4YT0A

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
616
structure length
616
Chain Sequence
b'SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 209
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4yt0A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4yt0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4yt0A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4yt0A04
1EL8A 1MXTA 3D1CA 1PBCA 2E5VA 1YQ4A 4JY2A 1DODA 2YG4A 5U25A 2R0GA 3NYEA 5FS8A 3UOYA 4YTMA 2ACZA 4FDCB 3P9UA 4TLZA 1GRBA 5C2TA 4E0VA 1DXLA 4UDPA 2JB2A 2V5ZA 3ATQA 3AYLA 3JSKA 4JQ9A 1XANA 1CJ3A 1JEHA 3VR8A 4H7UA 1JRYA 1GPEA 2CVJA 4TLXA 3UKAA 4EIPA 1KNPA 4IV9A 2BABA 4J36A 4BURA 1O5WA 5JCNA 4K22A 1CJ2A 4B1BA 3SUCA 4DGKA 3H8IA 3V76A 2GH5A 2RGOA 1PXCA 1DOEA 4CY8A 1GT8A 1TDEA 3GMBA 2R4EA 3NYFA 4EIQA 3AD8B 1GESA 1O95A 4EQRA 1EL5A 1VDCA 3AWIA 2C72A 3GRTA 4DNAA 2ARDA 1KF6A 3GRSA 2YAUA 4FK1A 2BYBA 2EQ6A 3G5RA 3VRDB 1H83A 4TM1A 1VG0A 4Z43A 3ABVA 3LXDA 3LADA 3VRAA 2GAGB 1ZKQA 3GSIA 3G5SA 3AE5A 4U2LA 5DBJA 2HQMA 4H4PA 5CQFA 1H6VA 3EPTA 2V60A 3GYJA 1VQWA 4J57A 1BF3A 1TRBA 3GWDA 1K0LA 3ICRA 1GALA 3CGDA 3V3NA 3M13A 3AEGA 1PXAA 2W0HA 2B7SA 1O94A 3B3RA 3CNPA 4N9XA 1IJHA 1H7WA 2Q6UA 4YXDA 3L1RA 1LPFA 2WDQA 3NIXA 3DGZA 3P4RA 2X3NA 1E1LA 1K4QA 1TYTA 3CNDA 1OJ9A 2YG3A 3NNEA 2VVMA 2OLNA 1CC4A 2YVJA 3CNJA 4H4YA 4H4XA 5LV9A 4MJWA 3NN6X 1DOBA 3AE4A 1REOA 3DJDA 1W4XA 3K7QX 4JDRA 3ICTA 2GMHA 2X8HA 3UTGA 3AE9A 2QA2A 2RABA 3AE1A 1MOKA 2C76A 2XVJA 4OPLA 5EB5A 3BNMA 1BGJA 2AAQA 1BGNA 5FS6A 2B9WA 1IUVA 2R4JA 4O5QA 5GRTA 1EL9A 3RP8A 4JN9A 1CHUA 3UOXA 4KX6A 2YQUA 3DMEA 1ZK7A 1XHCA 1H81A 4D03A 2GR2A 2JAEA 4U8OA 5GSNA 2WBAA 1F3PA 5J7XA 1ZX9A 2GQFA 3CN8A 3NLCA 4RG3A 5FS9A 3ZYXA 3IHGA 3ATRA 4Y4LA 1DJQA 4NZHA 3D8XA 3KKJA 3NK2X 3PVCA 4Z25A 2JB1A 3KA7A 4A9WA 2WOVA 4H2RA 4C5OA 1S3EA 1JNZA 2V6OA 3URHA 4Z26A 2XLTA 2EQ8A 2C75A 3CGBA 3P1WA 3QJ4A 4Z2RA 4NTCA 4YSYA 1S2QA 1GRTA 5KOXA 1ZDLA 1VG9A 4U8PA 2R0PA 1ZP0A 4OVIA 1RYIA 2XLPA 3IC9A 4OPGA 1IUSA 2A89A 2YG5A 1COYA 3F8DA 3NN0X 4LA1A 3SFEA 4A65A 5L46A 2XFNA 2OAMA 2XLRA 1ZMCA 4LIIA 4C74A 5FMHA 5KVIA 4WCTA 2VZ2A 3NHOX 3B6DA 1NHRA 4C3XA 4KPRA 1GRGA 1L9DA 5BULA 4OPDA 1RP0A 2X8CA 2GV8A 4NTEA 2RGHA 3BI4A 2BA9A 3RP6A 2R0CA 2V3BA 5KOWA 3AECA 2H88A 2C66A 1S3BA 3Q9TA 3QVPA 3UOZA 4EMWA 2VRLA 1HYUA 2C70A 3RNMA 3E1TA 2VQBA 1H84A 3EF6A 2PHHA 1TDKA 2BK5A 5HXIA 4BK2A 2V61A 5KVHA 2WQYA 1N4VA 3GYXA 1Y0PA 2BS4A 3S61A 4NEVA 2J3NA 4H4QA 2XVFA 2DKHA 3CGEA 1CJCA 2YR5A 4J33A 5EBKA 4H4VA 2CFYA 2NVKX 1PXBA 1D4EA 4GR1A 1ZOYA 4D04A 4A5LA 2YG7A 4EQWA 2BCPA 4YT0A 1D4CA 4EM4A 2RGJA 4IVOB 4GDPA 4B67A 3NH3X 4ZN0A 5JCKA 1EBDA 3AD9B 3HZLA 1Y56B 1NPXA 3AEDA 1N4WA 3NT6A 3CTYA 4OPCA 3GMCA 1E1NA 2GF3A 1E7PA 1IUWA 1TYPA 1NEKA 1K0IA 2R46A 3BHKA 3GD4A 4WX1A 4J56A 5EB4A 1L0VA 4GUVA 2BACA 2AQJA 1PN0A 2GR0A 1M64A 3M12A 3AEAA 1B4VA 2Y6QA 2WPEA 5KXJA 3DJGX 3KLJA 2BS2A 4Y4NA 3BI5A 4CY6A 2YWLA 3AEFA 3AE6A 2C73A 4JNAA 1D7LA 3G5QA 1CBOA 4U8LA 2GQWA 5BUKA 3AE7A 2AR8A 3CPHG 1LJ1A 2YM2A 3CNSA 4BV6A 3UKQA 2R9ZA 3BI2A 2CDUA 1E1KA 1FECA 1PBEA 1GERA 1GEUA 4TM3A 3NK1X 3RHAA 3ICSA 3V3OA 3AEBA 1PBDA 1EL7A 3WE0A 4HB9A 4Z24A 4U8IA 3AYJA 2PYXA 3UKFA 3NKSA 2Q0LA 1E39A 2E4GA 2WETA 3ZDNA 4BJYA 4NTDA 1TDOA 1FOHA 4X9MA 4YSZA 1LV0A 1F6MA 1NG4A 1H7XA 5HHFA 3EAOA 3LOVA 1S2YA 2GR1A 2VQ7A 4UP3A 1DOCA 3NGCX 1NHPA 3GQHA 3NG7X 4LU6A 2VVLA 3AE2A 1GRFA 2QAEA 4H4ZA 3KD9A 4B69A 3UP5A 1GV4A 4H4TA 1V59A 2GMJA 4Z2UA 4TM4A 1L9EA 2YM1A 1MO9A 3F8PA 4FX9A 4UDRA 2WU2A 1CC2A 1GRAA 1JRZA 1OJAA 1ZMDA 3AB1A 4J31A 4JNQA 1NAAA 4X9NA 4K5RA 3AXBA 3AE3A 3CIRA 1ZY8A 3SM8A 4IA5A 4B68A 4YKFA 4RG4A 3REDA 2WEUA 5KRQA 3ALJA 1VRQB 1FEAA 4B66A 2JB3A 2WPCA 2WS3A 1Q1RA 3Q6JA 3UKHA 2JK6A 4YTPA 2C64A 2WP5A 1CC6A 2YVFA 1UKVG 4XWZA 3CGCA 1DJNA 4B65A 3ALMA 1PBFA 4H4UA 2GR3A 1KSUA 4H4WA 3VQRA 3DA1A 2BK3A 1B37A 4H2QA 4EQSA 3AYIA 3VRBA 3ALLA 3S5WA 2TPRA 4EMIA 2H89A 4H4RA 1KDGA 4IVMB 4ECHA 1YY5A 1FL2A 5EOWA 2XCGA 1M6IA 3K7MX 4A7AA 4YSXA 3BNUA 2IIDA 3I3LA 2VRMA 3DH9A 2WDRA 4C3YA 3LZXA 3SFDA 1GOSA 2FJDA 1BKWA 4OPUA 2YLRA 3ADAB 4GF7A 1GXFA 4J2WA 2YLTA 4Z44A 1GRHA 1PBBA 2BCGG 4XXGA 3UCLA 2CULA 3I6DA 3VR9A 2X8GA 1GREA 4USQA 3DK8A 2EQ9A 3FBSA 1XDIA 3M0OA 2WP9A 1BZLA 4U2TA 3GYIA 1PS9A 3UTHA 2B9XA 1LQTA 2YR4A 1ELIA 2TMDA 1FEBA 2FBWA 1CJ4A 2WESA 2OALA 2C3DA 3OC4A 1RSGA 3ITJA 4H2PA 1QLBA 1NHSA 3COXA 4AT2A 3C4AA 3QSSA 2ZBWA 1PJ6A 3R9UA 4AOSA 2XVHA 3FMWA 1PJ5A 3C96A 2DKIA 1CF3A 3UTFA 4U2SA 1YQ3A 2GEWA 4YKGA 3UKLA 3IHMA 3KPFA 2A8XA 4BK1A 2XVEA 3KU9A 4O5UA 4OCGA 1E6EA 4H2NA 1KSSA 1QO8A 1ZOVA 4I59A 2FJEA 4ICYA 4A99A 2ZZBA 1D4DA 2YR6A 3GDPA 3ISHA 1Y56A 2C3CA 2V3AA 4H50A 3IWAA 5M10A 3K7TA 4GCMA 1OJDA 2IVEA 2XFOA 3UTEA 3DK9A 3NTDA 2BC1A 1F8SA 2QA1A 1N4UA 2BXRA 4K5SA 2X50A 1GTEA 2BK4A 2BXSA 1Z6LA 4B63A 2Y6RA 3DJEA 2WOWA 1D7YA 3EANA 4BK3A 3CNTA 1NG3A 3OZ2A 2IVDA 4AP3A 4K8DA 4BJZA 4AOXA 4C77A 3H8LA 1LTXR 1PDHA 4P9SA 2XLUA 3NYCA 4YWOA 5KWFA 5CKUA 5HYMA 1X31B 2VOUA 1FCDA 4CCQA 3H4KA 1AOGA 4U8KA 3C4NA 3LZWA 4REKA 4UDQA 3F8RA 4CCRA 5IPYA 3QVRA 4EQXA 3FIMB 3CPJG 3L8KA 4CNKA 2BC0A 1NENA 2XVIA 4CRTA 4RSLA 1CL0A 5TR3A 3P4PA 2YLXA 1NDAA 4M52A 1PJ7A 1ONFA 3DGHA 3QSMA 2Q7VA 4K7ZA 2GAHB 2O9ZA 2WPFA 1H82A 2QCUA 2UZZA 4CNJA 3GD3A 1GNDA 2NPXA 2XFPA 4AP1A 2Z5YA 4Z2TA 2XFQA 5IQ4A 1TDFA 1BWCA 3NTAA 1XPQA 3O0HA 4EM3A 2C7GA 2YG6A 4X4JA 4DSHA 4YSHA 3QFAA 2VVLG 3AEEA 4HA6A 1YKJA 4OPIA 2WP6A 1SEZA 5M0ZA 4CBQA 2OA1A 3KVEA 2E1MA 1JNRA 4GRTA 1B8SA 1F8WA 2WOIA 5JCMA 4PAAA 3GQKA 2F5ZA 1OJCA 3GDNA 2B9YA 2Z5XA 4A6NB 1N1PA 4I58A 4A6NA 4ADWA 4ZCCA 1F8RA 4H4SA 1TDNA 3SQPA 4AT0A 4YTNA 2JBVA 1H86A 3FG2P 5BVAA 1B5QA 1IUTA 2YLWA 4FK1C 2JKCA 1Q9IA 3II4A 4GDEA 3QFBA 2WDVA 5JCIA 3UKPA 1GSNA 1QJDA 2XLSA 2YLSA 4OPTA 1OJTA 1KNRA 1P2EA 4U8JA 2ZZCA 4J34A 3K30A 4ZCDA 2GVCA 1L9CA 5BRTA 5JCLA 1DNCA 2I0ZA 3UKKA 4B64A 1Q1WA 3T37A 4APNA 2LFCA 2A87A 5FS7A 2YLZA 1IUUA 2R45A 3CPIG 5IQ1A 4USRA 3UP4A 5U63A 2B7RA 2Q0KA 2X99A 3NK0X 3RP7A 4JY3A 1P2HA 4XWRA 1GTHA 2ZZ0A 4DSGA 4EMJA 1K0JA 4IA6A 2GRTA 5C3JA 1PHHA 1LQUA 4A79A 3P4SA 2GB0A 3NRNA 2WHDA 2C65A 3AD7B 4TM0A 3LJPA 1YQZA 3IF9A 3PS9A 3BHFA 2XFUA 2APGA 3P4QA 1JOAA 1LVLA 3PO7A 5ER0A 2FJAA 3DK4A 3SGLA 3GWFA 2FJBA 4K2XA 2YVGA 2XDOA 3QSEA 2C67A 1D5TA 1E1MA 2EQ7A 4Y4MA 4U8MA 5U1OA 2WU5A 5HY5A 2OLOA 1JU2A 3LB8A 1JRXA 1NHQA 3FPZA 3UOVA 3AE8A 2XYOA 2B76A 5J60A 1IUXA 3DJJA 1GETA 2BS3A 4NEWA 4PABA 1KFYA 4U8NA
chains in the Genus database with same CATH superfamily
3PUQA 4O4HE 4JY2A 5LP6E 2E5LT 2DWKA 4IREA 2BZBA 1HCIA 4FDCB 1GRBA 5C2TA 5FVKA 2JB2A 2V5ZA 4JQ9A 3AYLA 1CJ3A 5L47A 1JEHA 3RYIE 4HKAA 1GPEA 3UKAA 4ZI3D 4EZ4A 2P9BA 1HNWT 5JCNA 4LFBT 3H8IA 3V76A 4GKJT 3TLVA 1DOEA 4IE7A 4DIDB 3K3OA 3NYFA 4P1NA 4EIQA 1GESA 1O95A 1M62A 3AWIA 2ARDA 2L9QA 2CLYC 4EXTA 2EQ6A 1H83A 3PUXF 3V5SA 2KZ7B 3T1YT 1Z0PA 2QA7A 3LADA 1VBA4 3GSIA 3G5SA 5E0OA 4U2LA 4H4PA 5CQFA 3W15B 2R044 3P8CD 2V1DB 4DO0A 3E22E 5GONE 3GYJA 1TRBA 3M13A 3AEGA 3B3RA 4B3TT 4QXCB 4G63A 2X67A 2LSKA 1UK5A 2X0HA 4L5GA 3P4RA 2WM9A 1OJ9A 2YVJA 4H4YA 3RIFA 4MJWA 2V7LA 2VKHA 3K7QX 3AE4A 3GN5B 3MKDA 4OYJA 2GMHA 2QA2A 2RABA 3MA9A 3J7Yq 4AQGA 1BGNA 2YQUA 2N2NA 1XHCA 2C0SA 3A5XA 4U8OA 3ONJA 2YOEA 5L3EB 5J7XA 2LKHA 3ZLIA 3T31A 3CN8A 3T2KA 2YEVC 3N9MA 2LT3A 4CQIA 3D8XA 1HX8A 3KKJA 4Z25A 4A9WA 4H2RA 4JI0T 2V6OA 5TAOA 4Z26A 1VCTA 2EQ8A 4Z2RA 3QJ4A 3C98B 1N32T 4K0KT 3UUNA 4QWNB 2R0PA 4OVIA 2LM2A 2W4XA 2YG5A 2NWBA 4EOZB 4YJ2E 5LG4A 2OAMA 4LIIA 3OBVE 4ISSA 5KVIA 5JDFA 2VZ2A 2ZM0A 4N78D 4A97A 3KBTA 3JAFA 1NHRA 3B6DA 3NHOX 4EEDA 1GRGA 1L9DA 4OPDA 3ZYLA 4NTEA 5FY1A 3LBXB 3FXDB 1RMU4 2RGHA 5KOWA 2R0CA 2V3BA 3Q5XA 4H9PC 5LJMA 3UOZA 2L3LA 2C70A 1UCUA 5ABGA 4DR4T 2EHOC 1TDKA 2BK5A 3ONLC 2B1EA 1IBLT 4KHZF 1N4VA 3CQGB 1Y0PA 5AQNB 4LF7T 4LFAT 3IF8B 4QXBB 3CGEA 2YR5A 2LOPA 2UUAT 4H4VA 5JVDE 4HFHA 3ZYKA 5JDLA 2YG7A 4JEHB 4DMVA 2J1DG 3GA8A 4PAGA 4B67A 5JCKA 2R064 3HZLA 3AD9B 1N4WA 1AR84 2K5BB 3CK6A 4WZXA 2UU9T 2GF3A 3T14A 2KSRA 4GK0E 1TYPA 3N2OA 1K0IA 1XWMA 4DV1T 2CWYA 4LMKA 1ZV4X 2RMU4 5L2LA 1PN0A 3AEAA 4HFEA 2WPEA 5KXJA 4Y4NA 3AEFA 2HHHT 2CM0A 2UXNB 2W66A 4IIJE 2GQWA 3CPHG 2BG9A 5J0ZA 1XDOA 2V7JA 3FZHB 3M65A 1H7CA 3RH3A 4TM3A 3RHAA 2PY5A 3C51A 5JTGA 3AEBA 1EL7A 4HB9A 3UU6A 2PYXA 1E39A 2KXPB 2E4GA 1SE7A 1F6MA 1NG4A 2Q9QC 3SRZA 2LRLA 3NBXX 4UP3A 2JQ9A 2NW7A 1NHPA 3Q5WA 4O4IE 4JYAT 4Q4X4 2VVLA 3AE2A 3J9X1 2BKNA 2QAEA 1N36T 2WBLA 2GMJA 4PJMA 1L9EA 2YM1A 3ANWB 3HKBE 4YY3T 2WU2A 2CBIA 2BBJA 1GRAA 1JRZA 4DV6T 1OJAA 1VBB4 1NAAA 4ILBA 2CXLA 4X1KE 4IA5A 3OPCA 3H37A 5CA1E 5KRQA 1VRQB 1FEAA 2KINB 2WPCA 2IIUA 3FZFB 4YTPA 1OWAA 4PJJA 2GR3A 2QGSA 2XSAA 4EQSA 4ZXLA 4EMIA 2X9XA 4IE0A 1VCSA 1U4QA 4DV5T 5EOWA 3K7MX 2V26A 3I3LA 4QXHB 2WDRA 4U2ZA 5F5WA 4C3YA 2FJDA 1BKWA 3RQWA 2MAWA 4MALA 4Z44A 1Y01A 3U78A 1PBBA 2CULA 2NTXA 3I6DA 1RUC4 3VR9A 3JC6C 5HEOA 3VKHA 1GREA 3UUXB 4PDWD 3DK8A 5LG3A 3M0OA 2XY8B 3GYIA 1LQTA 1ELIA 4PK5A 2FBWA 4XZCA 3LSVA 3NZQA 2OALA 2XQ5A 3COXA 2VASA 3VKGA 1PJ6A 2CHOA 2DKIA 1U5PA 1BR0A 3HYXA 3UTFA 5JDGA 4KBMB 1YQ3A 5FY7A 3IHMA 5JRCA 3PV0F 2A8XA 4OCGA 4H2NA 1KSSA 1ZOVA 4I59A 2EHOD 2NW8A 4BAYB 4WYVA 1GQEA 1MNDA 5H6QB 3KPKA 4GCMA 2VK9A 3UTEA 3DK9A 4X1YE 1N4UA 2JPFA 4K5SA 1DU2A 3PU8A 3AAAB 3QB5A 1E1HB 3CNTA 4DR1T 4AP3A 2CXFA 3C4ZA 4K8DA 1VBC4 1IAPA 4DUZT 4P9SA 4YWOA 5J2UE 5HYMA 3OVUA 2KT9A 2LM9A 3KVAA 1OXZA 3AXJB 4L0RA 2GK9A 4CNKA 3FZKB 3QUJA 2XVIA 4CRTA 2CPTA 2PTFA 4M52A 1S94A 5LMUT 2VWAA 2GAHB 2O9ZA 2DI4A 1H82A 4H9QC 2NPXA 3DTOA 2R7FA 4X4JA 2LHRA 4HFVA 2AXDS 4HE8A 3AEEA 4HA6A 4IDPA 2WP6A 5M0ZA 2OA1A 5KNLA 5L3GB 1JNRA 3GQKA 1OJCA 1N1PA 4I58A 4A6NA 3LK42 4ZCCA 3SQPA 4F6RC 1NCQD 4FK1C 2XQ8A 1Q9IA 3II4A 4Q4W4 3PU3A 1GSNA 1HG2A 3UUMA 1KNRA 4DUYT 2RR14 4ILUA 4UELA 3K30A 4A98A 4UEMA 1W0BA 5JCLA 2X68A 4P0AA 2LFCA 3TKLB 5FS7A 4IE4A 2R45A 3CPIG 2LSIA 2B7RA 1Y64B 2ES0A 3CWZB 4JY3A 2I6HA 4NPPA 1XMOT 5FKYA 2GRTA 2BG9B 2WHDA 3R84B 3AD7B 4TM0A 3LJPA 2K48A 3IF9A 3BHFA 2APGA 1JOAA 3PO7A 3MK7C 5ER0A 2XASB 2FJAA 3SGLA 2XDOA 2JMKA 4QKNA 1D5TA 4JI5T 3TLWA 4LF9T 1E1MA 3FB2A 4EEBA 2X51A 2LJLA 2WU5A 5HY5A 1HTJF 1ASJ4 3LB8A 3O1HA 5DQWA 1GETA 2KMFA 4NEWA 4OPCA 5TR3A 4UVAB 2LHNA 1DODA 2V7IA 4HFBA 1HRI4 5C8YE 3UFEA 3UOYA 3C4WA 4UDPA 4JEUB 4TZ4C 3UUBA 4EV6A 4G9KA 4H7UA 4EIPA 4TLXA 4AKRB 1I94T 5ABHA 2BABA 5AQIB 4BURA 1O5WA 3WAKA 4B1BA 1POV0 4G2AA 2MBGA 1PXCA 2LOSA 5AQPB 4CY8A 1GT8A 3AD8B 5HAXA 1RUJ4 1EL5A 1HS7A 3C50A 4DNAA 2CCQA 1HRV4 2M6IA 2BYBA 3ZCIA 4AI6A 2X5ID 2H3RA 3N2KE 3LXDA 2CEAA 1ZKQA 3ESLA 2HQMA 5AQTB 3EPTA 5EZYE 1LKXA 2V60A 4YHHT 4YLHA 4GKKT 4AISA 4J57A 1K0LA 4HFCA 5KMPA 4N9XA 2B7SA 2JQKA 1OEDC 1IJHA 1H7WA 1XZYA 3N9NA 3ZCJA 4IL4A 3RYHE 3NIXA 3DGZA 2X3NA 1K4QA 1TYTA 3DJBA 3RRCA 3CNJA 4U74A 1CC4A 3NNEA 5HCMA 1DOBA 1REOA 2JQQA 3EDUA 2PW9A 5LGUB 2X8HA 2E9XC 3UTGA 3AE1A 2XUEA 4PNIA 4UV9B 3MXZA 4TN7B 2KNDA 4FI5A 1IUVA 2HPLA 2R4JA 4O5QA 3UFGA 3UOXA 2RS54 3DMEA 1ZK7A 2JAEA 3IHRA 4WBNE 5CJ5A 4V1Av 5FXXA 3U3IA 1ZX9A 2GQFA 4RG3A 5JDNA 4MHCA 3ZYXA 2V8SV 4NZHA 2JB1A 1K5MD 2WOVA 4DMWA 4ILAA 3PJAJ 4TV8E 3URHA 2PG8A 4U31A 4YSYA 3KVBA 1S2QA 2RM24 1ZDLA 1VG9A 4CI2B 2CE7A 5FYMA 4DBRA 4O4JE 2DHRA 2A89A 1COYA 3F8DA 4A65A 2XLRA 1ZMCA 4C74A 2DWGA 5FMHA 4WCTA 3F31A 4C3XA 4KPRA 4GIWA 4TWFA 5BULA 2X8CA 3T2YA 2A72A 3NRYA 3PUZF 3SWHA 4H9SE 1IBMT 2BA9A 4HN9A 3D0TA 2H88A 4TUYE 2C66A 3Q9TA 4IDQA 3ZN1B 3QVPA 4H9RC 3RNMA 3E1TA 1UURA 1H84A 1MIWA 5HXIA 2V61A 5KVHA 1ZHCA 3ZT5A 4NEVA 2JJ9A 2DKHA 5EBKA 4JV5T 2E9XB 1D4EA 4EIWA 4D04A 4A5LA 3HKEE 4YJ3E 1D4CA 1WCRA 3CX7B 4ZI3C 4ZN0A 4G74A 4JI7T 3AEDA 3EI0A 1CUNA 3CX6B 1IUWA 4QH1A 1NEKA 4A5XA 4WX1A 4PJNA 5EB4A 3UU4A 2I0MA 4ADZA 2GR0A 1M64A 2Y6QA 1QSDA 3KLJA 3BI5A 4UF0A 4A56A 4MLKA 5HXRA 3FZLB 2D2SA 3BI2A 2CDUA 2EX3A 1PBEA 1GERA 3ICSA 2WZIA 3WE0A 4U8IA 3AYJA 3NKSA 2Q0LA 2OA5A 2Q9QB 4NTDA 4GAPA 5FL0A 4YSZA 4JLEA 3EAOA 2KLQA 1D1BA 1UX5A 1DOCA 4DV0T 4H9OC 3GQHA 2C4CA 2MPKA 3NG7X 3KD9A 4LMLA 1GV4A 4U2YA 1V59A 1LVFA 3OYZA 4UVBB 3F8PA 4FX9A 3QB5K 4UDRA 3SX6A 4CXYA 4CXWA 1LRZA 5KMGP 3REDA 2WEUA 4PK4A 1WR0A 2WS3A 2UUCT 3HL6A 1Q1RA 2LSGA 1CC6A 4CI3B 1UKVG 1XNRT 2A9UA 4H4UA 3AA7B 3SS1A 4IDZA 2BK3A 2TPRA 2UXCT 2V5DA 5L3FB 3UQ7A 4ECHA 1YY5A 3N9QA 4E7SA 1M6IA 1MMNA 2XCGA 4A7AA 4YSXA 3BNUA 1WR6A 4E7ZA 5L3DB 3LZXA 2Q9QD 1GOSA 2YLRA 1GXFA 1GRHA 4XXGA 1IJ6A 3AA1B 4P09A 3PUSA 4TNWA 4TX5A 3CQXC 4DR2T 3UU3A 1XDIA 3FBSA 2WP9A 2LSJA 5LCYA 5FY0A 2B9XA 2YR4A 1EAH4 1CJ4A 2WESA 2WMOA 2IMLA 4KP3C 3ITJA 3WI3A 2UUBT 1NHSA 3C4AA 3C4XA 3R9UA 4H63V 1PJ5A 1CF3A 3HKCE 4IE6A 1HNXT 4O5UA 2XQYA 1E6EA 1J1JA 1AJ3A 1QO8A 2FJEA 4A99A 3QOFA 2ZZBA 3N9LA 1D4DA 3I9WA 3GDPA 2C3CA 2XQ4A 4H50A 3IWAA 3LBXA 1OJDA 2WWVA 3NTDA 4Q25A 3RF1A 1F8SA 2QA1A 3EVYA 2BXRA 3CVRA 4AQFC 5LBMA 1GTEA 2BK4A 4B63A 1D7YA 4BK3A 3OZ2A 2IVDA 4C77A 4BJZA 3H8LA 3RIAA 2BVMA 2XLUA 2OV9A 2X9HA 3NRXA 1X31B 3TLSA 1VRH4 4CCQA 3H4KA 1AOGA 3C4NA 4JUYA 4REKA 4RHV4 1HXS4 1UX4A 4U7IA 3QVRA 2V7KA 5IUXA 4OYKA 3HI2A 2F4VT 3P4PA 1NDAA 1PJ7A 1HNZT 5J1GA 4PFPA 3QSMA 3LK2B 4HFDA 2Q7VA 2LE8A 3X1DA 2QCUA 1GNDA 2Z5YA 2XFQA 5IQ4A 2CWOA 1TDFA 3NTAA 4EM3A 1SHZC 4DSHA 3QFAA 4OPIA 1SEZA 2JMHA 3RQUA 4G73A 4GRTA 1X9BA 3AAIA 4AQYT 4PAAA 1T72A 2F5ZA 3GDNA 2Z5XA 2Z6EA 2VKOA 3JADA 2XPKA 3KINB 1F8RA 2ZLYA 2XTLA 4AT0A 4YTNA 3FG2P 2YLWA 5LHGB 1Z8UA 4ISTA 4GDEA 3UKPA 3JAEA 5LOVE 4OPTA 1OJTA 5FMNA 1G8XA 3K8PC 4QH5A 3FBLA 1T98A 1Z7S4 3GWHA 2GVCA 1L9CA 5BRTA 4B6XA 1DNCA 4ZHQE 2V6YB 1Q1WA 1I6ZA 1IUUA 4LFCT 4USRA 1B7TA 2X99A 3FHNA 5HXEA 2HN1A 3MACA 2CXDA 5IWAT 1P2HA 2LEHA 1LQUA 4A79A 2GB0A 4CN6A 2BDEA 4EYYR 2C5JA 2QRXA 1N34T 3AA0B 3I1AA 2PLV4 4XBFB 5CGMA 1FEWA 4B3RT 3DK4A 3GWFA 4K2XA 2CMRA 1KK7A 2ZM6T 4OX9T 4Y4MA 5HXCA 4AKHA 3OTOT 4ZI2D 1LVKA 3FPZA 3EUHA 2B76A 2QVAA 4PK6A 2BS3A 4B66A 3AXJA 4PABA 2K9AA 4U8NA 4X20E 1PBCA 2E5VA 1YQ4A 2IAKA 5U25A 2Y6XA 2R0GA 5AFUL 3NYEA 3ONXA 2D9DA 4O8SA 2BG9C 4YTMA 2ACZA 3P9UA 5JREA 1YD8G 4E0VA 2G0UA 1DXLA 3ATQA 2J62A 2HWC4 1MMAA 1MIYA 1JRYA 1KNPA 2E2AA 2N9DA 3L39A 2EHOB 4K22A 2PFVA 4QHOA 2VQFT 1RUG4 4QX8B 2GH5A 2RGOA 3HR0A 2V6XA 2W00A 4CI1B 3G06A 2R4EA 3ZMUB 2YK0A 3O9XA 3MJXA 1VDCA 3VU7H 4IDOA 3HYWA 4ZI2C 2C72A 3GRTA 2D5UA 1KF6A 4FK1A 2YAUA 3G5RA 2V7MA 1VG0A 4Z43A 3QK6A 4IT4A 2HPJA 3VRAA 2GAGB 3CX8B 3AE5A 3FI7A 3KBUA 2X9WA 3GMIA 3VHLA 1VQWA 1BF3A 3ICRA 3GWDA 5HEHA 3P7IA 1GALA 3FXEB 2CA5A 4CN1A 3CGDA 3V3NA 4AQFA 2PZSA 4QX7B 2IUBA 5L4HA 4YXDA 3L1RA 1LPFA 2WDQA 4QH4A 4NUUA 5ABFB 4I55E 3HYVA 3ZPOA 5AQGB 3CNDA 1D1AA 5H6RB 2VVMA 2V6YA 4H4XA 5HEGA 1W4XA 3UQ4A 3ICTA 1T7SA 2I59A 2CHNA 2VURA 4OPLA 5AQQB 3BNMA 2AAQA 1MNEA 3RP8A 1EL9A 4II2A 1CHUA 4KX6A 3AB3B 4U33A 2GR2A 4D03A 3FZMB 2K24A 1PIV4 1VOMA 5FS9A 5F8PA 5LA6E 3IHGA 3ATRA 4Y4LA 3NK2X 3EHZA 1OEDB 3IEEA 3PVCA 3T8OA 3FBZA 1PO24 1S3EA 1JNZA 3ANWA 3TLTA 2C75A 3CGBA 2UXXB 4KMCA 5KOXA 5LNKA 4U8PA 1ZP0A 3N5LA 3IC9A 1IUSA 2BKPA 5L46A 3F2EA 2XFNA 4HEAA 5M4YA 3GN5A 5HEJA 5BMVE 2GV8A 2W2UA 4UIGA 2QYWA 3P50A 4ZZCA 4I4TE 3CQCB 3AECA 4EMWA 2VRLA 3DP7A 1HYUA 2R6GF 1YXRA 4EYUA 4BK2A 4CN4A 3EAMA 4GYRA 4G6HA 2WQYA 1IBKT 4B3ST 2YU2A 4HGAA 5AQHB 2J3NA 5CFBA 1WFDA 1UUSA 1CJCA 4J33A 2YINA 2CFYA 1PXBA 4MFRA 4GR1A 4KHPT 2BCPA 2W62A 4YT0A 2NW9A 4UR9A 2RGJA 5DJQC 4GDPA 1EBDA 1SUMB 1Y56B 1NPXA 3JBG4 2NOXA 1H8TD 2XSBA 4UVCB 3GMCA 3ZN0B 2XAGB 3BHKA 3GD4A 4J56A 5AQLB 1L0VA 2BACA 2AQJA 4DNDA 1B4VA 3PUGA 4CY6A 2YWLA 2JIWA 2C73A 3AE6A 5LBQB 5BUKA 1IJ5A 3AE7A 2AR8A 4GAVA 4BV6A 1E1KA 3HA4A 4YHJA 5KMRA 1FIOA 1GEUA 3NK1X 1PBDA 5HYAA 5L3CB 1HF8A 3PE0A 3UKFA 2XQ7A 4X62T 2MOZA 1WYBA 1XHXA 2M67A 1R094 3ZKRA 3CPZA 3UT5E 4YFSA 5LYJE 1H7XA 5HHFA 2PYJA 1S2YA 2GR1A 2VQ7A 2NR4A 3AAEB 3NGCX 1J5ET 4B69A 3UP5A 4AKLA 4H4TA 4Z2UA 4TM4A 2HWB4 4AIUA 1MO9A 2MTQA 5ETWA 2Q9QA 4HWFA 2SPCA 1ZMDA 3AB1A 4J31A 4X9NA 4K5RA 3AE3A 3SM8A 4B68A 3KV9A 4JI2T 4RG4A 1EZ3A 3ALJA 3N9OA 2JB3A 2VVSA 1D0XA 3UULA 3Q6JA 2JK6A 4DR3T 2C64A 1XDPA 5HXSA 3WAJA 4ZOLE 3CGCA 3ALMA 3KV4A 1KSUA 4H4WA 3VQRA 3DA1A 4H2QA 4JI6T 2PJQA 3AYIA 2RS14 3ALLA 2WAUA 3S5WA 1W9RA 1S35A 1KDGA 2DLRA 3B13A 2WB5A 1FL2A 1VBD4 5ABEA 2VL0A 2IIDA 2VRMA 4EB6E 2W61A 3SFDA 3RGLA 4OPUA 3ADAB 4GF7A 4J2WA 2YLTA 4NIQA 2BCGG 5IHYA 4NXNT 4NWZA 4NUVA 1RUF4 1RVF4 4IGUA 4COFA 1XHZA 1G73A 4B3MT 5L3BB 3H3MA 1BZLA 4U2TA 3UTHA 1X79A 4KUMB 3KFWX 2TMDA 1FEBA 1OEDE 2IHR1 2C3DA 3OC4A 4U3CA 1QLBA 4AT2A 4X5TA 3QSSA 3JC6D 3OKQA 2VVNA 2XVHA 3E0ZA 4U2SA 2WY2A 3UKLA 2BVLA 4BK1A 3KU9A 4ICYA 3ISHA 3ZMVB 2PYLA 5M10A 2BG9E 2IVEA 3SYIA 2BC1A 5JH7E 1FMWA 2IDOB 3Q9DA 2X50A 2E9XA 2Y6RA 2WOWA 4IHJE 1NG3A 4Q4V4 5FNVE 4AOXA 1QUUA 3QNUA 1PDHA 3NYCA 3T0KA 5CKUA 4C90A 2ZM2A 1US7B 3L8RA 1FCDA 2VOUA 1XNQT 3LZWA 4UDQA 4CCRA 5IPYA 2LSYA 3CMMA 3NWIA 2BC0A 1NENA 4OHFA 2BKOA 4UV8B 4DR5T 4ZI7E 4RSLA 1CL0A 2WWUA 1KEYA 2LKGA 1WLXA 1RUD4 3DGHA 3SZWA 2LLYA 1COV4 2WPFA 1UGOA 1AL24 3GD3A 4TWDA 2DCFA 5AQOB 3K1SA 2XFPA 4AP1A 4Z2TA 1RUI4 3O0HA 3SZ0A 4X64T 2YDRA 4YSHA 2VVLG 3BQIA 4DR6T 4LMJA 4JI4T 3KVEA 2JQHA 4ZEYA 5ADXL 5AQFB 3PUYF 2E1MA 1B8SA 1F8WA 5JCMA 1AR94 4A6NB 3PUAA 2AE9A 4ADWA 4H4SA 2WSSV 1H86A 1B5QA 1IUTA 3UTKA 3IA3A 4UXNB 3OJAA 3QFBA 5DABA 3AVSA 1VRBA 1P2EA 2KWIB 4U8JA 2ZZCA 4G6GA 4B64A 4DV4T 2A87A 2YLZA 3BK9A 3LJCA 3Q5EA 5IQ1A 5U63A 3NK0X 5BR8T 4EMJA 4CXXA 5C3JA 3I0QA 3RIUC 4DVDA 3P4SA 3NRNA 2C65A 1YQZA 3L3PA 2Y8DA 2FUPA 3M3ZB 5A1LA 2XFUA 4I43B 2ZMAA 3C64A 3P4QA 1LVLA 3H3AA 2L8KA 2CLYB 2FJBA 4TNVA 3TLUA 5LMNT 2XAJB 2D0TA 4U8MA 3ZJ1A 5U1OA 2ZM8A 5FP3A 5FVLA 2OLOA 4WW0A 4HTEA 1JU2A 1JRXA 3UOVA 4HWDA 3DJJA 3UU5A 1EL8A 1MXTA 3D1CA 1RHI4 4TV9E 2YG4A 2X0LB 5JR9A 5FS8A 2EHOA 4TLZA 3ZT7A 3N2GE 3JSKA 1YKHB 1XANA 3VR8A 2XAFB 4HWHA 2CVJA 2C5KT 3ZEFB 2YDSA 3F57A 4JI1T 4IV9A 4J36A 1EV14 5EK4A 1CJ2A 3SUCA 4DGKA 2H7VC 2J4GA 2XM1A 2X9YA 4O4LE 4H9NC 4O2BE 1J5WA 1BR2A 3NKZA 4M1PA 1TDEA 3GMBA 3RIUA 3EDVA 2XQ6A 5LB7B 4EQRA 4EAHA 4Q4Y4 3GRSA 1XMQT 2CBJA 3VRDB 1AR64 4XAXB 4TM1A 2VB6A 3JCFA 3CMLA 3ABVA 2Y48B 1KNZA 3ZT6A 1ZKEA 4LF8T 1HG5A 5DBJA 1MQTD 4EGWA 2C5IT 1H6VA 1WRDA 5F3JA 2XQ9A 1T8BA 1PXAA 2W0HA 1BR4A 1O94A 3CNPA 1YW0A 3RC3A 4C91A 4LF5T 2DL1A 4IL9A 1M7KA 2Q6UA 2VKDA 3ZC0A 4NXMT 1E1LA 3Q5DA 3ZC1A 2YG3A 2OLNA 2K3WA 5LV9A 1HX1B 3NN6X 2OLTA 2RS34 3DJDA 3PJAA 4JDRA 3AE9A 1MOKA 2C76A 2XVJA 5EB5A 1BGJA 4AXPA 2ACXA 2B9WA 5FS6A 5GRTA 1D1CA 4JN9A 1VBE4 3O1IA 4IE5A 4X65T 1H81A 3KV5A 1PVC4 5LGTB 5GSNA 4MBQA 2H7OA 5FL1A 2WBAA 1F3PA 4II3A 3IBPA 3NLCA 2E8IA 1DJQA 5JRCB 3SOLA 5JDQA 3KA7A 2WZHA 4C5OA 3J8F4 3Q2MA 2XLTA 3RLFF 3P1WA 4NTCA 5AQJB 1GRTA 1RYIA 2XLPA 4OPGA 3SXIA 1D0ZA 4L9IA 3NN0X 4LA1A 3SFEA 5AQRB 5JR9B 1BR1A 5EK2A 1FMVA 4HWIB 5FXVA 5AQVB 3N9PA 5AQKB 1RP0A 4JI3T 3I9YA 4X1IE 4BJNA 2A3DA 3BI4A 2XQ3A 3RP6A 1S3BA 4DR7T 4JBWF 2BRYA 3E08A 3S4UA 2VQBA 3A8YC 4GYSA 3EF6A 3ZSSA 1NA1D 3A7MA 2PHHA 2R074 3RPUA 4Z91A 5FXWA 3GYXA 4ASKA 2BS4A 3S61A 3PDYA 4H4QA 4PW8A 2XVFA 3CKDA 2XAQB 4H63H 2NP9A 2NVKX 4JI8T 1ZOYA 4K0UA 5HCJA 5LJNA 1ZEEA 4EQWA 2VQET 2XAHB 5DQVA 4LF6T 4BJMA 4IVOB 4EM4A 4DBQA 4X66T 3NH3X 1IZNB 3SZCA 2V5CA 3RKGA 4F8HA 4OFZA 2MYSA 5KX5E 3NT6A 1WYCA 2M6BA 3CTYA 1E1NA 5EK3A 1E7PA 2R46A 4AKGA 4GUVA 2PBIA 1MIVA 3PTRB 4OK0A 3T2ZA 1AR74 2HH7A 2HN2A 3M12A 1D0YA 3ZMSB 3ZSTA 4AKIA 3DJGX 2BS2A 4GK5E 4JNAA 3RKOA 1D7LA 1HR0T 4I0UA 3G5QA 2ODVA 3PUVF 1CBOA 5LXTE 4U8LA 1LJ1A 2YM2A 3CNSA 4ANJA 3UKQA 2R9ZA 1FECA 4BA9A 3B5MA 3KDSE 1O3XA 3V3OA 5KDMC 4PFOA 4Z24A 2JRKA 2WETA 3ZDNA 4BJYA 4Z90A 1TDOA 3K3NA 1FOHA 4ILCA 4X9MA 1LV0A 3ETVA 3LOVA 3ZYMA 3V5UA 4LU6A 2BBHA 3BQLA 1YKEB 1GRFA 2WCAA 4H4ZA 3O1JA 5LHHB 3AA6B 5ABFA 3JD74 3LG7A 3R6NA 1CC2A 4JNQA 3AXBA 3CIRA 1ZY8A 4WBOA 4YKFA 2N1GA 3EABA 3B57A 3UKHA 4DV2T 4PJLA 2WP5A 2YVFA 3O4XE 4XWZA 3P4WA 4DV3T 1DJNA 4B65A 1PBFA 3RYFE 2X0YA 1B37A 3VRBA 1MMDA 3OYXA 2H89A 4H4RA 4IVMB 4KI0F 4Z8XA 3RYCE 1V9DA 1R084 5KMSA 3RC8A 2XJ7A 4ZZBA 3ETUA 3DH9A 1N33T 4U72A 4HFIA 5HXHA 3RI5A 3BQKA 1R8IA 3UCLA 4O2AE 2X8GA 4USQA 5CB4E 2X66A 1MMGA 4TWHA 2EQ9A 4ERRA 2CRBA 2KWHA 3SZFA 1PS9A 2LRKA 1RSGA 4H2PA 1BEV4 1PO14 5JDHA 2RPAA 2ZBWA 4AOSA 3RRWA 3FMWA 3C96A 4J2CA 2GEWA 4YKGA 4GB34 3KPFA 2XVEA 2W63A 3LFMA 5HWXA 2XM2A 4DV7T 2YR6A 1Y56A 2V3AA 3HKDE 3K7TA 2XFOA 4P0BA 5FXZA 3PURA 2RA1A 2A2FX 1RUH4 2BXSA 1Z6LA 5CA0E 3DJEA 5AQUB 3EANA 4WNKA 5J2TE 1FJGT 5HEUA 1LTXR 2XQAA 3PUWF 5KWFA 4U8KA 5IYZE 3F8RA 1OEDA 4EQXA 1W09A 3FIMB 4GOUA 3CPJG 3L8KA 2NTYA 3ZMZB 2YU1A 2DNXA 2YLXA 2ODUA 2IC9A 1ONFA 3NVOA 4K7ZA 4I50E 2UZZA 4CNJA 3ZJ2A 1BWCA 1XPQA 3L09A 2C7GA 1XI1A 1E2AA 2YG6A 2RP4A 4FJOA 1OOPD 4U7YA 1HFAA 3SY4A 1YKJA 1W0AA 4CBQA 2XHEB 5JDMA 2J47A 3I0OA 4LF4T 5HWYA 2WOIA 3T1HT 2B9YA 3K3QC 3QC9A 3RHWA 1TDNA 2XZEA 2JBVA 5L4EA 2D0UA 5BVAA 4ZS3A 2WMNA 2JKCA 1D4M4 2YDQA 2WDVA 5JCIA 5JR9C 3KV6A 1QJDA 2XLSA 2YLSA 5LHIB 4J34A 2YN6A 4ZCDA 3AVRA 2I0ZA 3UKKA 3T37A 4APNA 2UXBT 4IDNA 4EZHA 3UP4A 3RP7A 2W67A 2Q0KA 3MZKB 2IC6A 2W0GA 4XWRA 1GTHA 2ZZ0A 4DSGA 2VKJA 1K0JA 2BRAA 4IA6A 4NNJA 4HWCA 3LK3B 1PHHA 3UU8A 5KMQA 3PS9A 5AQSB 4UF0B 5AQMB 2UXDT 3LDQB 2IW5B 3NZPA 3RX6A 3ZMTB 1NWMX 2YKSA 4ZS2A 1SA0E 2YVGA 3QSEA 5LGNB 1RUE4 2C67A 2VL8A 2EQ7A 5JQGE 1NHQA 2E9XD 3AE8A 4CZZB 2XYOA 5J60A 1IUXA 1NAFA 1KFYA
chains in the Genus database with same CATH topology
1EL8A 1MXTA 3D1CA 1PBCA 2E5VA 1YQ4A 4JY2A 1DODA 2YG4A 5U25A 2R0GA 3NYEA 5FS8A 3UOYA 4YTMA 2ACZA 4FDCB 3P9UA 4TLZA 1GRBA 5C2TA 4E0VA 1DXLA 4UDPA 2JB2A 2V5ZA 3ATQA 3AYLA 3JSKA 4JQ9A 1XANA 1CJ3A 1JEHA 3VR8A 4G9KA 4H7UA 1JRYA 1GPEA 2CVJA 4TLXA 3UKAA 4EIPA 1KNPA 4IV9A 2BABA 4J36A 4BURA 1O5WA 5JCNA 4K22A 1CJ2A 4B1BA 3SUCA 4DGKA 3H8IA 3V76A 2GH5A 2RGOA 1PXCA 1DOEA 4CY8A 1GT8A 1TDEA 3GMBA 2R4EA 3NYFA 4EIQA 3AD8B 1GESA 1O95A 4EQRA 1EL5A 1VDCA 3HYWA 3AWIA 2C72A 3GRTA 4DNAA 2ARDA 1KF6A 3GRSA 2YAUA 4FK1A 2BYBA 2EQ6A 3G5RA 3VRDB 1H83A 4TM1A 1VG0A 4Z43A 3ABVA 3LXDA 3LADA 3VRAA 2GAGB 1ZKQA 3GSIA 3G5SA 3AE5A 4U2LA 5DBJA 2HQMA 4H4PA 5CQFA 1H6VA 3EPTA 2V60A 3GYJA 1VQWA 4J57A 1BF3A 1TRBA 3GWDA 1K0LA 3ICRA 1GALA 3CGDA 3V3NA 3M13A 5KMPA 3AEGA 1PXAA 2W0HA 2B7SA 1O94A 3B3RA 3CNPA 4N9XA 1IJHA 1H7WA 2Q6UA 4YXDA 3L1RA 1LPFA 2WDQA 3NIXA 3DGZA 3HYVA 3P4RA 2X3NA 1E1LA 1K4QA 1TYTA 3CNDA 1OJ9A 2YG3A 3NNEA 2VVMA 2OLNA 1CC4A 2YVJA 3CNJA 4H4YA 4H4XA 5LV9A 4MJWA 3NN6X 1DOBA 3AE4A 1REOA 3DJDA 1W4XA 3K7QX 4JDRA 3ICTA 2GMHA 2X8HA 3UTGA 3AE9A 2QA2A 2RABA 3AE1A 1MOKA 2C76A 2XVJA 4OPLA 5EB5A 3BNMA 1BGJA 2AAQA 1BGNA 5FS6A 2B9WA 1IUVA 2R4JA 4O5QA 5GRTA 1EL9A 4II2A 3RP8A 4JN9A 1CHUA 3UOXA 4KX6A 2YQUA 3DMEA 1ZK7A 1XHCA 1H81A 4D03A 2GR2A 2JAEA 4U8OA 5GSNA 2WBAA 1F3PA 4II3A 5J7XA 3T31A 1ZX9A 2GQFA 3CN8A 3NLCA 4RG3A 5FS9A 3ZYXA 3IHGA 3ATRA 4Y4LA 3T2KA 1DJQA 4NZHA 3D8XA 3KKJA 3NK2X 3PVCA 4Z25A 2JB1A 3KA7A 4A9WA 2WOVA 4H2RA 4C5OA 1S3EA 1JNZA 2V6OA 3URHA 4Z26A 2XLTA 2EQ8A 2C75A 3CGBA 3P1WA 3QJ4A 4Z2RA 4NTCA 4YSYA 1S2QA 1GRTA 5KOXA 1ZDLA 1VG9A 4U8PA 2R0PA 1ZP0A 4OVIA 1RYIA 2XLPA 3IC9A 4OPGA 1IUSA 3SXIA 2A89A 2YG5A 1COYA 3F8DA 3NN0X 4LA1A 3SFEA 4A65A 5L46A 2XFNA 2OAMA 2XLRA 1ZMCA 4LIIA 4C74A 5FMHA 5KVIA 4WCTA 2VZ2A 3NHOX 3B6DA 1NHRA 4C3XA 4KPRA 1GRGA 1L9DA 5BULA 4OPDA 1RP0A 2X8CA 2GV8A 3T2YA 4NTEA 2RGHA 3BI4A 2BA9A 3RP6A 2R0CA 2V3BA 5KOWA 3AECA 2H88A 2C66A 1S3BA 3Q9TA 3QVPA 3UOZA 4EMWA 2VRLA 1HYUA 2BRYA 2C70A 3RNMA 3E1TA 2VQBA 1H84A 3EF6A 2PHHA 1TDKA 2BK5A 5HXIA 4BK2A 2V61A 5KVHA 4G6HA 2WQYA 1N4VA 3GYXA 1Y0PA 2BS4A 3S61A 4NEVA 2J3NA 4H4QA 2XVFA 2DKHA 3CGEA 1CJCA 2YR5A 4J33A 5EBKA 4H4VA 2CFYA 2NVKX 1PXBA 1D4EA 4GR1A 1ZOYA 4D04A 4A5LA 2YG7A 4EQWA 2BCPA 4YT0A 1D4CA 4EM4A 2RGJA 4IVOB 4GDPA 4B67A 3NH3X 3SZCA 4ZN0A 5JCKA 1EBDA 3AD9B 3HZLA 1Y56B 1NPXA 4G74A 3AEDA 1N4WA 3NT6A 3CTYA 4OPCA 3GMCA 1E1NA 2GF3A 3T14A 1E7PA 1IUWA 1TYPA 1NEKA 1K0IA 2R46A 3BHKA 3GD4A 4WX1A 4J56A 5EB4A 1L0VA 4GUVA 2BACA 2AQJA 3T2ZA 1PN0A 2GR0A 1M64A 3M12A 3AEAA 1B4VA 2Y6QA 2WPEA 5KXJA 3DJGX 3KLJA 2BS2A 4Y4NA 3BI5A 4CY6A 2YWLA 3AEFA 3AE6A 2C73A 4JNAA 1D7LA 3G5QA 1CBOA 4U8LA 2GQWA 5BUKA 3AE7A 2AR8A 3CPHG 4GAVA 1LJ1A 2YM2A 3CNSA 4BV6A 3UKQA 2R9ZA 3BI2A 2CDUA 1E1KA 1FECA 1PBEA 5KMRA 1GERA 1GEUA 4TM3A 3NK1X 3RHAA 3ICSA 3V3OA 3AEBA 1PBDA 1EL7A 3WE0A 4HB9A 4Z24A 4U8IA 3AYJA 2PYXA 3UKFA 3NKSA 2Q0LA 1E39A 2E4GA 2WETA 3ZDNA 4BJYA 4NTDA 4GAPA 1TDOA 1FOHA 4X9MA 4YSZA 1LV0A 1F6MA 1NG4A 1H7XA 5HHFA 3EAOA 3LOVA 1S2YA 2GR1A 2VQ7A 4UP3A 1DOCA 3NGCX 1NHPA 3GQHA 2C4CA 3NG7X 4LU6A 2VVLA 3AE2A 1GRFA 2QAEA 4H4ZA 3KD9A 4B69A 3UP5A 1GV4A 4H4TA 1V59A 2GMJA 4Z2UA 4TM4A 1L9EA 2YM1A 1MO9A 3F8PA 4FX9A 4UDRA 2WU2A 3SX6A 1CC2A 1GRAA 1JRZA 1OJAA 1ZMDA 3AB1A 4J31A 4JNQA 1NAAA 4X9NA 4K5RA 3AXBA 3AE3A 3CIRA 1ZY8A 3SM8A 4IA5A 4B68A 4YKFA 4RG4A 3REDA 2WEUA 5KRQA 3ALJA 1VRQB 1FEAA 4B66A 2JB3A 2WPCA 2WS3A 1Q1RA 3Q6JA 3UKHA 2JK6A 4YTPA 2C64A 2WP5A 1CC6A 2YVFA 1UKVG 4XWZA 3CGCA 1DJNA 4B65A 3ALMA 1PBFA 4H4UA 2GR3A 1KSUA 4H4WA 3VQRA 3DA1A 2BK3A 1B37A 4H2QA 4EQSA 3AYIA 3VRBA 3ALLA 3S5WA 2TPRA 4EMIA 2H89A 4H4RA 1KDGA 4IVMB 4ECHA 1YY5A 1FL2A 5KMSA 5EOWA 2XCGA 1M6IA 3K7MX 4A7AA 4YSXA 3BNUA 2IIDA 3I3LA 2VRMA 3DH9A 2WDRA 4C3YA 3LZXA 3SFDA 1GOSA 2FJDA 1BKWA 4OPUA 2YLRA 3ADAB 4GF7A 1GXFA 4J2WA 2YLTA 4Z44A 1GRHA 1PBBA 2BCGG 4XXGA 3UCLA 2CULA 3I6DA 3VR9A 4NWZA 2X8GA 1GREA 4USQA 3DK8A 2EQ9A 3FBSA 1XDIA 3M0OA 2WP9A 1BZLA 3SZFA 4U2TA 3GYIA 1PS9A 3UTHA 2B9XA 1LQTA 2YR4A 1ELIA 2TMDA 1FEBA 2FBWA 1CJ4A 2WESA 2OALA 2C3DA 3OC4A 1RSGA 3ITJA 4H2PA 1QLBA 1NHSA 3COXA 4AT2A 3C4AA 3QSSA 2ZBWA 1PJ6A 3R9UA 4AOSA 2XVHA 3FMWA 1PJ5A 3C96A 2DKIA 1CF3A 3HYXA 3UTFA 4U2SA 1YQ3A 2GEWA 4YKGA 3UKLA 3IHMA 3KPFA 2A8XA 4BK1A 2XVEA 3KU9A 4O5UA 4OCGA 1E6EA 4H2NA 1KSSA 1QO8A 1ZOVA 4I59A 2FJEA 4ICYA 4A99A 2ZZBA 1D4DA 2YR6A 3GDPA 3ISHA 1Y56A 2C3CA 2V3AA 4H50A 3IWAA 5M10A 3K7TA 3KPKA 4GCMA 1OJDA 2IVEA 2XFOA 3SYIA 3UTEA 3DK9A 3NTDA 2BC1A 1F8SA 2QA1A 1N4UA 2BXRA 4K5SA 2X50A 1GTEA 2BK4A 2BXSA 1Z6LA 4B63A 2Y6RA 3DJEA 2WOWA 1D7YA 3EANA 4BK3A 3CNTA 1NG3A 3OZ2A 2IVDA 4AP3A 4K8DA 4BJZA 4AOXA 4C77A 3H8LA 1LTXR 1PDHA 4P9SA 2XLUA 3NYCA 4YWOA 3T0KA 5KWFA 5CKUA 5HYMA 1X31B 2VOUA 1FCDA 4CCQA 3H4KA 1AOGA 4U8KA 3C4NA 3LZWA 4REKA 4UDQA 3F8RA 4CCRA 5IPYA 3CMMA 3QVRA 4EQXA 3FIMB 3CPJG 3L8KA 4CNKA 2BC0A 1NENA 2XVIA 4CRTA 4RSLA 1CL0A 5TR3A 3P4PA 2YLXA 1NDAA 4M52A 1PJ7A 1ONFA 3DGHA 3QSMA 2Q7VA 4K7ZA 3SZWA 2GAHB 2O9ZA 2WPFA 1H82A 2QCUA 2UZZA 4CNJA 3GD3A 1GNDA 2NPXA 2XFPA 4AP1A 2Z5YA 4Z2TA 2XFQA 5IQ4A 1TDFA 1BWCA 3NTAA 1XPQA 3O0HA 3SZ0A 4EM3A 2C7GA 2YG6A 4X4JA 4DSHA 4YSHA 3QFAA 2VVLG 3SY4A 3AEEA 4HA6A 1YKJA 4OPIA 2WP6A 1SEZA 5M0ZA 4CBQA 2OA1A 3KVEA 5KNLA 4G73A 2E1MA 1JNRA 4GRTA 1B8SA 1F8WA 2WOIA 5JCMA 4PAAA 3GQKA 2F5ZA 1OJCA 3GDNA 2B9YA 2Z5XA 4A6NB 1N1PA 4I58A 4A6NA 4ADWA 4ZCCA 1F8RA 4H4SA 1TDNA 3SQPA 4AT0A 4YTNA 2JBVA 1H86A 3FG2P 5BVAA 1B5QA 1IUTA 2YLWA 4FK1C 2JKCA 1Q9IA 3II4A 4GDEA 3QFBA 2WDVA 5JCIA 3UKPA 1GSNA 1QJDA 2XLSA 2YLSA 4OPTA 1OJTA 1KNRA 1P2EA 4U8JA 2ZZCA 4J34A 3K30A 4ZCDA 2GVCA 1L9CA 5BRTA 5JCLA 4G6GA 1DNCA 2I0ZA 3UKKA 4B64A 1Q1WA 3T37A 4APNA 2LFCA 2A87A 5FS7A 2YLZA 1IUUA 2R45A 3CPIG 5IQ1A 4USRA 3UP4A 5U63A 2B7RA 2Q0KA 2X99A 3NK0X 3RP7A 4JY3A 1P2HA 4XWRA 1GTHA 2ZZ0A 4DSGA 4EMJA 1K0JA 2BRAA 4IA6A 2GRTA 5C3JA 4NNJA 1PHHA 1LQUA 4A79A 3P4SA 2GB0A 3NRNA 2WHDA 2C65A 3AD7B 4TM0A 5KMQA 3LJPA 1YQZA 3IF9A 3PS9A 3BHFA 2XFUA 2APGA 3P4QA 1JOAA 1LVLA 3PO7A 5ER0A 2FJAA 3DK4A 3SGLA 3GWFA 2FJBA 4K2XA 2YVGA 2XDOA 3QSEA 2C67A 1D5TA 1E1MA 2EQ7A 4Y4MA 4U8MA 5U1OA 2WU5A 5HY5A 2OLOA 1JU2A 3LB8A 1JRXA 1NHQA 3FPZA 3UOVA 3AE8A 2XYOA 2B76A 5J60A 1IUXA 3DJJA 1GETA 2BS3A 4NEWA 4PABA 1KFYA 4U8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL8 A;  1MXT A;  3D1C A;  1PBC A;  2E5V A;  1YQ4 A;  4JY2 A;  1DOD A;  2YG4 A;  5U25 A;  2R0G A;  3NYE A;  5FS8 A;  3UOY A;  4YTM A;  2ACZ A;  4FDC B;  3P9U A;  4TLZ A;  1GRB A;  5C2T A;  4E0V A;  1DXL A;  4UDP A;  2JB2 A;  2V5Z A;  3ATQ A;  3AYL A;  3JSK A;  4JQ9 A;  1XAN A;  1CJ3 A;  1JEH A;  3VR8 A;  4H7U A;  1JRY A;  1GPE A;  2CVJ A;  4TLX A;  3UKA A;  4EIP A;  1KNP A;  4IV9 A;  2BAB A;  4J36 A;  4BUR A;  1O5W A;  5JCN A;  4K22 A;  1CJ2 A;  4B1B A;  3SUC A;  4DGK A;  3H8I A;  3V76 A;  2GH5 A;  2RGO A;  1PXC A;  1DOE A;  4CY8 A;  1GT8 A;  1TDE A;  3GMB A;  2R4E A;  3NYF A;  4EIQ A;  3AD8 B;  1GES A;  1O95 A;  4EQR A;  1EL5 A;  1VDC A;  3AWI A;  2C72 A;  3GRT A;  4DNA A;  2ARD A;  1KF6 A;  3GRS A;  2YAU A;  4FK1 A;  2BYB A;  2EQ6 A;  3G5R A;  3VRD B;  1H83 A;  4TM1 A;  1VG0 A;  4Z43 A;  3ABV A;  3LXD A;  3LAD A;  3VRA A;  2GAG B;  1ZKQ A;  3GSI A;  3G5S A;  3AE5 A;  4U2L A;  5DBJ A;  2HQM A;  4H4P A;  5CQF A;  1H6V A;  3EPT A;  2V60 A;  3GYJ A;  1VQW A;  4J57 A;  1BF3 A;  1TRB A;  3GWD A;  1K0L A;  3ICR A;  1GAL A;  3CGD A;  3V3N A;  3M13 A;  3AEG A;  1PXA A;  2W0H A;  2B7S A;  1O94 A;  3B3R A;  3CNP A;  4N9X A;  1IJH A;  1H7W A;  2Q6U A;  4YXD A;  3L1R A;  1LPF A;  2WDQ A;  3NIX A;  3DGZ A;  3P4R A;  2X3N A;  1E1L A;  1K4Q A;  1TYT A;  3CND A;  1OJ9 A;  2YG3 A;  3NNE A;  2VVM A;  2OLN A;  1CC4 A;  2YVJ A;  3CNJ A;  4H4Y A;  4H4X A;  5LV9 A;  4MJW A;  3NN6 X;  1DOB A;  3AE4 A;  1REO A;  3DJD A;  1W4X A;  3K7Q X;  4JDR A;  3ICT A;  2GMH A;  2X8H A;  3UTG A;  3AE9 A;  2QA2 A;  2RAB A;  3AE1 A;  1MOK A;  2C76 A;  2XVJ A;  4OPL A;  5EB5 A;  3BNM A;  1BGJ A;  2AAQ A;  1BGN A;  5FS6 A;  2B9W A;  1IUV A;  2R4J A;  4O5Q A;  5GRT A;  1EL9 A;  3RP8 A;  4JN9 A;  1CHU A;  3UOX A;  4KX6 A;  2YQU A;  3DME A;  1ZK7 A;  1XHC A;  1H81 A;  4D03 A;  2GR2 A;  2JAE A;  4U8O A;  5GSN A;  2WBA A;  1F3P A;  5J7X A;  1ZX9 A;  2GQF A;  3CN8 A;  3NLC A;  4RG3 A;  5FS9 A;  3ZYX A;  3IHG A;  3ATR A;  4Y4L A;  1DJQ A;  4NZH A;  3D8X A;  3KKJ A;  3NK2 X;  3PVC A;  4Z25 A;  2JB1 A;  3KA7 A;  4A9W A;  2WOV A;  4H2R A;  4C5O A;  1S3E A;  1JNZ A;  2V6O A;  3URH A;  4Z26 A;  2XLT A;  2EQ8 A;  2C75 A;  3CGB A;  3P1W A;  3QJ4 A;  4Z2R A;  4NTC A;  4YSY A;  1S2Q A;  1GRT A;  5KOX A;  1ZDL A;  1VG9 A;  4U8P A;  2R0P A;  1ZP0 A;  4OVI A;  1RYI A;  2XLP A;  3IC9 A;  4OPG A;  1IUS A;  2A89 A;  2YG5 A;  1COY A;  3F8D A;  3NN0 X;  4LA1 A;  3SFE A;  4A65 A;  5L46 A;  2XFN A;  2OAM A;  2XLR A;  1ZMC A;  4LII A;  4C74 A;  5FMH A;  5KVI A;  4WCT A;  2VZ2 A;  3NHO X;  3B6D A;  1NHR A;  4C3X A;  4KPR A;  1GRG A;  1L9D A;  5BUL A;  4OPD A;  1RP0 A;  2X8C A;  2GV8 A;  4NTE A;  2RGH A;  3BI4 A;  2BA9 A;  3RP6 A;  2R0C A;  2V3B A;  5KOW A;  3AEC A;  2H88 A;  2C66 A;  1S3B A;  3Q9T A;  3QVP A;  3UOZ A;  4EMW A;  2VRL A;  1HYU A;  2C70 A;  3RNM A;  3E1T A;  2VQB A;  1H84 A;  3EF6 A;  2PHH A;  1TDK A;  2BK5 A;  5HXI A;  4BK2 A;  2V61 A;  5KVH A;  2WQY A;  1N4V A;  3GYX A;  1Y0P A;  2BS4 A;  3S61 A;  4NEV A;  2J3N A;  4H4Q A;  2XVF A;  2DKH A;  3CGE A;  1CJC A;  2YR5 A;  4J33 A;  5EBK A;  4H4V A;  2CFY A;  2NVK X;  1PXB A;  1D4E A;  4GR1 A;  1ZOY A;  4D04 A;  4A5L A;  2YG7 A;  4EQW A;  2BCP A;  4YT0 A;  1D4C A;  4EM4 A;  2RGJ A;  4IVO B;  4GDP A;  4B67 A;  3NH3 X;  4ZN0 A;  5JCK A;  1EBD A;  3AD9 B;  3HZL A;  1Y56 B;  1NPX A;  3AED A;  1N4W A;  3NT6 A;  3CTY A;  4OPC A;  3GMC A;  1E1N A;  2GF3 A;  1E7P A;  1IUW A;  1TYP A;  1NEK A;  1K0I A;  2R46 A;  3BHK A;  3GD4 A;  4WX1 A;  4J56 A;  5EB4 A;  1L0V A;  4GUV A;  2BAC A;  2AQJ A;  1PN0 A;  2GR0 A;  1M64 A;  3M12 A;  3AEA A;  1B4V A;  2Y6Q A;  2WPE A;  5KXJ A;  3DJG X;  3KLJ A;  2BS2 A;  4Y4N A;  3BI5 A;  4CY6 A;  2YWL A;  3AEF A;  3AE6 A;  2C73 A;  4JNA A;  1D7L A;  3G5Q A;  1CBO A;  4U8L A;  2GQW A;  5BUK A;  3AE7 A;  2AR8 A;  3CPH G;  1LJ1 A;  2YM2 A;  3CNS A;  4BV6 A;  3UKQ A;  2R9Z A;  3BI2 A;  2CDU A;  1E1K A;  1FEC A;  1PBE A;  1GER A;  1GEU A;  4TM3 A;  3NK1 X;  3RHA A;  3ICS A;  3V3O A;  3AEB A;  1PBD A;  1EL7 A;  3WE0 A;  4HB9 A;  4Z24 A;  4U8I A;  3AYJ A;  2PYX A;  3UKF A;  3NKS A;  2Q0L A;  1E39 A;  2E4G A;  2WET A;  3ZDN A;  4BJY A;  4NTD A;  1TDO A;  1FOH A;  4X9M A;  4YSZ A;  1LV0 A;  1F6M A;  1NG4 A;  1H7X A;  5HHF A;  3EAO A;  3LOV A;  1S2Y A;  2GR1 A;  2VQ7 A;  4UP3 A;  1DOC A;  3NGC X;  1NHP A;  3GQH A;  3NG7 X;  4LU6 A;  2VVL A;  3AE2 A;  1GRF A;  2QAE A;  4H4Z A;  3KD9 A;  4B69 A;  3UP5 A;  1GV4 A;  4H4T A;  1V59 A;  2GMJ A;  4Z2U A;  4TM4 A;  1L9E A;  2YM1 A;  1MO9 A;  3F8P A;  4FX9 A;  4UDR A;  2WU2 A;  1CC2 A;  1GRA A;  1JRZ A;  1OJA A;  1ZMD A;  3AB1 A;  4J31 A;  4JNQ A;  1NAA A;  4X9N A;  4K5R A;  3AXB A;  3AE3 A;  3CIR A;  1ZY8 A;  3SM8 A;  4IA5 A;  4B68 A;  4YKF A;  4RG4 A;  3RED A;  2WEU A;  5KRQ A;  3ALJ A;  1VRQ B;  1FEA A;  4B66 A;  2JB3 A;  2WPC A;  2WS3 A;  1Q1R A;  3Q6J A;  3UKH A;  2JK6 A;  4YTP A;  2C64 A;  2WP5 A;  1CC6 A;  2YVF A;  1UKV G;  4XWZ A;  3CGC A;  1DJN A;  4B65 A;  3ALM A;  1PBF A;  4H4U A;  2GR3 A;  1KSU A;  4H4W A;  3VQR A;  3DA1 A;  2BK3 A;  1B37 A;  4H2Q A;  4EQS A;  3AYI A;  3VRB A;  3ALL A;  3S5W A;  2TPR A;  4EMI A;  2H89 A;  4H4R A;  1KDG A;  4IVM B;  4ECH A;  1YY5 A;  1FL2 A;  5EOW A;  2XCG A;  1M6I A;  3K7M X;  4A7A A;  4YSX A;  3BNU A;  2IID A;  3I3L A;  2VRM A;  3DH9 A;  2WDR A;  4C3Y A;  3LZX A;  3SFD A;  1GOS A;  2FJD A;  1BKW A;  4OPU A;  2YLR A;  3ADA B;  4GF7 A;  1GXF A;  4J2W A;  2YLT A;  4Z44 A;  1GRH A;  1PBB A;  2BCG G;  4XXG A;  3UCL A;  2CUL A;  3I6D A;  3VR9 A;  2X8G A;  1GRE A;  4USQ A;  3DK8 A;  2EQ9 A;  3FBS A;  1XDI A;  3M0O A;  2WP9 A;  1BZL A;  4U2T A;  3GYI A;  1PS9 A;  3UTH A;  2B9X A;  1LQT A;  2YR4 A;  1ELI A;  2TMD A;  1FEB A;  2FBW A;  1CJ4 A;  2WES A;  2OAL A;  2C3D A;  3OC4 A;  1RSG A;  3ITJ A;  4H2P A;  1QLB A;  1NHS A;  3COX A;  4AT2 A;  3C4A A;  3QSS A;  2ZBW A;  1PJ6 A;  3R9U A;  4AOS A;  2XVH A;  3FMW A;  1PJ5 A;  3C96 A;  2DKI A;  1CF3 A;  3UTF A;  4U2S A;  1YQ3 A;  2GEW A;  4YKG A;  3UKL A;  3IHM A;  3KPF A;  2A8X A;  4BK1 A;  2XVE A;  3KU9 A;  4O5U A;  4OCG A;  1E6E A;  4H2N A;  1KSS A;  1QO8 A;  1ZOV A;  4I59 A;  2FJE A;  4ICY A;  4A99 A;  2ZZB A;  1D4D A;  2YR6 A;  3GDP A;  3ISH A;  1Y56 A;  2C3C A;  2V3A A;  4H50 A;  3IWA A;  5M10 A;  3K7T A;  4GCM A;  1OJD A;  2IVE A;  2XFO A;  3UTE A;  3DK9 A;  3NTD A;  2BC1 A;  1F8S A;  2QA1 A;  1N4U A;  2BXR A;  4K5S A;  2X50 A;  1GTE A;  2BK4 A;  2BXS A;  1Z6L A;  4B63 A;  2Y6R A;  3DJE A;  2WOW A;  1D7Y A;  3EAN A;  4BK3 A;  3CNT A;  1NG3 A;  3OZ2 A;  2IVD A;  4AP3 A;  4K8D A;  4BJZ A;  4AOX A;  4C77 A;  3H8L A;  1LTX R;  1PDH A;  4P9S A;  2XLU A;  3NYC A;  4YWO A;  5KWF A;  5CKU A;  5HYM A;  1X31 B;  2VOU A;  1FCD A;  4CCQ A;  3H4K A;  1AOG A;  4U8K A;  3C4N A;  3LZW A;  4REK A;  4UDQ A;  3F8R A;  4CCR A;  5IPY A;  3QVR A;  4EQX A;  3FIM B;  3CPJ G;  3L8K A;  4CNK A;  2BC0 A;  1NEN A;  2XVI A;  4CRT A;  4RSL A;  1CL0 A;  5TR3 A;  3P4P A;  2YLX A;  1NDA A;  4M52 A;  1PJ7 A;  1ONF A;  3DGH A;  3QSM A;  2Q7V A;  4K7Z A;  2GAH B;  2O9Z A;  2WPF A;  1H82 A;  2QCU A;  2UZZ A;  4CNJ A;  3GD3 A;  1GND A;  2NPX A;  2XFP A;  4AP1 A;  2Z5Y A;  4Z2T A;  2XFQ A;  5IQ4 A;  1TDF A;  1BWC A;  3NTA A;  1XPQ A;  3O0H A;  4EM3 A;  2C7G A;  2YG6 A;  4X4J A;  4DSH A;  4YSH A;  3QFA A;  2VVL G;  3AEE A;  4HA6 A;  1YKJ A;  4OPI A;  2WP6 A;  1SEZ A;  5M0Z A;  4CBQ A;  2OA1 A;  3KVE A;  2E1M A;  1JNR A;  4GRT A;  1B8S A;  1F8W A;  2WOI A;  5JCM A;  4PAA A;  3GQK A;  2F5Z A;  1OJC A;  3GDN A;  2B9Y A;  2Z5X A;  4A6N B;  1N1P A;  4I58 A;  4A6N A;  4ADW A;  4ZCC A;  1F8R A;  4H4S A;  1TDN A;  3SQP A;  4AT0 A;  4YTN A;  2JBV A;  1H86 A;  3FG2 P;  5BVA A;  1B5Q A;  1IUT A;  2YLW A;  4FK1 C;  2JKC A;  1Q9I A;  3II4 A;  4GDE A;  3QFB A;  2WDV A;  5JCI A;  3UKP A;  1GSN A;  1QJD A;  2XLS A;  2YLS A;  4OPT A;  1OJT A;  1KNR A;  1P2E A;  4U8J A;  2ZZC A;  4J34 A;  3K30 A;  4ZCD A;  2GVC A;  1L9C A;  5BRT A;  5JCL A;  1DNC A;  2I0Z A;  3UKK A;  4B64 A;  1Q1W A;  3T37 A;  4APN A;  2LFC A;  2A87 A;  5FS7 A;  2YLZ A;  1IUU A;  2R45 A;  3CPI G;  5IQ1 A;  4USR A;  3UP4 A;  5U63 A;  2B7R A;  2Q0K A;  2X99 A;  3NK0 X;  3RP7 A;  4JY3 A;  1P2H A;  4XWR A;  1GTH A;  2ZZ0 A;  4DSG A;  4EMJ A;  1K0J A;  4IA6 A;  2GRT A;  5C3J A;  1PHH A;  1LQU A;  4A79 A;  3P4S A;  2GB0 A;  3NRN A;  2WHD A;  2C65 A;  3AD7 B;  4TM0 A;  3LJP A;  1YQZ A;  3IF9 A;  3PS9 A;  3BHF A;  2XFU A;  2APG A;  3P4Q A;  1JOA A;  1LVL A;  3PO7 A;  5ER0 A;  2FJA A;  3DK4 A;  3SGL A;  3GWF A;  2FJB A;  4K2X A;  2YVG A;  2XDO A;  3QSE A;  2C67 A;  1D5T A;  1E1M A;  2EQ7 A;  4Y4M A;  4U8M A;  5U1O A;  2WU5 A;  5HY5 A;  2OLO A;  1JU2 A;  3LB8 A;  1JRX A;  1NHQ A;  3FPZ A;  3UOV A;  3AE8 A;  2XYO A;  2B76 A;  5J60 A;  1IUX A;  3DJJ A;  1GET A;  2BS3 A;  4NEW A;  4PAB A;  1KFY A;  4U8N A; 
#chains in the Genus database with same CATH topology
 3PUQ A;  4O4H E;  4JY2 A;  5LP6 E;  2E5L T;  2DWK A;  4IRE A;  2BZB A;  1HCI A;  4FDC B;  1GRB A;  5C2T A;  5FVK A;  2JB2 A;  2V5Z A;  4JQ9 A;  3AYL A;  1CJ3 A;  5L47 A;  1JEH A;  3RYI E;  4HKA A;  1GPE A;  3UKA A;  4ZI3 D;  4EZ4 A;  2P9B A;  1HNW T;  5JCN A;  4LFB T;  3H8I A;  3V76 A;  4GKJ T;  3TLV A;  1DOE A;  4IE7 A;  4DID B;  3K3O A;  3NYF A;  4P1N A;  4EIQ A;  1GES A;  1O95 A;  1M62 A;  3AWI A;  2ARD A;  2L9Q A;  2CLY C;  4EXT A;  2EQ6 A;  1H83 A;  3PUX F;  3V5S A;  2KZ7 B;  3T1Y T;  1Z0P A;  2QA7 A;  3LAD A;  1VBA 4;  3GSI A;  3G5S A;  5E0O A;  4U2L A;  4H4P A;  5CQF A;  3W15 B;  2R04 4;  3P8C D;  2V1D B;  4DO0 A;  3E22 E;  5GON E;  3GYJ A;  1TRB A;  3M13 A;  3AEG A;  3B3R A;  4B3T T;  4QXC B;  4G63 A;  2X67 A;  2LSK A;  1UK5 A;  2X0H A;  4L5G A;  3P4R A;  2WM9 A;  1OJ9 A;  2YVJ A;  4H4Y A;  3RIF A;  4MJW A;  2V7L A;  2VKH A;  3K7Q X;  3AE4 A;  3GN5 B;  3MKD A;  4OYJ A;  2GMH A;  2QA2 A;  2RAB A;  3MA9 A;  3J7Y q;  4AQG A;  1BGN A;  2YQU A;  2N2N A;  1XHC A;  2C0S A;  3A5X A;  4U8O A;  3ONJ A;  2YOE A;  5L3E B;  5J7X A;  2LKH A;  3ZLI A;  3T31 A;  3CN8 A;  3T2K A;  2YEV C;  3N9M A;  2LT3 A;  4CQI A;  3D8X A;  1HX8 A;  3KKJ A;  4Z25 A;  4A9W A;  4H2R A;  4JI0 T;  2V6O A;  5TAO A;  4Z26 A;  1VCT A;  2EQ8 A;  4Z2R A;  3QJ4 A;  3C98 B;  1N32 T;  4K0K T;  3UUN A;  4QWN B;  2R0P A;  4OVI A;  2LM2 A;  2W4X A;  2YG5 A;  2NWB A;  4EOZ B;  4YJ2 E;  5LG4 A;  2OAM A;  4LII A;  3OBV E;  4ISS A;  5KVI A;  5JDF A;  2VZ2 A;  2ZM0 A;  4N78 D;  4A97 A;  3KBT A;  3JAF A;  1NHR A;  3B6D A;  3NHO X;  4EED A;  1GRG A;  1L9D A;  4OPD A;  3ZYL A;  4NTE A;  5FY1 A;  3LBX B;  3FXD B;  1RMU 4;  2RGH A;  5KOW A;  2R0C A;  2V3B A;  3Q5X A;  4H9P C;  5LJM A;  3UOZ A;  2L3L A;  2C70 A;  1UCU A;  5ABG A;  4DR4 T;  2EHO C;  1TDK A;  2BK5 A;  3ONL C;  2B1E A;  1IBL T;  4KHZ F;  1N4V A;  3CQG B;  1Y0P A;  5AQN B;  4LF7 T;  4LFA T;  3IF8 B;  4QXB B;  3CGE A;  2YR5 A;  2LOP A;  2UUA T;  4H4V A;  5JVD E;  4HFH A;  3ZYK A;  5JDL A;  2YG7 A;  4JEH B;  4DMV A;  2J1D G;  3GA8 A;  4PAG A;  4B67 A;  5JCK A;  2R06 4;  3HZL A;  3AD9 B;  1N4W A;  1AR8 4;  2K5B B;  3CK6 A;  4WZX A;  2UU9 T;  2GF3 A;  3T14 A;  2KSR A;  4GK0 E;  1TYP A;  3N2O A;  1K0I A;  1XWM A;  4DV1 T;  2CWY A;  4LMK A;  1ZV4 X;  2RMU 4;  5L2L A;  1PN0 A;  3AEA A;  4HFE A;  2WPE A;  5KXJ A;  4Y4N A;  3AEF A;  2HHH T;  2CM0 A;  2UXN B;  2W66 A;  4IIJ E;  2GQW A;  3CPH G;  2BG9 A;  5J0Z A;  1XDO A;  2V7J A;  3FZH B;  3M65 A;  1H7C A;  3RH3 A;  4TM3 A;  3RHA A;  2PY5 A;  3C51 A;  5JTG A;  3AEB A;  1EL7 A;  4HB9 A;  3UU6 A;  2PYX A;  1E39 A;  2KXP B;  2E4G A;  1SE7 A;  1F6M A;  1NG4 A;  2Q9Q C;  3SRZ A;  2LRL A;  3NBX X;  4UP3 A;  2JQ9 A;  2NW7 A;  1NHP A;  3Q5W A;  4O4I E;  4JYA T;  4Q4X 4;  2VVL A;  3AE2 A;  3J9X 1;  2BKN A;  2QAE A;  1N36 T;  2WBL A;  2GMJ A;  4PJM A;  1L9E A;  2YM1 A;  3ANW B;  3HKB E;  4YY3 T;  2WU2 A;  2CBI A;  2BBJ A;  1GRA A;  1JRZ A;  4DV6 T;  1OJA A;  1VBB 4;  1NAA A;  4ILB A;  2CXL A;  4X1K E;  4IA5 A;  3OPC A;  3H37 A;  5CA1 E;  5KRQ A;  1VRQ B;  1FEA A;  2KIN B;  2WPC A;  2IIU A;  3FZF B;  4YTP A;  1OWA A;  4PJJ A;  2GR3 A;  2QGS A;  2XSA A;  4EQS A;  4ZXL A;  4EMI A;  2X9X A;  4IE0 A;  1VCS A;  1U4Q A;  4DV5 T;  5EOW A;  3K7M X;  2V26 A;  3I3L A;  4QXH B;  2WDR A;  4U2Z A;  5F5W A;  4C3Y A;  2FJD A;  1BKW A;  3RQW A;  2MAW A;  4MAL A;  4Z44 A;  1Y01 A;  3U78 A;  1PBB A;  2CUL A;  2NTX A;  3I6D A;  1RUC 4;  3VR9 A;  3JC6 C;  5HEO A;  3VKH A;  1GRE A;  3UUX B;  4PDW D;  3DK8 A;  5LG3 A;  3M0O A;  2XY8 B;  3GYI A;  1LQT A;  1ELI A;  4PK5 A;  2FBW A;  4XZC A;  3LSV A;  3NZQ A;  2OAL A;  2XQ5 A;  3COX A;  2VAS A;  3VKG A;  1PJ6 A;  2CHO A;  2DKI A;  1U5P A;  1BR0 A;  3HYX A;  3UTF A;  5JDG A;  4KBM B;  1YQ3 A;  5FY7 A;  3IHM A;  5JRC A;  3PV0 F;  2A8X A;  4OCG A;  4H2N A;  1KSS A;  1ZOV A;  4I59 A;  2EHO D;  2NW8 A;  4BAY B;  4WYV A;  1GQE A;  1MND A;  5H6Q B;  3KPK A;  4GCM A;  2VK9 A;  3UTE A;  3DK9 A;  4X1Y E;  1N4U A;  2JPF A;  4K5S A;  1DU2 A;  3PU8 A;  3AAA B;  3QB5 A;  1E1H B;  3CNT A;  4DR1 T;  4AP3 A;  2CXF A;  3C4Z A;  4K8D A;  1VBC 4;  1IAP A;  4DUZ T;  4P9S A;  4YWO A;  5J2U E;  5HYM A;  3OVU A;  2KT9 A;  2LM9 A;  3KVA A;  1OXZ A;  3AXJ B;  4L0R A;  2GK9 A;  4CNK A;  3FZK B;  3QUJ A;  2XVI A;  4CRT A;  2CPT A;  2PTF A;  4M52 A;  1S94 A;  5LMU T;  2VWA A;  2GAH B;  2O9Z A;  2DI4 A;  1H82 A;  4H9Q C;  2NPX A;  3DTO A;  2R7F A;  4X4J A;  2LHR A;  4HFV A;  2AXD S;  4HE8 A;  3AEE A;  4HA6 A;  4IDP A;  2WP6 A;  5M0Z A;  2OA1 A;  5KNL A;  5L3G B;  1JNR A;  3GQK A;  1OJC A;  1N1P A;  4I58 A;  4A6N A;  3LK4 2;  4ZCC A;  3SQP A;  4F6R C;  1NCQ D;  4FK1 C;  2XQ8 A;  1Q9I A;  3II4 A;  4Q4W 4;  3PU3 A;  1GSN A;  1HG2 A;  3UUM A;  1KNR A;  4DUY T;  2RR1 4;  4ILU A;  4UEL A;  3K30 A;  4A98 A;  4UEM A;  1W0B A;  5JCL A;  2X68 A;  4P0A A;  2LFC A;  3TKL B;  5FS7 A;  4IE4 A;  2R45 A;  3CPI G;  2LSI A;  2B7R A;  1Y64 B;  2ES0 A;  3CWZ B;  4JY3 A;  2I6H A;  4NPP A;  1XMO T;  5FKY A;  2GRT A;  2BG9 B;  2WHD A;  3R84 B;  3AD7 B;  4TM0 A;  3LJP A;  2K48 A;  3IF9 A;  3BHF A;  2APG A;  1JOA A;  3PO7 A;  3MK7 C;  5ER0 A;  2XAS B;  2FJA A;  3SGL A;  2XDO A;  2JMK A;  4QKN A;  1D5T A;  4JI5 T;  3TLW A;  4LF9 T;  1E1M A;  3FB2 A;  4EEB A;  2X51 A;  2LJL A;  2WU5 A;  5HY5 A;  1HTJ F;  1ASJ 4;  3LB8 A;  3O1H A;  5DQW A;  1GET A;  2KMF A;  4NEW A;  4OPC A;  5TR3 A;  4UVA B;  2LHN A;  1DOD A;  2V7I A;  4HFB A;  1HRI 4;  5C8Y E;  3UFE A;  3UOY A;  3C4W A;  4UDP A;  4JEU B;  4TZ4 C;  3UUB A;  4EV6 A;  4G9K A;  4H7U A;  4EIP A;  4TLX A;  4AKR B;  1I94 T;  5ABH A;  2BAB A;  5AQI B;  4BUR A;  1O5W A;  3WAK A;  4B1B A;  1POV 0;  4G2A A;  2MBG A;  1PXC A;  2LOS A;  5AQP B;  4CY8 A;  1GT8 A;  3AD8 B;  5HAX A;  1RUJ 4;  1EL5 A;  1HS7 A;  3C50 A;  4DNA A;  2CCQ A;  1HRV 4;  2M6I A;  2BYB A;  3ZCI A;  4AI6 A;  2X5I D;  2H3R A;  3N2K E;  3LXD A;  2CEA A;  1ZKQ A;  3ESL A;  2HQM A;  5AQT B;  3EPT A;  5EZY E;  1LKX A;  2V60 A;  4YHH T;  4YLH A;  4GKK T;  4AIS A;  4J57 A;  1K0L A;  4HFC A;  5KMP A;  4N9X A;  2B7S A;  2JQK A;  1OED C;  1IJH A;  1H7W A;  1XZY A;  3N9N A;  3ZCJ A;  4IL4 A;  3RYH E;  3NIX A;  3DGZ A;  2X3N A;  1K4Q A;  1TYT A;  3DJB A;  3RRC A;  3CNJ A;  4U74 A;  1CC4 A;  3NNE A;  5HCM A;  1DOB A;  1REO A;  2JQQ A;  3EDU A;  2PW9 A;  5LGU B;  2X8H A;  2E9X C;  3UTG A;  3AE1 A;  2XUE A;  4PNI A;  4UV9 B;  3MXZ A;  4TN7 B;  2KND A;  4FI5 A;  1IUV A;  2HPL A;  2R4J A;  4O5Q A;  3UFG A;  3UOX A;  2RS5 4;  3DME A;  1ZK7 A;  2JAE A;  3IHR A;  4WBN E;  5CJ5 A;  4V1A v;  5FXX A;  3U3I A;  1ZX9 A;  2GQF A;  4RG3 A;  5JDN A;  4MHC A;  3ZYX A;  2V8S V;  4NZH A;  2JB1 A;  1K5M D;  2WOV A;  4DMW A;  4ILA A;  3PJA J;  4TV8 E;  3URH A;  2PG8 A;  4U31 A;  4YSY A;  3KVB A;  1S2Q A;  2RM2 4;  1ZDL A;  1VG9 A;  4CI2 B;  2CE7 A;  5FYM A;  4DBR A;  4O4J E;  2DHR A;  2A89 A;  1COY A;  3F8D A;  4A65 A;  2XLR A;  1ZMC A;  4C74 A;  2DWG A;  5FMH A;  4WCT A;  3F31 A;  4C3X A;  4KPR A;  4GIW A;  4TWF A;  5BUL A;  2X8C A;  3T2Y A;  2A72 A;  3NRY A;  3PUZ F;  3SWH A;  4H9S E;  1IBM T;  2BA9 A;  4HN9 A;  3D0T A;  2H88 A;  4TUY E;  2C66 A;  3Q9T A;  4IDQ A;  3ZN1 B;  3QVP A;  4H9R C;  3RNM A;  3E1T A;  1UUR A;  1H84 A;  1MIW A;  5HXI A;  2V61 A;  5KVH A;  1ZHC A;  3ZT5 A;  4NEV A;  2JJ9 A;  2DKH A;  5EBK A;  4JV5 T;  2E9X B;  1D4E A;  4EIW A;  4D04 A;  4A5L A;  3HKE E;  4YJ3 E;  1D4C A;  1WCR A;  3CX7 B;  4ZI3 C;  4ZN0 A;  4G74 A;  4JI7 T;  3AED A;  3EI0 A;  1CUN A;  3CX6 B;  1IUW A;  4QH1 A;  1NEK A;  4A5X A;  4WX1 A;  4PJN A;  5EB4 A;  3UU4 A;  2I0M A;  4ADZ A;  2GR0 A;  1M64 A;  2Y6Q A;  1QSD A;  3KLJ A;  3BI5 A;  4UF0 A;  4A56 A;  4MLK A;  5HXR A;  3FZL B;  2D2S A;  3BI2 A;  2CDU A;  2EX3 A;  1PBE A;  1GER A;  3ICS A;  2WZI A;  3WE0 A;  4U8I A;  3AYJ A;  3NKS A;  2Q0L A;  2OA5 A;  2Q9Q B;  4NTD A;  4GAP A;  5FL0 A;  4YSZ A;  4JLE A;  3EAO A;  2KLQ A;  1D1B A;  1UX5 A;  1DOC A;  4DV0 T;  4H9O C;  3GQH A;  2C4C A;  2MPK A;  3NG7 X;  3KD9 A;  4LML A;  1GV4 A;  4U2Y A;  1V59 A;  1LVF A;  3OYZ A;  4UVB B;  3F8P A;  4FX9 A;  3QB5 K;  4UDR A;  3SX6 A;  4CXY A;  4CXW A;  1LRZ A;  5KMG P;  3RED A;  2WEU A;  4PK4 A;  1WR0 A;  2WS3 A;  2UUC T;  3HL6 A;  1Q1R A;  2LSG A;  1CC6 A;  4CI3 B;  1UKV G;  1XNR T;  2A9U A;  4H4U A;  3AA7 B;  3SS1 A;  4IDZ A;  2BK3 A;  2TPR A;  2UXC T;  2V5D A;  5L3F B;  3UQ7 A;  4ECH A;  1YY5 A;  3N9Q A;  4E7S A;  1M6I A;  1MMN A;  2XCG A;  4A7A A;  4YSX A;  3BNU A;  1WR6 A;  4E7Z A;  5L3D B;  3LZX A;  2Q9Q D;  1GOS A;  2YLR A;  1GXF A;  1GRH A;  4XXG A;  1IJ6 A;  3AA1 B;  4P09 A;  3PUS A;  4TNW A;  4TX5 A;  3CQX C;  4DR2 T;  3UU3 A;  1XDI A;  3FBS A;  2WP9 A;  2LSJ A;  5LCY A;  5FY0 A;  2B9X A;  2YR4 A;  1EAH 4;  1CJ4 A;  2WES A;  2WMO A;  2IML A;  4KP3 C;  3ITJ A;  3WI3 A;  2UUB T;  1NHS A;  3C4A A;  3C4X A;  3R9U A;  4H63 V;  1PJ5 A;  1CF3 A;  3HKC E;  4IE6 A;  1HNX T;  4O5U A;  2XQY A;  1E6E A;  1J1J A;  1AJ3 A;  1QO8 A;  2FJE A;  4A99 A;  3QOF A;  2ZZB A;  3N9L A;  1D4D A;  3I9W A;  3GDP A;  2C3C A;  2XQ4 A;  4H50 A;  3IWA A;  3LBX A;  1OJD A;  2WWV A;  3NTD A;  4Q25 A;  3RF1 A;  1F8S A;  2QA1 A;  3EVY A;  2BXR A;  3CVR A;  4AQF C;  5LBM A;  1GTE A;  2BK4 A;  4B63 A;  1D7Y A;  4BK3 A;  3OZ2 A;  2IVD A;  4C77 A;  4BJZ A;  3H8L A;  3RIA A;  2BVM A;  2XLU A;  2OV9 A;  2X9H A;  3NRX A;  1X31 B;  3TLS A;  1VRH 4;  4CCQ A;  3H4K A;  1AOG A;  3C4N A;  4JUY A;  4REK A;  4RHV 4;  1HXS 4;  1UX4 A;  4U7I A;  3QVR A;  2V7K A;  5IUX A;  4OYK A;  3HI2 A;  2F4V T;  3P4P A;  1NDA A;  1PJ7 A;  1HNZ T;  5J1G A;  4PFP A;  3QSM A;  3LK2 B;  4HFD A;  2Q7V A;  2LE8 A;  3X1D A;  2QCU A;  1GND A;  2Z5Y A;  2XFQ A;  5IQ4 A;  2CWO A;  1TDF A;  3NTA A;  4EM3 A;  1SHZ C;  4DSH A;  3QFA A;  4OPI A;  1SEZ A;  2JMH A;  3RQU A;  4G73 A;  4GRT A;  1X9B A;  3AAI A;  4AQY T;  4PAA A;  1T72 A;  2F5Z A;  3GDN A;  2Z5X A;  2Z6E A;  2VKO A;  3JAD A;  2XPK A;  3KIN B;  1F8R A;  2ZLY A;  2XTL A;  4AT0 A;  4YTN A;  3FG2 P;  2YLW A;  5LHG B;  1Z8U A;  4IST A;  4GDE A;  3UKP A;  3JAE A;  5LOV E;  4OPT A;  1OJT A;  5FMN A;  1G8X A;  3K8P C;  4QH5 A;  3FBL A;  1T98 A;  1Z7S 4;  3GWH A;  2GVC A;  1L9C A;  5BRT A;  4B6X A;  1DNC A;  4ZHQ E;  2V6Y B;  1Q1W A;  1I6Z A;  1IUU A;  4LFC T;  4USR A;  1B7T A;  2X99 A;  3FHN A;  5HXE A;  2HN1 A;  3MAC A;  2CXD A;  5IWA T;  1P2H A;  2LEH A;  1LQU A;  4A79 A;  2GB0 A;  4CN6 A;  2BDE A;  4EYY R;  2C5J A;  2QRX A;  1N34 T;  3AA0 B;  3I1A A;  2PLV 4;  4XBF B;  5CGM A;  1FEW A;  4B3R T;  3DK4 A;  3GWF A;  4K2X A;  2CMR A;  1KK7 A;  2ZM6 T;  4OX9 T;  4Y4M A;  5HXC A;  4AKH A;  3OTO T;  4ZI2 D;  1LVK A;  3FPZ A;  3EUH A;  2B76 A;  2QVA A;  4PK6 A;  2BS3 A;  4B66 A;  3AXJ A;  4PAB A;  2K9A A;  4U8N A;  4X20 E;  1PBC A;  2E5V A;  1YQ4 A;  2IAK A;  5U25 A;  2Y6X A;  2R0G A;  5AFU L;  3NYE A;  3ONX A;  2D9D A;  4O8S A;  2BG9 C;  4YTM A;  2ACZ A;  3P9U A;  5JRE A;  1YD8 G;  4E0V A;  2G0U A;  1DXL A;  3ATQ A;  2J62 A;  2HWC 4;  1MMA A;  1MIY A;  1JRY A;  1KNP A;  2E2A A;  2N9D A;  3L39 A;  2EHO B;  4K22 A;  2PFV A;  4QHO A;  2VQF T;  1RUG 4;  4QX8 B;  2GH5 A;  2RGO A;  3HR0 A;  2V6X A;  2W00 A;  4CI1 B;  3G06 A;  2R4E A;  3ZMU B;  2YK0 A;  3O9X A;  3MJX A;  1VDC A;  3VU7 H;  4IDO A;  3HYW A;  4ZI2 C;  2C72 A;  3GRT A;  2D5U A;  1KF6 A;  4FK1 A;  2YAU A;  3G5R A;  2V7M A;  1VG0 A;  4Z43 A;  3QK6 A;  4IT4 A;  2HPJ A;  3VRA A;  2GAG B;  3CX8 B;  3AE5 A;  3FI7 A;  3KBU A;  2X9W A;  3GMI A;  3VHL A;  1VQW A;  1BF3 A;  3ICR A;  3GWD A;  5HEH A;  3P7I A;  1GAL A;  3FXE B;  2CA5 A;  4CN1 A;  3CGD A;  3V3N A;  4AQF A;  2PZS A;  4QX7 B;  2IUB A;  5L4H A;  4YXD A;  3L1R A;  1LPF A;  2WDQ A;  4QH4 A;  4NUU A;  5ABF B;  4I55 E;  3HYV A;  3ZPO A;  5AQG B;  3CND A;  1D1A A;  5H6R B;  2VVM A;  2V6Y A;  4H4X A;  5HEG A;  1W4X A;  3UQ4 A;  3ICT A;  1T7S A;  2I59 A;  2CHN A;  2VUR A;  4OPL A;  5AQQ B;  3BNM A;  2AAQ A;  1MNE A;  3RP8 A;  1EL9 A;  4II2 A;  1CHU A;  4KX6 A;  3AB3 B;  4U33 A;  2GR2 A;  4D03 A;  3FZM B;  2K24 A;  1PIV 4;  1VOM A;  5FS9 A;  5F8P A;  5LA6 E;  3IHG A;  3ATR A;  4Y4L A;  3NK2 X;  3EHZ A;  1OED B;  3IEE A;  3PVC A;  3T8O A;  3FBZ A;  1PO2 4;  1S3E A;  1JNZ A;  3ANW A;  3TLT A;  2C75 A;  3CGB A;  2UXX B;  4KMC A;  5KOX A;  5LNK A;  4U8P A;  1ZP0 A;  3N5L A;  3IC9 A;  1IUS A;  2BKP A;  5L46 A;  3F2E A;  2XFN A;  4HEA A;  5M4Y A;  3GN5 A;  5HEJ A;  5BMV E;  2GV8 A;  2W2U A;  4UIG A;  2QYW A;  3P50 A;  4ZZC A;  4I4T E;  3CQC B;  3AEC A;  4EMW A;  2VRL A;  3DP7 A;  1HYU A;  2R6G F;  1YXR A;  4EYU A;  4BK2 A;  4CN4 A;  3EAM A;  4GYR A;  4G6H A;  2WQY A;  1IBK T;  4B3S T;  2YU2 A;  4HGA A;  5AQH B;  2J3N A;  5CFB A;  1WFD A;  1UUS A;  1CJC A;  4J33 A;  2YIN A;  2CFY A;  1PXB A;  4MFR A;  4GR1 A;  4KHP T;  2BCP A;  2W62 A;  4YT0 A;  2NW9 A;  4UR9 A;  2RGJ A;  5DJQ C;  4GDP A;  1EBD A;  1SUM B;  1Y56 B;  1NPX A;  3JBG 4;  2NOX A;  1H8T D;  2XSB A;  4UVC B;  3GMC A;  3ZN0 B;  2XAG B;  3BHK A;  3GD4 A;  4J56 A;  5AQL B;  1L0V A;  2BAC A;  2AQJ A;  4DND A;  1B4V A;  3PUG A;  4CY6 A;  2YWL A;  2JIW A;  2C73 A;  3AE6 A;  5LBQ B;  5BUK A;  1IJ5 A;  3AE7 A;  2AR8 A;  4GAV A;  4BV6 A;  1E1K A;  3HA4 A;  4YHJ A;  5KMR A;  1FIO A;  1GEU A;  3NK1 X;  1PBD A;  5HYA A;  5L3C B;  1HF8 A;  3PE0 A;  3UKF A;  2XQ7 A;  4X62 T;  2MOZ A;  1WYB A;  1XHX A;  2M67 A;  1R09 4;  3ZKR A;  3CPZ A;  3UT5 E;  4YFS A;  5LYJ E;  1H7X A;  5HHF A;  2PYJ A;  1S2Y A;  2GR1 A;  2VQ7 A;  2NR4 A;  3AAE B;  3NGC X;  1J5E T;  4B69 A;  3UP5 A;  4AKL A;  4H4T A;  4Z2U A;  4TM4 A;  2HWB 4;  4AIU A;  1MO9 A;  2MTQ A;  5ETW A;  2Q9Q A;  4HWF A;  2SPC A;  1ZMD A;  3AB1 A;  4J31 A;  4X9N A;  4K5R A;  3AE3 A;  3SM8 A;  4B68 A;  3KV9 A;  4JI2 T;  4RG4 A;  1EZ3 A;  3ALJ A;  3N9O A;  2JB3 A;  2VVS A;  1D0X A;  3UUL A;  3Q6J A;  2JK6 A;  4DR3 T;  2C64 A;  1XDP A;  5HXS A;  3WAJ A;  4ZOL E;  3CGC A;  3ALM A;  3KV4 A;  1KSU A;  4H4W A;  3VQR A;  3DA1 A;  4H2Q A;  4JI6 T;  2PJQ A;  3AYI A;  2RS1 4;  3ALL A;  2WAU A;  3S5W A;  1W9R A;  1S35 A;  1KDG A;  2DLR A;  3B13 A;  2WB5 A;  1FL2 A;  1VBD 4;  5ABE A;  2VL0 A;  2IID A;  2VRM A;  4EB6 E;  2W61 A;  3SFD A;  3RGL A;  4OPU A;  3ADA B;  4GF7 A;  4J2W A;  2YLT A;  4NIQ A;  2BCG G;  5IHY A;  4NXN T;  4NWZ A;  4NUV A;  1RUF 4;  1RVF 4;  4IGU A;  4COF A;  1XHZ A;  1G73 A;  4B3M T;  5L3B B;  3H3M A;  1BZL A;  4U2T A;  3UTH A;  1X79 A;  4KUM B;  3KFW X;  2TMD A;  1FEB A;  1OED E;  2IHR 1;  2C3D A;  3OC4 A;  4U3C A;  1QLB A;  4AT2 A;  4X5T A;  3QSS A;  3JC6 D;  3OKQ A;  2VVN A;  2XVH A;  3E0Z A;  4U2S A;  2WY2 A;  3UKL A;  2BVL A;  4BK1 A;  3KU9 A;  4ICY A;  3ISH A;  3ZMV B;  2PYL A;  5M10 A;  2BG9 E;  2IVE A;  3SYI A;  2BC1 A;  5JH7 E;  1FMW A;  2IDO B;  3Q9D A;  2X50 A;  2E9X A;  2Y6R A;  2WOW A;  4IHJ E;  1NG3 A;  4Q4V 4;  5FNV E;  4AOX A;  1QUU A;  3QNU A;  1PDH A;  3NYC A;  3T0K A;  5CKU A;  4C90 A;  2ZM2 A;  1US7 B;  3L8R A;  1FCD A;  2VOU A;  1XNQ T;  3LZW A;  4UDQ A;  4CCR A;  5IPY A;  2LSY A;  3CMM A;  3NWI A;  2BC0 A;  1NEN A;  4OHF A;  2BKO A;  4UV8 B;  4DR5 T;  4ZI7 E;  4RSL A;  1CL0 A;  2WWU A;  1KEY A;  2LKG A;  1WLX A;  1RUD 4;  3DGH A;  3SZW A;  2LLY A;  1COV 4;  2WPF A;  1UGO A;  1AL2 4;  3GD3 A;  4TWD A;  2DCF A;  5AQO B;  3K1S A;  2XFP A;  4AP1 A;  4Z2T A;  1RUI 4;  3O0H A;  3SZ0 A;  4X64 T;  2YDR A;  4YSH A;  2VVL G;  3BQI A;  4DR6 T;  4LMJ A;  4JI4 T;  3KVE A;  2JQH A;  4ZEY A;  5ADX L;  5AQF B;  3PUY F;  2E1M A;  1B8S A;  1F8W A;  5JCM A;  1AR9 4;  4A6N B;  3PUA A;  2AE9 A;  4ADW A;  4H4S A;  2WSS V;  1H86 A;  1B5Q A;  1IUT A;  3UTK A;  3IA3 A;  4UXN B;  3OJA A;  3QFB A;  5DAB A;  3AVS A;  1VRB A;  1P2E A;  2KWI B;  4U8J A;  2ZZC A;  4G6G A;  4B64 A;  4DV4 T;  2A87 A;  2YLZ A;  3BK9 A;  3LJC A;  3Q5E A;  5IQ1 A;  5U63 A;  3NK0 X;  5BR8 T;  4EMJ A;  4CXX A;  5C3J A;  3I0Q A;  3RIU C;  4DVD A;  3P4S A;  3NRN A;  2C65 A;  1YQZ A;  3L3P A;  2Y8D A;  2FUP A;  3M3Z B;  5A1L A;  2XFU A;  4I43 B;  2ZMA A;  3C64 A;  3P4Q A;  1LVL A;  3H3A A;  2L8K A;  2CLY B;  2FJB A;  4TNV A;  3TLU A;  5LMN T;  2XAJ B;  2D0T A;  4U8M A;  3ZJ1 A;  5U1O A;  2ZM8 A;  5FP3 A;  5FVL A;  2OLO A;  4WW0 A;  4HTE A;  1JU2 A;  1JRX A;  3UOV A;  4HWD A;  3DJJ A;  3UU5 A;  1EL8 A;  1MXT A;  3D1C A;  1RHI 4;  4TV9 E;  2YG4 A;  2X0L B;  5JR9 A;  5FS8 A;  2EHO A;  4TLZ A;  3ZT7 A;  3N2G E;  3JSK A;  1YKH B;  1XAN A;  3VR8 A;  2XAF B;  4HWH A;  2CVJ A;  2C5K T;  3ZEF B;  2YDS A;  3F57 A;  4JI1 T;  4IV9 A;  4J36 A;  1EV1 4;  5EK4 A;  1CJ2 A;  3SUC A;  4DGK A;  2H7V C;  2J4G A;  2XM1 A;  2X9Y A;  4O4L E;  4H9N C;  4O2B E;  1J5W A;  1BR2 A;  3NKZ A;  4M1P A;  1TDE A;  3GMB A;  3RIU A;  3EDV A;  2XQ6 A;  5LB7 B;  4EQR A;  4EAH A;  4Q4Y 4;  3GRS A;  1XMQ T;  2CBJ A;  3VRD B;  1AR6 4;  4XAX B;  4TM1 A;  2VB6 A;  3JCF A;  3CML A;  3ABV A;  2Y48 B;  1KNZ A;  3ZT6 A;  1ZKE A;  4LF8 T;  1HG5 A;  5DBJ A;  1MQT D;  4EGW A;  2C5I T;  1H6V A;  1WRD A;  5F3J A;  2XQ9 A;  1T8B A;  1PXA A;  2W0H A;  1BR4 A;  1O94 A;  3CNP A;  1YW0 A;  3RC3 A;  4C91 A;  4LF5 T;  2DL1 A;  4IL9 A;  1M7K A;  2Q6U A;  2VKD A;  3ZC0 A;  4NXM T;  1E1L A;  3Q5D A;  3ZC1 A;  2YG3 A;  2OLN A;  2K3W A;  5LV9 A;  1HX1 B;  3NN6 X;  2OLT A;  2RS3 4;  3DJD A;  3PJA A;  4JDR A;  3AE9 A;  1MOK A;  2C76 A;  2XVJ A;  5EB5 A;  1BGJ A;  4AXP A;  2ACX A;  2B9W A;  5FS6 A;  5GRT A;  1D1C A;  4JN9 A;  1VBE 4;  3O1I A;  4IE5 A;  4X65 T;  1H81 A;  3KV5 A;  1PVC 4;  5LGT B;  5GSN A;  4MBQ A;  2H7O A;  5FL1 A;  2WBA A;  1F3P A;  4II3 A;  3IBP A;  3NLC A;  2E8I A;  1DJQ A;  5JRC B;  3SOL A;  5JDQ A;  3KA7 A;  2WZH A;  4C5O A;  3J8F 4;  3Q2M A;  2XLT A;  3RLF F;  3P1W A;  4NTC A;  5AQJ B;  1GRT A;  1RYI A;  2XLP A;  4OPG A;  3SXI A;  1D0Z A;  4L9I A;  3NN0 X;  4LA1 A;  3SFE A;  5AQR B;  5JR9 B;  1BR1 A;  5EK2 A;  1FMV A;  4HWI B;  5FXV A;  5AQV B;  3N9P A;  5AQK B;  1RP0 A;  4JI3 T;  3I9Y A;  4X1I E;  4BJN A;  2A3D A;  3BI4 A;  2XQ3 A;  3RP6 A;  1S3B A;  4DR7 T;  4JBW F;  2BRY A;  3E08 A;  3S4U A;  2VQB A;  3A8Y C;  4GYS A;  3EF6 A;  3ZSS A;  1NA1 D;  3A7M A;  2PHH A;  2R07 4;  3RPU A;  4Z91 A;  5FXW A;  3GYX A;  4ASK A;  2BS4 A;  3S61 A;  3PDY A;  4H4Q A;  4PW8 A;  2XVF A;  3CKD A;  2XAQ B;  4H63 H;  2NP9 A;  2NVK X;  4JI8 T;  1ZOY A;  4K0U A;  5HCJ A;  5LJN A;  1ZEE A;  4EQW A;  2VQE T;  2XAH B;  5DQV A;  4LF6 T;  4BJM A;  4IVO B;  4EM4 A;  4DBQ A;  4X66 T;  3NH3 X;  1IZN B;  3SZC A;  2V5C A;  3RKG A;  4F8H A;  4OFZ A;  2MYS A;  5KX5 E;  3NT6 A;  1WYC A;  2M6B A;  3CTY A;  1E1N A;  5EK3 A;  1E7P A;  2R46 A;  4AKG A;  4GUV A;  2PBI A;  1MIV A;  3PTR B;  4OK0 A;  3T2Z A;  1AR7 4;  2HH7 A;  2HN2 A;  3M12 A;  1D0Y A;  3ZMS B;  3ZST A;  4AKI A;  3DJG X;  2BS2 A;  4GK5 E;  4JNA A;  3RKO A;  1D7L A;  1HR0 T;  4I0U A;  3G5Q A;  2ODV A;  3PUV F;  1CBO A;  5LXT E;  4U8L A;  1LJ1 A;  2YM2 A;  3CNS A;  4ANJ A;  3UKQ A;  2R9Z A;  1FEC A;  4BA9 A;  3B5M A;  3KDS E;  1O3X A;  3V3O A;  5KDM C;  4PFO A;  4Z24 A;  2JRK A;  2WET A;  3ZDN A;  4BJY A;  4Z90 A;  1TDO A;  3K3N A;  1FOH A;  4ILC A;  4X9M A;  1LV0 A;  3ETV A;  3LOV A;  3ZYM A;  3V5U A;  4LU6 A;  2BBH A;  3BQL A;  1YKE B;  1GRF A;  2WCA A;  4H4Z A;  3O1J A;  5LHH B;  3AA6 B;  5ABF A;  3JD7 4;  3LG7 A;  3R6N A;  1CC2 A;  4JNQ A;  3AXB A;  3CIR A;  1ZY8 A;  4WBO A;  4YKF A;  2N1G A;  3EAB A;  3B57 A;  3UKH A;  4DV2 T;  4PJL A;  2WP5 A;  2YVF A;  3O4X E;  4XWZ A;  3P4W A;  4DV3 T;  1DJN A;  4B65 A;  1PBF A;  3RYF E;  2X0Y A;  1B37 A;  3VRB A;  1MMD A;  3OYX A;  2H89 A;  4H4R A;  4IVM B;  4KI0 F;  4Z8X A;  3RYC E;  1V9D A;  1R08 4;  5KMS A;  3RC8 A;  2XJ7 A;  4ZZB A;  3ETU A;  3DH9 A;  1N33 T;  4U72 A;  4HFI A;  5HXH A;  3RI5 A;  3BQK A;  1R8I A;  3UCL A;  4O2A E;  2X8G A;  4USQ A;  5CB4 E;  2X66 A;  1MMG A;  4TWH A;  2EQ9 A;  4ERR A;  2CRB A;  2KWH A;  3SZF A;  1PS9 A;  2LRK A;  1RSG A;  4H2P A;  1BEV 4;  1PO1 4;  5JDH A;  2RPA A;  2ZBW A;  4AOS A;  3RRW A;  3FMW A;  3C96 A;  4J2C A;  2GEW A;  4YKG A;  4GB3 4;  3KPF A;  2XVE A;  2W63 A;  3LFM A;  5HWX A;  2XM2 A;  4DV7 T;  2YR6 A;  1Y56 A;  2V3A A;  3HKD E;  3K7T A;  2XFO A;  4P0B A;  5FXZ A;  3PUR A;  2RA1 A;  2A2F X;  1RUH 4;  2BXS A;  1Z6L A;  5CA0 E;  3DJE A;  5AQU B;  3EAN A;  4WNK A;  5J2T E;  1FJG T;  5HEU A;  1LTX R;  2XQA A;  3PUW F;  5KWF A;  4U8K A;  5IYZ E;  3F8R A;  1OED A;  4EQX A;  1W09 A;  3FIM B;  4GOU A;  3CPJ G;  3L8K A;  2NTY A;  3ZMZ B;  2YU1 A;  2DNX A;  2YLX A;  2ODU A;  2IC9 A;  1ONF A;  3NVO A;  4K7Z A;  4I50 E;  2UZZ A;  4CNJ A;  3ZJ2 A;  1BWC A;  1XPQ A;  3L09 A;  2C7G A;  1XI1 A;  1E2A A;  2YG6 A;  2RP4 A;  4FJO A;  1OOP D;  4U7Y A;  1HFA A;  3SY4 A;  1YKJ A;  1W0A A;  4CBQ A;  2XHE B;  5JDM A;  2J47 A;  3I0O A;  4LF4 T;  5HWY A;  2WOI A;  3T1H T;  2B9Y A;  3K3Q C;  3QC9 A;  3RHW A;  1TDN A;  2XZE A;  2JBV A;  5L4E A;  2D0U A;  5BVA A;  4ZS3 A;  2WMN A;  2JKC A;  1D4M 4;  2YDQ A;  2WDV A;  5JCI A;  5JR9 C;  3KV6 A;  1QJD A;  2XLS A;  2YLS A;  5LHI B;  4J34 A;  2YN6 A;  4ZCD A;  3AVR A;  2I0Z A;  3UKK A;  3T37 A;  4APN A;  2UXB T;  4IDN A;  4EZH A;  3UP4 A;  3RP7 A;  2W67 A;  2Q0K A;  3MZK B;  2IC6 A;  2W0G A;  4XWR A;  1GTH A;  2ZZ0 A;  4DSG A;  2VKJ A;  1K0J A;  2BRA A;  4IA6 A;  4NNJ A;  4HWC A;  3LK3 B;  1PHH A;  3UU8 A;  5KMQ A;  3PS9 A;  5AQS B;  4UF0 B;  5AQM B;  2UXD T;  3LDQ B;  2IW5 B;  3NZP A;  3RX6 A;  3ZMT B;  1NWM X;  2YKS A;  4ZS2 A;  1SA0 E;  2YVG A;  3QSE A;  5LGN B;  1RUE 4;  2C67 A;  2VL8 A;  2EQ7 A;  5JQG E;  1NHQ A;  2E9X D;  3AE8 A;  4CZZ B;  2XYO A;  5J60 A;  1IUX A;  1NAF A;  1KFY A; 
#chains in the Genus database with same CATH homology
 1EL8 A;  1MXT A;  3D1C A;  1PBC A;  2E5V A;  1YQ4 A;  4JY2 A;  1DOD A;  2YG4 A;  5U25 A;  2R0G A;  3NYE A;  5FS8 A;  3UOY A;  4YTM A;  2ACZ A;  4FDC B;  3P9U A;  4TLZ A;  1GRB A;  5C2T A;  4E0V A;  1DXL A;  4UDP A;  2JB2 A;  2V5Z A;  3ATQ A;  3AYL A;  3JSK A;  4JQ9 A;  1XAN A;  1CJ3 A;  1JEH A;  3VR8 A;  4G9K A;  4H7U A;  1JRY A;  1GPE A;  2CVJ A;  4TLX A;  3UKA A;  4EIP A;  1KNP A;  4IV9 A;  2BAB A;  4J36 A;  4BUR A;  1O5W A;  5JCN A;  4K22 A;  1CJ2 A;  4B1B A;  3SUC A;  4DGK A;  3H8I A;  3V76 A;  2GH5 A;  2RGO A;  1PXC A;  1DOE A;  4CY8 A;  1GT8 A;  1TDE A;  3GMB A;  2R4E A;  3NYF A;  4EIQ A;  3AD8 B;  1GES A;  1O95 A;  4EQR A;  1EL5 A;  1VDC A;  3HYW A;  3AWI A;  2C72 A;  3GRT A;  4DNA A;  2ARD A;  1KF6 A;  3GRS A;  2YAU A;  4FK1 A;  2BYB A;  2EQ6 A;  3G5R A;  3VRD B;  1H83 A;  4TM1 A;  1VG0 A;  4Z43 A;  3ABV A;  3LXD A;  3LAD A;  3VRA A;  2GAG B;  1ZKQ A;  3GSI A;  3G5S A;  3AE5 A;  4U2L A;  5DBJ A;  2HQM A;  4H4P A;  5CQF A;  1H6V A;  3EPT A;  2V60 A;  3GYJ A;  1VQW A;  4J57 A;  1BF3 A;  1TRB A;  3GWD A;  1K0L A;  3ICR A;  1GAL A;  3CGD A;  3V3N A;  3M13 A;  5KMP A;  3AEG A;  1PXA A;  2W0H A;  2B7S A;  1O94 A;  3B3R A;  3CNP A;  4N9X A;  1IJH A;  1H7W A;  2Q6U A;  4YXD A;  3L1R A;  1LPF A;  2WDQ A;  3NIX A;  3DGZ A;  3HYV A;  3P4R A;  2X3N A;  1E1L A;  1K4Q A;  1TYT A;  3CND A;  1OJ9 A;  2YG3 A;  3NNE A;  2VVM A;  2OLN A;  1CC4 A;  2YVJ A;  3CNJ A;  4H4Y A;  4H4X A;  5LV9 A;  4MJW A;  3NN6 X;  1DOB A;  3AE4 A;  1REO A;  3DJD A;  1W4X A;  3K7Q X;  4JDR A;  3ICT A;  2GMH A;  2X8H A;  3UTG A;  3AE9 A;  2QA2 A;  2RAB A;  3AE1 A;  1MOK A;  2C76 A;  2XVJ A;  4OPL A;  5EB5 A;  3BNM A;  1BGJ A;  2AAQ A;  1BGN A;  5FS6 A;  2B9W A;  1IUV A;  2R4J A;  4O5Q A;  5GRT A;  1EL9 A;  4II2 A;  3RP8 A;  4JN9 A;  1CHU A;  3UOX A;  4KX6 A;  2YQU A;  3DME A;  1ZK7 A;  1XHC A;  1H81 A;  4D03 A;  2GR2 A;  2JAE A;  4U8O A;  5GSN A;  2WBA A;  1F3P A;  4II3 A;  5J7X A;  3T31 A;  1ZX9 A;  2GQF A;  3CN8 A;  3NLC A;  4RG3 A;  5FS9 A;  3ZYX A;  3IHG A;  3ATR A;  4Y4L A;  3T2K A;  1DJQ A;  4NZH A;  3D8X A;  3KKJ A;  3NK2 X;  3PVC A;  4Z25 A;  2JB1 A;  3KA7 A;  4A9W A;  2WOV A;  4H2R A;  4C5O A;  1S3E A;  1JNZ A;  2V6O A;  3URH A;  4Z26 A;  2XLT A;  2EQ8 A;  2C75 A;  3CGB A;  3P1W A;  3QJ4 A;  4Z2R A;  4NTC A;  4YSY A;  1S2Q A;  1GRT A;  5KOX A;  1ZDL A;  1VG9 A;  4U8P A;  2R0P A;  1ZP0 A;  4OVI A;  1RYI A;  2XLP A;  3IC9 A;  4OPG A;  1IUS A;  3SXI A;  2A89 A;  2YG5 A;  1COY A;  3F8D A;  3NN0 X;  4LA1 A;  3SFE A;  4A65 A;  5L46 A;  2XFN A;  2OAM A;  2XLR A;  1ZMC A;  4LII A;  4C74 A;  5FMH A;  5KVI A;  4WCT A;  2VZ2 A;  3NHO X;  3B6D A;  1NHR A;  4C3X A;  4KPR A;  1GRG A;  1L9D A;  5BUL A;  4OPD A;  1RP0 A;  2X8C A;  2GV8 A;  3T2Y A;  4NTE A;  2RGH A;  3BI4 A;  2BA9 A;  3RP6 A;  2R0C A;  2V3B A;  5KOW A;  3AEC A;  2H88 A;  2C66 A;  1S3B A;  3Q9T A;  3QVP A;  3UOZ A;  4EMW A;  2VRL A;  1HYU A;  2BRY A;  2C70 A;  3RNM A;  3E1T A;  2VQB A;  1H84 A;  3EF6 A;  2PHH A;  1TDK A;  2BK5 A;  5HXI A;  4BK2 A;  2V61 A;  5KVH A;  4G6H A;  2WQY A;  1N4V A;  3GYX A;  1Y0P A;  2BS4 A;  3S61 A;  4NEV A;  2J3N A;  4H4Q A;  2XVF A;  2DKH A;  3CGE A;  1CJC A;  2YR5 A;  4J33 A;  5EBK A;  4H4V A;  2CFY A;  2NVK X;  1PXB A;  1D4E A;  4GR1 A;  1ZOY A;  4D04 A;  4A5L A;  2YG7 A;  4EQW A;  2BCP A;  4YT0 A;  1D4C A;  4EM4 A;  2RGJ A;  4IVO B;  4GDP A;  4B67 A;  3NH3 X;  3SZC A;  4ZN0 A;  5JCK A;  1EBD A;  3AD9 B;  3HZL A;  1Y56 B;  1NPX A;  4G74 A;  3AED A;  1N4W A;  3NT6 A;  3CTY A;  4OPC A;  3GMC A;  1E1N A;  2GF3 A;  3T14 A;  1E7P A;  1IUW A;  1TYP A;  1NEK A;  1K0I A;  2R46 A;  3BHK A;  3GD4 A;  4WX1 A;  4J56 A;  5EB4 A;  1L0V A;  4GUV A;  2BAC A;  2AQJ A;  3T2Z A;  1PN0 A;  2GR0 A;  1M64 A;  3M12 A;  3AEA A;  1B4V A;  2Y6Q A;  2WPE A;  5KXJ A;  3DJG X;  3KLJ A;  2BS2 A;  4Y4N A;  3BI5 A;  4CY6 A;  2YWL A;  3AEF A;  3AE6 A;  2C73 A;  4JNA A;  1D7L A;  3G5Q A;  1CBO A;  4U8L A;  2GQW A;  5BUK A;  3AE7 A;  2AR8 A;  3CPH G;  4GAV A;  1LJ1 A;  2YM2 A;  3CNS A;  4BV6 A;  3UKQ A;  2R9Z A;  3BI2 A;  2CDU A;  1E1K A;  1FEC A;  1PBE A;  5KMR A;  1GER A;  1GEU A;  4TM3 A;  3NK1 X;  3RHA A;  3ICS A;  3V3O A;  3AEB A;  1PBD A;  1EL7 A;  3WE0 A;  4HB9 A;  4Z24 A;  4U8I A;  3AYJ A;  2PYX A;  3UKF A;  3NKS A;  2Q0L A;  1E39 A;  2E4G A;  2WET A;  3ZDN A;  4BJY A;  4NTD A;  4GAP A;  1TDO A;  1FOH A;  4X9M A;  4YSZ A;  1LV0 A;  1F6M A;  1NG4 A;  1H7X A;  5HHF A;  3EAO A;  3LOV A;  1S2Y A;  2GR1 A;  2VQ7 A;  4UP3 A;  1DOC A;  3NGC X;  1NHP A;  3GQH A;  2C4C A;  3NG7 X;  4LU6 A;  2VVL A;  3AE2 A;  1GRF A;  2QAE A;  4H4Z A;  3KD9 A;  4B69 A;  3UP5 A;  1GV4 A;  4H4T A;  1V59 A;  2GMJ A;  4Z2U A;  4TM4 A;  1L9E A;  2YM1 A;  1MO9 A;  3F8P A;  4FX9 A;  4UDR A;  2WU2 A;  3SX6 A;  1CC2 A;  1GRA A;  1JRZ A;  1OJA A;  1ZMD A;  3AB1 A;  4J31 A;  4JNQ A;  1NAA A;  4X9N A;  4K5R A;  3AXB A;  3AE3 A;  3CIR A;  1ZY8 A;  3SM8 A;  4IA5 A;  4B68 A;  4YKF A;  4RG4 A;  3RED A;  2WEU A;  5KRQ A;  3ALJ A;  1VRQ B;  1FEA A;  4B66 A;  2JB3 A;  2WPC A;  2WS3 A;  1Q1R A;  3Q6J A;  3UKH A;  2JK6 A;  4YTP A;  2C64 A;  2WP5 A;  1CC6 A;  2YVF A;  1UKV G;  4XWZ A;  3CGC A;  1DJN A;  4B65 A;  3ALM A;  1PBF A;  4H4U A;  2GR3 A;  1KSU A;  4H4W A;  3VQR A;  3DA1 A;  2BK3 A;  1B37 A;  4H2Q A;  4EQS A;  3AYI A;  3VRB A;  3ALL A;  3S5W A;  2TPR A;  4EMI A;  2H89 A;  4H4R A;  1KDG A;  4IVM B;  4ECH A;  1YY5 A;  1FL2 A;  5KMS A;  5EOW A;  2XCG A;  1M6I A;  3K7M X;  4A7A A;  4YSX A;  3BNU A;  2IID A;  3I3L A;  2VRM A;  3DH9 A;  2WDR A;  4C3Y A;  3LZX A;  3SFD A;  1GOS A;  2FJD A;  1BKW A;  4OPU A;  2YLR A;  3ADA B;  4GF7 A;  1GXF A;  4J2W A;  2YLT A;  4Z44 A;  1GRH A;  1PBB A;  2BCG G;  4XXG A;  3UCL A;  2CUL A;  3I6D A;  3VR9 A;  4NWZ A;  2X8G A;  1GRE A;  4USQ A;  3DK8 A;  2EQ9 A;  3FBS A;  1XDI A;  3M0O A;  2WP9 A;  1BZL A;  3SZF A;  4U2T A;  3GYI A;  1PS9 A;  3UTH A;  2B9X A;  1LQT A;  2YR4 A;  1ELI A;  2TMD A;  1FEB A;  2FBW A;  1CJ4 A;  2WES A;  2OAL A;  2C3D A;  3OC4 A;  1RSG A;  3ITJ A;  4H2P A;  1QLB A;  1NHS A;  3COX A;  4AT2 A;  3C4A A;  3QSS A;  2ZBW A;  1PJ6 A;  3R9U A;  4AOS A;  2XVH A;  3FMW A;  1PJ5 A;  3C96 A;  2DKI A;  1CF3 A;  3HYX A;  3UTF A;  4U2S A;  1YQ3 A;  2GEW A;  4YKG A;  3UKL A;  3IHM A;  3KPF A;  2A8X A;  4BK1 A;  2XVE A;  3KU9 A;  4O5U A;  4OCG A;  1E6E A;  4H2N A;  1KSS A;  1QO8 A;  1ZOV A;  4I59 A;  2FJE A;  4ICY A;  4A99 A;  2ZZB A;  1D4D A;  2YR6 A;  3GDP A;  3ISH A;  1Y56 A;  2C3C A;  2V3A A;  4H50 A;  3IWA A;  5M10 A;  3K7T A;  3KPK A;  4GCM A;  1OJD A;  2IVE A;  2XFO A;  3SYI A;  3UTE A;  3DK9 A;  3NTD A;  2BC1 A;  1F8S A;  2QA1 A;  1N4U A;  2BXR A;  4K5S A;  2X50 A;  1GTE A;  2BK4 A;  2BXS A;  1Z6L A;  4B63 A;  2Y6R A;  3DJE A;  2WOW A;  1D7Y A;  3EAN A;  4BK3 A;  3CNT A;  1NG3 A;  3OZ2 A;  2IVD A;  4AP3 A;  4K8D A;  4BJZ A;  4AOX A;  4C77 A;  3H8L A;  1LTX R;  1PDH A;  4P9S A;  2XLU A;  3NYC A;  4YWO A;  3T0K A;  5KWF A;  5CKU A;  5HYM A;  1X31 B;  2VOU A;  1FCD A;  4CCQ A;  3H4K A;  1AOG A;  4U8K A;  3C4N A;  3LZW A;  4REK A;  4UDQ A;  3F8R A;  4CCR A;  5IPY A;  3CMM A;  3QVR A;  4EQX A;  3FIM B;  3CPJ G;  3L8K A;  4CNK A;  2BC0 A;  1NEN A;  2XVI A;  4CRT A;  4RSL A;  1CL0 A;  5TR3 A;  3P4P A;  2YLX A;  1NDA A;  4M52 A;  1PJ7 A;  1ONF A;  3DGH A;  3QSM A;  2Q7V A;  4K7Z A;  3SZW A;  2GAH B;  2O9Z A;  2WPF A;  1H82 A;  2QCU A;  2UZZ A;  4CNJ A;  3GD3 A;  1GND A;  2NPX A;  2XFP A;  4AP1 A;  2Z5Y A;  4Z2T A;  2XFQ A;  5IQ4 A;  1TDF A;  1BWC A;  3NTA A;  1XPQ A;  3O0H A;  3SZ0 A;  4EM3 A;  2C7G A;  2YG6 A;  4X4J A;  4DSH A;  4YSH A;  3QFA A;  2VVL G;  3SY4 A;  3AEE A;  4HA6 A;  1YKJ A;  4OPI A;  2WP6 A;  1SEZ A;  5M0Z A;  4CBQ A;  2OA1 A;  3KVE A;  5KNL A;  4G73 A;  2E1M A;  1JNR A;  4GRT A;  1B8S A;  1F8W A;  2WOI A;  5JCM A;  4PAA A;  3GQK A;  2F5Z A;  1OJC A;  3GDN A;  2B9Y A;  2Z5X A;  4A6N B;  1N1P A;  4I58 A;  4A6N A;  4ADW A;  4ZCC A;  1F8R A;  4H4S A;  1TDN A;  3SQP A;  4AT0 A;  4YTN A;  2JBV A;  1H86 A;  3FG2 P;  5BVA A;  1B5Q A;  1IUT A;  2YLW A;  4FK1 C;  2JKC A;  1Q9I A;  3II4 A;  4GDE A;  3QFB A;  2WDV A;  5JCI A;  3UKP A;  1GSN A;  1QJD A;  2XLS A;  2YLS A;  4OPT A;  1OJT A;  1KNR A;  1P2E A;  4U8J A;  2ZZC A;  4J34 A;  3K30 A;  4ZCD A;  2GVC A;  1L9C A;  5BRT A;  5JCL A;  4G6G A;  1DNC A;  2I0Z A;  3UKK A;  4B64 A;  1Q1W A;  3T37 A;  4APN A;  2LFC A;  2A87 A;  5FS7 A;  2YLZ A;  1IUU A;  2R45 A;  3CPI G;  5IQ1 A;  4USR A;  3UP4 A;  5U63 A;  2B7R A;  2Q0K A;  2X99 A;  3NK0 X;  3RP7 A;  4JY3 A;  1P2H A;  4XWR A;  1GTH A;  2ZZ0 A;  4DSG A;  4EMJ A;  1K0J A;  2BRA A;  4IA6 A;  2GRT A;  5C3J A;  4NNJ A;  1PHH A;  1LQU A;  4A79 A;  3P4S A;  2GB0 A;  3NRN A;  2WHD A;  2C65 A;  3AD7 B;  4TM0 A;  5KMQ A;  3LJP A;  1YQZ A;  3IF9 A;  3PS9 A;  3BHF A;  2XFU A;  2APG A;  3P4Q A;  1JOA A;  1LVL A;  3PO7 A;  5ER0 A;  2FJA A;  3DK4 A;  3SGL A;  3GWF A;  2FJB A;  4K2X A;  2YVG A;  2XDO A;  3QSE A;  2C67 A;  1D5T A;  1E1M A;  2EQ7 A;  4Y4M A;  4U8M A;  5U1O A;  2WU5 A;  5HY5 A;  2OLO A;  1JU2 A;  3LB8 A;  1JRX A;  1NHQ A;  3FPZ A;  3UOV A;  3AE8 A;  2XYO A;  2B76 A;  5J60 A;  1IUX A;  3DJJ A;  1GET A;  2BS3 A;  4NEW A;  4PAB A;  1KFY A;  4U8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...