4YSZA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-iodo-n-[3-(1-methylethoxy)phenyl]benzamide
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 217
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4yszA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4yszA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4yszA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4yszA04
4WX1A 3AYLA 1E1LA 2X8CA 2WU2A 2EQ9A 5IQ1A 2YM2A 2YLSA 3V3NA 4UP3A 5GRTA 3O0HA 3NK2X 2RGHA 4A9WA 1D4CA 3ICSA 2GAHB 2GR0A 3UOYA 2YLTA 1REOA 1AOGA 1JEHA 2YLXA 1HYUA 3ICRA 3GRTA 1GTEA 4E0VA 4U2SA 3GYIA 4U8MA 3AE7A 2PHHA 1BGNA 3GMBA 4IV9A 1L9EA 4EIPA 1LPFA 4YTMA 1GV4A 1QO8A 2TMDA 3UTGA 4BK2A 2WU5A 1DJQA 1D7YA 4AT0A 4CCQA 1VQWA 4B67A 3CNJA 4APNA 2TPRA 4AOSA 4UDRA 5HHFA 1GESA 3G5QA 1XPQA 5EB4A 1LTXR 1IUUA 3V3OA 2B7RA 3AE3A 4YXDA 3QSSA 3NN6X 5HXIA 5J60A 3VR8A 1H86A 1PN0A 2OLNA 3QFAA 1NDAA 3AE4A 2XDOA 1L9CA 1H83A 4TM1A 2XYOA 3QVRA 1LJ1A 2GR2A 2XVFA 4FX9A 1KNPA 3FG2P 3G5RA 2OLOA 2ZZBA 4U2LA 5CKUA 3ADAB 4Y4MA 3CGBA 1DOEA 2ARDA 4YSZA 5M0ZA 2WP9A 1V59A 1QJDA 1S2YA 3H8IA 3JSKA 1CJ3A 1EBDA 4NTCA 5ER0A 4Z24A 1NHRA 4B69A 1GOSA 2Y6QA 4AT2A 2F5ZA 3LZXA 4EIQA 2R0GA 2XFNA 4JQ9A 5KVIA 1RSGA 4AP1A 2V6OA 2BXSA 1GNDA 4FDCB 1ONFA 1F8WA 1TDFA 4BURA 4H4SA 5BVAA 1CBOA 2WPCA 1JNRA 4OPDA 4EQRA 1GEUA 4H4ZA 3NLCA 5JCMA 1GRAA 3ICTA 4ZCCA 4J56A 2Q7VA 4JNQA 4OPCA 5FS8A 3GYJA 3VR9A 3CNPA 2ZBWA 4IVMB 3B3RA 5JCNA 1ZY8A 2GVCA 2B7SA 2B9WA 1H84A 1VG9A 4K7ZA 1Z6LA 2V60A 5JCIA 1E1KA 2QAEA 3UOZA 1CC2A 4ECHA 2VVLA 4C77A 2GMHA 4CY6A 4TLXA 1GRFA 2WETA 4J34A 1TDOA 3M0OA 1OJ9A 2R0CA 3AEFA 2GB0A 3NK1X 1DXLA 1YKJA 4DSGA 1L0VA 3SM8A 4H4YA 3DGZA 1SEZA 4D03A 3NGCX 3CPHG 2ZZCA 2C67A 4USRA 4CY8A 2VQ7A 4I58A 1CC6A 1KDGA 2JKCA 3VQRA 2JB1A 3QSMA 3C4NA 4MJWA 1FCDA 5EOWA 1YQZA 2GH5A 4OPUA 2GMJA 3C96A 3IWAA 2A87A 3AXBA 4K8DA 2NPXA 2FBWA 1BZLA 4N9XA 4X4JA 5FS6A 3UKHA 3QSEA 3AD7B 3AYJA 2BXRA 2CDUA 3Q9TA 2CULA 1GREA 1KSSA 3NKSA 4H50A 2YG4A 4JY3A 4BJYA 4YKGA 2YLZA 3OZ2A 1TDNA 4B66A 4TM4A 2R0PA 2GV8A 1YY5A 2E5VA 3H8LA 3UP4A 2X8HA 4BJZA 3EF6A 3NYCA 1CJCA 2A8XA 1IUTA 3AECA 2WP5A 3KLJA 3PVCA 2C70A 4A5LA 4GUVA 2WQYA 3CTYA 4AP3A 5KWFA 3I6DA 3BI2A 4NZHA 4GRTA 2BACA 2WOVA 3BNMA 4EQWA 1NG4A 3SFDA 1ZX9A 1YQ4A 3L8KA 3DJDA 1GALA 2WDVA 1VDCA 2DKHA 1B8SA 1EL9A 2C75A 5EB5A 2XLSA 1IUVA 1O95A 2AQJA 3UKLA 3AE8A 4B63A 2B9YA 2ACZA 2XCGA 2C66A 3G5SA 3NRNA 1Q1RA 2O9ZA 2FJBA 3D8XA 1OJDA 2E4GA 2BC1A 4GR1A 1PBDA 1ZKQA 4K22A 2BCGG 5KRQA 3P4RA 3CNTA 1BF3A 1KSUA 2RGJA 3AWIA 4YKFA 3AEGA 2CFYA 3UKPA 2EQ7A 4ZCDA 1VG0A 5L46A 3VRAA 2W0HA 2YG6A 1B5QA 4J57A 4A6NB 2WPFA 2XVHA 1PJ7A 1B37A 1TRBA 3DA1A 2BYBA 2VZ2A 3EAOA 3NK0X 1GRHA 3UKAA 3V76A 2GQFA 5JCKA 3DJJA 4Y4LA 3KU9A 1EL7A 2AR8A 2JK6A 1PXAA 4B64A 2BK4A 3SFEA 2WP6A 4DNAA 4JDRA 2XVEA 3GDNA 1KFYA 1GTHA 1NG3A 2YR6A 1DOCA 4J36A 3F8PA 4H4TA 2YG5A 1D5TA 2RGOA 3T37A 5KOWA 2GQWA 3F8DA 2Q0LA 3GD3A 2BK3A 1JRXA 4JNAA 5DBJA 4C5OA 5KOXA 1CL0A 2VQBA 3DMEA 1W4XA 4J33A 1RP0A 1GT8A 2GF3A 4U8JA 2C73A 2OA1A 4H4UA 1K4QA 4AOXA 2H88A 1EL8A 1Y56A 1M6IA 3FIMB 2WDQA 2C64A 3CNSA 5U63A 3DH9A 3DJEA 2JB3A 3NG7X 3QJ4A 4EQXA 1NPXA 3ISHA 4U2TA 4EMWA 3ABVA 3RP6A 3BI5A 2APGA 2YVGA 4I59A 1MO9A 4O5UA 3UKKA 4H4VA 3DJGX 3S5WA 2R46A 1H7WA 3FPZA 4YSHA 2XVIA 1N4VA 4Z25A 1EL5A 2BS3A 1PDHA 5FMHA 4K5SA 3L1RA 1PBCA 5EBKA 3UCLA 1NHQA 4ICYA 5BULA 4GDEA 1IUWA 3GQKA 4OPLA 4C74A 4H4RA 1PBEA 1GPEA 2Z5XA 4P9SA 4M52A 3RP8A 2XFPA 2WEUA 2YG7A 2HQMA 4H7UA 3REDA 2JAEA 1P2EA 4PAAA 1GRTA 4A99A 1D4DA 2YG3A 4CCRA 5LV9A 1QLBA 3ITJA 1E1MA 4Z2UA 1O94A 2GRTA 3CGDA 1PJ6A 3LXDA 1ZMCA 3UTFA 4X9MA 3RP7A 3AEEA 2H89A 1Q1WA 3ZDNA 2C3DA 1CHUA 1E1NA 1O5WA 3EPTA 3AB1A 4EMIA 2V5ZA 4A65A 3UP5A 1N4UA 3M12A 2C65A 3AEBA 2WPEA 4DGKA 3LOVA 3RNMA 2PYXA 1BGJA 1P2HA 4LA1A 1UKVG 1JU2A 4XXGA 4EMJA 2C72A 2X99A 1X31B 3GMCA 1DOBA 2BCPA 4J2WA 2V61A 2GAGB 3SGLA 2YAUA 3S61A 2QCUA 3P4QA 3LADA 2BK5A 4Z2RA 3AEDA 3PS9A 3NYFA 1IUXA 2GEWA 5J7XA 5JCLA 1K0IA 3PO7A 1MXTA 1BKWA 1LVLA 3SUCA 2JBVA 3DK4A 1Y56B 1H82A 2IIDA 1S3BA 1RYIA 3NTAA 2YR5A 2EQ8A 5BRTA 4OPIA 4J31A 2A89A 1FEAA 4EM4A 1LQUA 2R45A 2VOUA 3DK8A 3AD8B 4H2NA 4Y4NA 4Z2TA 2YWLA 1CC4A 1F8RA 2GR3A 3P9UA 3AD9B 4XWZA 3LZWA 3R9UA 2WS3A 4Z43A 1FOHA 2XLRA 1PBBA 2XLTA 4GF7A 3UKFA 2X8GA 4USQA 5TR3A 4KPRA 3NT6A 1PBFA 4CNKA 2DKIA 3ATRA 3URHA 1ZDLA 2C3CA 3FBSA 3C4AA 4LIIA 2B76A 3GWDA 2XFQA 3NN0X 1NHSA 2BS4A 1OJAA 3ALLA 4HA6A 3KVEA 2YR4A 4GDPA 1FEBA 2V3AA 3ALMA 1CJ4A 1TDKA 5U1OA 2YQUA 3NIXA 3GQHA 2XFOA 4U8LA 1TDEA 2C76A 2FJDA 4FK1C 4C3YA 3ALJA 1ZK7A 4U8OA 4CBQA 3EANA 3OC4A 3NYEA 4UDPA 1TYPA 2X3NA 2YM1A 3VRDB 5C3JA 4ADWA 1H81A 3CN8A 2IVEA 3B6DA 1YQ3A 2GR1A 2VVLG 1Y0PA 4YTPA 2WESA 3UOVA 3UTHA 4TM3A 3ZYXA 2OALA 2XVJA 1IUSA 1GXFA 3ATQA 4YSXA 4IA6A 2JB2A 1LV0A 1GRBA 1OJTA 1F8SA 1CJ2A 1XDIA 3AE1A 1F3PA 3CPJG 3Q6JA 4H4PA 4EM3A 2R9ZA 3KKJA 2WOIA 4RG4A 3P4SA 4IA5A 3AE5A 3AYIA 3IC9A 3AE2A 3LJPA 3I3LA 4U8IA 3SQPA 1NENA 3FMWA 3H4KA 4BK1A 5HYMA 5HY5A 3P1WA 3BI4A 3F8RA 3LB8A 1M64A 4CNJA 1FECA 1GSNA 1F6MA 2LFCA 5GSNA 4B1BA 4FK1A 3BHKA 3BHFA 2FJEA 2E1MA 2I0ZA 2CVJA 3CNDA 3CGEA 3DK9A 5CQFA 5FS9A 1ZOVA 1ZOYA 4NEWA 2BABA 2Y6RA 2FJAA 4D04A 2BS2A 5IPYA 1L9DA 2J3NA 1ELIA 5M10A 2VRMA 4BK3A 5FS7A 2Q6UA 1PJ5A 3GWFA 2YVJA 2WHDA 3CIRA 4Z26A 5BUKA 1XANA 4EQSA 3CPIG 1NHPA 3NHOX 4U8PA 5KXJA 4BV6A 2EQ6A 2V3BA 2YLWA 3K7QX 3GYXA 1PHHA 2Q0KA 2WDRA 4NTDA 4K2XA 1BWCA 2RABA 2R4EA 1N1PA 1FL2A 3COXA 4WCTA 1XHCA 1D7LA 1DODA 1GETA 1E7PA 1JRZA 1PXBA 2UZZA 1ZP0A 5U25A 3KA7A 4GCMA 1H6VA 3CGCA 2BA9A 4OCGA 3AE9A 3RHAA 2B9XA 4U8KA 4TLZA 4Z44A 3GRSA 1E39A 2XFUA 3GSIA 3UOXA 4X9NA 1DNCA 2YVFA 1S3EA 4HB9A 4H4WA 4A7AA 1D4EA 2R4JA 4YWOA 4A79A 3HZLA 1B4VA 1KF6A 2XLUA 3II4A 3KD9A 1N4WA 1COYA 5KVHA 2QA2A 3E1TA 4XWRA 1GRGA 1MOKA 3D1CA 4PABA 1NEKA 4OPGA 2VVMA 3WE0A 3BNUA 2IVDA 1PS9A 2WOWA 4C3XA 4YT0A 4NEVA 4NTEA 1CF3A 2YLRA 1OJCA 4O5QA 5C2TA 3NNEA 4JY2A 4LU6A 4A6NA 3K7TA 2NVKX 1K0LA 3GDPA 2AAQA 2C7GA 4H4XA 2OAMA 1Q9IA 3IHGA 4JN9A 1PXCA 3UKQA 1IJHA 2VRLA 3P4PA 3QFBA 1ZMDA 3DGHA 3IF9A 3NH3X 3M13A 1DJNA 2QA1A 1H7XA 4H4QA 4KX6A 1JRYA 2Z5YA 3IHMA 3AEAA 2WBAA 4CRTA 3UTEA 4OVIA 4DSHA 3GD4A 2ZZ0A 1GERA 2XLPA 4REKA 4U8NA 5IQ4A 4UDQA 4IVOB 4B68A 1JOAA 1KNRA 2BC0A 4K5RA 1LQTA 4YTNA 1TYTA 2X50A 3QVPA 3K7MX 4RSLA 3K30A 1E6EA 1JNZA 3AE6A 1K0JA 4TM0A 1VRQB 1NAAA 3NTDA 4OPTA 4H2RA 4ZN0A 4RG3A 4H2PA 4H2QA 4YSYA 1S2QA 3VRBA 4B65A 3KPFA
chains in the Genus database with same CATH superfamily
5HCMA 1W0BA 3LK2B 3OTOT 3N2GE 3SZWA 2RGHA 1H8TD 1D4CA 2R064 4GYSA 2I59A 3CPZA 3ICRA 2DI4A 4PFPA 1XNRT 4IV9A 1BGNA 2NW7A 1L9EA 2YOEA 3NKZA 4JV5T 3KBUA 1GV4A 1D7YA 2WBLA 3PU8A 5L4EA 4CCQA 2CLYC 2VQFT 1VOMA 2BZBA 5M4YA 4OHFA 3FI7A 5FMNA 4B3ST 5ETWA 5HHFA 2V8SV 5HEOA 3V3OA 3AE3A 3QSSA 2JQHA 5J60A 1IBMT 3AE4A 2XAHB 2XYOA 3CVRA 5J1GA 3QVRA 3C4WA 3G5RA 2OLOA 2ZZBA 4U2LA 4PDWD 3ADAB 2UU9T 5KMSA 4YSZA 2ARDA 5M0ZA 1V59A 2V26A 3H8IA 3A7MA 1VBA4 3JSKA 3HYWA 4NUUA 5FYMA 4NTCA 4Z24A 3SX6A 1NHRA 3EHZA 2BG9C 4U2YA 3J9X1 4GIWA 1GQEA 5AQMB 2BXSA 1GNDA 2IMLA 3LFMA 4HFEA 1ONFA 4NWZA 2Q9QC 5BVAA 3ZMZB 4YY3T 4OPDA 3UU3A 4EQRA 4COFA 3UFGA 4J2CA 3L3PA 1AR84 3GN5B 3X1DA 4DR6T 4P1NA 3VR9A 3B3RA 5JCNA 1ZY8A 2WZIA 1H84A 2VVLA 4CN4A 4TLXA 2DLRA 1TDOA 5A1LA 3M3ZB 2EHOA 1SEZA 3NZQA 1RUC4 4A5XA 3EVYA 4QH1A 3FHNA 4CY8A 1CC6A 4FI5A 5EOWA 4OPUA 4N9XA 5FS6A 3AD7B 2CHOA 5HXCA 4B3TT 1PIV4 1KSSA 3J7Yq 3HKBE 4Q25A 4LF9T 4TM4A 2X9XA 1SHZC 2GV8A 1YY5A 3NYCA 1IUTA 3AECA 2WP5A 3JCFA 3PVCA 1D1BA 1VRH4 3BI2A 2NOXA 3ZCJA 1M62A 3NBXX 4GRTA 2ACXA 2WOVA 4EQWA 1NG4A 4GYRA 4HE8A 3L8KA 4DIDB 3UUMA 3DJDA 1B8SA 2C5JA 5DQVA 3PE0A 1UGOA 2NR4A 1XMOT 4YJ3E 4H9SE 2E9XD 3ZSTA 2E9XB 2C66A 3SZFA 2W2UA 4WBOA 4N78D 5EK3A 3A5XA 2BC1A 1RUI4 2HWC4 1BF3A 4NIQA 2RGJA 5KMRA 2A2FX 5L46A 2RA1A 1B5QA 3CQCB 2WPFA 5JDNA 3ZT6A 3JBG4 4I0UA 3N2OA 3EAOA 4KP3C 3DJJA 2J4GA 4JI0T 3KU9A 3T14A 4PK5A 1AR94 2BK4A 3SFEA 1IJ6A 3PUXF 2R7FA 3T8OA 2RPAA 4JEUB 3T37A 2GQWA 3GD3A 1JRXA 4Q4Y4 2VWAA 2QYWA 4J33A 5LOVE 2PW9A 4Z90A 2UUBT 1NCQD 2H88A 2IDOB 3FIMB 3Q5DA 3DJEA 4EQXA 4U2TA 3RP6A 2APGA 5AFUL 4O5UA 2KZ7B 3UKKA 4H4VA 2R46A 3FPZA 1N4VA 2HH7A 3ZKRA 5L47A 1EL5A 2FUPA 2V5DA 2JIWA 2C4CA 3O4XE 1NHQA 2MAWA 3AVRA 4OPLA 4P9SA 2Z5XA 3RHWA 2YDSA 1ZHCA 4V1Av 3JC6C 2JMHA 2CBJA 3ANWB 4H7UA 3UUNA 2JAEA 4PAAA 3REDA 2PTFA 4A99A 3IF8B 3RKGA 4Z2UA 1O94A 3CGDA 2JQKA 4UIGA 5JDMA 3RP7A 5AQKB 1Q1WA 4X5TA 4ZI2C 2CA5A 4A65A 1N4UA 3AEBA 1VRBA 2PYXA 1BGJA 1P2HA 4LA1A 4EMJA 1JU2A 4J2WA 1HCIA 2BCPA 2YAUA 3IEEA 3K3QC 2BK5A 4DBRA 3AEDA 3PS9A 2RS34 2RS14 4G2AA 4JYAT 5H6RB 2DHRA 4AQYT 2VVNA 3RKOA 4MHCA 2JBVA 1NWMX 1Y56B 1CUNA 3NTAA 2YR5A 3P7IA 1OEDC 4J31A 4EM4A 4Y4NA 1G8XA 1F8RA 5FVLA 3CX6B 2J47A 4XAXB 2W61A 1KNZA 1PBBA 5TR3A 3QC9A 3FBSA 1WYBA 3RQWA 3NN0X 2MPKA 3ZSSA 1NHSA 2XFQA 1HNZT 1OJAA 3PUAA 3ALLA 1FEBA 2D9DA 2KNDA 1W9RA 1CJ4A 3ALMA 2YQUA 5U1OA 2PY5A 3RQUA 2XFOA 2LOSA 1TDEA 2XY8B 2V7MA 4C3YA 4IE6A 3T1YT 2N9DA 4KHPT 5IHYA 4ADWA 1ZV4X 5LYJE 1HF8A 1HX8A 5KX5E 5KMPA 1N34T 1Y0PA 5FVKA 4YTPA 3OPCA 3WAJA 4ILAA 4TM3A 2OALA 2XVJA 1GXFA 4IA6A 5FKYA 3RGLA 2JB2A 1OJTA 1F3PA 1RUF4 3KKJA 2WOIA 1MMNA 3LBXB 4IA5A 4DV7T 2H3RA 3T2ZA 4GB34 3AE2A 2CPTA 3I3LA 4BK1A 1NENA 1XHZA 4EIWA 2XQYA 5LNKA 5FL0A 3P1WA 1M64A 5CQFA 1MIYA 2XZEA 5AQPB 2BS2A 5IPYA 4HFCA 2V6XA 3RYHE 1I94T 4CN6A 4L9IA 2WHDA 4LMJA 4UELA 2LE8A 3K8PC 4XZCA 5BUKA 3Q5EA 3TLSA 2X68A 2VL0A 2WDRA 3ONLC 4GAPA 3COXA 3ZMSB 2J1DG 3AXJB 4WCTA 1DODA 1GETA 5HYAA 1E7PA 3KA7A 4QXBB 3KVBA 3RHAA 3AE9A 2UUAT 4TLZA 5EK2A 4Z44A 2IUBA 3UOXA 2MYSA 3GSIA 2YVFA 4U7IA 3ZT5A 4A79A 1B4VA 1KF6A 2XM2A 1VBD4 3KD9A 1N4WA 5KVHA 3UU8A 2V7IA 2X9HA 3E1TA 4JI1T 2DWGA 1HX1B 2SPCA 1GRGA 1MOKA 4PABA 2PYJA 1NEKA 3AAAB 2VVMA 1OXZA 5LGNB 2E5LT 3T31A 1PS9A 5HXSA 2V7JA 2XM1A 2LJLA 5KDMC 2KMFA 4PJJA 4NTEA 4H9OC 1MIVA 4LU6A 2NVKX 3HR0A 4DR3T 1W09A 4K0UA 2C7GA 1PXCA 1IJHA 3QFBA 2VKHA 3P4PA 5F3JA 3M13A 5L3CB 3UUXB 4H4QA 3AAIA 4DVDA 3AEAA 2Z5YA 2PG8A 2ZZ0A 1SUMB 4II2A 3ZT7A 4IVOB 2X50A 3LSVA 3QVPA 3UU5A 3K7MX 5HEHA 2ZMAA 3NVOA 5AQOB 5LG3A 4UXNB 3VKGA 4YFSA 4YSYA 1Y64B 2BVMA 4DR5T 2WU2A 2X0LB 2EQ9A 1Z0PA 2YM2A 2XQ8A 5GRTA 3O0HA 3C64A 3ZJ2A 4TNVA 3UTKA 1REOA 3CQXC 4IDPA 2CM0A 4E0VA 4U8MA 1MMAA 3AE7A 4YTMA 5AQLB 3F31A 3B5MA 1D0ZA 2TPRA 5HXRA 4AOSA 2YDQA 4AKRB 3G5QA 1LTXR 1IAPA 2B7RA 5BMVE 3RLFF 4G63A 2K48A 5LMUT 1H86A 4HWIB 3QFAA 4O4HE 1L9CA 5LBQB 4TM1A 4LFBT 3N9LA 2GR2A 4FX9A 4M1PA 1KNPA 5IYZE 4Y4MA 3ETVA 1O3XA 3CGBA 2WSSV 2D0UA 2ZM0A 1HG2A 1QJDA 1S2YA 4JEHB 1CJ3A 4B69A 4NXMT 2Y6QA 2WCAA 4JQ9A 4EB6E 2V6OA 1IJ5A 2WWVA 4BURA 4B3MT 1F8WA 3OJAA 2LKHA 4QX7B 1CBOA 4H4ZA 3NLCA 5JCMA 4ZCCA 1E1HB 2Q7VA 1Y01A 2VKDA 3GYJA 4TZ4C 3T0KA 3I0QA 4HGAA 2D2SA 2GVCA 3MJXA 4K7ZA 1Z6LA 5JCIA 1E1KA 2QAEA 1CC2A 4C77A 1X79A 1GRFA 4PJNA 2WETA 2VVSA 4J34A 1OJ9A 3NK1X 1YKJA 4DSGA 3SM8A 3DGZA 2V7LA 2ZZCA 2C67A 2BG9A 4USRA 4I58A 2JB1A 3QSMA 3C4NA 3RRCA 2Q9QA 2YU2A 3RH3A 3OVUA 3C96A 5HEGA 4K8DA 2FBWA 4DR1T 2W4XA 1WYCA 2CDUA 3Q9TA 3C4XA 4H50A 4YKGA 4JY3A 1WFDA 4UV8B 3OZ2A 4DUZT 4BAYB 3WAKA 5HAXA 2XSBA 4BJZA 3GMIA 2A8XA 1YKEB 5L3EB 3EAMA 1VBB4 3VKHA 2C70A 4A5LA 2QGSA 4GUVA 2NWBA 1ASJ4 3SS1A 2R074 3AVSA 2P9BA 4UF0A 4HKAA 4AKIA 3HL6A 1HRV4 3UULA 3BNMA 3SFDA 3ONXA 1YQ4A 4AKGA 2WDVA 1EL9A 4HTEA 3AE8A 4B63A 5JR9B 3PTRB 2XCGA 4WBNE 3P4WA 3NRNA 4UVBB 2FJBA 2EHOD 4U31A 5L3FB 1ZKQA 1J5WA 1RHI4 3CNTA 3CX7B 1KSUA 3AWIA 4GAVA 2HN2A 3QB5K 3VRAA 2W0HA 2IW5B 4J57A 4A6NB 1HXS4 1PJ7A 3DA1A 2VURA 2JRKA 4JLEA 3NK0X 3V76A 3ZLIA 2GQFA 2C5IT 1Z7S4 1MQTD 1PXAA 4PJMA 3IA3A 3EI0A 2XVEA 4K0KT 2YR6A 1DOCA 3QOFA 2ODUA 4IT4A 2YG5A 1D5TA 3F8DA 2Q0LA 4JNAA 2BK3A 4GOUA 5KOXA 4WYVA 5FNVE 4U72A 3DMEA 1W4XA 2C73A 2OA1A 4G73A 4AOXA 1M6IA 2C64A 4EAHA 3NG7X 2Z6EA 3QJ4A 1NPXA 3ISHA 4ZZBA 2V5CA 5JRCA 5DABA 3BI5A 4I59A 3SXIA 1MO9A 2Y8DA 4CXXA 3FZMB 4X66T 5ABFA 2XVIA 3EUHA 2BS3A 5FMHA 3EDVA 3L1RA 5EBKA 4JI5T 1BR4A 4ZS2A 3ZYMA 4IE4A 4M52A 3JAFA 4WW0A 2WEUA 2XFPA 2HQMA 2YG7A 1RMU4 1P2EA 1GRTA 2D0TA 2BBJA 2E2AA 4CCRA 1QLBA 1T7SA 1E1MA 2BRAA 5ABGA 2Y48B 3LXDA 1I6ZA 3L39A 4P0AA 1AR64 3WI3A 2H89A 4CQIA 4UVAB 1T8BA 2YN6A 1E1NA 3EPTA 4ZHQE 3AB1A 5LXTE 1YXRA 2W62A 5FXXA 3RNMA 3RC8A 3PU3A 2C72A 3GMCA 3SGLA 3JAEA 2GAGB 4EV6A 3P4QA 2CBIA 4Z2RA 5JCLA 1BKWA 2BRYA 5CJ5A 5KMGP 1H82A 3KV4A 1S3BA 5BRTA 4HWCA 1LQUA 2R45A 2VOUA 3DK8A 2V6YA 4Z2TA 1FIOA 4IDOA 2BKOA 2RS54 3P9UA 4XWZA 2WS3A 5JDGA 4EEBA 1V9DA 3UKFA 2X8GA 1BEV4 4ZI3D 2DKIA 3ATRA 5JDFA 2C3CA 4LIIA 4E7SA 2BS4A 1WRDA 3LDQB 3UT5E 2X9YA 2LRLA 4QX8B 3NIXA 2MOZA 5HXHA 4U2ZA 4U8LA 5CA1E 3OBVE 2FJDA 5KMQA 3MXZA 3ALJA 3EANA 1OEDA 1TYPA 5AQTB 2YM1A 4L0RA 5C3JA 5F8PA 1W0AA 4WNKA 2IVEA 4TUYE 1YQ3A 2GR1A 3FZLB 3ZN1B 4NPPA 2WESA 2XPKA 2XAFB 3ZYXA 4AXPA 4EOZB 1LKXA 3E08A 3KINB 5LMNT 1J5ET 4EZHA 1CJ2A 1XDIA 3Q6JA 4H4PA 4XBFB 4RG4A 3P4SA 3AYIA 3IC9A 1SA0E 3OYXA 3BQKA 2RMU4 3H4KA 4X1YE 1FECA 1F6MA 4A97A 3PURA 2L8KA 2FJEA 2I0ZA 1ZOVA 4NEWA 1K5MD 2JPFA 4TWDA 1H7CA 2YK0A 1ELIA 3KV5A 2A3DA 3QB5A 1PJ5A 3GWFA 2YVJA 5LGTB 4LFAT 3CIRA 5FL1A 3PJAA 1US7B 2W0GA 3O1JA 1RVF4 3CPIG 2CEAA 4CI3B 5KXJA 5LP6E 2V3BA 4JI8T 3GYXA 2PFVA 4NTDA 4K2XA 2LRKA 2R4EA 4DV5T 1FL2A 1D4M4 1D7LA 1XHCA 4Q4V4 1PXBA 3ONJA 1H6VA 3CGCA 4U8KA 2L9QA 4LFCT 2XFUA 4X9NA 1Z8UA 3M65A 3AAEB 3N9MA 5LGUB 2R4JA 2DWKA 4G74A 4IREA 3ZMTB 3II4A 2E9XA 2UXDT 3O1HA 2QA2A 2OLTA 4OFZA 4OPGA 3CK6A 5AQHB 4AQGA 4DO0A 1R8IA 1CF3A 3NRYA 1OJCA 2CCQA 5C2TA 4JY2A 3K7TA 1FMWA 3U3IA 4H9RC 4H4XA 2OAMA 5KNLA 3IHGA 4B3RT 2LHNA 2VRLA 4H63H 4LMLA 3DGHA 3IF9A 3UU6A 1DJNA 2QA1A 3NWIA 3UU4A 1PO14 3AA6B 1FEWA 2BC0A 1LQTA 2LHRA 4PAGA 5CB4E 3K30A 5JVDE 2IIUA 1E6EA 1NA1D 2NW8A 4TNWA 3I1AA 3RX6A 2YU1A 1S2QA 2K3WA 3PUGA 4WX1A 3AYLA 4AKLA 3A8YC 5IQ1A 2YLSA 4II3A 4UP3A 5FXWA 3SZCA 3ICSA 4AI6A 4IGUA 2GAHB 2YLTA 4OYKA 2CWYA 1AOGA 5L3DB 4CI2B 1JEHA 2YLXA 1HYUA 3GRTA 3CX8B 1GTEA 4U2SA 4UEMA 4IDZA 2NW9A 4MLKA 4IDQA 2TMDA 5AQNB 1DJQA 2BVLA 4AT0A 4CXYA 5LCYA 1VQWA 4B67A 3CNJA 4EYYR 5ADXL 2BKPA 3T1HT 1UUSA 4IDNA 1GESA 3PV0F 1M7KA 4YJ2E 3RYFE 3SZ0A 4O4LE 3NN6X 4ZS3A 3VR8A 1PN0A 4C91A 2XDOA 1H83A 4AKHA 3EDUA 2W00A 2ZLYA 4ILCA 5LJMA 1LJ1A 3NRXA 1MIWA 2DCFA 4AQFC 4U7YA 2XVFA 3FG2P 5CKUA 4DNDA 2E9XC 1DOEA 2JMKA 2WP9A 2XASB 3CKDA 2XQ7A 1LVFA 1EBDA 1GOSA 1U5PA 2ES0A 4EIQA 2IAKA 5KVIA 4AP1A 4FDCB 4BA9A 4H4SA 1JNRA 2NP9A 3ICTA 5FS8A 4OK0A 3FB2A 3FZHB 2ZBWA 2B7SA 1PO24 2V60A 4KBMB 3VHLA 2GMHA 5CGMA 4H9QC 3M0OA 2XQ9A 2HHHT 5L3BB 3AEFA 2GB0A 1DXLA 3ZC1A 3NGCX 5J0ZA 3D0TA 5CFBA 2VQ7A 3CQGB 1KDGA 3VQRA 3F57A 4MJWA 4DUYT 4X1KE 3IWAA 3UKQA 3QSEA 4HWHA 2BXRA 1OWAA 3K1SA 3NKSA 1POV0 2UXCT 4BJYA 2YLZA 4TWHA 2V7KA 4B66A 2R0PA 2X0HA 3K3NA 3H8LA 3UP4A 3Q9DA 2KSRA 3EF6A 1CJCA 2CLYB 4IL4A 5KWFA 4CZZB 4ANJA 4NZHA 3KFWX 1QUUA 2BACA 3HKDE 1ZX9A 3DP7A 3ZYKA 1GALA 4PNIA 2C75A 3RPUA 2XLSA 3UKLA 1HNWT 3E22E 4HFHA 3BQIA 1B7TA 3G5SA 3C4ZA 1Q1RA 3D8XA 3Q5WA 4DMVA 1PBDA 5KRQA 5AQGB 3UKPA 3ESLA 2ZM8A 3B13A 2YG6A 2Q9QD 2XVHA 1B37A 2BYBA 2VZ2A 5E0OA 3PUWF 4Y4LA 3ZPOA 1EL7A 1XDPA 2AR8A 2JK6A 3ZCIA 4B64A 4JDRA 3GDNA 1KFYA 1NG3A 3HKEE 3SY4A 1ZKEA 3U78A 2WMNA 5DBJA 4I55E 1WCRA 2XUEA 1CL0A 2VQBA 3W15B 3KVAA 1GT8A 3N9PA 4H63V 3BK9A 4H4UA 3MKDA 5DQWA 3V5UA 1EL8A 3RC3A 5AQRB 1AL24 4UF0B 4MALA 2WDQA 3DH9A 4ZZCA 2JB3A 4YHHT 3CMMA 2VL8A 3TLTA 3ABVA 5IWAT 2UXXB 4H9NC 2YVGA 1COV4 1HRI4 4UVCB 4Z25A 1PDHA 1PBCA 3UCLA 4ICYA 1IUWA 3H3MA 2XQ6A 4PK6A 4H4RA 4HFVA 1NAFA 4UR9A 4MFRA 2CXLA 3QK6A 5FY0A 4DV4T 2B1EA 1D4DA 2YG3A 2PBIA 5LV9A 3ITJA 4IE5A 1MNEA 4A56A 1PJ6A 1HTJF 2KINB 4F8HA 4TN7B 3UTFA 3RIAA 1DU2A 2WMOA 3QNUA 3UFEA 2W63A 3ZDNA 4ERRA 4EMIA 4LF4T 3M12A 4DGKA 3LOVA 1WR6A 3H3AA 2WY2A 3P8CD 4JBWF 1UURA 1X31B 4PFOA 2NTYA 4LF8T 4AIUA 1DOBA 2XAJB 3AA7B 3ZMUB 3NYFA 1IUXA 4ISTA 1K0IA 3PO7A 1IZNB 1LVLA 2VASA 3BQLA 1RYIA 2EQ8A 2A89A 1FEAA 2QRXA 4H2NA 3EABA 3V5SA 3AD8B 2PJQA 1FJGT 5JRCB 1CC4A 2YWLA 2NTXA 4LF5T 5ABFB 3C98B 3AD9B 2CWOA 3LZWA 2N1GA 3R9UA 5AQJB 4Z43A 2XHEB 1FOHA 1MNDA 2XLTA 4GF7A 3HYXA 1XMQT 4USQA 4IIJE 4ISSA 3RIUC 3NT6A 3IBPA 5LBMA 2LSIA 1PBFA 1ZDLA 2X5ID 3C4AA 2B76A 1RUG4 2EHOB 2BG9E 2JQ9A 3Q2MA 4GDPA 2LKGA 2V3AA 1TDKA 2IC6A 3I0OA 3E0ZA 2C76A 4RHV4 4FK1C 1XHXA 1ZK7A 3OC4A 4UDPA 1N33T 1XI1A 4X65T 1H81A 3RI5A 3CN8A 5AQVB 3B6DA 5HEJA 4LMKA 3UOVA 4HN9A 3TLWA 3UTHA 4NXNT 2KWIB 1IUSA 4YSXA 5L3GB 4ADZA 5JDQA 1QSDA 3RIFA 5LHGB 3AE1A 3CPJG 4GKKT 3J8F4 3KBTA 2R9ZA 3ZJ1A 3JC6D 3AE5A 3P50A 3LJPA 4U8IA 3FMWA 5HYMA 2A9UA 2C5KT 3BI4A 2LSKA 4DR4T 2EX3A 3MZKB 1GSNA 3Q5XA 5BR8T 2LFCA 2V6YB 4B1BA 3F2EA 3BHKA 3CNDA 3DK9A 4DV6T 1ZOYA 4ZEYA 4ZI2D 2BABA 4KUMB 4U33A 5ABHA 2J3NA 1LVKA 2VRMA 5FS7A 5J2TE 2Q6UA 3T2KA 2X51A 2CRBA 4Z26A 3O1IA 4LF7T 1XANA 4EQSA 3N2KE 2YLWA 3K7QX 2Q0KA 1N1PA 3UTGA 4B6XA 2I6HA 1OOPD 2K24A 2UZZA 4Z8XA 2XQAA 2BA9A 4OCGA 4I4TE 1OEDB 2LSGA 1R084 1S3EA 4HB9A 2CXFA 4A7AA 4YWOA 2UUCT 3HZLA 5JR9A 1XWMA 2XLUA 1BR2A 1RUD4 4Z91A 2GK9A 2LOPA 2MTQA 4NNJA 2CMRA 2VK9A 5FXZA 2QA7A 4HWFA 4JI4T 2WOWA 3DTOA 4KI0F 4C3XA 2LM2A 4YT0A 4NEVA 4O5QA 1J1JA 4A6NA 4L5GA 4U74A 4F6RC 1K0LA 3GDPA 2AAQA 5H6QB 2XQ5A 2CHNA 4JN9A 1HR0T 2KXPB 3NH3X 1H7XA 3I9WA 4DR7T 1VCTA 1UCUA 4OVIA 4I43B 1GERA 2XLPA 3C50A 4U8NA 4UDQA 3KV6A 3PUZF 3UQ4A 1TYTA 2UXBT 4RSLA 5FY1A 3AE6A 1K0JA 4TM0A 4DV0T 3PUYF 1WLXA 4RG3A 1MMGA 2OA5A 3NZPA 2XJ7A 4DR2T 2YDRA 3VRBA 3SRZA 5LHIB 3KPFA 1UX4A 1E1LA 2X8CA 2WAUA 3ZC0A 3V3NA 3NK2X 4A9WA 4X62T 2GR0A 3GN5A 1YD8G 3UOYA 4WZXA 3SOLA 4ASKA 1XZYA 2IC9A 5FXVA 4LF6T 3T2YA 2L3LA 5FP3A 3GYIA 4PK4A 2PHHA 3GMBA 4EIPA 1LPFA 5AQUB 4BK2A 1QO8A 3FXEB 2WU5A 1BR0A 5JQGE 2AXDS 1LRZA 4APNA 5LB7B 4ILBA 2WZHA 4EGWA 4UDRA 4JI7T 5JDHA 2LLYA 1XPQA 2D5UA 4GK5E 2JJ9A 5EB4A 1IUUA 1SE7A 4YXDA 4CXWA 5HXIA 3HKCE 1D1AA 3IHRA 2OLNA 1NDAA 3QUJA 1UX5A 2YEVC 5JR9C 5LHHB 4I50E 2ZM6T 3FXDB 3R84B 5C8YE 3RYIE 2AE9A 2WWUA 2EHOC 3LK42 4DV3T 5CA0E 5ER0A 5AQSB 2R6GF 4AT2A 2F5ZA 1T98A 3LZXA 2R0GA 2XFNA 4G6GA 4HFDA 1RSGA 3PUVF 1TDFA 2WPCA 2M6BA 4HWDA 2LSJA 1GEUA 1GRAA 1E2AA 1PVC4 1OEDE 4J56A 3TKLB 4JNQA 4OPCA 2MBGA 2G0UA 3CNPA 4IVMB 5LJNA 2B9WA 1VG9A 3FBLA 3UOZA 4ECHA 4AQFA 4CY6A 2UXNB 2R0CA 3PDYA 1L0VA 1R094 4H4YA 4D03A 5ABEA 2I0MA 3LG7A 3MA9A 3CPHG 3RRWA 2M6IA 3ZMVB 1FMVA 2QVAA 2JKCA 4IHJE 1HNXT 2ZM2A 4GK0E 2H7OA 4CN1A 2JQQA 2PZSA 1FCDA 2VQET 1YQZA 2GH5A 2GMJA 2A87A 3AXBA 3GA8A 2NPXA 2OV9A 1BZLA 4X4JA 3UKHA 2RR14 1RUJ4 3AYJA 2CULA 1GREA 1YKHB 2YG4A 4PW8A 1TDNA 4AISA 4C90A 5HEUA 5EK4A 3N9OA 2E5VA 2KWHA 2X8HA 2Y6XA 4YLHA 2VKJA 4TV9E 3KLJA 2WQYA 3N9QA 3CTYA 4AP3A 2HPLA 3R6NA 3I6DA 4YHJA 4ZI7E 4A98A 5L2LA 4QHOA 1VDCA 2DKHA 5HWXA 5EB5A 1IUVA 1O95A 2AQJA 4PJLA 4JI3T 2B9YA 2ACZA 4IL9A 2ODVA 2VB6A 4ILUA 4G9KA 2O9ZA 3HI2A 1HG5A 4QXCB 4QXHB 1OJDA 2CE7A 4UV9B 2E4GA 2R044 4IE7A 4OYJA 2M67A 4GR1A 4K22A 2BCGG 3ANWA 3DJBA 3P4RA 4EXTA 4HFIA 4YKFA 3AEGA 2CFYA 2XAGB 2EQ7A 3CMLA 4ZCDA 1VG0A 1U4QA 4QH5A 1T72A 5JDLA 4IE0A 4X64T 1TRBA 3ZYLA 1GRHA 3UKAA 5JCKA 3RF1A 4FJOA 1VBC4 2XQ4A 3MACA 2WP6A 3ETUA 5F5WA 4DNAA 3CWZB 2DL1A 2YINA 4QH4A 4ZI3C 1GTHA 4J36A 3F8PA 4H4TA 5KOWA 2RGOA 3C51A 3AA1B 3HYVA 4C5OA 4NUVA 1RP0A 2GF3A 4U8JA 3GWHA 1K4QA 2H7VC 1Y56A 2IHR1 4O4IE 1HS7A 3CNSA 5U63A 5DJQC 3LJCA 4EMWA 2WB5A 5IUXA 3JD74 1VBE4 3SWHA 3K3OA 3DJGX 5TAOA 3S5WA 1H7WA 4YSHA 1BR1A 4K5SA 4MBQA 5BULA 3HA4A 4JI6T 4GDEA 5JH7E 3GQKA 4C74A 2X66A 2N2NA 3L8RA 3N9NA 2X9WA 1GPEA 1PBEA 4EEDA 4DBQA 3ZN0B 1D0YA 3RP8A 2PLV4 1IBKT 4O2AE 3O9XA 5FY7A 2RP4A 4HFBA 2BDEA 3KDSE 4O8SA 2C0SA 2GRTA 5JTGA 1S35A 1ZMCA 1AJ3A 4X9MA 3AEEA 1G73A 1UK5A 2A72A 4E7ZA 2BBHA 4EZ4A 4U3CA 2C3DA 1CHUA 1O5WA 4DMWA 3AA0B 2V5ZA 3FZKB 3UP5A 2C65A 2WPEA 4X20E 1UKVG 4XXGA 2X99A 1XDOA 2V61A 3PUSA 1N36T 3S61A 2QCUA 5L4HA 3LADA 4O4JE 4TV8E 2GEWA 3LBXA 5J7XA 1ZEEA 1MXTA 3SUCA 3DK4A 1D1CA 5HCJA 2IIDA 3B57A 1X9BA 4OPIA 3PJAJ 5JREA 2PYLA 5HXEA 1EAH4 1HFAA 4EYUA 2GR3A 2BKNA 3L09A 2KT9A 2XLRA 3JADA 4OX9T 2KLQA 5HWYA 3OYZA 4KPRA 3UQ7A 1MMDA 4CNKA 3URHA 3OKQA 3GWDA 4QWNB 3KV9A 4HA6A 3KVEA 2YR4A 3AXJA 3GQHA 2BG9B 2K5BB 5EZYE 2J62A 4U8OA 4CBQA 3NYEA 2Q9QB 4P09A 2X3NA 2HN1A 3VRDB 1KK7A 4H9PC 2VVLG 2HWB4 2HPJA 4TX5A 3ATQA 2V1DB 2VKOA 4X1IE 1LV0A 1D0XA 5LA6E 1GRBA 3RIUA 1F8SA 4DV1T 3TLVA 4EM3A 4HEAA 4JUYA 1AR74 3SQPA 1VCSA 2X0YA 5HY5A 5AQIB 3F8RA 3LB8A 4CNJA 2RM24 5J2UE 5GSNA 4FK1A 2CXDA 3BHFA 2E1MA 2CVJA 5FS9A 3CGEA 3PUQA 4JI2T 2E8IA 3UUBA 2Y6RA 2FJAA 4D04A 1L9DA 5M10A 4BK3A 4ZOLE 4KHZF 1KEYA 1NHPA 1EZ3A 3NHOX 4U8PA 4BV6A 2EQ6A 1PHHA 2LEHA 1BWCA 2RABA 1JRZA 1ZP0A 4P0BA 5U25A 4GCMA 3G06A 2B9XA 3GRSA 1E39A 1DNCA 5AQQB 4H4WA 1D4EA 2F4VT 3I9YA 2W67A 2XQ3A 3MK7C 1RUE4 1RUH4 2LM9A 2X67A 3FZFB 3VU7H 1COYA 2LSYA 4Q4X4 4XWRA 4BJNA 2WM9A 4ZXLA 1EV14 3D1CA 3SYIA 5AQFB 2DNXA 3WE0A 3BNUA 2IVDA 3AB3B 2XSAA 2LT3A 1XNQT 2YLRA 4QKNA 4O2BE 1N32T 3NNEA 2XTLA 4Q4W4 4CI1B 1Q9IA 2YKSA 2W66A 1ZMDA 1YW0A 1IBLT 4TWFA 5GONE 3S4UA 5LG4A 3LK3B 4KX6A 4BJMA 1JRYA 3IHMA 2WBAA 3H37A 3UTEA 4CRTA 4DSHA 3FBZA 3GD4A 2K9AA 4REKA 5IQ4A 4G6HA 3ZEFB 4B68A 1JOAA 1KNRA 3N5LA 4K5RA 4YTNA 1JNZA 4KMCA 3KPKA 1VRQB 1NAAA 3NTDA 4DV2T 4OPTA 4H2RA 4ZN0A 4H2PA 4H2QA 1WR0A 3RYCE 4GKJT 2XAQB 4B65A 3TLUA 1S94A
chains in the Genus database with same CATH topology
4WX1A 3AYLA 1E1LA 2X8CA 2WU2A 2EQ9A 5IQ1A 2YM2A 2YLSA 3V3NA 4II3A 4UP3A 5GRTA 3O0HA 3SZCA 3NK2X 2RGHA 3SZWA 4A9WA 1D4CA 3ICSA 2GAHB 2GR0A 3UOYA 2YLTA 1REOA 1AOGA 1JEHA 2YLXA 1HYUA 3ICRA 3GRTA 3T2YA 1GTEA 4E0VA 4U2SA 3GYIA 4U8MA 3AE7A 2PHHA 1BGNA 3GMBA 4IV9A 1L9EA 4EIPA 1LPFA 4YTMA 1GV4A 1QO8A 2TMDA 3UTGA 4BK2A 2WU5A 1DJQA 1D7YA 4AT0A 4CCQA 1VQWA 4B67A 3CNJA 4APNA 2TPRA 4AOSA 4UDRA 5HHFA 1GESA 3G5QA 1XPQA 5EB4A 1LTXR 1IUUA 3V3OA 2B7RA 3AE3A 4YXDA 3SZ0A 3QSSA 3NN6X 5HXIA 5J60A 3VR8A 1H86A 1PN0A 2OLNA 3QFAA 1NDAA 3AE4A 2XDOA 1L9CA 1H83A 4TM1A 2XYOA 3QVRA 1LJ1A 2GR2A 2XVFA 4FX9A 1KNPA 3FG2P 3G5RA 2OLOA 2ZZBA 4U2LA 5CKUA 3ADAB 4Y4MA 5KMSA 3CGBA 1DOEA 2ARDA 4YSZA 5M0ZA 2WP9A 1V59A 1QJDA 1S2YA 3H8IA 3JSKA 3HYWA 1CJ3A 1EBDA 4NTCA 5ER0A 4Z24A 3SX6A 1NHRA 4B69A 1GOSA 2Y6QA 4AT2A 2F5ZA 3LZXA 4G6GA 2R0GA 2XFNA 4EIQA 4JQ9A 5KVIA 1RSGA 4AP1A 2V6OA 2BXSA 1GNDA 4FDCB 1ONFA 1F8WA 1TDFA 4NWZA 4H4SA 4BURA 5BVAA 1CBOA 2WPCA 1JNRA 4OPDA 4EQRA 1GEUA 4H4ZA 3NLCA 5JCMA 1GRAA 3ICTA 4ZCCA 4J56A 2Q7VA 4JNQA 4OPCA 5FS8A 3GYJA 3VR9A 3CNPA 2ZBWA 4IVMB 3B3RA 3T0KA 5JCNA 1ZY8A 2GVCA 2B7SA 2B9WA 1H84A 1VG9A 4K7ZA 1Z6LA 2V60A 5JCIA 1E1KA 2QAEA 3UOZA 1CC2A 4ECHA 2VVLA 4C77A 2GMHA 4CY6A 4TLXA 1GRFA 2WETA 4J34A 1TDOA 3M0OA 1OJ9A 2R0CA 3AEFA 2GB0A 3NK1X 1DXLA 1YKJA 4DSGA 1L0VA 3SM8A 4H4YA 3DGZA 1SEZA 4D03A 3NGCX 3CPHG 2ZZCA 2C67A 4USRA 4CY8A 2VQ7A 4I58A 1CC6A 1KDGA 2JKCA 3VQRA 2JB1A 3QSMA 3C4NA 4MJWA 1FCDA 5EOWA 1YQZA 2GH5A 4OPUA 2GMJA 3C96A 3IWAA 2A87A 3AXBA 4K8DA 2NPXA 2FBWA 1BZLA 4N9XA 4X4JA 5FS6A 3UKHA 3QSEA 3AD7B 3AYJA 2BXRA 2CDUA 3Q9TA 2CULA 1GREA 1KSSA 3NKSA 4H50A 2YG4A 4JY3A 4BJYA 4YKGA 2YLZA 3OZ2A 1TDNA 4B66A 4TM4A 2R0PA 2GV8A 1YY5A 2E5VA 3H8LA 3UP4A 2X8HA 4BJZA 3EF6A 3NYCA 1CJCA 2A8XA 1IUTA 3AECA 2WP5A 3KLJA 3PVCA 2C70A 4A5LA 4GUVA 2WQYA 3CTYA 4AP3A 5KWFA 3I6DA 3BI2A 4NZHA 4GRTA 2BACA 2WOVA 3BNMA 4EQWA 1NG4A 3SFDA 1ZX9A 1YQ4A 3L8KA 3DJDA 1GALA 2WDVA 1VDCA 2DKHA 1B8SA 1EL9A 2C75A 5EB5A 2XLSA 1IUVA 1O95A 2AQJA 3UKLA 3AE8A 4B63A 2B9YA 2ACZA 2XCGA 2C66A 3G5SA 3NRNA 1Q1RA 3SZFA 4G9KA 2O9ZA 2FJBA 3D8XA 1OJDA 2E4GA 2BC1A 4GR1A 1PBDA 1ZKQA 4K22A 2BCGG 5KRQA 3P4RA 3CNTA 1BF3A 1KSUA 2RGJA 3AWIA 4GAVA 4YKFA 3AEGA 2CFYA 3UKPA 5KMRA 2EQ7A 4ZCDA 1VG0A 5L46A 3VRAA 2W0HA 2YG6A 1B5QA 4J57A 4A6NB 2WPFA 2XVHA 1PJ7A 1B37A 1TRBA 3DA1A 2BYBA 2VZ2A 3EAOA 3NK0X 1GRHA 3UKAA 3V76A 2GQFA 5JCKA 3DJJA 4Y4LA 3KU9A 1EL7A 3T14A 2AR8A 2JK6A 1PXAA 4B64A 2BK4A 3SFEA 2WP6A 4DNAA 4JDRA 2XVEA 3GDNA 1KFYA 1GTHA 1NG3A 2YR6A 1DOCA 4J36A 3F8PA 3SY4A 4H4TA 2YG5A 1D5TA 2RGOA 3T37A 5KOWA 2GQWA 3F8DA 2Q0LA 3GD3A 2BK3A 1JRXA 4JNAA 5DBJA 3HYVA 4C5OA 5KOXA 1CL0A 2VQBA 3DMEA 1W4XA 4J33A 1RP0A 1GT8A 2GF3A 4U8JA 2C73A 2OA1A 4G73A 4H4UA 1K4QA 4AOXA 2H88A 1EL8A 1Y56A 1M6IA 3FIMB 2WDQA 2C64A 3CNSA 5U63A 3DH9A 3DJEA 2JB3A 3NG7X 3QJ4A 3CMMA 4EQXA 1NPXA 3ISHA 4U2TA 4EMWA 3ABVA 3RP6A 3BI5A 2APGA 2YVGA 4I59A 1MO9A 4O5UA 3SXIA 3UKKA 4H4VA 3DJGX 3S5WA 2R46A 1H7WA 3FPZA 4YSHA 2XVIA 1N4VA 4Z25A 1EL5A 2BS3A 1PDHA 5FMHA 4K5SA 3L1RA 1PBCA 2C4CA 5EBKA 3UCLA 1NHQA 4ICYA 5BULA 4GDEA 1IUWA 3GQKA 4OPLA 4C74A 4H4RA 1PBEA 1GPEA 2Z5XA 4P9SA 4M52A 3RP8A 2XFPA 2WEUA 2YG7A 2HQMA 4H7UA 3REDA 2JAEA 1P2EA 4PAAA 1GRTA 4A99A 1D4DA 2YG3A 4CCRA 5LV9A 1QLBA 3ITJA 1E1MA 4Z2UA 1O94A 2GRTA 3CGDA 1PJ6A 2BRAA 3LXDA 1ZMCA 3UTFA 4X9MA 3RP7A 3AEEA 2H89A 1Q1WA 3ZDNA 2C3DA 1CHUA 1E1NA 1O5WA 3EPTA 3AB1A 4EMIA 2V5ZA 4A65A 3UP5A 1N4UA 3M12A 2C65A 3AEBA 2WPEA 4DGKA 3LOVA 3RNMA 2PYXA 1BGJA 1P2HA 4LA1A 1UKVG 1JU2A 4XXGA 4EMJA 2C72A 2X99A 1X31B 3GMCA 1DOBA 2BCPA 4J2WA 2V61A 2GAGB 3SGLA 2YAUA 3S61A 2QCUA 3P4QA 3LADA 2BK5A 4Z2RA 3AEDA 3PS9A 3NYFA 1IUXA 2GEWA 5J7XA 5JCLA 1K0IA 3PO7A 1MXTA 1BKWA 1LVLA 2BRYA 3SUCA 2JBVA 3DK4A 1Y56B 1H82A 2IIDA 1S3BA 1RYIA 3NTAA 2YR5A 2EQ8A 5BRTA 4OPIA 4J31A 2A89A 1FEAA 4EM4A 1LQUA 2R45A 2VOUA 3DK8A 3AD8B 4H2NA 4Y4NA 4Z2TA 2YWLA 1CC4A 1F8RA 2GR3A 3P9UA 3AD9B 4XWZA 3LZWA 3R9UA 2WS3A 4Z43A 1FOHA 2XLRA 1PBBA 2XLTA 4GF7A 3HYXA 3UKFA 2X8GA 4USQA 5TR3A 4KPRA 3NT6A 1PBFA 4CNKA 2DKIA 3ATRA 3URHA 1ZDLA 2C3CA 3FBSA 3C4AA 4LIIA 2B76A 3GWDA 2XFQA 3NN0X 1NHSA 2BS4A 1OJAA 3ALLA 4HA6A 3KVEA 2YR4A 4GDPA 1FEBA 2V3AA 3ALMA 1CJ4A 1TDKA 5U1OA 2YQUA 3NIXA 3GQHA 2XFOA 4U8LA 1TDEA 2C76A 2FJDA 5KMQA 4FK1C 4C3YA 3ALJA 1ZK7A 4U8OA 4CBQA 3EANA 3OC4A 3NYEA 4UDPA 1TYPA 2X3NA 2YM1A 3VRDB 5C3JA 4ADWA 1H81A 3CN8A 2IVEA 3B6DA 5KMPA 1YQ3A 2GR1A 2VVLG 1Y0PA 4YTPA 2WESA 3UOVA 3UTHA 4TM3A 3ZYXA 2OALA 2XVJA 1IUSA 1GXFA 3ATQA 4YSXA 4IA6A 2JB2A 1LV0A 1GRBA 1OJTA 1F8SA 1CJ2A 1XDIA 3AE1A 1F3PA 3CPJG 3Q6JA 4H4PA 4EM3A 2R9ZA 3KKJA 2WOIA 4RG4A 3P4SA 4IA5A 3AE5A 3AYIA 3T2ZA 3IC9A 3AE2A 3LJPA 3I3LA 4U8IA 3SQPA 1NENA 3FMWA 3H4KA 4BK1A 5HYMA 5HY5A 3P1WA 3BI4A 3F8RA 3LB8A 1M64A 4CNJA 1FECA 1GSNA 1F6MA 2LFCA 5GSNA 4B1BA 4FK1A 3BHKA 3BHFA 2FJEA 2E1MA 2I0ZA 2CVJA 3CNDA 3CGEA 3DK9A 5CQFA 5FS9A 1ZOVA 1ZOYA 4NEWA 2BABA 2Y6RA 2FJAA 4D04A 2BS2A 5IPYA 1L9DA 2J3NA 1ELIA 5M10A 2VRMA 4BK3A 5FS7A 2Q6UA 1PJ5A 3GWFA 2YVJA 3T2KA 2WHDA 3CIRA 4Z26A 5BUKA 1XANA 4EQSA 3CPIG 1NHPA 3NHOX 4U8PA 5KXJA 4BV6A 2EQ6A 2V3BA 2YLWA 3GYXA 3K7QX 1PHHA 2Q0KA 2WDRA 4NTDA 4K2XA 1BWCA 2RABA 4GAPA 2R4EA 1N1PA 1FL2A 3COXA 4WCTA 1XHCA 1D7LA 1DODA 1GETA 1E7PA 1JRZA 1PXBA 2UZZA 1ZP0A 5U25A 3KA7A 4GCMA 1H6VA 3CGCA 2BA9A 4OCGA 3AE9A 3RHAA 2B9XA 4U8KA 4TLZA 4Z44A 3GRSA 1E39A 2XFUA 3GSIA 3UOXA 4X9NA 1DNCA 2YVFA 1S3EA 4HB9A 4H4WA 4A7AA 1D4EA 2R4JA 4YWOA 4A79A 4G74A 3HZLA 1B4VA 1KF6A 2XLUA 3II4A 3KD9A 1N4WA 1COYA 5KVHA 2QA2A 4NNJA 3E1TA 4XWRA 1GRGA 1MOKA 3D1CA 4PABA 3SYIA 1NEKA 4OPGA 2VVMA 3WE0A 3BNUA 2IVDA 3T31A 1PS9A 2WOWA 4C3XA 4YT0A 4NEVA 4NTEA 1CF3A 2YLRA 1OJCA 4O5QA 5C2TA 3NNEA 4JY2A 4LU6A 4A6NA 3K7TA 2NVKX 1K0LA 3GDPA 2AAQA 2C7GA 4H4XA 2OAMA 1Q9IA 5KNLA 3IHGA 4JN9A 1PXCA 3UKQA 1IJHA 2VRLA 3P4PA 3QFBA 1ZMDA 3DGHA 3IF9A 3NH3X 3M13A 1DJNA 2QA1A 1H7XA 4H4QA 4KX6A 1JRYA 2Z5YA 3IHMA 3AEAA 2WBAA 4CRTA 3UTEA 4OVIA 4DSHA 3GD4A 2ZZ0A 1GERA 2XLPA 4REKA 4U8NA 4G6HA 5IQ4A 4II2A 4UDQA 4IVOB 4B68A 1JOAA 1KNRA 2BC0A 4K5RA 1LQTA 4YTNA 1TYTA 2X50A 3QVPA 3K7MX 4RSLA 3K30A 1E6EA 1JNZA 3KPKA 3AE6A 1K0JA 4TM0A 1VRQB 1NAAA 3NTDA 4OPTA 4H2RA 4ZN0A 4RG3A 4H2PA 4H2QA 4YSYA 1S2QA 3VRBA 4B65A 3KPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WX1 A;  3AYL A;  1E1L A;  2X8C A;  2WU2 A;  2EQ9 A;  5IQ1 A;  2YM2 A;  2YLS A;  3V3N A;  4UP3 A;  5GRT A;  3O0H A;  3NK2 X;  2RGH A;  4A9W A;  1D4C A;  3ICS A;  2GAH B;  2GR0 A;  3UOY A;  2YLT A;  1REO A;  1AOG A;  1JEH A;  2YLX A;  1HYU A;  3ICR A;  3GRT A;  1GTE A;  4E0V A;  4U2S A;  3GYI A;  4U8M A;  3AE7 A;  2PHH A;  1BGN A;  3GMB A;  4IV9 A;  1L9E A;  4EIP A;  1LPF A;  4YTM A;  1GV4 A;  1QO8 A;  2TMD A;  3UTG A;  4BK2 A;  2WU5 A;  1DJQ A;  1D7Y A;  4AT0 A;  4CCQ A;  1VQW A;  4B67 A;  3CNJ A;  4APN A;  2TPR A;  4AOS A;  4UDR A;  5HHF A;  1GES A;  3G5Q A;  1XPQ A;  5EB4 A;  1LTX R;  1IUU A;  3V3O A;  2B7R A;  3AE3 A;  4YXD A;  3QSS A;  3NN6 X;  5HXI A;  5J60 A;  3VR8 A;  1H86 A;  1PN0 A;  2OLN A;  3QFA A;  1NDA A;  3AE4 A;  2XDO A;  1L9C A;  1H83 A;  4TM1 A;  2XYO A;  3QVR A;  1LJ1 A;  2GR2 A;  2XVF A;  4FX9 A;  1KNP A;  3FG2 P;  3G5R A;  2OLO A;  2ZZB A;  4U2L A;  5CKU A;  3ADA B;  4Y4M A;  3CGB A;  1DOE A;  2ARD A;  4YSZ A;  5M0Z A;  2WP9 A;  1V59 A;  1QJD A;  1S2Y A;  3H8I A;  3JSK A;  1CJ3 A;  1EBD A;  4NTC A;  5ER0 A;  4Z24 A;  1NHR A;  4B69 A;  1GOS A;  2Y6Q A;  4AT2 A;  2F5Z A;  3LZX A;  4EIQ A;  2R0G A;  2XFN A;  4JQ9 A;  5KVI A;  1RSG A;  4AP1 A;  2V6O A;  2BXS A;  1GND A;  4FDC B;  1ONF A;  1F8W A;  1TDF A;  4BUR A;  4H4S A;  5BVA A;  1CBO A;  2WPC A;  1JNR A;  4OPD A;  4EQR A;  1GEU A;  4H4Z A;  3NLC A;  5JCM A;  1GRA A;  3ICT A;  4ZCC A;  4J56 A;  2Q7V A;  4JNQ A;  4OPC A;  5FS8 A;  3GYJ A;  3VR9 A;  3CNP A;  2ZBW A;  4IVM B;  3B3R A;  5JCN A;  1ZY8 A;  2GVC A;  2B7S A;  2B9W A;  1H84 A;  1VG9 A;  4K7Z A;  1Z6L A;  2V60 A;  5JCI A;  1E1K A;  2QAE A;  3UOZ A;  1CC2 A;  4ECH A;  2VVL A;  4C77 A;  2GMH A;  4CY6 A;  4TLX A;  1GRF A;  2WET A;  4J34 A;  1TDO A;  3M0O A;  1OJ9 A;  2R0C A;  3AEF A;  2GB0 A;  3NK1 X;  1DXL A;  1YKJ A;  4DSG A;  1L0V A;  3SM8 A;  4H4Y A;  3DGZ A;  1SEZ A;  4D03 A;  3NGC X;  3CPH G;  2ZZC A;  2C67 A;  4USR A;  4CY8 A;  2VQ7 A;  4I58 A;  1CC6 A;  1KDG A;  2JKC A;  3VQR A;  2JB1 A;  3QSM A;  3C4N A;  4MJW A;  1FCD A;  5EOW A;  1YQZ A;  2GH5 A;  4OPU A;  2GMJ A;  3C96 A;  3IWA A;  2A87 A;  3AXB A;  4K8D A;  2NPX A;  2FBW A;  1BZL A;  4N9X A;  4X4J A;  5FS6 A;  3UKH A;  3QSE A;  3AD7 B;  3AYJ A;  2BXR A;  2CDU A;  3Q9T A;  2CUL A;  1GRE A;  1KSS A;  3NKS A;  4H50 A;  2YG4 A;  4JY3 A;  4BJY A;  4YKG A;  2YLZ A;  3OZ2 A;  1TDN A;  4B66 A;  4TM4 A;  2R0P A;  2GV8 A;  1YY5 A;  2E5V A;  3H8L A;  3UP4 A;  2X8H A;  4BJZ A;  3EF6 A;  3NYC A;  1CJC A;  2A8X A;  1IUT A;  3AEC A;  2WP5 A;  3KLJ A;  3PVC A;  2C70 A;  4A5L A;  4GUV A;  2WQY A;  3CTY A;  4AP3 A;  5KWF A;  3I6D A;  3BI2 A;  4NZH A;  4GRT A;  2BAC A;  2WOV A;  3BNM A;  4EQW A;  1NG4 A;  3SFD A;  1ZX9 A;  1YQ4 A;  3L8K A;  3DJD A;  1GAL A;  2WDV A;  1VDC A;  2DKH A;  1B8S A;  1EL9 A;  2C75 A;  5EB5 A;  2XLS A;  1IUV A;  1O95 A;  2AQJ A;  3UKL A;  3AE8 A;  4B63 A;  2B9Y A;  2ACZ A;  2XCG A;  2C66 A;  3G5S A;  3NRN A;  1Q1R A;  2O9Z A;  2FJB A;  3D8X A;  1OJD A;  2E4G A;  2BC1 A;  4GR1 A;  1PBD A;  1ZKQ A;  4K22 A;  2BCG G;  5KRQ A;  3P4R A;  3CNT A;  1BF3 A;  1KSU A;  2RGJ A;  3AWI A;  4YKF A;  3AEG A;  2CFY A;  3UKP A;  2EQ7 A;  4ZCD A;  1VG0 A;  5L46 A;  3VRA A;  2W0H A;  2YG6 A;  1B5Q A;  4J57 A;  4A6N B;  2WPF A;  2XVH A;  1PJ7 A;  1B37 A;  1TRB A;  3DA1 A;  2BYB A;  2VZ2 A;  3EAO A;  3NK0 X;  1GRH A;  3UKA A;  3V76 A;  2GQF A;  5JCK A;  3DJJ A;  4Y4L A;  3KU9 A;  1EL7 A;  2AR8 A;  2JK6 A;  1PXA A;  4B64 A;  2BK4 A;  3SFE A;  2WP6 A;  4DNA A;  4JDR A;  2XVE A;  3GDN A;  1KFY A;  1GTH A;  1NG3 A;  2YR6 A;  1DOC A;  4J36 A;  3F8P A;  4H4T A;  2YG5 A;  1D5T A;  2RGO A;  3T37 A;  5KOW A;  2GQW A;  3F8D A;  2Q0L A;  3GD3 A;  2BK3 A;  1JRX A;  4JNA A;  5DBJ A;  4C5O A;  5KOX A;  1CL0 A;  2VQB A;  3DME A;  1W4X A;  4J33 A;  1RP0 A;  1GT8 A;  2GF3 A;  4U8J A;  2C73 A;  2OA1 A;  4H4U A;  1K4Q A;  4AOX A;  2H88 A;  1EL8 A;  1Y56 A;  1M6I A;  3FIM B;  2WDQ A;  2C64 A;  3CNS A;  5U63 A;  3DH9 A;  3DJE A;  2JB3 A;  3NG7 X;  3QJ4 A;  4EQX A;  1NPX A;  3ISH A;  4U2T A;  4EMW A;  3ABV A;  3RP6 A;  3BI5 A;  2APG A;  2YVG A;  4I59 A;  1MO9 A;  4O5U A;  3UKK A;  4H4V A;  3DJG X;  3S5W A;  2R46 A;  1H7W A;  3FPZ A;  4YSH A;  2XVI A;  1N4V A;  4Z25 A;  1EL5 A;  2BS3 A;  1PDH A;  5FMH A;  4K5S A;  3L1R A;  1PBC A;  5EBK A;  3UCL A;  1NHQ A;  4ICY A;  5BUL A;  4GDE A;  1IUW A;  3GQK A;  4OPL A;  4C74 A;  4H4R A;  1PBE A;  1GPE A;  2Z5X A;  4P9S A;  4M52 A;  3RP8 A;  2XFP A;  2WEU A;  2YG7 A;  2HQM A;  4H7U A;  3RED A;  2JAE A;  1P2E A;  4PAA A;  1GRT A;  4A99 A;  1D4D A;  2YG3 A;  4CCR A;  5LV9 A;  1QLB A;  3ITJ A;  1E1M A;  4Z2U A;  1O94 A;  2GRT A;  3CGD A;  1PJ6 A;  3LXD A;  1ZMC A;  3UTF A;  4X9M A;  3RP7 A;  3AEE A;  2H89 A;  1Q1W A;  3ZDN A;  2C3D A;  1CHU A;  1E1N A;  1O5W A;  3EPT A;  3AB1 A;  4EMI A;  2V5Z A;  4A65 A;  3UP5 A;  1N4U A;  3M12 A;  2C65 A;  3AEB A;  2WPE A;  4DGK A;  3LOV A;  3RNM A;  2PYX A;  1BGJ A;  1P2H A;  4LA1 A;  1UKV G;  1JU2 A;  4XXG A;  4EMJ A;  2C72 A;  2X99 A;  1X31 B;  3GMC A;  1DOB A;  2BCP A;  4J2W A;  2V61 A;  2GAG B;  3SGL A;  2YAU A;  3S61 A;  2QCU A;  3P4Q A;  3LAD A;  2BK5 A;  4Z2R A;  3AED A;  3PS9 A;  3NYF A;  1IUX A;  2GEW A;  5J7X A;  5JCL A;  1K0I A;  3PO7 A;  1MXT A;  1BKW A;  1LVL A;  3SUC A;  2JBV A;  3DK4 A;  1Y56 B;  1H82 A;  2IID A;  1S3B A;  1RYI A;  3NTA A;  2YR5 A;  2EQ8 A;  5BRT A;  4OPI A;  4J31 A;  2A89 A;  1FEA A;  4EM4 A;  1LQU A;  2R45 A;  2VOU A;  3DK8 A;  3AD8 B;  4H2N A;  4Y4N A;  4Z2T A;  2YWL A;  1CC4 A;  1F8R A;  2GR3 A;  3P9U A;  3AD9 B;  4XWZ A;  3LZW A;  3R9U A;  2WS3 A;  4Z43 A;  1FOH A;  2XLR A;  1PBB A;  2XLT A;  4GF7 A;  3UKF A;  2X8G A;  4USQ A;  5TR3 A;  4KPR A;  3NT6 A;  1PBF A;  4CNK A;  2DKI A;  3ATR A;  3URH A;  1ZDL A;  2C3C A;  3FBS A;  3C4A A;  4LII A;  2B76 A;  3GWD A;  2XFQ A;  3NN0 X;  1NHS A;  2BS4 A;  1OJA A;  3ALL A;  4HA6 A;  3KVE A;  2YR4 A;  4GDP A;  1FEB A;  2V3A A;  3ALM A;  1CJ4 A;  1TDK A;  5U1O A;  2YQU A;  3NIX A;  3GQH A;  2XFO A;  4U8L A;  1TDE A;  2C76 A;  2FJD A;  4FK1 C;  4C3Y A;  3ALJ A;  1ZK7 A;  4U8O A;  4CBQ A;  3EAN A;  3OC4 A;  3NYE A;  4UDP A;  1TYP A;  2X3N A;  2YM1 A;  3VRD B;  5C3J A;  4ADW A;  1H81 A;  3CN8 A;  2IVE A;  3B6D A;  1YQ3 A;  2GR1 A;  2VVL G;  1Y0P A;  4YTP A;  2WES A;  3UOV A;  3UTH A;  4TM3 A;  3ZYX A;  2OAL A;  2XVJ A;  1IUS A;  1GXF A;  3ATQ A;  4YSX A;  4IA6 A;  2JB2 A;  1LV0 A;  1GRB A;  1OJT A;  1F8S A;  1CJ2 A;  1XDI A;  3AE1 A;  1F3P A;  3CPJ G;  3Q6J A;  4H4P A;  4EM3 A;  2R9Z A;  3KKJ A;  2WOI A;  4RG4 A;  3P4S A;  4IA5 A;  3AE5 A;  3AYI A;  3IC9 A;  3AE2 A;  3LJP A;  3I3L A;  4U8I A;  3SQP A;  1NEN A;  3FMW A;  3H4K A;  4BK1 A;  5HYM A;  5HY5 A;  3P1W A;  3BI4 A;  3F8R A;  3LB8 A;  1M64 A;  4CNJ A;  1FEC A;  1GSN A;  1F6M A;  2LFC A;  5GSN A;  4B1B A;  4FK1 A;  3BHK A;  3BHF A;  2FJE A;  2E1M A;  2I0Z A;  2CVJ A;  3CND A;  3CGE A;  3DK9 A;  5CQF A;  5FS9 A;  1ZOV A;  1ZOY A;  4NEW A;  2BAB A;  2Y6R A;  2FJA A;  4D04 A;  2BS2 A;  5IPY A;  1L9D A;  2J3N A;  1ELI A;  5M10 A;  2VRM A;  4BK3 A;  5FS7 A;  2Q6U A;  1PJ5 A;  3GWF A;  2YVJ A;  2WHD A;  3CIR A;  4Z26 A;  5BUK A;  1XAN A;  4EQS A;  3CPI G;  1NHP A;  3NHO X;  4U8P A;  5KXJ A;  4BV6 A;  2EQ6 A;  2V3B A;  2YLW A;  3K7Q X;  3GYX A;  1PHH A;  2Q0K A;  2WDR A;  4NTD A;  4K2X A;  1BWC A;  2RAB A;  2R4E A;  1N1P A;  1FL2 A;  3COX A;  4WCT A;  1XHC A;  1D7L A;  1DOD A;  1GET A;  1E7P A;  1JRZ A;  1PXB A;  2UZZ A;  1ZP0 A;  5U25 A;  3KA7 A;  4GCM A;  1H6V A;  3CGC A;  2BA9 A;  4OCG A;  3AE9 A;  3RHA A;  2B9X A;  4U8K A;  4TLZ A;  4Z44 A;  3GRS A;  1E39 A;  2XFU A;  3GSI A;  3UOX A;  4X9N A;  1DNC A;  2YVF A;  1S3E A;  4HB9 A;  4H4W A;  4A7A A;  1D4E A;  2R4J A;  4YWO A;  4A79 A;  3HZL A;  1B4V A;  1KF6 A;  2XLU A;  3II4 A;  3KD9 A;  1N4W A;  1COY A;  5KVH A;  2QA2 A;  3E1T A;  4XWR A;  1GRG A;  1MOK A;  3D1C A;  4PAB A;  1NEK A;  4OPG A;  2VVM A;  3WE0 A;  3BNU A;  2IVD A;  1PS9 A;  2WOW A;  4C3X A;  4YT0 A;  4NEV A;  4NTE A;  1CF3 A;  2YLR A;  1OJC A;  4O5Q A;  5C2T A;  3NNE A;  4JY2 A;  4LU6 A;  4A6N A;  3K7T A;  2NVK X;  1K0L A;  3GDP A;  2AAQ A;  2C7G A;  4H4X A;  2OAM A;  1Q9I A;  3IHG A;  4JN9 A;  1PXC A;  3UKQ A;  1IJH A;  2VRL A;  3P4P A;  3QFB A;  1ZMD A;  3DGH A;  3IF9 A;  3NH3 X;  3M13 A;  1DJN A;  2QA1 A;  1H7X A;  4H4Q A;  4KX6 A;  1JRY A;  2Z5Y A;  3IHM A;  3AEA A;  2WBA A;  4CRT A;  3UTE A;  4OVI A;  4DSH A;  3GD4 A;  2ZZ0 A;  1GER A;  2XLP A;  4REK A;  4U8N A;  5IQ4 A;  4UDQ A;  4IVO B;  4B68 A;  1JOA A;  1KNR A;  2BC0 A;  4K5R A;  1LQT A;  4YTN A;  1TYT A;  2X50 A;  3QVP A;  3K7M X;  4RSL A;  3K30 A;  1E6E A;  1JNZ A;  3AE6 A;  1K0J A;  4TM0 A;  1VRQ B;  1NAA A;  3NTD A;  4OPT A;  4H2R A;  4ZN0 A;  4RG3 A;  4H2P A;  4H2Q A;  4YSY A;  1S2Q A;  3VRB A;  4B65 A;  3KPF A; 
#chains in the Genus database with same CATH topology
 5HCM A;  1W0B A;  3LK2 B;  3OTO T;  3N2G E;  3SZW A;  2RGH A;  1H8T D;  1D4C A;  2R06 4;  4GYS A;  2I59 A;  3CPZ A;  3ICR A;  2DI4 A;  4PFP A;  1XNR T;  4IV9 A;  1BGN A;  2NW7 A;  1L9E A;  2YOE A;  3NKZ A;  4JV5 T;  3KBU A;  1GV4 A;  1D7Y A;  2WBL A;  3PU8 A;  5L4E A;  4CCQ A;  2CLY C;  2VQF T;  1VOM A;  2BZB A;  5M4Y A;  4OHF A;  3FI7 A;  5FMN A;  4B3S T;  5ETW A;  5HHF A;  2V8S V;  5HEO A;  3V3O A;  3AE3 A;  3QSS A;  2JQH A;  5J60 A;  1IBM T;  3AE4 A;  2XAH B;  2XYO A;  3CVR A;  5J1G A;  3QVR A;  3C4W A;  3G5R A;  2OLO A;  2ZZB A;  4U2L A;  4PDW D;  3ADA B;  2UU9 T;  5KMS A;  4YSZ A;  2ARD A;  5M0Z A;  1V59 A;  2V26 A;  3H8I A;  3A7M A;  1VBA 4;  3JSK A;  3HYW A;  4NUU A;  5FYM A;  4NTC A;  4Z24 A;  3SX6 A;  1NHR A;  3EHZ A;  2BG9 C;  4U2Y A;  3J9X 1;  4GIW A;  1GQE A;  5AQM B;  2BXS A;  1GND A;  2IML A;  3LFM A;  4HFE A;  1ONF A;  4NWZ A;  2Q9Q C;  5BVA A;  3ZMZ B;  4YY3 T;  4OPD A;  3UU3 A;  4EQR A;  4COF A;  3UFG A;  4J2C A;  3L3P A;  1AR8 4;  3GN5 B;  3X1D A;  4DR6 T;  4P1N A;  3VR9 A;  3B3R A;  5JCN A;  1ZY8 A;  2WZI A;  1H84 A;  2VVL A;  4CN4 A;  4TLX A;  2DLR A;  1TDO A;  5A1L A;  3M3Z B;  2EHO A;  1SEZ A;  3NZQ A;  1RUC 4;  4A5X A;  3EVY A;  4QH1 A;  3FHN A;  4CY8 A;  1CC6 A;  4FI5 A;  5EOW A;  4OPU A;  4N9X A;  5FS6 A;  3AD7 B;  2CHO A;  5HXC A;  4B3T T;  1PIV 4;  1KSS A;  3J7Y q;  3HKB E;  4Q25 A;  4LF9 T;  4TM4 A;  2X9X A;  1SHZ C;  2GV8 A;  1YY5 A;  3NYC A;  1IUT A;  3AEC A;  2WP5 A;  3JCF A;  3PVC A;  1D1B A;  1VRH 4;  3BI2 A;  2NOX A;  3ZCJ A;  1M62 A;  3NBX X;  4GRT A;  2ACX A;  2WOV A;  4EQW A;  1NG4 A;  4GYR A;  4HE8 A;  3L8K A;  4DID B;  3UUM A;  3DJD A;  1B8S A;  2C5J A;  5DQV A;  3PE0 A;  1UGO A;  2NR4 A;  1XMO T;  4YJ3 E;  4H9S E;  2E9X D;  3ZST A;  2E9X B;  2C66 A;  3SZF A;  2W2U A;  4WBO A;  4N78 D;  5EK3 A;  3A5X A;  2BC1 A;  1RUI 4;  2HWC 4;  1BF3 A;  4NIQ A;  2RGJ A;  5KMR A;  2A2F X;  5L46 A;  2RA1 A;  1B5Q A;  3CQC B;  2WPF A;  5JDN A;  3ZT6 A;  3JBG 4;  4I0U A;  3N2O A;  3EAO A;  4KP3 C;  3DJJ A;  2J4G A;  4JI0 T;  3KU9 A;  3T14 A;  4PK5 A;  1AR9 4;  2BK4 A;  3SFE A;  1IJ6 A;  3PUX F;  2R7F A;  3T8O A;  2RPA A;  4JEU B;  3T37 A;  2GQW A;  3GD3 A;  1JRX A;  4Q4Y 4;  2VWA A;  2QYW A;  4J33 A;  5LOV E;  2PW9 A;  4Z90 A;  2UUB T;  1NCQ D;  2H88 A;  2IDO B;  3FIM B;  3Q5D A;  3DJE A;  4EQX A;  4U2T A;  3RP6 A;  2APG A;  5AFU L;  4O5U A;  2KZ7 B;  3UKK A;  4H4V A;  2R46 A;  3FPZ A;  1N4V A;  2HH7 A;  3ZKR A;  5L47 A;  1EL5 A;  2FUP A;  2V5D A;  2JIW A;  2C4C A;  3O4X E;  1NHQ A;  2MAW A;  3AVR A;  4OPL A;  4P9S A;  2Z5X A;  3RHW A;  2YDS A;  1ZHC A;  4V1A v;  3JC6 C;  2JMH A;  2CBJ A;  3ANW B;  4H7U A;  3UUN A;  2JAE A;  4PAA A;  3RED A;  2PTF A;  4A99 A;  3IF8 B;  3RKG A;  4Z2U A;  1O94 A;  3CGD A;  2JQK A;  4UIG A;  5JDM A;  3RP7 A;  5AQK B;  1Q1W A;  4X5T A;  4ZI2 C;  2CA5 A;  4A65 A;  1N4U A;  3AEB A;  1VRB A;  2PYX A;  1BGJ A;  1P2H A;  4LA1 A;  4EMJ A;  1JU2 A;  4J2W A;  1HCI A;  2BCP A;  2YAU A;  3IEE A;  3K3Q C;  2BK5 A;  4DBR A;  3AED A;  3PS9 A;  2RS3 4;  2RS1 4;  4G2A A;  4JYA T;  5H6R B;  2DHR A;  4AQY T;  2VVN A;  3RKO A;  4MHC A;  2JBV A;  1NWM X;  1Y56 B;  1CUN A;  3NTA A;  2YR5 A;  3P7I A;  1OED C;  4J31 A;  4EM4 A;  4Y4N A;  1G8X A;  1F8R A;  5FVL A;  3CX6 B;  2J47 A;  4XAX B;  2W61 A;  1KNZ A;  1PBB A;  5TR3 A;  3QC9 A;  3FBS A;  1WYB A;  3RQW A;  3NN0 X;  2MPK A;  3ZSS A;  1NHS A;  2XFQ A;  1HNZ T;  1OJA A;  3PUA A;  3ALL A;  1FEB A;  2D9D A;  2KND A;  1W9R A;  1CJ4 A;  3ALM A;  2YQU A;  5U1O A;  2PY5 A;  3RQU A;  2XFO A;  2LOS A;  1TDE A;  2XY8 B;  2V7M A;  4C3Y A;  4IE6 A;  3T1Y T;  2N9D A;  4KHP T;  5IHY A;  4ADW A;  1ZV4 X;  5LYJ E;  1HF8 A;  1HX8 A;  5KX5 E;  5KMP A;  1N34 T;  1Y0P A;  5FVK A;  4YTP A;  3OPC A;  3WAJ A;  4ILA A;  4TM3 A;  2OAL A;  2XVJ A;  1GXF A;  4IA6 A;  5FKY A;  3RGL A;  2JB2 A;  1OJT A;  1F3P A;  1RUF 4;  3KKJ A;  2WOI A;  1MMN A;  3LBX B;  4IA5 A;  4DV7 T;  2H3R A;  3T2Z A;  4GB3 4;  3AE2 A;  2CPT A;  3I3L A;  4BK1 A;  1NEN A;  1XHZ A;  4EIW A;  2XQY A;  5LNK A;  5FL0 A;  3P1W A;  1M64 A;  5CQF A;  1MIY A;  2XZE A;  5AQP B;  2BS2 A;  5IPY A;  4HFC A;  2V6X A;  3RYH E;  1I94 T;  4CN6 A;  4L9I A;  2WHD A;  4LMJ A;  4UEL A;  2LE8 A;  3K8P C;  4XZC A;  5BUK A;  3Q5E A;  3TLS A;  2X68 A;  2VL0 A;  2WDR A;  3ONL C;  4GAP A;  3COX A;  3ZMS B;  2J1D G;  3AXJ B;  4WCT A;  1DOD A;  1GET A;  5HYA A;  1E7P A;  3KA7 A;  4QXB B;  3KVB A;  3RHA A;  3AE9 A;  2UUA T;  4TLZ A;  5EK2 A;  4Z44 A;  2IUB A;  3UOX A;  2MYS A;  3GSI A;  2YVF A;  4U7I A;  3ZT5 A;  4A79 A;  1B4V A;  1KF6 A;  2XM2 A;  1VBD 4;  3KD9 A;  1N4W A;  5KVH A;  3UU8 A;  2V7I A;  2X9H A;  3E1T A;  4JI1 T;  2DWG A;  1HX1 B;  2SPC A;  1GRG A;  1MOK A;  4PAB A;  2PYJ A;  1NEK A;  3AAA B;  2VVM A;  1OXZ A;  5LGN B;  2E5L T;  3T31 A;  1PS9 A;  5HXS A;  2V7J A;  2XM1 A;  2LJL A;  5KDM C;  2KMF A;  4PJJ A;  4NTE A;  4H9O C;  1MIV A;  4LU6 A;  2NVK X;  3HR0 A;  4DR3 T;  1W09 A;  4K0U A;  2C7G A;  1PXC A;  1IJH A;  3QFB A;  2VKH A;  3P4P A;  5F3J A;  3M13 A;  5L3C B;  3UUX B;  4H4Q A;  3AAI A;  4DVD A;  3AEA A;  2Z5Y A;  2PG8 A;  2ZZ0 A;  1SUM B;  4II2 A;  3ZT7 A;  4IVO B;  2X50 A;  3LSV A;  3QVP A;  3UU5 A;  3K7M X;  5HEH A;  2ZMA A;  3NVO A;  5AQO B;  5LG3 A;  4UXN B;  3VKG A;  4YFS A;  4YSY A;  1Y64 B;  2BVM A;  4DR5 T;  2WU2 A;  2X0L B;  2EQ9 A;  1Z0P A;  2YM2 A;  2XQ8 A;  5GRT A;  3O0H A;  3C64 A;  3ZJ2 A;  4TNV A;  3UTK A;  1REO A;  3CQX C;  4IDP A;  2CM0 A;  4E0V A;  4U8M A;  1MMA A;  3AE7 A;  4YTM A;  5AQL B;  3F31 A;  3B5M A;  1D0Z A;  2TPR A;  5HXR A;  4AOS A;  2YDQ A;  4AKR B;  3G5Q A;  1LTX R;  1IAP A;  2B7R A;  5BMV E;  3RLF F;  4G63 A;  2K48 A;  5LMU T;  1H86 A;  4HWI B;  3QFA A;  4O4H E;  1L9C A;  5LBQ B;  4TM1 A;  4LFB T;  3N9L A;  2GR2 A;  4FX9 A;  4M1P A;  1KNP A;  5IYZ E;  4Y4M A;  3ETV A;  1O3X A;  3CGB A;  2WSS V;  2D0U A;  2ZM0 A;  1HG2 A;  1QJD A;  1S2Y A;  4JEH B;  1CJ3 A;  4B69 A;  4NXM T;  2Y6Q A;  2WCA A;  4JQ9 A;  4EB6 E;  2V6O A;  1IJ5 A;  2WWV A;  4BUR A;  4B3M T;  1F8W A;  3OJA A;  2LKH A;  4QX7 B;  1CBO A;  4H4Z A;  3NLC A;  5JCM A;  4ZCC A;  1E1H B;  2Q7V A;  1Y01 A;  2VKD A;  3GYJ A;  4TZ4 C;  3T0K A;  3I0Q A;  4HGA A;  2D2S A;  2GVC A;  3MJX A;  4K7Z A;  1Z6L A;  5JCI A;  1E1K A;  2QAE A;  1CC2 A;  4C77 A;  1X79 A;  1GRF A;  4PJN A;  2WET A;  2VVS A;  4J34 A;  1OJ9 A;  3NK1 X;  1YKJ A;  4DSG A;  3SM8 A;  3DGZ A;  2V7L A;  2ZZC A;  2C67 A;  2BG9 A;  4USR A;  4I58 A;  2JB1 A;  3QSM A;  3C4N A;  3RRC A;  2Q9Q A;  2YU2 A;  3RH3 A;  3OVU A;  3C96 A;  5HEG A;  4K8D A;  2FBW A;  4DR1 T;  2W4X A;  1WYC A;  2CDU A;  3Q9T A;  3C4X A;  4H50 A;  4YKG A;  4JY3 A;  1WFD A;  4UV8 B;  3OZ2 A;  4DUZ T;  4BAY B;  3WAK A;  5HAX A;  2XSB A;  4BJZ A;  3GMI A;  2A8X A;  1YKE B;  5L3E B;  3EAM A;  1VBB 4;  3VKH A;  2C70 A;  4A5L A;  2QGS A;  4GUV A;  2NWB A;  1ASJ 4;  3SS1 A;  2R07 4;  3AVS A;  2P9B A;  4UF0 A;  4HKA A;  4AKI A;  3HL6 A;  1HRV 4;  3UUL A;  3BNM A;  3SFD A;  3ONX A;  1YQ4 A;  4AKG A;  2WDV A;  1EL9 A;  4HTE A;  3AE8 A;  4B63 A;  5JR9 B;  3PTR B;  2XCG A;  4WBN E;  3P4W A;  3NRN A;  4UVB B;  2FJB A;  2EHO D;  4U31 A;  5L3F B;  1ZKQ A;  1J5W A;  1RHI 4;  3CNT A;  3CX7 B;  1KSU A;  3AWI A;  4GAV A;  2HN2 A;  3QB5 K;  3VRA A;  2W0H A;  2IW5 B;  4J57 A;  4A6N B;  1HXS 4;  1PJ7 A;  3DA1 A;  2VUR A;  2JRK A;  4JLE A;  3NK0 X;  3V76 A;  3ZLI A;  2GQF A;  2C5I T;  1Z7S 4;  1MQT D;  1PXA A;  4PJM A;  3IA3 A;  3EI0 A;  2XVE A;  4K0K T;  2YR6 A;  1DOC A;  3QOF A;  2ODU A;  4IT4 A;  2YG5 A;  1D5T A;  3F8D A;  2Q0L A;  4JNA A;  2BK3 A;  4GOU A;  5KOX A;  4WYV A;  5FNV E;  4U72 A;  3DME A;  1W4X A;  2C73 A;  2OA1 A;  4G73 A;  4AOX A;  1M6I A;  2C64 A;  4EAH A;  3NG7 X;  2Z6E A;  3QJ4 A;  1NPX A;  3ISH A;  4ZZB A;  2V5C A;  5JRC A;  5DAB A;  3BI5 A;  4I59 A;  3SXI A;  1MO9 A;  2Y8D A;  4CXX A;  3FZM B;  4X66 T;  5ABF A;  2XVI A;  3EUH A;  2BS3 A;  5FMH A;  3EDV A;  3L1R A;  5EBK A;  4JI5 T;  1BR4 A;  4ZS2 A;  3ZYM A;  4IE4 A;  4M52 A;  3JAF A;  4WW0 A;  2WEU A;  2XFP A;  2HQM A;  2YG7 A;  1RMU 4;  1P2E A;  1GRT A;  2D0T A;  2BBJ A;  2E2A A;  4CCR A;  1QLB A;  1T7S A;  1E1M A;  2BRA A;  5ABG A;  2Y48 B;  3LXD A;  1I6Z A;  3L39 A;  4P0A A;  1AR6 4;  3WI3 A;  2H89 A;  4CQI A;  4UVA B;  1T8B A;  2YN6 A;  1E1N A;  3EPT A;  4ZHQ E;  3AB1 A;  5LXT E;  1YXR A;  2W62 A;  5FXX A;  3RNM A;  3RC8 A;  3PU3 A;  2C72 A;  3GMC A;  3SGL A;  3JAE A;  2GAG B;  4EV6 A;  3P4Q A;  2CBI A;  4Z2R A;  5JCL A;  1BKW A;  2BRY A;  5CJ5 A;  5KMG P;  1H82 A;  3KV4 A;  1S3B A;  5BRT A;  4HWC A;  1LQU A;  2R45 A;  2VOU A;  3DK8 A;  2V6Y A;  4Z2T A;  1FIO A;  4IDO A;  2BKO A;  2RS5 4;  3P9U A;  4XWZ A;  2WS3 A;  5JDG A;  4EEB A;  1V9D A;  3UKF A;  2X8G A;  1BEV 4;  4ZI3 D;  2DKI A;  3ATR A;  5JDF A;  2C3C A;  4LII A;  4E7S A;  2BS4 A;  1WRD A;  3LDQ B;  3UT5 E;  2X9Y A;  2LRL A;  4QX8 B;  3NIX A;  2MOZ A;  5HXH A;  4U2Z A;  4U8L A;  5CA1 E;  3OBV E;  2FJD A;  5KMQ A;  3MXZ A;  3ALJ A;  3EAN A;  1OED A;  1TYP A;  5AQT B;  2YM1 A;  4L0R A;  5C3J A;  5F8P A;  1W0A A;  4WNK A;  2IVE A;  4TUY E;  1YQ3 A;  2GR1 A;  3FZL B;  3ZN1 B;  4NPP A;  2WES A;  2XPK A;  2XAF B;  3ZYX A;  4AXP A;  4EOZ B;  1LKX A;  3E08 A;  3KIN B;  5LMN T;  1J5E T;  4EZH A;  1CJ2 A;  1XDI A;  3Q6J A;  4H4P A;  4XBF B;  4RG4 A;  3P4S A;  3AYI A;  3IC9 A;  1SA0 E;  3OYX A;  3BQK A;  2RMU 4;  3H4K A;  4X1Y E;  1FEC A;  1F6M A;  4A97 A;  3PUR A;  2L8K A;  2FJE A;  2I0Z A;  1ZOV A;  4NEW A;  1K5M D;  2JPF A;  4TWD A;  1H7C A;  2YK0 A;  1ELI A;  3KV5 A;  2A3D A;  3QB5 A;  1PJ5 A;  3GWF A;  2YVJ A;  5LGT B;  4LFA T;  3CIR A;  5FL1 A;  3PJA A;  1US7 B;  2W0G A;  3O1J A;  1RVF 4;  3CPI G;  2CEA A;  4CI3 B;  5KXJ A;  5LP6 E;  2V3B A;  4JI8 T;  3GYX A;  2PFV A;  4NTD A;  4K2X A;  2LRK A;  2R4E A;  4DV5 T;  1FL2 A;  1D4M 4;  1D7L A;  1XHC A;  4Q4V 4;  1PXB A;  3ONJ A;  1H6V A;  3CGC A;  4U8K A;  2L9Q A;  4LFC T;  2XFU A;  4X9N A;  1Z8U A;  3M65 A;  3AAE B;  3N9M A;  5LGU B;  2R4J A;  2DWK A;  4G74 A;  4IRE A;  3ZMT B;  3II4 A;  2E9X A;  2UXD T;  3O1H A;  2QA2 A;  2OLT A;  4OFZ A;  4OPG A;  3CK6 A;  5AQH B;  4AQG A;  4DO0 A;  1R8I A;  1CF3 A;  3NRY A;  1OJC A;  2CCQ A;  5C2T A;  4JY2 A;  3K7T A;  1FMW A;  3U3I A;  4H9R C;  4H4X A;  2OAM A;  5KNL A;  3IHG A;  4B3R T;  2LHN A;  2VRL A;  4H63 H;  4LML A;  3DGH A;  3IF9 A;  3UU6 A;  1DJN A;  2QA1 A;  3NWI A;  3UU4 A;  1PO1 4;  3AA6 B;  1FEW A;  2BC0 A;  1LQT A;  2LHR A;  4PAG A;  5CB4 E;  3K30 A;  5JVD E;  2IIU A;  1E6E A;  1NA1 D;  2NW8 A;  4TNW A;  3I1A A;  3RX6 A;  2YU1 A;  1S2Q A;  2K3W A;  3PUG A;  4WX1 A;  3AYL A;  4AKL A;  3A8Y C;  5IQ1 A;  2YLS A;  4II3 A;  4UP3 A;  5FXW A;  3SZC A;  3ICS A;  4AI6 A;  4IGU A;  2GAH B;  2YLT A;  4OYK A;  2CWY A;  1AOG A;  5L3D B;  4CI2 B;  1JEH A;  2YLX A;  1HYU A;  3GRT A;  3CX8 B;  1GTE A;  4U2S A;  4UEM A;  4IDZ A;  2NW9 A;  4MLK A;  4IDQ A;  2TMD A;  5AQN B;  1DJQ A;  2BVL A;  4AT0 A;  4CXY A;  5LCY A;  1VQW A;  4B67 A;  3CNJ A;  4EYY R;  5ADX L;  2BKP A;  3T1H T;  1UUS A;  4IDN A;  1GES A;  3PV0 F;  1M7K A;  4YJ2 E;  3RYF E;  3SZ0 A;  4O4L E;  3NN6 X;  4ZS3 A;  3VR8 A;  1PN0 A;  4C91 A;  2XDO A;  1H83 A;  4AKH A;  3EDU A;  2W00 A;  2ZLY A;  4ILC A;  5LJM A;  1LJ1 A;  3NRX A;  1MIW A;  2DCF A;  4AQF C;  4U7Y A;  2XVF A;  3FG2 P;  5CKU A;  4DND A;  2E9X C;  1DOE A;  2JMK A;  2WP9 A;  2XAS B;  3CKD A;  2XQ7 A;  1LVF A;  1EBD A;  1GOS A;  1U5P A;  2ES0 A;  4EIQ A;  2IAK A;  5KVI A;  4AP1 A;  4FDC B;  4BA9 A;  4H4S A;  1JNR A;  2NP9 A;  3ICT A;  5FS8 A;  4OK0 A;  3FB2 A;  3FZH B;  2ZBW A;  2B7S A;  1PO2 4;  2V60 A;  4KBM B;  3VHL A;  2GMH A;  5CGM A;  4H9Q C;  3M0O A;  2XQ9 A;  2HHH T;  5L3B B;  3AEF A;  2GB0 A;  1DXL A;  3ZC1 A;  3NGC X;  5J0Z A;  3D0T A;  5CFB A;  2VQ7 A;  3CQG B;  1KDG A;  3VQR A;  3F57 A;  4MJW A;  4DUY T;  4X1K E;  3IWA A;  3UKQ A;  3QSE A;  4HWH A;  2BXR A;  1OWA A;  3K1S A;  3NKS A;  1POV 0;  2UXC T;  4BJY A;  2YLZ A;  4TWH A;  2V7K A;  4B66 A;  2R0P A;  2X0H A;  3K3N A;  3H8L A;  3UP4 A;  3Q9D A;  2KSR A;  3EF6 A;  1CJC A;  2CLY B;  4IL4 A;  5KWF A;  4CZZ B;  4ANJ A;  4NZH A;  3KFW X;  1QUU A;  2BAC A;  3HKD E;  1ZX9 A;  3DP7 A;  3ZYK A;  1GAL A;  4PNI A;  2C75 A;  3RPU A;  2XLS A;  3UKL A;  1HNW T;  3E22 E;  4HFH A;  3BQI A;  1B7T A;  3G5S A;  3C4Z A;  1Q1R A;  3D8X A;  3Q5W A;  4DMV A;  1PBD A;  5KRQ A;  5AQG B;  3UKP A;  3ESL A;  2ZM8 A;  3B13 A;  2YG6 A;  2Q9Q D;  2XVH A;  1B37 A;  2BYB A;  2VZ2 A;  5E0O A;  3PUW F;  4Y4L A;  3ZPO A;  1EL7 A;  1XDP A;  2AR8 A;  2JK6 A;  3ZCI A;  4B64 A;  4JDR A;  3GDN A;  1KFY A;  1NG3 A;  3HKE E;  3SY4 A;  1ZKE A;  3U78 A;  2WMN A;  5DBJ A;  4I55 E;  1WCR A;  2XUE A;  1CL0 A;  2VQB A;  3W15 B;  3KVA A;  1GT8 A;  3N9P A;  4H63 V;  3BK9 A;  4H4U A;  3MKD A;  5DQW A;  3V5U A;  1EL8 A;  3RC3 A;  5AQR B;  1AL2 4;  4UF0 B;  4MAL A;  2WDQ A;  3DH9 A;  4ZZC A;  2JB3 A;  4YHH T;  3CMM A;  2VL8 A;  3TLT A;  3ABV A;  5IWA T;  2UXX B;  4H9N C;  2YVG A;  1COV 4;  1HRI 4;  4UVC B;  4Z25 A;  1PDH A;  1PBC A;  3UCL A;  4ICY A;  1IUW A;  3H3M A;  2XQ6 A;  4PK6 A;  4H4R A;  4HFV A;  1NAF A;  4UR9 A;  4MFR A;  2CXL A;  3QK6 A;  5FY0 A;  4DV4 T;  2B1E A;  1D4D A;  2YG3 A;  2PBI A;  5LV9 A;  3ITJ A;  4IE5 A;  1MNE A;  4A56 A;  1PJ6 A;  1HTJ F;  2KIN B;  4F8H A;  4TN7 B;  3UTF A;  3RIA A;  1DU2 A;  2WMO A;  3QNU A;  3UFE A;  2W63 A;  3ZDN A;  4ERR A;  4EMI A;  4LF4 T;  3M12 A;  4DGK A;  3LOV A;  1WR6 A;  3H3A A;  2WY2 A;  3P8C D;  4JBW F;  1UUR A;  1X31 B;  4PFO A;  2NTY A;  4LF8 T;  4AIU A;  1DOB A;  2XAJ B;  3AA7 B;  3ZMU B;  3NYF A;  1IUX A;  4IST A;  1K0I A;  3PO7 A;  1IZN B;  1LVL A;  2VAS A;  3BQL A;  1RYI A;  2EQ8 A;  2A89 A;  1FEA A;  2QRX A;  4H2N A;  3EAB A;  3V5S A;  3AD8 B;  2PJQ A;  1FJG T;  5JRC B;  1CC4 A;  2YWL A;  2NTX A;  4LF5 T;  5ABF B;  3C98 B;  3AD9 B;  2CWO A;  3LZW A;  2N1G A;  3R9U A;  5AQJ B;  4Z43 A;  2XHE B;  1FOH A;  1MND A;  2XLT A;  4GF7 A;  3HYX A;  1XMQ T;  4USQ A;  4IIJ E;  4ISS A;  3RIU C;  3NT6 A;  3IBP A;  5LBM A;  2LSI A;  1PBF A;  1ZDL A;  2X5I D;  3C4A A;  2B76 A;  1RUG 4;  2EHO B;  2BG9 E;  2JQ9 A;  3Q2M A;  4GDP A;  2LKG A;  2V3A A;  1TDK A;  2IC6 A;  3I0O A;  3E0Z A;  2C76 A;  4RHV 4;  4FK1 C;  1XHX A;  1ZK7 A;  3OC4 A;  4UDP A;  1N33 T;  1XI1 A;  4X65 T;  1H81 A;  3RI5 A;  3CN8 A;  5AQV B;  3B6D A;  5HEJ A;  4LMK A;  3UOV A;  4HN9 A;  3TLW A;  3UTH A;  4NXN T;  2KWI B;  1IUS A;  4YSX A;  5L3G B;  4ADZ A;  5JDQ A;  1QSD A;  3RIF A;  5LHG B;  3AE1 A;  3CPJ G;  4GKK T;  3J8F 4;  3KBT A;  2R9Z A;  3ZJ1 A;  3JC6 D;  3AE5 A;  3P50 A;  3LJP A;  4U8I A;  3FMW A;  5HYM A;  2A9U A;  2C5K T;  3BI4 A;  2LSK A;  4DR4 T;  2EX3 A;  3MZK B;  1GSN A;  3Q5X A;  5BR8 T;  2LFC A;  2V6Y B;  4B1B A;  3F2E A;  3BHK A;  3CND A;  3DK9 A;  4DV6 T;  1ZOY A;  4ZEY A;  4ZI2 D;  2BAB A;  4KUM B;  4U33 A;  5ABH A;  2J3N A;  1LVK A;  2VRM A;  5FS7 A;  5J2T E;  2Q6U A;  3T2K A;  2X51 A;  2CRB A;  4Z26 A;  3O1I A;  4LF7 T;  1XAN A;  4EQS A;  3N2K E;  2YLW A;  3K7Q X;  2Q0K A;  1N1P A;  3UTG A;  4B6X A;  2I6H A;  1OOP D;  2K24 A;  2UZZ A;  4Z8X A;  2XQA A;  2BA9 A;  4OCG A;  4I4T E;  1OED B;  2LSG A;  1R08 4;  1S3E A;  4HB9 A;  2CXF A;  4A7A A;  4YWO A;  2UUC T;  3HZL A;  5JR9 A;  1XWM A;  2XLU A;  1BR2 A;  1RUD 4;  4Z91 A;  2GK9 A;  2LOP A;  2MTQ A;  4NNJ A;  2CMR A;  2VK9 A;  5FXZ A;  2QA7 A;  4HWF A;  4JI4 T;  2WOW A;  3DTO A;  4KI0 F;  4C3X A;  2LM2 A;  4YT0 A;  4NEV A;  4O5Q A;  1J1J A;  4A6N A;  4L5G A;  4U74 A;  4F6R C;  1K0L A;  3GDP A;  2AAQ A;  5H6Q B;  2XQ5 A;  2CHN A;  4JN9 A;  1HR0 T;  2KXP B;  3NH3 X;  1H7X A;  3I9W A;  4DR7 T;  1VCT A;  1UCU A;  4OVI A;  4I43 B;  1GER A;  2XLP A;  3C50 A;  4U8N A;  4UDQ A;  3KV6 A;  3PUZ F;  3UQ4 A;  1TYT A;  2UXB T;  4RSL A;  5FY1 A;  3AE6 A;  1K0J A;  4TM0 A;  4DV0 T;  3PUY F;  1WLX A;  4RG3 A;  1MMG A;  2OA5 A;  3NZP A;  2XJ7 A;  4DR2 T;  2YDR A;  3VRB A;  3SRZ A;  5LHI B;  3KPF A;  1UX4 A;  1E1L A;  2X8C A;  2WAU A;  3ZC0 A;  3V3N A;  3NK2 X;  4A9W A;  4X62 T;  2GR0 A;  3GN5 A;  1YD8 G;  3UOY A;  4WZX A;  3SOL A;  4ASK A;  1XZY A;  2IC9 A;  5FXV A;  4LF6 T;  3T2Y A;  2L3L A;  5FP3 A;  3GYI A;  4PK4 A;  2PHH A;  3GMB A;  4EIP A;  1LPF A;  5AQU B;  4BK2 A;  1QO8 A;  3FXE B;  2WU5 A;  1BR0 A;  5JQG E;  2AXD S;  1LRZ A;  4APN A;  5LB7 B;  4ILB A;  2WZH A;  4EGW A;  4UDR A;  4JI7 T;  5JDH A;  2LLY A;  1XPQ A;  2D5U A;  4GK5 E;  2JJ9 A;  5EB4 A;  1IUU A;  1SE7 A;  4YXD A;  4CXW A;  5HXI A;  3HKC E;  1D1A A;  3IHR A;  2OLN A;  1NDA A;  3QUJ A;  1UX5 A;  2YEV C;  5JR9 C;  5LHH B;  4I50 E;  2ZM6 T;  3FXD B;  3R84 B;  5C8Y E;  3RYI E;  2AE9 A;  2WWU A;  2EHO C;  3LK4 2;  4DV3 T;  5CA0 E;  5ER0 A;  5AQS B;  2R6G F;  4AT2 A;  2F5Z A;  1T98 A;  3LZX A;  2R0G A;  2XFN A;  4G6G A;  4HFD A;  1RSG A;  3PUV F;  1TDF A;  2WPC A;  2M6B A;  4HWD A;  2LSJ A;  1GEU A;  1GRA A;  1E2A A;  1PVC 4;  1OED E;  4J56 A;  3TKL B;  4JNQ A;  4OPC A;  2MBG A;  2G0U A;  3CNP A;  4IVM B;  5LJN A;  2B9W A;  1VG9 A;  3FBL A;  3UOZ A;  4ECH A;  4AQF A;  4CY6 A;  2UXN B;  2R0C A;  3PDY A;  1L0V A;  1R09 4;  4H4Y A;  4D03 A;  5ABE A;  2I0M A;  3LG7 A;  3MA9 A;  3CPH G;  3RRW A;  2M6I A;  3ZMV B;  1FMV A;  2QVA A;  2JKC A;  4IHJ E;  1HNX T;  2ZM2 A;  4GK0 E;  2H7O A;  4CN1 A;  2JQQ A;  2PZS A;  1FCD A;  2VQE T;  1YQZ A;  2GH5 A;  2GMJ A;  2A87 A;  3AXB A;  3GA8 A;  2NPX A;  2OV9 A;  1BZL A;  4X4J A;  3UKH A;  2RR1 4;  1RUJ 4;  3AYJ A;  2CUL A;  1GRE A;  1YKH B;  2YG4 A;  4PW8 A;  1TDN A;  4AIS A;  4C90 A;  5HEU A;  5EK4 A;  3N9O A;  2E5V A;  2KWH A;  2X8H A;  2Y6X A;  4YLH A;  2VKJ A;  4TV9 E;  3KLJ A;  2WQY A;  3N9Q A;  3CTY A;  4AP3 A;  2HPL A;  3R6N A;  3I6D A;  4YHJ A;  4ZI7 E;  4A98 A;  5L2L A;  4QHO A;  1VDC A;  2DKH A;  5HWX A;  5EB5 A;  1IUV A;  1O95 A;  2AQJ A;  4PJL A;  4JI3 T;  2B9Y A;  2ACZ A;  4IL9 A;  2ODV A;  2VB6 A;  4ILU A;  4G9K A;  2O9Z A;  3HI2 A;  1HG5 A;  4QXC B;  4QXH B;  1OJD A;  2CE7 A;  4UV9 B;  2E4G A;  2R04 4;  4IE7 A;  4OYJ A;  2M67 A;  4GR1 A;  4K22 A;  2BCG G;  3ANW A;  3DJB A;  3P4R A;  4EXT A;  4HFI A;  4YKF A;  3AEG A;  2CFY A;  2XAG B;  2EQ7 A;  3CML A;  4ZCD A;  1VG0 A;  1U4Q A;  4QH5 A;  1T72 A;  5JDL A;  4IE0 A;  4X64 T;  1TRB A;  3ZYL A;  1GRH A;  3UKA A;  5JCK A;  3RF1 A;  4FJO A;  1VBC 4;  2XQ4 A;  3MAC A;  2WP6 A;  3ETU A;  5F5W A;  4DNA A;  3CWZ B;  2DL1 A;  2YIN A;  4QH4 A;  4ZI3 C;  1GTH A;  4J36 A;  3F8P A;  4H4T A;  5KOW A;  2RGO A;  3C51 A;  3AA1 B;  3HYV A;  4C5O A;  4NUV A;  1RP0 A;  2GF3 A;  4U8J A;  3GWH A;  1K4Q A;  2H7V C;  1Y56 A;  2IHR 1;  4O4I E;  1HS7 A;  3CNS A;  5U63 A;  5DJQ C;  3LJC A;  4EMW A;  2WB5 A;  5IUX A;  3JD7 4;  1VBE 4;  3SWH A;  3K3O A;  3DJG X;  5TAO A;  3S5W A;  1H7W A;  4YSH A;  1BR1 A;  4K5S A;  4MBQ A;  5BUL A;  3HA4 A;  4JI6 T;  4GDE A;  5JH7 E;  3GQK A;  4C74 A;  2X66 A;  2N2N A;  3L8R A;  3N9N A;  2X9W A;  1GPE A;  1PBE A;  4EED A;  4DBQ A;  3ZN0 B;  1D0Y A;  3RP8 A;  2PLV 4;  1IBK T;  4O2A E;  3O9X A;  5FY7 A;  2RP4 A;  4HFB A;  2BDE A;  3KDS E;  4O8S A;  2C0S A;  2GRT A;  5JTG A;  1S35 A;  1ZMC A;  1AJ3 A;  4X9M A;  3AEE A;  1G73 A;  1UK5 A;  2A72 A;  4E7Z A;  2BBH A;  4EZ4 A;  4U3C A;  2C3D A;  1CHU A;  1O5W A;  4DMW A;  3AA0 B;  2V5Z A;  3FZK B;  3UP5 A;  2C65 A;  2WPE A;  4X20 E;  1UKV G;  4XXG A;  2X99 A;  1XDO A;  2V61 A;  3PUS A;  1N36 T;  3S61 A;  2QCU A;  5L4H A;  3LAD A;  4O4J E;  4TV8 E;  2GEW A;  3LBX A;  5J7X A;  1ZEE A;  1MXT A;  3SUC A;  3DK4 A;  1D1C A;  5HCJ A;  2IID A;  3B57 A;  1X9B A;  4OPI A;  3PJA J;  5JRE A;  2PYL A;  5HXE A;  1EAH 4;  1HFA A;  4EYU A;  2GR3 A;  2BKN A;  3L09 A;  2KT9 A;  2XLR A;  3JAD A;  4OX9 T;  2KLQ A;  5HWY A;  3OYZ A;  4KPR A;  3UQ7 A;  1MMD A;  4CNK A;  3URH A;  3OKQ A;  3GWD A;  4QWN B;  3KV9 A;  4HA6 A;  3KVE A;  2YR4 A;  3AXJ A;  3GQH A;  2BG9 B;  2K5B B;  5EZY E;  2J62 A;  4U8O A;  4CBQ A;  3NYE A;  2Q9Q B;  4P09 A;  2X3N A;  2HN1 A;  3VRD B;  1KK7 A;  4H9P C;  2VVL G;  2HWB 4;  2HPJ A;  4TX5 A;  3ATQ A;  2V1D B;  2VKO A;  4X1I E;  1LV0 A;  1D0X A;  5LA6 E;  1GRB A;  3RIU A;  1F8S A;  4DV1 T;  3TLV A;  4EM3 A;  4HEA A;  4JUY A;  1AR7 4;  3SQP A;  1VCS A;  2X0Y A;  5HY5 A;  5AQI B;  3F8R A;  3LB8 A;  4CNJ A;  2RM2 4;  5J2U E;  5GSN A;  4FK1 A;  2CXD A;  3BHF A;  2E1M A;  2CVJ A;  5FS9 A;  3CGE A;  3PUQ A;  4JI2 T;  2E8I A;  3UUB A;  2Y6R A;  2FJA A;  4D04 A;  1L9D A;  5M10 A;  4BK3 A;  4ZOL E;  4KHZ F;  1KEY A;  1NHP A;  1EZ3 A;  3NHO X;  4U8P A;  4BV6 A;  2EQ6 A;  1PHH A;  2LEH A;  1BWC A;  2RAB A;  1JRZ A;  1ZP0 A;  4P0B A;  5U25 A;  4GCM A;  3G06 A;  2B9X A;  3GRS A;  1E39 A;  1DNC A;  5AQQ B;  4H4W A;  1D4E A;  2F4V T;  3I9Y A;  2W67 A;  2XQ3 A;  3MK7 C;  1RUE 4;  1RUH 4;  2LM9 A;  2X67 A;  3FZF B;  3VU7 H;  1COY A;  2LSY A;  4Q4X 4;  4XWR A;  4BJN A;  2WM9 A;  4ZXL A;  1EV1 4;  3D1C A;  3SYI A;  5AQF B;  2DNX A;  3WE0 A;  3BNU A;  2IVD A;  3AB3 B;  2XSA A;  2LT3 A;  1XNQ T;  2YLR A;  4QKN A;  4O2B E;  1N32 T;  3NNE A;  2XTL A;  4Q4W 4;  4CI1 B;  1Q9I A;  2YKS A;  2W66 A;  1ZMD A;  1YW0 A;  1IBL T;  4TWF A;  5GON E;  3S4U A;  5LG4 A;  3LK3 B;  4KX6 A;  4BJM A;  1JRY A;  3IHM A;  2WBA A;  3H37 A;  3UTE A;  4CRT A;  4DSH A;  3FBZ A;  3GD4 A;  2K9A A;  4REK A;  5IQ4 A;  4G6H A;  3ZEF B;  4B68 A;  1JOA A;  1KNR A;  3N5L A;  4K5R A;  4YTN A;  1JNZ A;  4KMC A;  3KPK A;  1VRQ B;  1NAA A;  3NTD A;  4DV2 T;  4OPT A;  4H2R A;  4ZN0 A;  4H2P A;  4H2Q A;  1WR0 A;  3RYC E;  4GKJ T;  2XAQ B;  4B65 A;  3TLU A;  1S94 A; 
#chains in the Genus database with same CATH homology
 4WX1 A;  3AYL A;  1E1L A;  2X8C A;  2WU2 A;  2EQ9 A;  5IQ1 A;  2YM2 A;  2YLS A;  3V3N A;  4II3 A;  4UP3 A;  5GRT A;  3O0H A;  3SZC A;  3NK2 X;  2RGH A;  3SZW A;  4A9W A;  1D4C A;  3ICS A;  2GAH B;  2GR0 A;  3UOY A;  2YLT A;  1REO A;  1AOG A;  1JEH A;  2YLX A;  1HYU A;  3ICR A;  3GRT A;  3T2Y A;  1GTE A;  4E0V A;  4U2S A;  3GYI A;  4U8M A;  3AE7 A;  2PHH A;  1BGN A;  3GMB A;  4IV9 A;  1L9E A;  4EIP A;  1LPF A;  4YTM A;  1GV4 A;  1QO8 A;  2TMD A;  3UTG A;  4BK2 A;  2WU5 A;  1DJQ A;  1D7Y A;  4AT0 A;  4CCQ A;  1VQW A;  4B67 A;  3CNJ A;  4APN A;  2TPR A;  4AOS A;  4UDR A;  5HHF A;  1GES A;  3G5Q A;  1XPQ A;  5EB4 A;  1LTX R;  1IUU A;  3V3O A;  2B7R A;  3AE3 A;  4YXD A;  3SZ0 A;  3QSS A;  3NN6 X;  5HXI A;  5J60 A;  3VR8 A;  1H86 A;  1PN0 A;  2OLN A;  3QFA A;  1NDA A;  3AE4 A;  2XDO A;  1L9C A;  1H83 A;  4TM1 A;  2XYO A;  3QVR A;  1LJ1 A;  2GR2 A;  2XVF A;  4FX9 A;  1KNP A;  3FG2 P;  3G5R A;  2OLO A;  2ZZB A;  4U2L A;  5CKU A;  3ADA B;  4Y4M A;  5KMS A;  3CGB A;  1DOE A;  2ARD A;  4YSZ A;  5M0Z A;  2WP9 A;  1V59 A;  1QJD A;  1S2Y A;  3H8I A;  3JSK A;  3HYW A;  1CJ3 A;  1EBD A;  4NTC A;  5ER0 A;  4Z24 A;  3SX6 A;  1NHR A;  4B69 A;  1GOS A;  2Y6Q A;  4AT2 A;  2F5Z A;  3LZX A;  4G6G A;  2R0G A;  2XFN A;  4EIQ A;  4JQ9 A;  5KVI A;  1RSG A;  4AP1 A;  2V6O A;  2BXS A;  1GND A;  4FDC B;  1ONF A;  1F8W A;  1TDF A;  4NWZ A;  4H4S A;  4BUR A;  5BVA A;  1CBO A;  2WPC A;  1JNR A;  4OPD A;  4EQR A;  1GEU A;  4H4Z A;  3NLC A;  5JCM A;  1GRA A;  3ICT A;  4ZCC A;  4J56 A;  2Q7V A;  4JNQ A;  4OPC A;  5FS8 A;  3GYJ A;  3VR9 A;  3CNP A;  2ZBW A;  4IVM B;  3B3R A;  3T0K A;  5JCN A;  1ZY8 A;  2GVC A;  2B7S A;  2B9W A;  1H84 A;  1VG9 A;  4K7Z A;  1Z6L A;  2V60 A;  5JCI A;  1E1K A;  2QAE A;  3UOZ A;  1CC2 A;  4ECH A;  2VVL A;  4C77 A;  2GMH A;  4CY6 A;  4TLX A;  1GRF A;  2WET A;  4J34 A;  1TDO A;  3M0O A;  1OJ9 A;  2R0C A;  3AEF A;  2GB0 A;  3NK1 X;  1DXL A;  1YKJ A;  4DSG A;  1L0V A;  3SM8 A;  4H4Y A;  3DGZ A;  1SEZ A;  4D03 A;  3NGC X;  3CPH G;  2ZZC A;  2C67 A;  4USR A;  4CY8 A;  2VQ7 A;  4I58 A;  1CC6 A;  1KDG A;  2JKC A;  3VQR A;  2JB1 A;  3QSM A;  3C4N A;  4MJW A;  1FCD A;  5EOW A;  1YQZ A;  2GH5 A;  4OPU A;  2GMJ A;  3C96 A;  3IWA A;  2A87 A;  3AXB A;  4K8D A;  2NPX A;  2FBW A;  1BZL A;  4N9X A;  4X4J A;  5FS6 A;  3UKH A;  3QSE A;  3AD7 B;  3AYJ A;  2BXR A;  2CDU A;  3Q9T A;  2CUL A;  1GRE A;  1KSS A;  3NKS A;  4H50 A;  2YG4 A;  4JY3 A;  4BJY A;  4YKG A;  2YLZ A;  3OZ2 A;  1TDN A;  4B66 A;  4TM4 A;  2R0P A;  2GV8 A;  1YY5 A;  2E5V A;  3H8L A;  3UP4 A;  2X8H A;  4BJZ A;  3EF6 A;  3NYC A;  1CJC A;  2A8X A;  1IUT A;  3AEC A;  2WP5 A;  3KLJ A;  3PVC A;  2C70 A;  4A5L A;  4GUV A;  2WQY A;  3CTY A;  4AP3 A;  5KWF A;  3I6D A;  3BI2 A;  4NZH A;  4GRT A;  2BAC A;  2WOV A;  3BNM A;  4EQW A;  1NG4 A;  3SFD A;  1ZX9 A;  1YQ4 A;  3L8K A;  3DJD A;  1GAL A;  2WDV A;  1VDC A;  2DKH A;  1B8S A;  1EL9 A;  2C75 A;  5EB5 A;  2XLS A;  1IUV A;  1O95 A;  2AQJ A;  3UKL A;  3AE8 A;  4B63 A;  2B9Y A;  2ACZ A;  2XCG A;  2C66 A;  3G5S A;  3NRN A;  1Q1R A;  3SZF A;  4G9K A;  2O9Z A;  2FJB A;  3D8X A;  1OJD A;  2E4G A;  2BC1 A;  4GR1 A;  1PBD A;  1ZKQ A;  4K22 A;  2BCG G;  5KRQ A;  3P4R A;  3CNT A;  1BF3 A;  1KSU A;  2RGJ A;  3AWI A;  4GAV A;  4YKF A;  3AEG A;  2CFY A;  3UKP A;  5KMR A;  2EQ7 A;  4ZCD A;  1VG0 A;  5L46 A;  3VRA A;  2W0H A;  2YG6 A;  1B5Q A;  4J57 A;  4A6N B;  2WPF A;  2XVH A;  1PJ7 A;  1B37 A;  1TRB A;  3DA1 A;  2BYB A;  2VZ2 A;  3EAO A;  3NK0 X;  1GRH A;  3UKA A;  3V76 A;  2GQF A;  5JCK A;  3DJJ A;  4Y4L A;  3KU9 A;  1EL7 A;  3T14 A;  2AR8 A;  2JK6 A;  1PXA A;  4B64 A;  2BK4 A;  3SFE A;  2WP6 A;  4DNA A;  4JDR A;  2XVE A;  3GDN A;  1KFY A;  1GTH A;  1NG3 A;  2YR6 A;  1DOC A;  4J36 A;  3F8P A;  3SY4 A;  4H4T A;  2YG5 A;  1D5T A;  2RGO A;  3T37 A;  5KOW A;  2GQW A;  3F8D A;  2Q0L A;  3GD3 A;  2BK3 A;  1JRX A;  4JNA A;  5DBJ A;  3HYV A;  4C5O A;  5KOX A;  1CL0 A;  2VQB A;  3DME A;  1W4X A;  4J33 A;  1RP0 A;  1GT8 A;  2GF3 A;  4U8J A;  2C73 A;  2OA1 A;  4G73 A;  4H4U A;  1K4Q A;  4AOX A;  2H88 A;  1EL8 A;  1Y56 A;  1M6I A;  3FIM B;  2WDQ A;  2C64 A;  3CNS A;  5U63 A;  3DH9 A;  3DJE A;  2JB3 A;  3NG7 X;  3QJ4 A;  3CMM A;  4EQX A;  1NPX A;  3ISH A;  4U2T A;  4EMW A;  3ABV A;  3RP6 A;  3BI5 A;  2APG A;  2YVG A;  4I59 A;  1MO9 A;  4O5U A;  3SXI A;  3UKK A;  4H4V A;  3DJG X;  3S5W A;  2R46 A;  1H7W A;  3FPZ A;  4YSH A;  2XVI A;  1N4V A;  4Z25 A;  1EL5 A;  2BS3 A;  1PDH A;  5FMH A;  4K5S A;  3L1R A;  1PBC A;  2C4C A;  5EBK A;  3UCL A;  1NHQ A;  4ICY A;  5BUL A;  4GDE A;  1IUW A;  3GQK A;  4OPL A;  4C74 A;  4H4R A;  1PBE A;  1GPE A;  2Z5X A;  4P9S A;  4M52 A;  3RP8 A;  2XFP A;  2WEU A;  2YG7 A;  2HQM A;  4H7U A;  3RED A;  2JAE A;  1P2E A;  4PAA A;  1GRT A;  4A99 A;  1D4D A;  2YG3 A;  4CCR A;  5LV9 A;  1QLB A;  3ITJ A;  1E1M A;  4Z2U A;  1O94 A;  2GRT A;  3CGD A;  1PJ6 A;  2BRA A;  3LXD A;  1ZMC A;  3UTF A;  4X9M A;  3RP7 A;  3AEE A;  2H89 A;  1Q1W A;  3ZDN A;  2C3D A;  1CHU A;  1E1N A;  1O5W A;  3EPT A;  3AB1 A;  4EMI A;  2V5Z A;  4A65 A;  3UP5 A;  1N4U A;  3M12 A;  2C65 A;  3AEB A;  2WPE A;  4DGK A;  3LOV A;  3RNM A;  2PYX A;  1BGJ A;  1P2H A;  4LA1 A;  1UKV G;  1JU2 A;  4XXG A;  4EMJ A;  2C72 A;  2X99 A;  1X31 B;  3GMC A;  1DOB A;  2BCP A;  4J2W A;  2V61 A;  2GAG B;  3SGL A;  2YAU A;  3S61 A;  2QCU A;  3P4Q A;  3LAD A;  2BK5 A;  4Z2R A;  3AED A;  3PS9 A;  3NYF A;  1IUX A;  2GEW A;  5J7X A;  5JCL A;  1K0I A;  3PO7 A;  1MXT A;  1BKW A;  1LVL A;  2BRY A;  3SUC A;  2JBV A;  3DK4 A;  1Y56 B;  1H82 A;  2IID A;  1S3B A;  1RYI A;  3NTA A;  2YR5 A;  2EQ8 A;  5BRT A;  4OPI A;  4J31 A;  2A89 A;  1FEA A;  4EM4 A;  1LQU A;  2R45 A;  2VOU A;  3DK8 A;  3AD8 B;  4H2N A;  4Y4N A;  4Z2T A;  2YWL A;  1CC4 A;  1F8R A;  2GR3 A;  3P9U A;  3AD9 B;  4XWZ A;  3LZW A;  3R9U A;  2WS3 A;  4Z43 A;  1FOH A;  2XLR A;  1PBB A;  2XLT A;  4GF7 A;  3HYX A;  3UKF A;  2X8G A;  4USQ A;  5TR3 A;  4KPR A;  3NT6 A;  1PBF A;  4CNK A;  2DKI A;  3ATR A;  3URH A;  1ZDL A;  2C3C A;  3FBS A;  3C4A A;  4LII A;  2B76 A;  3GWD A;  2XFQ A;  3NN0 X;  1NHS A;  2BS4 A;  1OJA A;  3ALL A;  4HA6 A;  3KVE A;  2YR4 A;  4GDP A;  1FEB A;  2V3A A;  3ALM A;  1CJ4 A;  1TDK A;  5U1O A;  2YQU A;  3NIX A;  3GQH A;  2XFO A;  4U8L A;  1TDE A;  2C76 A;  2FJD A;  5KMQ A;  4FK1 C;  4C3Y A;  3ALJ A;  1ZK7 A;  4U8O A;  4CBQ A;  3EAN A;  3OC4 A;  3NYE A;  4UDP A;  1TYP A;  2X3N A;  2YM1 A;  3VRD B;  5C3J A;  4ADW A;  1H81 A;  3CN8 A;  2IVE A;  3B6D A;  5KMP A;  1YQ3 A;  2GR1 A;  2VVL G;  1Y0P A;  4YTP A;  2WES A;  3UOV A;  3UTH A;  4TM3 A;  3ZYX A;  2OAL A;  2XVJ A;  1IUS A;  1GXF A;  3ATQ A;  4YSX A;  4IA6 A;  2JB2 A;  1LV0 A;  1GRB A;  1OJT A;  1F8S A;  1CJ2 A;  1XDI A;  3AE1 A;  1F3P A;  3CPJ G;  3Q6J A;  4H4P A;  4EM3 A;  2R9Z A;  3KKJ A;  2WOI A;  4RG4 A;  3P4S A;  4IA5 A;  3AE5 A;  3AYI A;  3T2Z A;  3IC9 A;  3AE2 A;  3LJP A;  3I3L A;  4U8I A;  3SQP A;  1NEN A;  3FMW A;  3H4K A;  4BK1 A;  5HYM A;  5HY5 A;  3P1W A;  3BI4 A;  3F8R A;  3LB8 A;  1M64 A;  4CNJ A;  1FEC A;  1GSN A;  1F6M A;  2LFC A;  5GSN A;  4B1B A;  4FK1 A;  3BHK A;  3BHF A;  2FJE A;  2E1M A;  2I0Z A;  2CVJ A;  3CND A;  3CGE A;  3DK9 A;  5CQF A;  5FS9 A;  1ZOV A;  1ZOY A;  4NEW A;  2BAB A;  2Y6R A;  2FJA A;  4D04 A;  2BS2 A;  5IPY A;  1L9D A;  2J3N A;  1ELI A;  5M10 A;  2VRM A;  4BK3 A;  5FS7 A;  2Q6U A;  1PJ5 A;  3GWF A;  2YVJ A;  3T2K A;  2WHD A;  3CIR A;  4Z26 A;  5BUK A;  1XAN A;  4EQS A;  3CPI G;  1NHP A;  3NHO X;  4U8P A;  5KXJ A;  4BV6 A;  2EQ6 A;  2V3B A;  2YLW A;  3GYX A;  3K7Q X;  1PHH A;  2Q0K A;  2WDR A;  4NTD A;  4K2X A;  1BWC A;  2RAB A;  4GAP A;  2R4E A;  1N1P A;  1FL2 A;  3COX A;  4WCT A;  1XHC A;  1D7L A;  1DOD A;  1GET A;  1E7P A;  1JRZ A;  1PXB A;  2UZZ A;  1ZP0 A;  5U25 A;  3KA7 A;  4GCM A;  1H6V A;  3CGC A;  2BA9 A;  4OCG A;  3AE9 A;  3RHA A;  2B9X A;  4U8K A;  4TLZ A;  4Z44 A;  3GRS A;  1E39 A;  2XFU A;  3GSI A;  3UOX A;  4X9N A;  1DNC A;  2YVF A;  1S3E A;  4HB9 A;  4H4W A;  4A7A A;  1D4E A;  2R4J A;  4YWO A;  4A79 A;  4G74 A;  3HZL A;  1B4V A;  1KF6 A;  2XLU A;  3II4 A;  3KD9 A;  1N4W A;  1COY A;  5KVH A;  2QA2 A;  4NNJ A;  3E1T A;  4XWR A;  1GRG A;  1MOK A;  3D1C A;  4PAB A;  3SYI A;  1NEK A;  4OPG A;  2VVM A;  3WE0 A;  3BNU A;  2IVD A;  3T31 A;  1PS9 A;  2WOW A;  4C3X A;  4YT0 A;  4NEV A;  4NTE A;  1CF3 A;  2YLR A;  1OJC A;  4O5Q A;  5C2T A;  3NNE A;  4JY2 A;  4LU6 A;  4A6N A;  3K7T A;  2NVK X;  1K0L A;  3GDP A;  2AAQ A;  2C7G A;  4H4X A;  2OAM A;  1Q9I A;  5KNL A;  3IHG A;  4JN9 A;  1PXC A;  3UKQ A;  1IJH A;  2VRL A;  3P4P A;  3QFB A;  1ZMD A;  3DGH A;  3IF9 A;  3NH3 X;  3M13 A;  1DJN A;  2QA1 A;  1H7X A;  4H4Q A;  4KX6 A;  1JRY A;  2Z5Y A;  3IHM A;  3AEA A;  2WBA A;  4CRT A;  3UTE A;  4OVI A;  4DSH A;  3GD4 A;  2ZZ0 A;  1GER A;  2XLP A;  4REK A;  4U8N A;  4G6H A;  5IQ4 A;  4II2 A;  4UDQ A;  4IVO B;  4B68 A;  1JOA A;  1KNR A;  2BC0 A;  4K5R A;  1LQT A;  4YTN A;  1TYT A;  2X50 A;  3QVP A;  3K7M X;  4RSL A;  3K30 A;  1E6E A;  1JNZ A;  3KPK A;  3AE6 A;  1K0J A;  4TM0 A;  1VRQ B;  1NAA A;  3NTD A;  4OPT A;  4H2R A;  4ZN0 A;  4RG3 A;  4H2P A;  4H2Q A;  4YSY A;  1S2Q A;  3VRB A;  4B65 A;  3KPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...