;  1UUS A;  2VVM A;  2GEW A;  4P09 A;  3KVB A;  5JRC B;  2WOV A;  4C3X A;  1E1L A;  3JC6 C;  1H86 A;  2RGO A;  3VHL A;  2UXN B;  2VK9 A;  2JQH A;  2ZM6 T;  1D7L A;  4RG3 A;  2KSR A;  4P1N A;  3GD3 A;  1E7P A;  2WES A;  4IE7 A;  4A56 A;  5IQ1 A;  3ZSS A;  3NTD A;  1GOS A;  2I0Z A;  4GK5 E;  4EZ4 A;  2V6Y B;  2XAS B;  2XM2 A;  4N78 D;  5JDN A;  2XLT A;  2ARD A;  3OBV E;  4CZZ B;  4CY6 A;  2C5K T;  2Q9Q B;  5AQO B;  3AEE A;  4HWH A;  1FMW A;  2RAB A;  4XXG A;  5JQG E;  4PJJ A;  3VR8 A;  4IGU A;  4O5Q A;  3EVY A;  3DGH A;  3OKQ A;  5CFB A;  1H82 A;  4QH5 A;  4B67 A;  2AXD S;  4AOS A;  3CK6 A;  2XAH B;  1J5E T;  4H2Q A;  3GN5 A;  3F2E A;  3FXE B;  2DWK A;  1VRQ B;  3AE9 A;  3ZYM A;  3AD7 B;  3D8X A;  1P2H A;  2XDO A;  2M6I A;  3MXZ A;  2A8X A;  3P4W A;  4ASK A;  4GYR A;  1B37 A;  1F3P A;  1JRY A;  2KZ7 B;  5EOW A;  4FJO A;  2LM2 A;  1LVK A;  1WR6 A;  5LBQ B;  4Z43 A;  1RVF 4;  2BCP A;  2WMO A;  1N36 T;  5KMG P;  3QK6 A;  2VQB A;  3ZJ2 A;  1B8S A;  3SQP A;  1ZX9 A;  3FPZ A;  2XFP A;  1YD8 G;  1IUX A;  4DND A;  1M6I A;  3AYL A;  5LOV E;  1FEA A;  4A65 A;  4X1I E;  1MIY A;  1H7X A;  3PUZ F;  1GET A;  2XLU A;  3VKH A;  2XTL A;  3GMI A;  1AR6 4;  2BS3 A;  4IVO B;  3KV9 A;  4UXN B;  3IHR A;  3AA0 B;  3AXJ A;  4M52 A;  1SHZ C;  2W66 A;  3F8R A;  3UFG A;  3PVC A;  5KX5 E;  4PK4 A;  2GR0 A;  3KU9 A;  1G73 A;  2VWA A;  5FNV E;  1XAN A;  1MMG A;  2XQ7 A;  3C4Z A;  5DQV A;  5FMN A;  5AQT B;  3CX8 B;  3CGE A;  4WCT A;  2BXS A;  1W4X A;  4YHJ A;  4UDR A;  2WZH A;  4IIJ E;  2DKH A;  5DBJ A;  2MBG A;  4PJM A;  1UKV G;  5HXS A;  4UF0 B;  3DGZ A;  2LT3 A;  4AOX A;  1YW0 A;  5FS7 A;  3UU4 A;  1N4U A;  3MA9 A;  5DQW A;  5LGT B;  3GWH A;  2IDO B;  2WET A;  4H2N A;  3NKZ A;  2RM2 4;  2HN2 A;  4BAY B;  3O9X A;  1JOA A;  2BAB A;  2FJD A;  1HG5 A;  3WI3 A;  4A5L A;  2LOS A;  3UUX B;  2EQ7 A;  1RUG 4;  2BRA A;  4ZZB A;  4G9K A;  1VBB 4;  2RS5 4;  4OHF A;  5EBK A;  4K0K T;  1XDP A;  4HKA A;  2WU2 A;  4H4T A;  3HKB E;  1GRA A;  1U4Q A;  1V59 A;  4O4J E;  4DBR A;  4WZX A;  1LQT A;  1K0L A;  3NK1 X;  3C4W A;  4JI3 T;  4G63 A;  2H89 A;  1QUU A;  2B9Y A;  1TYP A;  2VL8 A;  4U31 A;  1EL9 A;  2LSK A;  3P4Q A;  4GYS A;  5CKU A;  4A79 A;  1PHH A;  4DUZ T;  4E7Z A;  5TR3 A;  2JQK A;  2XYO A;  2J4G A;  5LGU B;  2WP6 A;  1B7T A;  2C5J A;  1DXL A;  4H4P A;  1YY5 A;  3ONL C;  4NWZ A;  1E1K A;  2PY5 A;  4H63 H;  3NBX X;  2UXD T;  1OJ9 A;  4V1A v;  3DA1 A;  4OPD A;  2B1E A;  2IIU A;  3AE7 A;  2OAM A;  4CXW A;  3KKJ A;  2BAC A;  1FMV A;  3KBU A;  3ATR A;  3NHO X;  1XDI A;  2JMH A;  4Z2U A;  4EMJ A;  5JCN A;  2FBW A;  2CM0 A;  4DV4 T;  5EK2 A;  3DK8 A;  1BEV 4;  1UUR A;  2RMU 4;  3O0H A;  1GND A;  5JDF A;  1H8T D;  1RMU 4;  3P8C D;  2RP4 A;  1GTE A;  3UT5 E;  3UP4 A;  4EQR A;  4K8D A;  2ZMA A;  1D0Y A;  3D1C A;  4HFB A;  2YDQ A;  1KEY A;  4CNK A;  1HNX T;  5EK4 A;  1TDF A;  2NPX A;  2FUP A;  3SZF A;  1LVL A;  4EQS A;  3FBS A;  4ZCD A;  4REK A;  3PUQ A;  2YG7 A;  3LZX A;  2A2F X;  3DME A;  5HWX A;  2V7L A;  5F8P A;  2JB2 A;  2R0C A;  3C51 A;  5AQP B;  2WAU A;  5EK3 A;  4DR1 T;  4X65 T;  2R07 4;  1DNC A;  1MIW A;  2VB6 A;  1FEC A;  2B76 A;  3EAN A;  5KDM C;  3ISH A;  4UF0 A;  2TPR A;  4UEL A;  3ZYX A;  4PW8 A;  2WWV A;  1VDC A;  4NZH A;  5DAB A;  2I0M A;  2Q9Q C;  1HX8 A;  2GK9 A;  4F6R C;  1CHU A;  3Q5W A;  2GRT A;  3ICR A;  2XQ3 A;  1PXA A;  3H8L A;  4DV6 T;  2WDV A;  1YKJ A;  3ICS A;  1T72 A;  3ZT5 A;  3UP5 A;  3FXD B;  1KSS A;  4J57 A;  1BWC A;  1IBK T;  3CML A;  5FMH A;  2A9U A;  2YEV C;  3DJE A;  3NRN A;  1LJ1 A;  2YR5 A;  1CC4 A;  3SXI A;  4AQY T;  3PS9 A;  3QOF A;  3UQ4 A;  5J2T E;  4JI4 T;  2MPK A;  2VKD A;  4ZS3 A;  1OED E;  3ZKR A;  1YXR A;  1HR0 T;  4QHO A;  5M0Z A;  2X8C A;  4K7Z A;  3RLF F;  4IT4 A;  3AE2 A;  1H84 A;  2MAW A;  4Y4N A;  2W0H A;  2KND A;  4LMK A;  3IEE A;  3EPT A;  5HHF A;  2YU1 A;  3H4K A;  1XI1 A;  4A97 A;  4DBQ A;  3R9U A;  3UU5 A;  1FEW A;  3PUR A;  4JI1 T;  4GDP A;  5FYM A;  1PBB A;  3RQU A;  2CHN A;  4TX5 A;  4Q4V 4;  4LML A;  2X68 A;  2X99 A;  1GPE A;  3GMB A;  5FL1 A;  2LRK A;  2OA1 A;  1MMD A;  3OTO T;  2V61 A;  4ZS2 A;  4WBN E;  5EB5 A;  2LHN A;  1F8S A;  3LOV A;  3B3R A;  1L9C A;  4UVA B;  4PK5 A;  4X1Y E;  4FK1 A;  4H7U A;  3WAJ A;  4AKH A;  3K7M X;  3PU3 A;  4ADZ A;  3OPC A;  4ZI7 E;  3CPZ A;  2PHH A;  2BG9 B;  2IVD A;  3GDP A;  4OPC A;  2VQE T;  3K8P C;  2NW8 A;  4Z90 A;  4LFB T;  5ABF A;  3B13 A;  3N5L A;  3RYI E;  2BG9 C;  4AP1 A;  4BV6 A;  4TUY E;  4HGA A;  4TNV A;  2YK0 A;  3ONJ A;  4HN9 A;  4TNW A;  3CQC B;  5H6Q B;  1CC2 A;  3KLJ A;  2APG A;  2DWG A;  5FY0 A;  3P4R A;  4ZZC A;  4WYV A;  4AXP A;  4D04 A;  1AL2 4;  3TLU A;  1VBD 4;  4RG4 A;  4UV9 B;  1PBE A;  2N9D A;  4KMC A;  4LF8 T;  3GYX A;  3N2O A;  3BI2 A;  4LF7 T;  3CKD A;  4GCM A;  3RC8 A;  3CVR A;  2LKH A;  1IUU A;  3SUC A;  4G6H A;  4NIQ A;  2X5I D;  3HKC E;  2XLP A;  1AOG A;  5LMU T;  4JV5 T;  1BGN A;  3LAD A;  4B65 A;  4IE5 A;  2V8S V;  5KVH A;  3T37 A;  2BCG G;  4JLE A;  3NTA A;  2OLO A;  5FP3 A;  4NEW A;  3URH A;  4ZXL A;  3O1H A;  3RHW A;  4YJ3 E;  5L47 A;  3VQR A;  1HX1 B;  4CY8 A;  1RUE 4;  1U5P A;  2XSB A;  4LF9 T;  4ZEY A;  3T1Y T;  2GMJ A;  4EZH A;  4YTM A;  3KPK A;  1D4M 4;  4JNA A;  2R06 4;  1OJA A;  2YM1 A;  2WDR A;  3ETV A;  4YSY A;  4AKG A;  1NPX A;  4OVI A;  3K3N A;  2VRM A;  1LKX A;  5KXJ A;  2IVE A;  1ZP0 A;  2YOE A;  4HWI B;  4U2L A;  3O1I A;  2H7V C;  3OJA A;  4PK6 A;  3J8F 4;  4U8I A;  1COY A;  4H4X A;  1NEK A;  2XY8 B;  2BS4 A;  1KSU A;  4Z8X A;  5FVK A;  5BRT A;  4AKL A;  1HYU A;  3DK4 A;  2BG9 E;  4DNA A;  1CUN A;  1T7S A;  4DV3 T;  1CBO A;  1PXB A;  3T2Y A;  4UV8 B;  2W63 A;  5L4H A;  3FB2 A;  2BRY A;  1NG3 A;  4G73 A;  3DJB A;  1V9D A;  3CNT A;  5LG4 A;  3NYF A;  2E9X A;  3PE0 A;  3H37 A;  4O2B E;  3AA7 B;  1EV1 4;  1KNR A;  5HXH A;  3UKK A;  4O8S A;  5AQI B;  2AE9 A;  2VVL G;  3S4U A;  3QNU A;  3PUY F;  3AXJ B;  1E2A A;  2ZM8 A;  4KX6 A;  4ICY A;  3ZC1 A;  2VZ2 A;  2D9D A;  2Z5Y A;  1XWM A;  1OJT A;  3PU8 A;  2E9X D;  3EAB A;  4O4I E;  4XAX B;  5IWA T;  2B7S A;  3CPH G;  4QXH B;  3GYJ A;  1FIO A;  2BBH A;  4XZC A;  5FY7 A;  1ZDL A;  4EM4 A;  2QA7 A;  4EQX A;  3RP8 A;  1T8B A;  2BA9 A;  4PJL A;  4A6N A;  4PAB A;  3UUL A;  2X9W A;  2UUB T;  2DNX A;  2X0H A;  2E1M A;  4ZCC A;  4DR3 T;  2V1D B;  2NW9 A;  2LRL A;  1XMQ T;  4EAH A;  3RP7 A;  3UOV A;  3OVU A;  3NWI A;  4EQW A;  4JQ9 A;  2Y6R A;  3T2Z A;  2ZZC A;  3UTE A;  1UK5 A;  5BVA A;  2XAF B;  2P9B A;  5L3F B;  4GKJ T;  2Q0L A;  2A89 A;  2CHO A;  5AQG B;  4JI8 T;  3RC3 A;  1RUI 4;  2YM2 A;  2WSS V;  4JY2 A;  3IWA A;  3B6D A;  3PJA A;  3IC9 A;  4X9N A;  1VOM A;  3QJ4 A;  3AE6 A;  3LK2 B;  3UTK A;  3SY4 A;  2YVJ A;  5AQJ B;  3ITJ A;  1XZY A;  1R08 4;  3RQW A;  2XQY A;  4U33 A;  2JQ9 A;  2C5I T;  3OZ2 A;  4Z25 A;  5FS6 A;  1KF6 A;  4OX9 T;  4AQG A;  2GQW A;  3TKL B;  5AQM B;  1B4V A;  4YFS A;  3RF1 A;  5IQ4 A;  2DI4 A;  5LXT E;  2JAE A;  4YXD A;  4PNI A;  5HXE A;  3HYW A;  4ILU A;  4A5X A;  3M12 A;  4CBQ A;  3RYH E;  4J2C A;  2YWL A;  3B5M A;  2R9Z A;  2CWO A;  3SZW A;  3NLC A;  2ES0 A;  2BC1 A;  3AE1 A;  5LMN T;  1OED C;  2RA1 A;  1FOH A;  3KPF A;  2WU5 A;  3QC9 A;  2XJ7 A;  2VUR A;  4PAG A;  2KT9 A;  1TDK A;  3JD7 4;  3II4 A;  5FS8 A;  3WAK A;  1US7 B;  2VQ7 A;  1NHP A;  4USR A;  5U25 A;  1QLB A;  4PDW D;  5TAO A;  2WP5 A;  4BK1 A;  3Q5D A;  2WCA A;  3UU8 A;  2NWB A;  5KMQ A;  3AB3 B;  2RS1 4;  5FXZ A;  4U74 A;  3H3M A;  4BA9 A;  1S2Q A;  3IA3 A;  5HYM A;  1S3B A;  4Q4W 4;  4XBF B;  5AQL B;  3QSS A;  2FJA A;  1QJD A;  4U8K A;  5GON E;  1D1C A;  4TLZ A;  4M1P A;  2L3L A;  4USQ A;  2KWI B;  1MIV A;  4JYA T;  1D5T A;  1MQT D;  1Y56 B;  4U7Y A;  4O5U A;  2UXC T;  2F5Z A;  4TLX A;  4GKK T;  3E08 A;  2ZM0 A;  3SZ0 A;  4UDQ A;  4ZN0 A;  1HG2 A;  4UR9 A;  4YSZ A;  2WPF A;  4AT0 A;  2CRB A;  1L9E A;  2J62 A;  1RUD 4;  1LTX R;  5L3G B;  4H4Q A;  2IC6 A;  5H6R B;  5F5W A;  3DJG X;  4UVB B;  3SS1 A;  4B68 A;  2NTX A;  2C0S A;  2IHR 1;  5AQQ B;  5JRC A;  2XQA A;  2FJE A;  3RYC E;  1NAF A;  4GIW A;  3VKG A;  1CJC A;  3NVO A;  2YDR A;  3EAM A;  3K7T A;  3V5S A;  2LJL A;  2MOZ A;  2N1G A;  1N32 T;  3BNM A;  1YQ3 A;  4CN4 A;  1SE7 A;  4BJN A;  4TZ4 C;  1E1N A;  2R6G F;  5FXX A;  2B7R A;  2CWY A;  3PO7 A;  2XQ9 A;  4B69 A;  2CMR A;  4CNJ A;  3LBX B;  2DKI A;  2BBJ A;  2E8I A;  4H4W A;  1GRE A;  3UTG A;  3ESL A;  3BQL A;  2DCF A;  1GRG A;  4QX8 B;  3AA1 B;  3AAA B;  1WFD A;  3ZMU B;  3ZT6 A;  4HFD A;  2XSA A;  5M10 A;  1M62 A;  4HB9 A;  3ONX A;  3H8I A;  4EYU A;  5J1G A;  4DR4 T;  2LFC A;  4DR2 T;  2RS3 4;  3EDU A;  5LYJ E;  3OYZ A;  4EXT A;  2WWU A;  3S5W A;  3ZCI A;  3GMC A;  4H4R A;  2XVF A;  1D1A A;  1T98 A;  5LG3 A;  3RIU C;  1CC6 A;  2W00 A;  4JI7 T;  2BG9 A;  3NYE A;  1IUV A;  1GES A;  2QGS A;  4AI6 A;  4B66 A;  4MJW A;  4ZI3 C;  3AXB A;  3LFM A;  2BVL A;  3GWF A;  2ZBW A;  1O3X A;  3RRC A;  5CB4 E;  2V7M A;  4LF5 T;  2GV8 A;  1Z8U A;  4UIG A;  3PUA A;  3IBP A;  1GRT A;  1PO1 4;  2LSY A;  3QSE A;  3EF6 A;  1UX5 A;  4CCR A;  3ZEF B;  3GRS A;  4Q4X 4;  2B9X A;  2YN6 A;  4U8L A;  2WQY A;  5U1O A;  5J0Z A;  1WYC A;  5J60 A;  2EQ6 A;  2V3A A;  3GD4 A;  3CNP A;  4H4Z A;  2R0P A;  2Z6E A;  2WP9 A;  1XNQ T;  2WBL A;  2VKO A;  4HWD A;  4U3C A;  4ZOL E;  5EZY E;  5JR9 B;  3CPJ G;  4JY3 A;  4U8O A;  3NKS A;  1PVC 4;  3FBL A;  4JDR A;  3ABV A;  3A7M A;  2VL0 A;  3Q9D A;  5HCM A;  1YKE B;  4L5G A;  2IAK A;  3O4X E;  4U7I A;  4D03 A;  3K30 A;  3KV5 A;  3Q5E A;  4DR5 T;  1DJN A;  5U63 A;  3C64 A;  4GK0 E;  2K9A A;  1W0A A;  3EHZ A;  2Y48 B;  4G74 A;  2BXR A;  2J3N A;  1COV 4;  1W0B A;  2ZLY A;  4IHJ E;  4XWR A;  3ZN1 B;  3RKG A;  2XFU A;  4DV0 T;  4X20 E;  3ZPO A;  3AYI A;  3AE5 A;  4KI0 F;  2CPT A;  3BQK A;  5KMP A;  2CE7 A;  1ZKQ A;  3EUH A;  3Q5X A;  4IE4 A;  2WB5 A;  4IL4 A;  3OYX A;  2XVE A;  2GAH B;  1S2Y A;  2RGH A;  2R04 4;  1SUM B;  2X3N A;  5JDQ A;  5HEH A;  2E5V A;  5CQF A;  4DUY T;  3RED A;  3ALJ A;  3SGL A;  3T2K A;  4AIU A;  5M4Y A;  5KWF A;  4QXC B;  4TM3 A;  5JR9 A;  3NYC A;  2QA2 A;  2M6B A;  5JCK A;  4OCG A;  5HXR A;  3C50 A;  1EZ3 A;  5L4E A;  2C67 A;  4LFC T;  3IF8 B;  4H4Y A;  4TWD A;  4EMW A;  2XUE A;  1MOK A;  4L9I A;  5HEJ A;  1Y64 B;  4H4V A;  1XHX A;  3E0Z A;  2IID A;  1K5M D;  2LE8 A;  3BI5 A;  4CN1 A;  3L8R A;  1H6V A;  3N2K E;  5KNL A;  4H9Q C;  4HWF A;  3UTF A;  1ZOV A;  3KV4 A;  3UQ7 A;  3PV0 F;  4QKN A;  2D5U A;  4TWH A;  5HAX A;  2WMN A;  3N9L A;  1I94 T;  4IDQ A;  3RRW A;  1ZMD A;  2XLS A;  1PN0 A;  5LHG B;  2X9X A;  4XWZ A;  3BNU A;  2VKH A;  5BMV E;  1PBD A;  3U3I A;  2KMF A;  3AEC A;  4I43 B;  1GT8 A;  4U8N A;  1WRD A;  2TMD A;  2C7G A;  2V6Y A;  3QFA A;  5ADX L;  3I0O A;  1K0I A;  4PFP A;  5EB4 A;  3L3P A;  2JKC A;  5LNK A;  2AQJ A;  4CXX A;  1LV0 A;  1GSN A;  2JB1 A;  2PYJ A;  5F3J A;  3P9U A;  1IJ5 A;  4MBQ A;  4IDO A;  5JR9 C;  4KP3 C;  4MAL A;  2ODU A;  3KVE A;  1GRF A;  4N9X A;  3DP7 A;  5AQU B;  4QH1 A;  2W61 A;  2PFV A;  3CNS A;  3LDQ B;  1VBA 4;  2CCQ A;  2K5B B;  3BK9 A;  4HA6 A;  3M13 A;  4EEB A;  1RHI 4;  3CX7 B;  3M3Z B;  4AP3 A;  3FHN A;  1RYI A;  2X8G A;  1BR1 A;  4GB3 4;  2WPE A;  4X62 T;  4J2W A;  1TRB A;  3V76 A;  2W0G A;  4WX1 A;  5AQK B;  2IC9 A;  4I58 A;  4Y4M A;  3QB5 K;  4A98 A;  2J47 A;  3I9W A;  3E1T A;  3G5R A;  3KV6 A;  2DL1 A;  1BR2 A;  2W62 A;  1EBD A;  2XVJ A;  2Q6U A;  3AWI A;  3GQK A;  4TWF A;  3ICT A;  4LMJ A;  5FS9 A;  5CGM A;  3AAI A;  2XPK A;  1GXF A;  2WZI A;  2XAG B;  4RSL A;  2F4V T;  3VRD B;  1IBM T;  1Q9I A;  3AEF A;  4U2S A;  3RNM A;  1QSD A;  5J2U E;  3NNE A;  1HNW T;  2W2U A;  2K24 A;  5HEU A;  4OPI A;  5IPY A;  1BGJ A;  4H50 A;  1L0V A;  4IL9 A;  2C70 A;  2VRL A;  2VOU A;  4DV5 T;  4LU6 A;  2PJQ A;  2GMH A;  3VU7 H;  4B64 A;  3QVR A;  4AKR B;  4U8P A;  3CX6 B;  1VRH 4;  2YU2 A;  1DOD A;  2V7J A;  4JI5 T;  2X0Y A;  1KK7 A;  2H7O A;  2KIN B;  5C8Y E;  3CIR A;  3RGL A;  2I59 A;  1JNZ A;  4ILB A;  3NT6 A;  4Z24 A;  4CXY A;  2C3D A;  3NH3 X;  1BR4 A;  5HXC A;  3ZYL A;  3G5S A;  3J7Y q;  4B3S T;  2V5D A;  3FBZ A;  4G2A A;  4C5O A;  2LSG A;  3FG2 P;  3AVR A;  2GR3 A;  1PJ5 A;  2Y6X A;  1NCQ D;  2PG8 A;  4YY3 T;  1NHS A;  4IDN A;  4AKI A;  4YT0 A;  1FCD A;  3Q6J A;  4WNK A;  5IHY A;  3ATQ A;  2WM9 A;  2YAU A;  4COF A;  4Z44 A;  1ASJ 4;  3IHM A;  3KFW X;  4B3R T;  1MXT A;  4DSH A;  3UOY A;  1SA0 E;  5LHH B;  1HS7 A;  5JVD E;  2W4X A;  3MJX A;  4OFZ A;  2WBA A;  5ABF B;  3PUG A;  4I0U A;  5L2L A;  2E5L T;  2YR4 A;  4OPG A;  2YG4 A;  2JRK A;  2YLT A;  4HE8 A;  5LV9 A;  4K0U A;  2L9Q A;  3F8P A;  1G8X A;  5KRQ A;  1JRZ A;  3PUW F;  3BQI A;  1IAP A;  1VG9 A;  5JDM A;  2ZZ0 A;  4OPT A;  1N33 T;  5A1L A;  4OPU A;  5LP6 E;  1CF3 A;  4BUR A;  4H9P C;  2LSI A;  1OXZ A;  2C65 A;  1VBC 4;  4IA6 A;  4NXM T;  1XPQ A;  3QSM A;  4LII A;  4QX7 B;  3ANW A;  2C73 A;  3SM8 A;  5LJN A;  3CND A;  1IUW A;  2XVI A;  4HFI A;  2E2A A;  5L3B B;  1N1P A;  3C96 A;  2PYL A;  3HR0 A;  3GDN A;  3I3L A;  1CJ3 A;  2AAQ A;  5L3E B;  4JUY A;  4OYK A;  5ABH A;  3N9O A;  1FJG T;  1M7K A;  2CEA A;  1BF3 A;  4K5R A;  4KUM B;  3FZK B;  1NDA A;  3JSK A;  1VG0 A;  2QAE A;  3LK3 B;  4EV6 A;  2MYS A;  2X8H A;  2HWC 4;  1H83 A;  3KVA A;  4NXN T;  1OED A;  3HZL A;  4JI0 T;  4HWC A;  3LSV A;  2A3D A;  1F8R A;  4Z91 A;  4ZI2 D;  4IST A;  4EM3 A;  2JBV A;  4EIW A;  3L8K A;  4O4H E;  4X5T A;  2Y6Q A;  4X9M A;  2NP9 A;  1E1M A;  1X31 B;  3KD9 A;  3I0Q A;  5AQV B;  1HNZ T;  4GUV A;  3RHA A;  1OWA A;  1OJD A;  1PXC A;  2H88 A;  2G0U A;  4H2P A;  2YR6 A;  2UXX B;  4JI6 T;  5JDL A;  3QFB A;  5FXW A;  4B3T T;  1ONF A;  2UUA T;  5ER0 A;  4X4J A;  3ZT7 A;  3LK4 2;  4JEH B;  4GAV A;  2PLV 4;  3C98 B;  4X64 T;  1NA1 D;  1GEU A;  1O94 A;  3UCL A;  2BS2 A;  3N2G E;  3AEG A;  5AQH B;  2C64 A;  1AR8 4;  3ZMZ B;  4ILA A;  1RUH 4;  2PW9 A;  5C2T A;  4FI5 A;  4I4T E;  5KVI A;  2VVS A;  5HWY A;  2W67 A;  2WOI A;  2EX3 A;  3K7Q X;  4BK2 A;  3CQG B;  4EIP A;  3GWD A;  5AQF B;  1Z7S 4;  4U8M A;  2OLT A;  4DV7 T;  3N9P A;  1X79 A;  2J1D G;  2C3C A;  3AE8 A;  3HL6 A;  2JB3 A;  3EAO A;  1WCR A;  2YG5 A;  2YVF A;  2WHD A;  2KXP B;  1OOP D;  3H3A A;  1ZK7 A;  1DU2 A;  4GDE A;  1N4W A;  2A87 A;  4AT2 A;  3P4S A;  4JN9 A;  3LG7 A;  5IYZ E;  4A9W A;  4DID B;  4LFA T;  1UGO A;  1IJH A;  3AD9 B;  2BKP A;  3K3Q C;  1PBF A;  3HA4 A;  2EHO D;  2EQ9 A;  2YKS A;  5KOW A;  3CNJ A;  2XFQ A;  2YQU A;  2C76 A;  1VQW A;  4U2Z A;  4YSH A;  2K48 A;  4Y4L A;  4O2A E;  3B57 A;  1HRV 4;  4ZHQ E;  5C3J A;  2QRX A;  1N34 T;  1Y0P A;  4QWN B;  2CVJ A;  2EHO A;  4CI1 B;  5FVL A;  4KPR A;  3AYJ A;  4BK3 A;  5AQS B;  4U8J A;  4RHV 4;  2GQF A;  5LA6 E;  5AFU L;  4YJ2 E;  2X67 A;  2R45 A;  4I59 A;  3PUS A;  1H7W A;  5LCY A;  4DV2 T;  2I6H A;  1M64 A;  1MNE A;  3SYI A;  4Z26 A;  3SFD A;  2OA5 A;  5KOX A;  4CI2 B;  4HEA A;  3N9Q A;  3I9Y A;  3UTH A;  4OK0 A;  3KDS E;  4CCQ A;  2JK6 A;  1YKH B;  1MMN A;  3RIF A;  3ZC0 A;  3ADA B;  2PTF A;  2EHO C;  2VVN A;  2XQ8 A;  4DMV A;  4TV9 E;  2BKO A;  5LHI B;  2BZB A;  3W15 B;  4PAA A;  4Z2R A;  1MND A;  1Z6L A;  2IW5 B;  1D1B A;  4BJY A;  5L46 A;  3ZMT B;  1ZMC A;  4ZI3 D;  3T1H T;  2PZS A;  1KNP A;  1D0X A;  2XLR A;  4IDP A;  2BYB A;  2XAJ B;  3ETU A;  3TLT A;  2BK4 A;  2V6O A;  4II2 A;  2KLQ A;  2V60 A;  3ALL A;  1NHQ A;  3GSI A;  1E1H B;  3SFE A;  4DR6 T;  3ZCJ A;  4CRT A;  1IUT A;  3LBX A;  3ANW B;  2WY2 A;  4J34 A;  2B9W A;  1TDE A;  5FKY A;  3FZM B;  5E0O A;  3JC6 D;  3UKH A;  1PJ7 A;  1HCI A;  2YIN A;  2V5C A;  3UUB A;  3C4N A;  2NR4 A;  3SOL A;  4YTP A;  4QXB B;  1PBC A;  3SZC A;  5KMS A;  3O1J A;  4JI2 T;  2R46 A;  5LB7 B;  3J9X 1;  3ZMS B;  1EL7 A;  3RKO A;  4H4U A;  1VCS A;  4OYJ A;  1GRB A;  4HTE A;  1EAH 4;  3NN0 X;  3DTO A;  4DO0 A;  4Z2T A;  1Q1R A;  2BK3 A;  2HWB 4;  5JTG A;  1JRX A;  1YQZ A;  3MKD A;  3ZLI A;  4WW0 A;  1Y56 A;  1UCU A;  3I6D A;  1NWM X;  2VKJ A;  2HPJ A;  2VQF T;  4CN6 A;  1KFY A;  3CN8 A;  3UU3 A;  2XHE B;  5FXV A;  1WLX A;  3LZW A;  1YQ4 A;  3UOZ A;  2BC0 A;  2LEH A;  3CTY A;  4J36 A;  4YTN A;  4DSG A;  3BI4 A;  3PUX F;  4TM0 A;  2XAQ B;  2WEU A;  3ZYK A;  4NTD A;  1VRB A;  2NOX A;  4P0A A;  4HFE A;  3G06 A;  2CXF A;  3MZK B;  3AVS A;  3QVP A;  3AE3 A;  5FL0 A;  5BR8 T;  2XZE A;  4JNQ A;  5AQR B;  4E7S A;  3GN5 B;  1AR7 4;  1E39 A;  3A5X A;  1CJ4 A;  4HFH A;  2OAL A;  1FL2 A;  1TYT A;  2C4C A;  5CA0 E;  2D2S A;  4H9R C;  4A99 A;  1DOB A;  2BDE A;  4X66 T;  1MO9 A;  3VRB A;  4EGW A;  5J7X A;  3V3N A;  2QCU A;  4J33 A;  3I1A A;  4K22 A;  3UKQ A;  2C72 A;  4EB6 E;  2IML A;  3ZJ1 A;  2XQ5 A;  3IHG A;  1EL8 A;  1IBL T;  4F8H A;  1P2E A;  3RP6 A;  2JJ9 A;  1DJQ A;  2EQ8 A;  3UU6 A;  4II3 A;  3AB1 A;  1F6M A;  4IRE A;  3CGB A;  3UOX A;  4FDC B;  3N9M A;  4IA5 A;  4X1K E;  3MAC A;  2UXB T;  4LF6 T;  3UKP A;  2ZM2 A;  3RX6 A;  3RPU A;  2C75 A;  1X9B A;  2BVM A;  2KWH A;  2Q9Q A;  1J1J A;  3DH9 A;  1H81 A;  2YLZ A;  1K4Q A;  1ZOY A;  2JMK A;  2X9H A;  5LJM A;  2GR1 A;  4UP3 A;  4C77 A;  1NAA A;  5HEG A;  2D0T A;  3OC4 A;  1AR9 4;  3C4A A;  2X9Y A;  3ZN0 B;  3AEB A;  4KHP T;  2BK5 A;  5IUX A;  3K3O A;  4O4L E;  4H63 V;  1IZN B;  3PJA J;  4QH4 A;  1ZHC A;  1TDN A;  2LSJ A;  2V6X A;  2LLY A;  2XQ6 A;  2RGJ A;  4TV8 E;  3HYV A;  2HPL A;  3KA7 A;  4H9O C;  1PJ6 A; 
#chains in the Genus database with same CATH homology
 3IWA A;  4G6G A;  3B6D A;  3FG2 P;  2XVH A;  4H2R A;  2GB0 A;  3IC9 A;  2GR3 A;  4X9N A;  1PJ5 A;  4NTC A;  3QJ4 A;  3AE6 A;  4M52 A;  4NNJ A;  4J31 A;  2YVJ A;  3SY4 A;  3F8R A;  3ITJ A;  3CPI G;  4J56 A;  4IV9 A;  3SX6 A;  3PVC A;  1FEB A;  1PS9 A;  1NHS A;  2XCG A;  3S61 A;  2GR0 A;  3OZ2 A;  3KU9 A;  4Z25 A;  5FS6 A;  4YT0 A;  2ZZB A;  1XAN A;  3AD8 B;  3IF9 A;  1KF6 A;  1FCD A;  3T31 A;  2WDQ A;  2Z5X A;  3Q6J A;  3CGE A;  4C74 A;  4WCT A;  2BXS A;  1W4X A;  3CGD A;  3ATQ A;  2YAU A;  4UDR A;  5KMR A;  4Z44 A;  3IHM A;  2DKH A;  5DBJ A;  2GQW A;  1MXT A;  1B4V A;  1L9D A;  1UKV G;  4DSH A;  3DGZ A;  3NG7 X;  2R4J A;  5IQ4 A;  1E6E A;  4H4S A;  3UOY A;  5FS7 A;  4AOX A;  1N4U A;  2JAE A;  2UZZ A;  2X50 A;  4GAP A;  2WBA A;  4YXD A;  2WET A;  3HYW A;  4H2N A;  2YLW A;  4CBQ A;  3M12 A;  3GQH A;  2YR4 A;  4OPG A;  2YG4 A;  2YLT A;  2XFO A;  2YWL A;  1JOA A;  2BAB A;  5JCI A;  5LV9 A;  2FJD A;  2R9Z A;  3F8P A;  3SZW A;  1GTH A;  4A5L A;  4ADW A;  3NLC A;  5KRQ A;  1JRZ A;  2BC1 A;  3AE1 A;  2EQ7 A;  1FOH A;  3LJP A;  2BRA A;  1VG9 A;  3KPF A;  2WU5 A;  4G9K A;  2ZZ0 A;  4OPT A;  1TDK A;  4GR1 A;  4OPU A;  5EBK A;  3II4 A;  1CF3 A;  3M0O A;  5FS8 A;  2VQ7 A;  4B1B A;  4BUR A;  4NEV A;  1BKW A;  2WU2 A;  1NHP A;  4H4T A;  4USR A;  4GF7 A;  5U25 A;  2C65 A;  1QLB A;  1GRA A;  1ELI A;  1V59 A;  4IA6 A;  1XPQ A;  3QSM A;  3NK0 X;  4LII A;  2WP5 A;  4BK1 A;  4B63 A;  1LQT A;  1K0L A;  3NK1 X;  2C73 A;  3SM8 A;  5KMQ A;  1DOE A;  3CND A;  1PDH A;  1IUW A;  2XVI A;  2VVL A;  2H89 A;  1N1P A;  2OLN A;  3C96 A;  1S2Q A;  5HYM A;  1S3B A;  3QSS A;  3GDN A;  2FJA A;  1QJD A;  3I3L A;  1CJ3 A;  4U8K A;  2AAQ A;  2B9Y A;  1TYP A;  1BF3 A;  4K5R A;  1EL9 A;  3P4Q A;  1NDA A;  3JSK A;  4TLZ A;  2QA1 A;  1VG0 A;  2QAE A;  5HXI A;  4USQ A;  1D4C A;  5CKU A;  4A79 A;  1DOC A;  1PHH A;  1LPF A;  2X8H A;  1D5T A;  1H83 A;  1Y56 B;  1NEN A;  1GER A;  4O5U A;  3HZL A;  2F5Z A;  5TR3 A;  4TLX A;  3SZ0 A;  1IUS A;  2GH5 A;  4UDQ A;  4ZN0 A;  2XYO A;  2WP6 A;  4YSZ A;  2WPF A;  3BHF A;  4AT0 A;  4E0V A;  1F8R A;  1DXL A;  1L9E A;  4H4P A;  1YY5 A;  1LTX R;  4H4Q A;  4EM3 A;  2JBV A;  3L8K A;  1E1K A;  4NWZ A;  3DJG X;  4B68 A;  2Y6Q A;  4X9M A;  4YWO A;  1OJ9 A;  1E1M A;  3DJJ A;  3DA1 A;  4OPD A;  1X31 B;  3KD9 A;  1JEH A;  3AE7 A;  4GUV A;  3RHA A;  1OJD A;  2FJE A;  1PXC A;  2H88 A;  3AE4 A;  2OAM A;  3KKJ A;  4H2P A;  2BAC A;  1CJC A;  2YR6 A;  2YVG A;  3F8D A;  3ATR A;  3NHO X;  1XDI A;  4Z2U A;  4EMJ A;  5JCN A;  2C66 A;  1TDO A;  2FBW A;  2Q0K A;  3QFB A;  3VRA A;  3K7T A;  3BNM A;  1ONF A;  1YQ3 A;  5ER0 A;  4X4J A;  3DK8 A;  3NGC X;  1E1N A;  4GAV A;  3HYX A;  2B7R A;  3O0H A;  1GND A;  4APN A;  3CMM A;  3PO7 A;  3T0K A;  3L1R A;  4B69 A;  2YLS A;  4CNJ A;  1GEU A;  2DKI A;  1O94 A;  3UCL A;  2BS2 A;  1GTE A;  3ALM A;  2C64 A;  3AEG A;  1GRE A;  4H4W A;  4K8D A;  5GRT A;  3UP4 A;  3UTG A;  4P9S A;  3DK9 A;  3D1C A;  1GRG A;  4EMI A;  5C2T A;  5KVI A;  5JCM A;  2WOI A;  3K7Q X;  4BK2 A;  4EIP A;  3GWD A;  4CNK A;  1REO A;  1NHR A;  1TDF A;  4U8M A;  2CFY A;  4FX9 A;  5GSN A;  2NPX A;  5M10 A;  3WE0 A;  4HB9 A;  4BJZ A;  3SZF A;  2C3C A;  3H8I A;  1JU2 A;  1LVL A;  2LFC A;  4EQS A;  3FBS A;  4ZCD A;  2O9Z A;  4REK A;  2YG7 A;  3LZX A;  3AE8 A;  2V3B A;  2JB3 A;  3DME A;  3EAO A;  4UDP A;  4A7A A;  3S5W A;  3GMC A;  2JB2 A;  2R0C A;  2YG5 A;  1K0J A;  2HQM A;  2R4E A;  4H4R A;  2XVF A;  4TM1 A;  2R0G A;  3LXD A;  2YVF A;  2WHD A;  1CC6 A;  1DNC A;  2GAG B;  1ZK7 A;  3NYE A;  1IUV A;  1GES A;  4GDE A;  1FEC A;  1GV4 A;  2B76 A;  1B5Q A;  3EAN A;  1N4W A;  2A87 A;  3ISH A;  3P4S A;  1LQU A;  4AT2 A;  4MJW A;  4B66 A;  5BUK A;  3AXB A;  2TPR A;  4JN9 A;  3ZYX A;  3GWF A;  2ZBW A;  2V5Z A;  4A9W A;  3GRT A;  1VDC A;  2GV8 A;  4NZH A;  3LB8 A;  4K5S A;  1GRT A;  3AEA A;  1IJH A;  2WPC A;  3NN6 X;  3FMW A;  3AD9 B;  2PYX A;  1CHU A;  1PBF A;  2GRT A;  3ICR A;  3QSE A;  3EF6 A;  3UKF A;  1PXA A;  3H8L A;  1YKJ A;  2WDV A;  3Q9T A;  2EQ9 A;  3ICS A;  4CCR A;  3GRS A;  3UP5 A;  5KOW A;  2ACZ A;  1O5W A;  1KSS A;  2B9X A;  1BWC A;  3CNJ A;  4J57 A;  2XFQ A;  2GVC A;  2WQY A;  4U8L A;  5U1O A;  2Q7V A;  2YQU A;  5FMH A;  1ZY8 A;  1VQW A;  2C76 A;  5J60 A;  2EQ6 A;  4YSH A;  3DJE A;  3NRN A;  4Y4L A;  1JNR A;  2V3A A;  3GD4 A;  1LJ1 A;  4TM4 A;  3CNP A;  2AR8 A;  1N4V A;  3AED A;  5C3J A;  2YR5 A;  1CC4 A;  3SXI A;  1Y0P A;  2CVJ A;  2R0P A;  3PS9 A;  4H4Z A;  1S3E A;  4LA1 A;  2WP9 A;  1CJ2 A;  4JY3 A;  3GQK A;  2CUL A;  4U8O A;  3CPJ G;  3NKS A;  4KPR A;  3AYJ A;  4BK3 A;  3ZDN A;  4JDR A;  3ABV A;  4U8J A;  1D7Y A;  2GQF A;  3UKL A;  5BUL A;  5M0Z A;  2X8C A;  4K7Z A;  4YSX A;  3K30 A;  4D03 A;  3AE2 A;  1DJN A;  5U63 A;  2R45 A;  4I59 A;  1H84 A;  4Y4N A;  1H7W A;  2W0H A;  4G74 A;  2BXR A;  1M64 A;  3SYI A;  4Z26 A;  3EPT A;  3SFD A;  2E4G A;  5HHF A;  1Q1W A;  2J3N A;  3H4K A;  5KOX A;  3R9U A;  4XWR A;  3UTH A;  4CCQ A;  5JCL A;  2JK6 A;  2CDU A;  2XFU A;  4GDP A;  3AYI A;  3AE5 A;  3ADA B;  1PBB A;  3CGC A;  2GR2 A;  5KMP A;  3P4P A;  1ZKQ A;  4PAA A;  2X99 A;  1GPE A;  3GMB A;  1NG4 A;  1Z6L A;  1XHC A;  3FIM B;  4EIQ A;  4Z2R A;  1D4D A;  2OA1 A;  2XVE A;  4BJY A;  2GAH B;  1S2Y A;  2RGH A;  2V61 A;  5HY5 A;  5L46 A;  5EB5 A;  1F8S A;  2X3N A;  1ZMC A;  3LOV A;  1RSG A;  3B3R A;  1L9C A;  2E5V A;  5CQF A;  1KNP A;  3RED A;  3ALJ A;  2XLR A;  3SGL A;  3T2K A;  2YLX A;  4A6N B;  2WS3 A;  4FK1 A;  2YG3 A;  4H7U A;  2BYB A;  3K7M X;  5KWF A;  2V6O A;  2BK4 A;  3BHK A;  4TM3 A;  3NYC A;  4II2 A;  3ALL A;  2V60 A;  2PHH A;  2QA2 A;  4OPL A;  1NHQ A;  3GSI A;  2IVD A;  5JCK A;  3SFE A;  3GDP A;  4OCG A;  3COX A;  4CRT A;  4OPC A;  1IUT A;  4K2X A;  4U2T A;  2C67 A;  2WOW A;  4H4Y A;  4EMW A;  4J34 A;  1O95 A;  2GF3 A;  3DJD A;  2B9W A;  1MOK A;  1TDE A;  1EL5 A;  4H4V A;  4AP1 A;  2IID A;  4BV6 A;  1KDG A;  3UKH A;  1PJ7 A;  3BI5 A;  1H6V A;  5KNL A;  1GAL A;  3VR9 A;  1ZOV A;  3UTF A;  3V3O A;  3C4N A;  4NTE A;  1OJC A;  3NK2 X;  1F8W A;  4YTP A;  1CL0 A;  3SZC A;  1PBC A;  5KMS A;  1ZMD A;  1CC2 A;  2R46 A;  1D4E A;  3KLJ A;  2APG A;  1EL7 A;  3P4R A;  2XLS A;  1PN0 A;  3UKA A;  4H4U A;  4XWZ A;  3BNU A;  4D04 A;  1PBD A;  3AEC A;  4RG4 A;  1GT8 A;  4U8N A;  4IVM B;  1GRB A;  1PBE A;  2TMD A;  2C7G A;  3QFA A;  1K0I A;  3NN0 X;  4Z2T A;  5EB4 A;  3GYX A;  1Q1R A;  2BK3 A;  1JRX A;  3BI2 A;  1YQZ A;  3NIX A;  2XFN A;  4GCM A;  1Y56 A;  2AQJ A;  2JKC A;  3G5Q A;  3P1W A;  1IUU A;  1LV0 A;  1GSN A;  2JB1 A;  3I6D A;  3T14 A;  4G6H A;  3SUC A;  2FJB A;  1QO8 A;  1RP0 A;  1KFY A;  3CN8 A;  3GYI A;  3LZW A;  3P9U A;  1YQ4 A;  1SEZ A;  2XLP A;  1GRH A;  1AOG A;  3UOZ A;  4DGK A;  2BC0 A;  1BGN A;  3LAD A;  4EQR A;  4B65 A;  4C3Y A;  5KVH A;  4FK1 C;  2BCG G;  3T37 A;  3CTY A;  3KVE A;  2OLO A;  3NTA A;  4GRT A;  4NEW A;  3URH A;  1GRF A;  4N9X A;  4J36 A;  2YG6 A;  4YTN A;  3VQR A;  4DSG A;  3CNS A;  3BI4 A;  4CY8 A;  1BZL A;  4TM0 A;  4ECH A;  2NVK X;  2GMJ A;  2WEU A;  4YKG A;  4YTM A;  2YLR A;  4NTD A;  4HA6 A;  3M13 A;  3KPK A;  4JNA A;  1OJA A;  4AP3 A;  2YM1 A;  2WDR A;  4YSY A;  3QVP A;  3AE3 A;  1NPX A;  4YKF A;  4OVI A;  1RYI A;  2X8G A;  4JNQ A;  2VVM A;  2VRM A;  2GEW A;  5KXJ A;  2IVE A;  1ZP0 A;  2WPE A;  1E39 A;  4U2L A;  2WOV A;  1CJ4 A;  4J2W A;  2OAL A;  4U8I A;  4C3X A;  1FL2 A;  1E1L A;  1COY A;  4H4X A;  1NEK A;  2C4C A;  1H86 A;  1TRB A;  1TYT A;  3V76 A;  2BS4 A;  1KSU A;  4A99 A;  4WX1 A;  1DOB A;  1MO9 A;  2RGO A;  5BRT A;  3VRB A;  1HYU A;  5J7X A;  3V3N A;  2QCU A;  3DK4 A;  4I58 A;  4Y4M A;  4DNA A;  4J33 A;  1D7L A;  1CBO A;  1PXB A;  4K22 A;  3E1T A;  3G5R A;  4RG3 A;  3T2Y A;  3GD3 A;  1EBD A;  1E7P A;  2XVJ A;  2C72 A;  2Q6U A;  2WES A;  3AWI A;  3UKQ A;  3ICT A;  5IQ1 A;  3IHG A;  1EL8 A;  2BRY A;  5FS9 A;  1NG3 A;  1GOS A;  2I0Z A;  3NTD A;  4G73 A;  3CNT A;  1P2E A;  3RP6 A;  1GXF A;  3NYF A;  1DJQ A;  2EQ8 A;  4II3 A;  2XLT A;  2ARD A;  3AB1 A;  4CY6 A;  1F6M A;  4RSL A;  1KNR A;  3UKK A;  3VRD B;  3CGB A;  1Q9I A;  2VVL G;  3UOX A;  3AEE A;  3AEF A;  4U2S A;  2RAB A;  4FDC B;  4KX6 A;  4ICY A;  4XXG A;  3RNM A;  3VR8 A;  2VZ2 A;  4IA5 A;  3NNE A;  4O5Q A;  2Z5Y A;  3DGH A;  1H82 A;  1OJT A;  4B67 A;  2B7S A;  3CPH G;  4AOS A;  4OPI A;  3GYJ A;  3UKP A;  4H2Q A;  1BGJ A;  4H50 A;  5IPY A;  1L0V A;  2C70 A;  2VRL A;  2C75 A;  1ZDL A;  2VOU A;  4EM4 A;  1VRQ B;  3AE9 A;  3AD7 B;  3D8X A;  4EQX A;  3DH9 A;  1H81 A;  1P2H A;  2XDO A;  2YLZ A;  2A8X A;  1K4Q A;  4LU6 A;  3RP8 A;  2GMH A;  1ZOY A;  2BA9 A;  1B37 A;  4UP3 A;  2GR1 A;  4PAB A;  1F3P A;  4A6N A;  1JRY A;  4C77 A;  4B64 A;  1NAA A;  2E1M A;  3QVR A;  5EOW A;  4ZCC A;  4U8P A;  3OC4 A;  4Z43 A;  2BCP A;  3C4A A;  3AEB A;  2BK5 A;  3RP7 A;  2VQB A;  3UOV A;  1B8S A;  1DOD A;  3SQP A;  1ZX9 A;  3FPZ A;  2XFP A;  4EQW A;  1IUX A;  4JQ9 A;  1M6I A;  3AYL A;  2Y6R A;  1TDN A;  1FEA A;  2ZZC A;  3T2Z A;  4A65 A;  3UTE A;  1H7X A;  5BVA A;  3CIR A;  3NT6 A;  1GET A;  1JNZ A;  4Z24 A;  2Q0L A;  2XLU A;  2A89 A;  2C3D A;  3NH3 X;  3G5S A;  2BS3 A;  2RGJ A;  2YM2 A;  3HYV A;  4IVO B;  3KA7 A;  4C5O A;  4JY2 A;  1PJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...