4YT0A

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 209
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4yt0A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4yt0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4yt0A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4yt0A04
2QA1A 4XWZA 5JCNA 1FEBA 2FJEA 1E6EA 3EF6A 2YG3A 3UKPA 1S3EA 5GRTA 4YXDA 1N1PA 2BS4A 1GT8A 1NG4A 1H7XA 2DKHA 2V61A 3II4A 2V3AA 3M13A 1P2EA 3P9UA 2GR0A 1SEZA 2V5ZA 3AD8B 2F5ZA 4H2RA 4Z44A 5BRTA 1IUWA 4PABA 2GF3A 2WOVA 3CN8A 4A5LA 3G5SA 5TR3A 2BC0A 2LFCA 3GYJA 3NG7X 1BF3A 1UKVG 3AYJA 1PXBA 2RGHA 3QVPA 2GR1A 3O0HA 4APNA 4B66A 1JNZA 2R9ZA 1ZOYA 2X8GA 5DBJA 2GRTA 3CNPA 2R4EA 4Y4MA 2XLTA 2X8HA 1E1NA 2XVJA 3NRNA 1TYPA 3GRTA 2BC1A 2GAHB 1CJ4A 1K0LA 2BACA 3K7TA 3K7MX 3NIXA 3UP4A 4BURA 1IUTA 3GRSA 5KWFA 4BK2A 4GDEA 3V3OA 3ALMA 3NN0X 4H50A 5EBKA 1F8SA 1X31B 2XFQA 4Z2TA 2CULA 3DJGX 2AAQA 1BGNA 3GMBA 3NK2X 4IV9A 2GQWA 2TPRA 4OPLA 1PBDA 3AE2A 1RP0A 3ZDNA 4OCGA 3CGDA 1GPEA 1PBBA 1LVLA 4P9SA 4YKFA 3G5QA 3JSKA 3KA7A 3KU9A 3AEEA 2O9ZA 3I6DA 2FJAA 3L1RA 5CQFA 4GUVA 4B67A 4RG3A 1NHPA 3LOVA 3F8PA 4Z24A 3V3NA 3NYEA 4UDQA 2Z5YA 1CJ2A 1PXAA 2YG6A 1K4QA 3GDPA 4NTCA 5KRQA 4CNKA 1YQ3A 4U8KA 2BK5A 3DH9A 2E4GA 4JQ9A 2GMHA 2RABA 2WP5A 2B7RA 2VQ7A 3NLCA 3AEDA 2GH5A 3AYIA 1LV0A 3CPJG 4D03A 3QSMA 3VR8A 1JEHA 1P2HA 3Q9TA 1N4WA 4K5RA 1CBOA 1CC2A 2B7SA 2C73A 2JB2A 4J31A 5M10A 2EQ8A 2OALA 4OPIA 1ZMDA 2R0GA 3REDA 2C7GA 1COYA 3AD9B 5JCMA 4AP1A 3BI4A 3P1WA 5EB4A 1ELIA 1KFYA 5BVAA 5FS6A 3SQPA 2V3BA 4C5OA 4YSHA 1Q1WA 3CNJA 4UDPA 2JK6A 4AT0A 1YQ4A 2EQ6A 1E1MA 4MJWA 2WDRA 1GRGA 1ONFA 3BHFA 1EL8A 3LZXA 1GXFA 1YQZA 4IVMB 1PBCA 4B64A 4K5SA 3G5RA 1Y56B 1M6IA 2X3NA 4CNJA 4H4RA 4AOXA 4J33A 3ICSA 3GWFA 4NEVA 2YM1A 3GDNA 4TM3A 3LJPA 2EQ9A 2ZZCA 4U8IA 4EQSA 2WDQA 1NHQA 2OLOA 4FK1C 3CGBA 1TDKA 1JRXA 2ZZ0A 2C64A 2B76A 1JRYA 4H4SA 1XHCA 4NEWA 4C74A 3P4RA 1KSSA 3SFEA 1GRHA 1S2YA 2GV8A 3KD9A 2BXSA 3KPFA 4EQRA 2BCGG 2WOIA 1D4DA 3FG2P 1Y0PA 4JN9A 2VVMA 4H2NA 2NPXA 3NYFA 3D8XA 1H7WA 3UTEA 1E1LA 2AQJA 4U8JA 3VRAA 1ZOVA 3BI5A 1Q1RA 2VOUA 1MXTA 3ADAB 2AR8A 2XVHA 2VRLA 1ZMCA 2BA9A 4HA6A 1OJCA 2Z5XA 3CIRA 3GMCA 4U8NA 4K22A 2VZ2A 4CRTA 1AOGA 2IVEA 1D7LA 1ZY8A 1DOEA 3AYLA 3EANA 4ZCDA 3HZLA 4X9NA 5J7XA 4X9MA 2R0PA 3UKHA 3AE5A 3NK1X 1FL2A 4OPGA 2VVLG 3AEBA 2YG4A 1PS9A 2BABA 2B9XA 1GRTA 3M0OA 3GSIA 1LPFA 2WETA 4JNAA 4GF7A 1GTHA 3NK0X 1D7YA 2YLZA 3UKLA 3NTDA 4U2TA 1DJQA 4NTDA 3UTGA 3UKQA 2GQFA 4H4UA 1GRFA 1KSUA 3VRBA 3V76A 2GMJA 2WP6A 4J34A 2EQ7A 1VQWA 1H82A 3FPZA 2FBWA 1BZLA 1K0IA 3AEFA 1K0JA 1GALA 4H4QA 2JB3A 2QA2A 4CCRA 1PHHA 2A89A 4C3XA 3ITJA 2XFNA 2NVKX 2FJBA 4A9WA 2JBVA 1GESA 2YLSA 1GSNA 3FIMB 1RYIA 3UOYA 4D04A 5HXIA 2GR2A 1TRBA 1D4CA 2YLWA 5U25A 1OJAA 4U8MA 1MOKA 1GTEA 1XANA 2X8CA 3OC4A 4KPRA 1NENA 1CF3A 1GRBA 2BYBA 3QSSA 4XWRA 1CC4A 2V6OA 3COXA 4TM1A 4B69A 2APGA 2VRMA 1H83A 3GQKA 4H2QA 3RHAA 1ZDLA 3CNSA 1NG3A 1XDIA 3DGZA 3NH3X 4ZN0A 3CTYA 4DGKA 3GYIA 3ATQA 4JY3A 2YM2A 3FBSA 1QLBA 3UKFA 4B65A 5JCKA 1FEAA 2YLTA 3IF9A 1XPQA 3BNMA 5KXJA 4Y4NA 1CJCA 2WHDA 3DK4A 2RGJA 5IPYA 1CC6A 1O5WA 1JU2A 5FS9A 5CKUA 2I0ZA 2YLRA 2YR4A 3LADA 4YWOA 4USQA 1H81A 4YSZA 2XYOA 2ACZA 3L8KA 2RGOA 3CPIG 4GRTA 1H6VA 4EIQA 2BS3A 2YWLA 3DJEA 1VG9A 4TM0A 4USRA 3URHA 1TYTA 2BCPA 4YTPA 1REOA 1CJ3A 3AB1A 1F8RA 4IA6A 5KOXA 3UCLA 5U63A 1KNRA 4TLZA 2R45A 1NHRA 2JKCA 4KX6A 1F8WA 2PYXA 4TM4A 4WCTA 2XLPA 3DMEA 2BK4A 4B1BA 2WS3A 5GSNA 5JCLA 3EAOA 3UOXA 4FK1A 3AE1A 2WU5A 2XVEA 2R4JA 3NYCA 3AEGA 4YT0A 2B9WA 2WPCA 4ZCCA 4H4YA 1F6MA 3E1TA 3ABVA 4C3YA 1EL9A 2XDOA 4FX9A 1IUSA 1YKJA 3RP6A 4U8OA 4WX1A 4OPCA 2C76A 4B68A 2C65A 4A6NA 1ZP0A 2BS2A 3DGHA 5J60A 1GV4A 1JNRA 5FS7A 1BWCA 3CNTA 1NEKA 1FECA 2VQBA 3GYXA 1N4VA 1PJ7A 1F3PA 3SM8A 5L46A 2FJDA 4EMJA 1PBEA 4A99A 3CPHG 3NKSA 4J2WA 1W4XA 1FCDA 2GVCA 3GWDA 4A79A 2C66A 2CDUA 4B63A 2R46A 4OPTA 4AP3A 1NPXA 3PVCA 1HYUA 2GB0A 4H4VA 4BJYA 1KNPA 2A8XA 4ECHA 2XFPA 1ZKQA 4H4WA 2CFYA 2OAMA 1IJHA 3RP8A 1QO8A 3H4KA 3NN6X 3H8IA 4CY6A 3CNDA 2XFOA 4ICYA 5KVIA 3IHGA 5IQ1A 3VRDB 4BV6A 3LB8A 4I59A 3AE7A 1GETA 2YVGA 3GD4A 3P4PA 4HB9A 1DXLA 1PJ5A 3F8RA 1PDHA 1RSGA 4U2LA 1M64A 3GD3A 2DKIA 2BXRA 5FS8A 2JAEA 2OLNA 3R9UA 3I3LA 4OPDA 4XXGA 4YSYA 1LTXR 4H4ZA 2E1MA 1JOAA 3DJJA 1S3BA 3NT6A 4H7UA 2XVFA 1Y56A 2C3CA 2Q0KA 2C67A 2XFUA 5ER0A 2B9YA 3FMWA 4I58A 4LA1A 4EQWA 3ZYXA 1L0VA 3AE6A 4EIPA 2YLXA 5FMHA 1B4VA 5C3JA 3GQHA 5C2TA 3ALJA 3EPTA 2YR5A 3Q6JA 2ZBWA 3K30A 2YVFA 2CVJA 3QVRA 4JNQA 3SUCA 2WP9A 2WOWA 1L9CA 1EBDA 1NDAA 1YY5A 2YVJA 3DA1A 3LXDA 2C3DA 1TDEA 1KDGA 2JB1A 4O5UA 3S61A 3ATRA 3CGEA 2Y6QA 4LIIA 4M52A 2C70A 1GEUA 5BUKA 1E39A 1JRZA 1Z6LA 3NGCX 4YSXA 3QFBA 4OVIA 2YG5A 1ZX9A 2GEWA 1GRAA 3B3RA 3C4AA 2XLRA 1DOCA 1PN0A 1OJTA 2XLUA 4CBQA 4Z26A 2X50A 3IWAA 4H4XA 2ZZBA 1O94A 4H4TA 4O5QA 2WPFA 5KVHA 2ARDA 1ZK7A 2XVIA 1QJDA 4U8LA 3CGCA 3S5WA 3KVEA 3LZWA 1CHUA 1TDNA 4GR1A 3KLJA 2IVDA 1DNCA 3DK8A 4IA5A 1GNDA 3D1CA 4J36A 3NNEA 2OA1A 4H2PA 3P4QA 2E5VA 2R0CA 2WBAA 4JY2A 4U2SA 1L9EA 1B8SA 1IUXA 1LJ1A 3ISHA 4NZHA 4UDRA 1B5QA 4EMIA 5EB5A 4NTEA 1E7PA 3NTAA 3PS9A 3UTHA 4Z25A 4J56A 3UKAA 3VR9A 3BNUA 2GR3A 3IC9A 3QJ4A 4H4PA 1DODA 3SGLA 1O95A 2PHHA 2X99A 4EM4A 2GAGB 4ADWA 1D5TA 5HHFA 3C4NA 4DSGA 3AE4A 3P4SA 4IVOB 3KKJA 3ALLA 2WDVA 1EL5A 3H8LA 4K7ZA 2VVLA 4J57A 1LQTA 4X4JA 4Z2UA 1FOHA 2WEUA 3UP5A 3AWIA 3QFAA 3ICTA 4A6NB 3QSEA 4E0VA 3AE8A 3AE3A 1OJDA 4K8DA 4RSLA 2H89A 4BJZA 3AECA 3RNMA 1N4UA 2WESA 3F8DA 1MO9A 1LQUA 4U8PA 1VDCA 3T37A 2H88A 2IIDA 1H86A 4AOSA 4Z2RA 4EM3A 1CL0A 2C72A 4GDPA 2XLSA 1IUVA 4RG4A 4CY8A 2YR6A 4YKGA 5KOWA 5HYMA 1H84A 2Q6UA 4K2XA 4A7AA 2Y6RA 3OZ2A 4OPUA 5U1OA 3WE0A 5IQ4A 1B37A 2C75A 4BK3A 3NHOX 1KF6A 2V60A 1DOBA 4BK1A 3C96A 5BULA 1EL7A 1TDOA 3M12A 5M0ZA 3AEAA 4YTMA 4TLXA 3RP7A 4C77A 2YQUA 4N9XA 4DSHA 4PAAA 2A87A 2QCUA 3IHMA 4EQXA 1PBFA 1PJ6A 3UTFA 4LU6A 3VQRA 3UKKA 4CCQA 1NHSA 5EOWA 2BK3A 5LV9A 5HY5A 1D4EA 1BGJA 3SFDA 1NAAA 4GCMA 1GERA 4A65A 2Q7VA 3BHKA 3UOZA 4REKA 4Y4LA 3AD7B 4DNAA 2YG7A 3K7QX 1OJ9A 1TDFA 2WPEA 2WU2A 1VRQB 1IUUA 1L9DA 2XCGA 1DJNA 1BKWA 5JCIA 2WQYA 4AT2A 3DK9A 1S2QA 2J3NA 2Q0LA 2UZZA 1Q9IA 3AE9A 3PO7A 3UOVA 4JDRA 3ICRA 4YTNA 1GOSA 1V59A 2TMDA 2YAUA 3AXBA 3DJDA 3BI2A 4FDCB 4UP3A 4Z43A 3B6DA 2HQMA 4EMWA 2W0HA 1GREA 1E1KA 1PXCA 1VG0A 2QAEA
chains in the Genus database with same CATH superfamily
4HWFA 4XWZA 4KBMB 3UFGA 2W2UA 1FEBA 5DJQC 2YG3A 5GRTA 3PUXF 4C5OA 3CX7B 4P09A 4HKAA 4FI5A 3ZJ2A 4IE5A 5BRTA 4GKKT 4A5LA 2V6YA 5TR3A 1UKVG 3DTOA 3AXJB 4LFBT 3AYJA 2NTXA 1PXBA 2RGHA 3QVPA 3TLWA 4APNA 5LGNB 2R9ZA 1NAFA 2IC6A 2R4EA 4YLHA 3TLUA 2XLTA 2VKDA 3NRNA 2BC1A 1RUH4 1BR1A 2LRKA 1CJ4A 4GK5E 3UP4A 4I0UA 4BURA 4OYKA 1IUTA 1HG2A 2IIUA 3NN0X 5FL1A 2BG9B 1X31B 3RIFA 2AAQA 1BGNA 4IV9A 1RMU4 2GQWA 4OPLA 4QXBB 3AVSA 3CGDA 3ONJA 2LLYA 2PY5A 1LVLA 5DQWA 1H8TD 3G5QA 2BDEA 4P0AA 2X51A 4B67A 1OWAA 2MBGA 4UDQA 4U2ZA 4UR9A 2Z5YA 2CXLA 1XNRT 4TNVA 4Q25A 3FXEB 3LSVA 3CMMA 5KRQA 3ZC1A 2FUPA 3J9X1 3N2OA 4H9NC 2VQ7A 4J2CA 1YW0A 2Z6EA 4GK0E 3CPZA 1CC2A 2C73A 1V9DA 2D2SA 1ZMDA 3CX8B 2C7GA 2XQ6A 4U33A 2M6IA 4ZS3A 4JEUB 5LB7B 3PTRB 4JLEA 4UVCB 1E1MA 3IHRA 4YJ3E 1YKEB 1PBCA 4B64A 4QH1A 1K5MD 1Y56B 4DR5T 4DR3T 2D9DA 3RQUA 4HWCA 4H4RA 3GWFA 1VBB4 2EQ9A 2ZZCA 2LEHA 2VVNA 2XAFB 4H9SE 1TDKA 3T31A 1JRXA 1XHCA 4NEWA 2C0SA 1IBKT 1KSSA 2YU1A 4MHCA 1GRHA 1S2YA 2GV8A 1IJ5A 3N9OA 4DV2T 4JI1T 4ZHQE 3B5MA 4HWHA 2IAKA 3CX6B 5LCYA 2I6HA 4LFAT 5AFUL 5HXSA 3KVBA 2VQFT 3BI5A 4HA6A 3CIRA 3GMCA 4U8NA 1DOEA 3AYLA 3HZLA 4DV0T 2WM9A 4CN4A 3AE5A 2XQ5A 4UIGA 3BQLA 3ZEFB 3A5XA 2WETA 4JNAA 5JH7E 3NK0X 2H7OA 3UKLA 4U2TA 1DJQA 4O2AE 2LSYA 3FZLB 2UUCT 3UKQA 3VRBA 2GMJA 3PU3A 3LG7A 1H82A 3OYZA 4H4QA 1GALA 4HFCA 4HFIA 2JB3A 2QA2A 4CCRA 4JI8T 3KPKA 4C3XA 2XFNA 2NVKX 1GSNA 3UOYA 1TRBA 3FZMB 5U25A 4Z90A 4PK6A 2X8CA 3HKEE 1CF3A 4XWRA 2BYBA 5CGMA 4EIWA 2XAJB 4TM1A 4PDWD 3PV0F 3GQKA 3MA9A 3CNSA 1NG3A 1XDIA 3NH3X 4UXNB 4OX9T 3PJAJ 3CTYA 2HHHT 1MMGA 4K0KT 5LGTB 2YM2A 1BEV4 1XPQA 3TKLB 5KXJA 2WHDA 2V7LA 4U3CA 3KFWX 4PFPA 2YR4A 3Q5WA 3MZKB 2ACZA 4O8SA 5JDHA 2CXDA 4ZEYA 4FJOA 2YWLA 2BCPA 4TWHA 5KNLA 1MNEA 1G73A 4IA6A 3RI5A 5KOXA 4QHOA 3JC6D 4GAVA 1IBLT 4TLZA 5JDMA 1F8WA 5KMPA 3N9QA 1PIV4 2WS3A 5GSNA 5HEJA 3UOXA 4DR6T 2WU5A 2BZBA 1RUF4 1YD8G 3MXZA 4ZCCA 4H4YA 1F6MA 4TWDA 5JRCB 4DV6T 5CA0E 1LVFA 4UEMA 3PU8A 3SYIA 1IUSA 4BAYB 3RLFF 3DGHA 3AAAB 5L47A 1FECA 3KV9A 2CHNA 4HEAA 4EMJA 3OYXA 2A72A 3LBXB 3CPHG 4ILCA 2GVCA 4DUYT 2C66A 2CDUA 4OPTA 2E9XC 5H6RB 4BJYA 1ZKQA 3ZN0B 2OAMA 3H8IA 3N9NA 3VRDB 2PG8A 2IW5B 5A1LA 4IT4A 3B13A 3LB8A 4I59A 2CBIA 4H9RC 4AQFC 4LMJA 3ZN1B 4IL9A 3I0OA 2C5KT 1S35A 3X1DA 4DNDA 1PO24 1HNXT 4X65T 4B3ST 1D1AA 3IF8B 3I3LA 4OPDA 2D0TA 5HXEA 1JOAA 1S3BA 4H7UA 2XFUA 2B9YA 2PFVA 3SRZA 4LA1A 1BR0A 4EQWA 1D0YA 1L0VA 4QWNB 3L09A 1KEYA 3ZMTB 1B4VA 3FHNA 1IJ6A 4Q4V4 1WR0A 3ZYLA 4QXHB 3QVRA 4GIWA 4IE7A 3SUCA 1YY5A 3DA1A 2C3DA 4HTEA 4ZI2C 4EZHA 3S61A 3ATRA 3BQKA 2Y6QA 4LIIA 5AQKB 4WBNE 2YG5A 2XUEA 4N78D 2A9UA 1GRAA 3GWHA 1OJTA 2IHR1 5J2TE 1O94A 3PUZF 4O5QA 2HPJA 2AE9A 4U8LA 4XBFB 5FY7A 3KVEA 3QB5K 1G8XA 1TDNA 4EB6E 3JD74 1W09A 4A5XA 2LSIA 3DK8A 4LMLA 1GNDA 5AQMB 3ESLA 3D1CA 3EAMA 3ZLIA 3NNEA 4H2PA 1H7CA 2R0CA 2WBAA 3E22E 4JBWF 1LJ1A 4UDRA 5EB5A 4NTEA 1E7PA 2MAWA 3RYIE 3BNUA 3SGLA 4EM4A 3OBVE 5J1GA 2CWOA 3ALLA 1QSDA 3SZ0A 2A2FX 2C5JA 2QGSA 2N2NA 3QOFA 3ICTA 4C91A 2R6GF 4E0VA 1OJDA 4IREA 2H89A 4ASKA 2VKHA 3AECA 1N4UA 2WESA 4ILUA 1WLXA 4JI4T 3F8DA 4U8PA 1VDCA 2VQET 4ISSA 1IZNB 2QRXA 4AOSA 5L3EB 4K0UA 4NIQA 2EHOC 4LMKA 2C72A 4RG4A 4WYVA 2YR6A 2B1EA 4YKGA 2V26A 3O9XA 4OPUA 2NTYA 3HR0A 5IQ4A 5LMNT 2VK9A 4BK3A 3KINB 2JQKA 4EV6A 4IDZA 2ZM2A 3M3ZB 2XTLA 5LG3A 1TDOA 2E2AA 2W66A 3LDQB 4H9PC 3IHMA 1PJ6A 4ILBA 1XNQT 4IDNA 2BRAA 5LV9A 4LF8T 4G6GA 3NZPA 3ZJ1A 1OJ9A 1TDFA 2WPEA 1IUUA 1DJNA 1BKWA 2IMLA 3PE0A 1S2QA 4CQIA 4ERRA 2J3NA 1Q9IA 3ICRA 1WYBA 2Q9QB 4PJNA 4YTNA 4Z43A 3BI2A 2X9XA 4UP3A 3B6DA 2ODUA 5H6QB 1GREA 3LJCA 4H4SA 3JADA 4LF5T 2QA1A 5JCNA 1I94T 1HX8A 5HEUA 3UKPA 4TN7B 5FXVA 1N1PA 2UUBT 1UX5A 3P9UA 2GR0A 2NOXA 1AR74 3LFMA 4WW0A 4Z44A 4U72A 3F2EA 3O1JA 3CN8A 3GYJA 3O1HA 3AAEB 1BF3A 2DCFA 1HG5A 1RUI4 2LOSA 2X9HA 3BQIA 4II2A 4YHHT 3NIXA 4IDQA 3V3OA 4PJLA 3CQXC 3Q5DA 4GYRA 1F8SA 2DNXA 2XFQA 5AQIB 2CULA 4DIDB 2L9QA 5FYMA 3AE2A 3ZDNA 3HKBE 2YN6A 1HF8A 3JSKA 3KA7A 3KU9A 2X5ID 2FJAA 1W0AA 4HWDA 4BJMA 3ZSSA 5LJNA 4RG3A 1UCUA 1NHPA 3F31A 3NYEA 2IDOB 2RS34 5BMVE 5AQPB 4CNKA 2LSKA 4ADZA 4JQ9A 5AQFB 2RABA 2WP5A 2WWUA 2X0YA 3HA4A 4G6HA 3AEDA 2LM2A 2GH5A 4ZI3D 3AYIA 3C64A 3CPJG 2EHOA 3VR8A 1X9BA 5FY1A 3NRXA 1P2HA 3F57A 2H7VC 4O4IE 3ZMSB 2EQ8A 2OALA 3HYVA 2R0GA 1EZ3A 1COYA 5JCMA 4AP1A 3JAFA 5FNVE 5EB4A 4WBOA 5BVAA 4NNJA 4NUUA 3P7IA 1Q1WA 3CNJA 4UDPA 4AT0A 1W9RA 2OLTA 3PUAA 2MOZA 3LZXA 4YFSA 5ETWA 3VKHA 4I4TE 2ZM6T 4CI2B 1NCQD 1SA0E 3GDNA 4EQSA 3OTOT 2WDQA 2CA5A 1VBC4 4EAHA 2NP9A 4FK1C 2K24A 2V1DB 2ZZ0A 4C74A 2BBJA 2YDRA 4U74A 4DMVA 4BA9A 3KPFA 4EQRA 2BCGG 2K3WA 1D4DA 4TUYE 4JN9A 3MACA 2NPXA 3NYFA 1E1LA 4U8JA 3RKGA 3CQGB 3ANWA 4EZ4A 5ABFB 1Q1RA 1OEDB 1MMNA 5FL0A 2VRLA 1ZMCA 2BA9A 2YOEA 2Z5XA 1VBA4 4CRTA 2IVEA 4NXNT 3EANA 4ZCDA 2PBIA 4X9NA 4QXCB 2N9DA 2XAGB 4X9MA 5J7XA 2R0PA 2BABA 1D1CA 2B9XA 5JVDE 2WSSV 3QUJA 3M0OA 4KUMB 1LPFA 3EABA 5FVLA 4U7YA 4PNIA 1KSUA 3V76A 4J34A 2JMHA 1HNZT 3FPZA 3FBZA 1K0JA 4ILAA 5FY0A 1GQEA 4X1YE 4A9WA 2JBVA 3FZFB 4GB34 2LHRA 1RYIA 2UUAT 2GR2A 2YLWA 4U8MA 1MOKA 2BVLA 3OC4A 5FKYA 4KPRA 2XJ7A 4DV3T 3RIUC 2V6OA 5LGUB 3CK6A 1OEDA 2VRMA 4E7SA 4H2QA 3RHAA 4E7ZA 5BR8T 3UT5E 1ZDLA 3DGZA 1VRBA 2WAUA 3AA1B 4EOZB 4B65A 5JCKA 1FEAA 3IF9A 1AR84 4KP3C 1CJCA 3RPUA 5CKUA 4F6RC 3LADA 4IIJE 1S94A 3L8KA 1H6VA 4CN6A 2BS3A 1D0ZA 4EIQA 1VG9A 5AQGB 4YTPA 1REOA 1CJ3A 3AB1A 2LM9A 2LOPA 3JAEA 5E0OA 4NWZA 3UCLA 3NZQA 5U63A 3R84B 2X67A 4EEBA 4UELA 4KX6A 3V5UA 4WCTA 4B1BA 5JCLA 2RPAA 3EAOA 1CUNA 4AKRB 2VKOA 4G63A 4YT0A 2LJLA 5HEOA 1EL9A 1KK7A 2XDOA 3QK6A 4U8OA 4B68A 2C65A 2BS2A 3P50A 1FIOA 2XPKA 4OK0A 1JNRA 3AXJA 5FS7A 3RH3A 3EHZA 3GYXA 3S4UA 2J62A 2OV9A 1ZKEA 1F3PA 2FJDA 5LHIB 3NKSA 5ABFA 4IDOA 1FCDA 1I6ZA 4A79A 4B63A 2R46A 1FMVA 2KMFA 2GB0A 1BR4A 1KNPA 1UX4A 2HWC4 2CFYA 2LHNA 1IJHA 3R6NA 5IWAT 3RP8A 2DLRA 3ETVA 3NN6X 2PYLA 3UQ7A 4ICYA 2PZSA 1MMDA 5IQ1A 1R094 3AE7A 1GETA 3AB3B 2BKNA 3Q5XA 4G9KA 3DP7A 3KVAA 3P4PA 2K5BB 4U2LA 3QNUA 4I55E 3UTKA 2BXRA 5LBQB 5FS8A 3N2GE 1RHI4 4IGUA 4YSYA 1OOPD 2E1MA 4LF7T 3VKGA 1LKXA 2WMOA 3FMWA 3ZYXA 3N9MA 1SHZC 5L3FB 1HR0T 4PJMA 3GQHA 3EPTA 3MJXA 2YR5A 3T1HT 4XAXB 4JNQA 4G73A 1NA1D 3H3MA 3K8PC 1XHZA 2W4XA 2JB1A 4AQFA 4M1PA 2LT3A 5ABGA 3NGCX 4OVIA 4X64T 1HX1B 2GEWA 3C4AA 1DOCA 1PN0A 2XLUA 4UV8B 4UF0B 2X50A 4H4XA 2ZZBA 5KVHA 4DMWA 2WPFA 4UF0A 2ARDA 2XVIA 1QJDA 3RRCA 3ZMUB 4EXTA 5JDLA 4HFEA 1CHUA 2XHEB 1VOMA 1DNCA 1RUC4 4L9IA 2JIWA 2OA1A 2DL1A 4U31A 2DI4A 2JQQA 2EHOB 2V7KA 4U2SA 1IUXA 2WY2A 3PUWF 4NZHA 2PYJA 3H37A 4HWIB 4EMIA 4Z25A 4EEDA 3UKAA 1XMOT 3A7MA 4DR7T 2VURA 3IC9A 4B3TT 4H4PA 2JRKA 3QC9A 4DR1T 3T14A 2SPCA 4IVOB 3KKJA 2HN1A 2WDVA 4HFBA 4IE4A 4L0RA 1EL5A 4HE8A 5LOVE 1FOHA 5LG4A 2NW7A 3UP5A 3SXIA 4HN9A 3QSEA 3AE8A 4LF6T 3C98B 4RSLA 2Y6XA 3ONLC 1YKHB 3T37A 2H88A 3K3NA 5JDGA 2YEVC 4H63V 1MIYA 1HTJF 4EM3A 1UURA 1ZEEA 5HYMA 1H84A 4K2XA 4A7AA 3L8RA 5U1OA 4AKGA 4UV9B 1MIVA 3HYXA 1DOBA 3C96A 1EL7A 4C77A 2XQ3A 2V5CA 4N9XA 4YJ2E 2W00A 4IE0A 2A87A 2RP4A 1PBFA 5EOWA 4WZXA 3SFDA 4GCMA 2GK9A 4A65A 4Q4W4 3U78A 3UOZA 4REKA 4WNKA 1MMAA 2YG7A 5AQLB 2BKOA 3K7QX 2C5IT 1XHXA 4QH5A 3IBPA 4OFZA 5JCIA 4H9QC 2XY8B 4O4LE 4DO0A 3UOVA 2H3RA 2X0HA 1GOSA 3AXBA 4FDCB 3DJDA 3ZYMA 5AQTB 3PUSA 4IHJE 2W0HA 1UGOA 1VG0A 2ZM0A 3OKQA 4H63H 3ZT7A 2XAQB 1GT8A 2DKHA 2V61A 3D0TA 4O4HE 1SEZA 3AD8B 1EV14 4DVDA 1IUWA 4PABA 4YY3T 2WOVA 2KT9A 5ABEA 3G5SA 4KHPT 5HYAA 2R074 1ASJ4 2GR1A 3EVYA 3O0HA 4B66A 1ZOYA 2W61A 2V5DA 3N5LA 3RKOA 2RM24 4Y4MA 3DJBA 2X8HA 1E1NA 2XVJA 1TYPA 4GOUA 3GRTA 3O1IA 2LRLA 1K0LA 1E1HB 3RC8A 4BK2A 1MQTD 2RS54 4ANJA 1T8BA 4Z2TA 3DJGX 2TPRA 1RP0A 1GPEA 4ISTA 3FZHB 4YKFA 3AEEA 3I6DA 4ZI7E 4B3MT 4AISA 2RR14 3PUVF 1PXAA 4NTCA 4U8KA 3T2YA 3O4XE 3RQWA 3JC6C 1LV0A 4MBQA 5LP6E 3T1YT 4D03A 4K5RA 1CBOA 4V1Av 2B7SA 2JB2A 2WB5A 2E9XD 2MPKA 4OPIA 3REDA 3UU3A 1AJ3A 3BI4A 3RYHE 3P1WA 2UXXB 4JI2T 1XDOA 1ELIA 5KX5E 3SOLA 5FS6A 4NPPA 1OEDC 2BBHA 2V3BA 2JK6A 4DV1T 2EQ6A 3WAJA 2WDRA 1GRGA 3OJAA 4LFCT 1GXFA 1YQZA 4EYYR 5HWXA 4Z8XA 1M6IA 2HH7A 3GMIA 3KV6A 4AOXA 4J33A 1WYCA 1N34T 3PDYA 3ZC0A 1NHQA 5AQQB 2CRBA 1EAH4 2DHRA 2ES0A 3EUHA 4JEHB 5LHHB 5IUXA 3KD9A 2BXSA 2WOIA 3FG2P 1Y0PA 5FP3A 1H7WA 2AQJA 5HCJA 3VRAA 3JBG4 4TZ4C 5KMRA 2V6XA 3FB2A 2AR8A 2XVHA 1VBE4 3JCFA 1D7LA 2J4GA 4OPGA 5LA6E 2YG4A 3AEBA 3NBXX 2WWVA 4GF7A 1SUMB 3CKDA 5AQJB 1O3XA 3UTGA 2GQFA 4H4UA 2RA1A 1GRFA 3KBUA 1VQWA 2FBWA 5HEHA 1BZLA 2V8SV 3AEFA 3T2KA 2LKGA 5AQOB 1PHHA 3M65A 1SE7A 2FJBA 2YLSA 3FIMB 5L2LA 3I0QA 3MK7C 5M4YA 3Q9DA 3ZSTA 1XANA 2CWYA 1GRBA 2VWAA 3TLVA 1M62A 3I1AA 3RC3A 3COXA 4P1NA 1HNWT 4DR2T 2HN2A 3LK2B 4ZN0A 5AQNB 4DGKA 3GYIA 3ATQA 1PVC4 1OEDE 3RIUA 2WZHA 4CXXA 3BNMA 4Y4NA 3DK4A 2RGJA 4LF4T 4COFA 1CC6A 1O5WA 1JU2A 5FS9A 2UXDT 2YLRA 4AKHA 4USQA 1H81A 3SZWA 4YSZA 2XYOA 4A56A 4TM0A 3URHA 3GA8A 3C4XA 3CQCB 1F8RA 4TX5A 5CJ5A 5HAXA 3WAKA 1KNRA 3UQ4A 1NWMX 3EDVA 1NHRA 2PYXA 5L3BB 5IHYA 3DMEA 2BK4A 2N1GA 4PW8A 3AE1A 5L3CB 3NYCA 3AEGA 2B9WA 3E1TA 3HL6A 2CMRA 4HGAA 1UK5A 2KINB 4FX9A 1YKJA 3RP6A 5ABHA 2C76A 3MKDA 4A6NA 1ZP0A 4A97A 2ODVA 3UUMA 1GV4A 4KI0F 1MNDA 1BWCA 3CNTA 2VQBA 1N4VA 1PJ7A 5L46A 1T7SA 1PBEA 5JQGE 4CN1A 5L3DB 4J2WA 1W4XA 3UUNA 3I9YA 4AP3A 1NPXA 3PVCA 4H4VA 4KHZF 5KMGP 2M67A 3HKDE 3T8OA 4CY6A 3CNDA 2XFOA 5KVIA 1PO14 2JQHA 1HXS4 1DU2A 2DWGA 1PDHA 3GD3A 2DKIA 1HS7A 2JAEA 1J5ET 2OLNA 3R9UA 4XXGA 1Y56A 2C3CA 2Q0KA 2C67A 4ZOLE 1J1JA 2XAHB 5C3JA 1D4M4 4O4JE 3ALJA 3Q6JA 2YVFA 3ZT6A 2NW9A 2CLYB 2WP9A 2WOWA 3KV4A 1L9CA 1EBDA 4QX7B 3FBLA 1NDAA 4EGWA 4PFOA 2WZIA 5JR9A 1KDGA 4II3A 4O5UA 5TAOA 2W62A 3CMLA 5JR9B 4YHJA 3ZCIA 3FXDB 5AQUB 5JRCA 2C70A 1AR64 1JRZA 5JTGA 1Z6LA 4YSXA 3HKCE 2DWKA 4MFRA 1ZX9A 3B3RA 4CBQA 2F4VT 4Z26A 2W67A 3C50A 4H4TA 3HYWA 5F3JA 2LE8A 3S5WA 3LZWA 2QA7A 2L3LA 5J2UE 5LHGB 4GR1A 3KLJA 2IVDA 2R044 2LSGA 4IA5A 3C4ZA 5FXXA 4JY2A 1R8IA 1L9EA 1B8SA 3B57A 3V5SA 2X9YA 3ISHA 5LMUT 4IE6A 4CZZB 2YDQA 3VR9A 3QJ4A 2GR3A 1DODA 5HXHA 2X99A 4OYJA 2E9XB 3AE4A 3RHWA 3ZKRA 4DSGA 4X66T 5HWYA 3E0ZA 2E9XA 2XQ7A 1J5WA 2D0UA 4QX8B 3OPCA 2W0GA 4J57A 4JI7T 5FMNA 4CXWA 2BG9E 3UUXB 3RYFE 2WEUA 4A6NB 1RUG4 2XM2A 3AE3A 4BJZA 2XQ8A 3RNMA 3C51A 4DR4T 4IL4A 1D0XA 1MO9A 2VASA 1RVF4 1IBMT 2RS14 4ZS2A 2QYWA 2IIDA 2IUBA 2OA5A 4A98A 1CL0A 4GDPA 4CY8A 2X9WA 4JI3T 2Y6RA 3OZ2A 3WE0A 2VKJA 1XZYA 2KNDA 2C75A 2UU9T 3NHOX 1YXRA 2V60A 4AIUA 3LK3B 2PTFA 3RYCE 3UUBA 5BULA 3AEAA 4YTMA 4TLXA 3RP7A 2YINA 1WR6A 2YQUA 4DSHA 4PAAA 2QCUA 3UTFA 3UKKA 1D1BA 4CCQA 1D4EA 1BGJA 5CFBA 2XQ9A 3P8CD 3AD7B 2E5LT 4DV4T 5CA1E 2VB6A 2IC9A 3EI0A 5JDQA 2WU2A 1RUD4 2I0MA 1VCSA 2XCGA 4AT2A 2Q0LA 4IDPA 2UZZA 3PO7A 3UULA 2WMNA 4JDRA 2YAUA 4O2BE 3KV5A 2HQMA 1E1KA 2YVJA 4X4JA 4PAGA 2FJEA 2JMKA 1E6EA 3EF6A 1S3EA 4CXYA 4YXDA 1NG4A 2BS4A 3M13A 1H7XA 4C90A 3II4A 3N2KE 2V3AA 1P2EA 2XQAA 2V5ZA 2F5ZA 3K3QC 2QVAA 4H2RA 4X20E 2HWB4 2GF3A 2YKSA 2BC0A 2LFCA 2ZLYA 3NG7X 2D5UA 5HXRA 4DBQA 4DUZT 4TV8E 3AVRA 5HXCA 3RGLA 3BK9A 1JNZA 1LRZA 2X8GA 2GRTA 5DBJA 3CNPA 1VBD4 2WCAA 2GAHB 1MIWA 3K7MX 2BACA 3LBXA 3K7TA 2I59A 3GRSA 5KWFA 4GDEA 3ALMA 5EBKA 4H50A 3ZCJA 3GMBA 3NK2X 1PBDA 4OCGA 3NRYA 5F8PA 1PBBA 2AXDS 4P9SA 2XSBA 4DV5T 2PJQA 5EK2A 3L1RA 1UUSA 2O9ZA 5CQFA 4GUVA 2KWHA 5L3GB 3LOVA 4Z24A 3F8PA 3V3NA 4B3RT 2M6BA 1CJ2A 2YG6A 1K4QA 3GDPA 3SX6A 1U4QA 1YQ3A 3ZT5A 2NR4A 2BK5A 3DH9A 2L8KA 3QB5A 2E4GA 4DV7T 2EHOD 5L4EA 2GMHA 2Q9QD 4JV5T 2B7RA 3ETUA 3NLCA 2JPFA 1HRI4 3QSMA 1JEHA 3Q9TA 1N4WA 1VCTA 2MTQA 3GN5A 4I43B 4J31A 3NWIA 5M10A 4NUVA 3RRWA 4JUYA 3NVOA 5LYJE 1RUE4 3AD9B 1FEWA 4UVBB 2Q9QC 3I9WA 4QKNA 1KFYA 3SQPA 1Z0PA 4YSHA 1M7KA 2X66A 3PUQA 4Z91A 4HFDA 1YQ4A 4MJWA 2CBJA 1ONFA 4OHFA 4JYAT 3BHFA 1EL8A 4DBRA 4IVMB 2X68A 4ZZBA 1ZV4X 4K5SA 3G5RA 2X3NA 3W15B 4CNJA 4I50E 3ICSA 4NEVA 2KXPB 2YM1A 4TM3A 3LJPA 4TWFA 4U8IA 2KWIB 2E8IA 3OVUA 1POV0 2OLOA 3CGBA 3AA7B 1U5PA 2C64A 2B76A 1JRYA 2UXBT 3P4RA 3SFEA 3SY4A 2A3DA 4AXPA 1T72A 2VVMA 4H2NA 3D8XA 1WCRA 1QUUA 3UTEA 1BR2A 1ZOVA 3J7Yq 2VOUA 2NW8A 1R084 1MXTA 3ADAB 2ACXA 1OJCA 3FZKB 3NKZA 5LJMA 4K22A 2VZ2A 2PLV4 1AOGA 3L3PA 4PK4A 1ZY8A 2HPLA 3UKHA 3NK1X 1FL2A 3ZMZB 2VVLG 1PS9A 1Z8UA 1GRTA 3AAIA 1W0BA 3GSIA 5C8YE 1GTHA 1D7YA 2YLZA 1ZHCA 3NTDA 5EK3A 4NTDA 2WP6A 2R064 2EQ7A 3RF1A 4JI5T 1K0IA 5GONE 3TLSA 1WFDA 2A89A 3AA6B 5IYZE 3ITJA 2PW9A 3HI2A 2G0UA 2RMU4 1GESA 4D04A 5HXIA 3VU7H 3SZCA 2LSJA 1D4CA 1OJAA 1GTEA 3ZYKA 1E2AA 1NENA 1AL24 3QSSA 2KZ7B 3IA3A 1CC4A 3SS1A 5EK4A 5KMQA 1T98A 1KNZA 2CE7A 4B69A 2APGA 2J47A 1H83A 3RIAA 2EX3A 3CVRA 5JREA 1AR94 5LNKA 4JY3A 3FBSA 1QLBA 3UKFA 2YLTA 3E08A 4G74A 2Q9QA 1OXZA 3T0KA 3UU5A 3T2ZA 2V7MA 5IPYA 2CPTA 4L5GA 4H9OC 2I0ZA 3ZMVB 2ZMAA 4F8HA 4YWOA 2BG9A 5JDFA 4MLKA 2RGOA 3CPIG 4GRTA 5JDNA 3DJEA 2Y48B 4USRA 1TYTA 3UFEA 3Q2MA 4AQGA 3Q5EA 5J0ZA 4AQYT 1FJGT 1N32T 4EYUA 5CB4E 4GYSA 3H3AA 4GKJT 4PK5A 3N9PA 2R45A 2JKCA 1XI1A 4QH4A 4TM4A 2WBLA 4CI1B 2XLPA 4NXMT 2XSAA 4HFVA 4FK1A 3PUYF 2XVEA 4JI0T 2R4JA 2CM0A 1XMQT 2WPCA 1X79A 2NWBA 3ABVA 4C3YA 2LKHA 3A8YC 1HRV4 1XDPA 4WX1A 4OPCA 1Y64B 3K3OA 5J60A 2JQ9A 1NEKA 2W63A 2UXCT 2XQYA 3SM8A 4ZXLA 1HCIA 4HFHA 4A99A 2ZM8A 5AQVB 4BJNA 2X0LB 3AA0B 4G2AA 3GWDA 3GN5B 4AKLA 1HYUA 4U7IA 2A8XA 1RUJ4 4ECHA 2XFPA 5AQHB 4H4WA 3C4WA 3RX6A 1QO8A 3H4KA 1Y01A 3IHGA 2CEAA 4BV6A 2YVGA 4U2YA 4Q4Y4 4X5TA 3GD4A 4HB9A 3IEEA 1DXLA 5KDMC 1PJ5A 2P9BA 3F8RA 1RSGA 3WI3A 1M64A 2C4CA 4JI6T 1Z7S4 1LTXR 4H4ZA 3DJJA 3NT6A 5EZYE 2XVFA 3PUGA 5ER0A 4I58A 3K1SA 2MYSA 5FXWA 3AE6A 4EIPA 1WRDA 2YLXA 2K9AA 5FMHA 3VHLA 5C2TA 1LVKA 2ZBWA 3K30A 3ZPOA 2CVJA 3UU6A 2V7IA 3FI7A 2BKPA 2BG9C 4X1IE 5LBMA 3LXDA 2CHOA 2VL8A 1TDEA 5FVKA 4TV9E 3CGEA 4M52A 1GEUA 5BUKA 1E39A 2KSRA 3QFBA 3ANWB 3PURA 2XLRA 3SWHA 3IWAA 1ZK7A 5LXTE 3CGCA 2R7FA 4B6XA 4ZI2D 4J36A 3P4QA 2E5VA 3KBTA 2UXNB 5FXZA 1B5QA 3NTAA 3PS9A 3PJAA 2Y8DA 3UTHA 4J56A 2CCQA 3SZFA 1O95A 2PHHA 2XM1A 2V7JA 2GAGB 2KLQA 5DABA 4ADWA 1D5TA 1N33T 3C4NA 5HHFA 3P4SA 3H8LA 5AQSB 4K7ZA 4X62T 2VVLA 1LQTA 4Z2UA 2XASB 3AWIA 3QFAA 3ONXA 5F5WA 3U3IA 3N9LA 4P0BA 3LK42 5DQVA 2V6YB 4K8DA 2CXFA 1LQUA 2YU2A 3TLTA 2YDSA 2BVMA 3P4WA 5KMSA 2YK0A 1H86A 4MALA 4PJJA 5AQRB 2JJ9A 4Z2RA 2XLSA 1IUVA 5KOWA 4Q4X4 2Q6UA 5HCMA 1FMWA 3EDUA 4X1KE 1B37A 1KF6A 4BK1A 2J1DG 2XQ4A 5L4HA 3M12A 5M0ZA 3UU8A 5ADXL 1VRH4 3UU4A 4CI3B 4XZCA 2K48A 4EQXA 2VVSA 4TNWA 4LU6A 3VQRA 1NHSA 2BK3A 2CLYC 5HY5A 5JR9C 1XWMA 4UVAB 1GERA 4AI6A 1NAAA 2Q7VA 3L39A 3BHKA 4KMCA 4Y4LA 2XZEA 2VL0A 4DNAA 4GAPA 1HFAA 1VRQB 1N36T 4LF9T 4ZZCA 1L9DA 4ZI3C 2WQYA 2BRYA 3DK9A 1US7B 3CWZB 3AE9A 5HEGA 1COV4 1IAPA 1V59A 2TMDA 3KDSE 3J8F4 3G06A 4EMWA 1B7TA 4AKIA 4RHV4 1PXCA 2QAEA
chains in the Genus database with same CATH topology
2QA1A 4XWZA 5JCNA 1FEBA 2FJEA 1E6EA 3EF6A 2YG3A 3UKPA 1S3EA 5GRTA 4YXDA 1N1PA 2BS4A 1GT8A 1NG4A 1H7XA 2DKHA 2V61A 3II4A 2V3AA 3M13A 1P2EA 3P9UA 2GR0A 1SEZA 2V5ZA 3AD8B 2F5ZA 4H2RA 4Z44A 5BRTA 1IUWA 4PABA 2GF3A 2WOVA 3CN8A 4A5LA 3G5SA 5TR3A 2BC0A 2LFCA 3GYJA 3NG7X 1BF3A 1UKVG 3AYJA 1PXBA 2RGHA 3QVPA 2GR1A 3O0HA 4APNA 4B66A 4II2A 1JNZA 2R9ZA 1ZOYA 2X8GA 5DBJA 2GRTA 3CNPA 2R4EA 4Y4MA 2XLTA 2X8HA 1E1NA 2XVJA 3NRNA 1TYPA 3GRTA 2BC1A 2GAHB 1CJ4A 1K0LA 2BACA 3K7TA 3K7MX 3NIXA 3UP4A 4BURA 1IUTA 3GRSA 5KWFA 4BK2A 4GDEA 3V3OA 3ALMA 3NN0X 4H50A 5EBKA 1F8SA 1X31B 2XFQA 4Z2TA 2CULA 3DJGX 2AAQA 1BGNA 3GMBA 3NK2X 4IV9A 2GQWA 2TPRA 4OPLA 1PBDA 3AE2A 1RP0A 3ZDNA 4OCGA 3CGDA 1GPEA 1PBBA 1LVLA 4P9SA 4YKFA 3G5QA 3JSKA 3KA7A 3KU9A 3AEEA 2O9ZA 3I6DA 2FJAA 3L1RA 5CQFA 4GUVA 4B67A 4RG3A 1NHPA 3LOVA 3F8PA 4Z24A 3V3NA 3NYEA 4UDQA 2Z5YA 1CJ2A 1PXAA 2YG6A 1K4QA 3GDPA 4NTCA 3CMMA 5KRQA 3SX6A 4CNKA 1YQ3A 4U8KA 2BK5A 3DH9A 2E4GA 4JQ9A 3T2YA 2GMHA 2RABA 2WP5A 2B7RA 2VQ7A 3NLCA 3AEDA 2GH5A 3AYIA 4G6HA 1LV0A 3CPJG 4D03A 3QSMA 3VR8A 1JEHA 1P2HA 3Q9TA 1N4WA 4K5RA 1CBOA 1CC2A 2B7SA 2C73A 2JB2A 4J31A 5M10A 2EQ8A 2OALA 4OPIA 1ZMDA 3HYVA 2R0GA 3REDA 2C7GA 1COYA 3AD9B 5JCMA 4AP1A 3BI4A 3P1WA 5EB4A 1ELIA 1KFYA 5BVAA 5FS6A 3SQPA 2V3BA 4C5OA 4YSHA 4NNJA 1Q1WA 3CNJA 4UDPA 2JK6A 4AT0A 1YQ4A 2EQ6A 1E1MA 4MJWA 2WDRA 1GRGA 1ONFA 3BHFA 1EL8A 3LZXA 1GXFA 1YQZA 4IVMB 1PBCA 4B64A 4K5SA 3G5RA 1Y56B 1M6IA 2X3NA 4CNJA 4H4RA 4AOXA 4J33A 3ICSA 3GWFA 4NEVA 2YM1A 3GDNA 4TM3A 3LJPA 2EQ9A 2ZZCA 4U8IA 4EQSA 2WDQA 1NHQA 2OLOA 4FK1C 3CGBA 1TDKA 3T31A 1JRXA 2ZZ0A 2C64A 2B76A 1JRYA 4H4SA 1XHCA 4NEWA 4C74A 3P4RA 1KSSA 3SFEA 3SY4A 1GRHA 1S2YA 2GV8A 3KD9A 2BXSA 3KPFA 4EQRA 2BCGG 2WOIA 1D4DA 3FG2P 1Y0PA 4JN9A 2VVMA 4H2NA 2NPXA 3NYFA 3D8XA 1H7WA 3UTEA 1E1LA 2AQJA 4U8JA 3VRAA 1ZOVA 5KMRA 3BI5A 1Q1RA 2VOUA 1MXTA 3ADAB 2AR8A 2XVHA 2VRLA 1ZMCA 2BA9A 4HA6A 1OJCA 2Z5XA 3CIRA 3GMCA 4U8NA 4K22A 2VZ2A 4CRTA 1AOGA 2IVEA 1D7LA 1ZY8A 1DOEA 3AYLA 3EANA 4ZCDA 3HZLA 4X9NA 5J7XA 4X9MA 2R0PA 3UKHA 3AE5A 3NK1X 1FL2A 4OPGA 2VVLG 3AEBA 2YG4A 1PS9A 2BABA 2B9XA 1GRTA 3M0OA 3GSIA 1LPFA 2WETA 4JNAA 4GF7A 1GTHA 3NK0X 1D7YA 2YLZA 3UKLA 3NTDA 4U2TA 1DJQA 4NTDA 3UTGA 3UKQA 2GQFA 4H4UA 1GRFA 1KSUA 3VRBA 3V76A 2GMJA 2WP6A 4J34A 2EQ7A 1VQWA 1H82A 3FPZA 2FBWA 1BZLA 1K0IA 3AEFA 3T2KA 1K0JA 1GALA 4H4QA 2JB3A 2QA2A 4CCRA 1PHHA 2A89A 3KPKA 3ITJA 2XFNA 4C3XA 2NVKX 2FJBA 4A9WA 2JBVA 1GESA 2YLSA 1GSNA 3FIMB 1RYIA 3UOYA 4D04A 5HXIA 2GR2A 3SZCA 1TRBA 1D4CA 2YLWA 5U25A 1OJAA 4U8MA 1MOKA 1GTEA 1XANA 2X8CA 3OC4A 4KPRA 1NENA 1CF3A 1GRBA 2BYBA 3QSSA 4XWRA 1CC4A 2V6OA 3COXA 5KMQA 4TM1A 4B69A 2APGA 2VRMA 1H83A 3GQKA 4H2QA 3RHAA 1ZDLA 3CNSA 1NG3A 1XDIA 3DGZA 3NH3X 4ZN0A 3CTYA 4DGKA 3GYIA 3ATQA 4JY3A 2YM2A 3FBSA 1QLBA 3UKFA 4B65A 5JCKA 1FEAA 2YLTA 3IF9A 1XPQA 3BNMA 5KXJA 4G74A 1CJCA 2WHDA 4Y4NA 3T0KA 3DK4A 2RGJA 3T2ZA 5IPYA 1CC6A 1O5WA 1JU2A 5FS9A 5CKUA 2I0ZA 2YLRA 2YR4A 3LADA 4YWOA 4USQA 1H81A 3SZWA 4YSZA 2XYOA 2ACZA 3L8KA 2RGOA 3CPIG 4GRTA 1H6VA 4EIQA 2BS3A 2YWLA 3DJEA 1VG9A 4TM0A 4USRA 3URHA 1TYTA 2BCPA 4YTPA 1REOA 1CJ3A 3AB1A 5KNLA 1F8RA 4IA6A 4NWZA 3UCLA 5KOXA 5U63A 4GAVA 1KNRA 4TLZA 2R45A 1NHRA 2JKCA 4KX6A 1F8WA 2PYXA 4TM4A 4WCTA 5KMPA 2XLPA 3DMEA 2BK4A 4B1BA 2WS3A 5GSNA 5JCLA 3EAOA 3UOXA 4FK1A 3AE1A 2WU5A 2XVEA 2R4JA 3NYCA 3AEGA 4YT0A 2B9WA 2WPCA 4ZCCA 4H4YA 1F6MA 3E1TA 3ABVA 4C3YA 1EL9A 2XDOA 3SYIA 4FX9A 1IUSA 1YKJA 3RP6A 4U8OA 4WX1A 4OPCA 2C76A 4B68A 2C65A 4A6NA 1ZP0A 2BS2A 3DGHA 5J60A 1GV4A 1JNRA 5FS7A 1BWCA 3CNTA 1NEKA 1FECA 2VQBA 3GYXA 1N4VA 1PJ7A 1F3PA 3SM8A 5L46A 2FJDA 4EMJA 1PBEA 4A99A 3CPHG 3NKSA 4J2WA 1W4XA 1FCDA 2GVCA 3GWDA 4A79A 2C66A 2CDUA 4B63A 2R46A 4OPTA 4AP3A 1NPXA 3PVCA 1HYUA 2GB0A 4H4VA 4BJYA 1KNPA 2A8XA 4ECHA 2XFPA 1ZKQA 4H4WA 2CFYA 2OAMA 1IJHA 3RP8A 1QO8A 3H4KA 3NN6X 3H8IA 4CY6A 3CNDA 2XFOA 4ICYA 5KVIA 3IHGA 5IQ1A 3VRDB 4BV6A 3LB8A 4I59A 3AE7A 1GETA 2YVGA 4G9KA 3GD4A 3P4PA 4HB9A 1DXLA 1PJ5A 3F8RA 1PDHA 1RSGA 4U2LA 1M64A 3GD3A 2DKIA 2BXRA 5FS8A 2JAEA 2OLNA 3R9UA 3I3LA 2C4CA 4OPDA 4XXGA 4YSYA 1LTXR 4H4ZA 2E1MA 1JOAA 3DJJA 1S3BA 3NT6A 4H7UA 2XVFA 1Y56A 2C3CA 2Q0KA 2C67A 2XFUA 5ER0A 2B9YA 3FMWA 4I58A 4LA1A 4EQWA 3ZYXA 1L0VA 3AE6A 4EIPA 2YLXA 5FMHA 1B4VA 5C3JA 3GQHA 5C2TA 3ALJA 3EPTA 2YR5A 3Q6JA 2ZBWA 3K30A 2YVFA 2CVJA 3QVRA 4JNQA 3SUCA 4G73A 2WP9A 2WOWA 1L9CA 1EBDA 1NDAA 1YY5A 2YVJA 3DA1A 3LXDA 2C3DA 1TDEA 1KDGA 2JB1A 4II3A 4O5UA 3S61A 3ATRA 3CGEA 2Y6QA 4LIIA 4M52A 2C70A 1GEUA 5BUKA 1E39A 1JRZA 1Z6LA 3NGCX 4YSXA 3QFBA 4OVIA 2YG5A 1ZX9A 2GEWA 1GRAA 3B3RA 3C4AA 2XLRA 1DOCA 1PN0A 1OJTA 2XLUA 4CBQA 4Z26A 2X50A 3IWAA 4H4XA 2ZZBA 1O94A 4H4TA 4O5QA 2WPFA 5KVHA 2ARDA 3HYWA 1ZK7A 5LV9A 2XVIA 1QJDA 4U8LA 3CGCA 3S5WA 3KVEA 3LZWA 1CHUA 1TDNA 4GR1A 3KLJA 2IVDA 1DNCA 3DK8A 4IA5A 1GNDA 3D1CA 4J36A 3NNEA 2OA1A 4H2PA 3P4QA 2E5VA 2R0CA 2WBAA 4JY2A 4U2SA 1L9EA 1B8SA 1IUXA 1LJ1A 3ISHA 4NZHA 4UDRA 1B5QA 4EMIA 5EB5A 4NTEA 1E7PA 3NTAA 3PS9A 3UTHA 4Z25A 4J56A 3UKAA 3VR9A 3BNUA 2GR3A 3IC9A 3QJ4A 4H4PA 1DODA 3SGLA 3SZFA 1O95A 2PHHA 2X99A 4EM4A 2GAGB 3T14A 4ADWA 1D5TA 5HHFA 3C4NA 4DSGA 3AE4A 3P4SA 4IVOB 3KKJA 3ALLA 3SZ0A 2WDVA 1EL5A 3H8LA 4K7ZA 2VVLA 4J57A 1LQTA 4X4JA 4Z2UA 1FOHA 2WEUA 3UP5A 3SXIA 3AWIA 3QFAA 3ICTA 4A6NB 3QSEA 4E0VA 3AE8A 3AE3A 1OJDA 4K8DA 4RSLA 2H89A 4BJZA 3AECA 3RNMA 1N4UA 2WESA 3F8DA 1MO9A 1LQUA 4U8PA 1VDCA 3T37A 2H88A 5KMSA 2IIDA 1H86A 4AOSA 4Z2RA 4EM3A 1CL0A 2C72A 4GDPA 2XLSA 1IUVA 4RG4A 4CY8A 2YR6A 4YKGA 5KOWA 5HYMA 1H84A 2Q6UA 4K2XA 4A7AA 2Y6RA 3OZ2A 4OPUA 5U1OA 3WE0A 5IQ4A 1B37A 2C75A 4BK3A 3NHOX 1KF6A 2V60A 3HYXA 1DOBA 4BK1A 3C96A 5BULA 1EL7A 1TDOA 3M12A 5M0ZA 3AEAA 4YTMA 4TLXA 3RP7A 4C77A 2YQUA 4N9XA 4DSHA 4PAAA 2A87A 2QCUA 3IHMA 4EQXA 1PBFA 1PJ6A 3UTFA 2BRAA 4LU6A 3UKKA 3VQRA 1NHSA 5EOWA 2BK3A 4CCQA 5HY5A 1D4EA 1BGJA 3SFDA 1NAAA 4GCMA 1GERA 4G6GA 2Q7VA 4A65A 3BHKA 3UOZA 4REKA 4Y4LA 3AD7B 4DNAA 2YG7A 4GAPA 3K7QX 1OJ9A 1TDFA 2WPEA 2WU2A 1VRQB 1IUUA 1L9DA 2XCGA 1DJNA 1BKWA 5JCIA 2WQYA 2BRYA 4AT2A 3DK9A 1S2QA 2J3NA 2Q0LA 2UZZA 1Q9IA 3AE9A 3PO7A 3UOVA 4JDRA 3ICRA 4YTNA 1GOSA 1V59A 2TMDA 2YAUA 3AXBA 3DJDA 3BI2A 4FDCB 4UP3A 4Z43A 3B6DA 2HQMA 4EMWA 2W0HA 1GREA 1E1KA 1PXCA 1VG0A 2QAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA1 A;  4XWZ A;  5JCN A;  1FEB A;  2FJE A;  1E6E A;  3EF6 A;  2YG3 A;  3UKP A;  1S3E A;  5GRT A;  4YXD A;  1N1P A;  2BS4 A;  1GT8 A;  1NG4 A;  1H7X A;  2DKH A;  2V61 A;  3II4 A;  2V3A A;  3M13 A;  1P2E A;  3P9U A;  2GR0 A;  1SEZ A;  2V5Z A;  3AD8 B;  2F5Z A;  4H2R A;  4Z44 A;  5BRT A;  1IUW A;  4PAB A;  2GF3 A;  2WOV A;  3CN8 A;  4A5L A;  3G5S A;  5TR3 A;  2BC0 A;  2LFC A;  3GYJ A;  3NG7 X;  1BF3 A;  1UKV G;  3AYJ A;  1PXB A;  2RGH A;  3QVP A;  2GR1 A;  3O0H A;  4APN A;  4B66 A;  1JNZ A;  2R9Z A;  1ZOY A;  2X8G A;  5DBJ A;  2GRT A;  3CNP A;  2R4E A;  4Y4M A;  2XLT A;  2X8H A;  1E1N A;  2XVJ A;  3NRN A;  1TYP A;  3GRT A;  2BC1 A;  2GAH B;  1CJ4 A;  1K0L A;  2BAC A;  3K7T A;  3K7M X;  3NIX A;  3UP4 A;  4BUR A;  1IUT A;  3GRS A;  5KWF A;  4BK2 A;  4GDE A;  3V3O A;  3ALM A;  3NN0 X;  4H50 A;  5EBK A;  1F8S A;  1X31 B;  2XFQ A;  4Z2T A;  2CUL A;  3DJG X;  2AAQ A;  1BGN A;  3GMB A;  3NK2 X;  4IV9 A;  2GQW A;  2TPR A;  4OPL A;  1PBD A;  3AE2 A;  1RP0 A;  3ZDN A;  4OCG A;  3CGD A;  1GPE A;  1PBB A;  1LVL A;  4P9S A;  4YKF A;  3G5Q A;  3JSK A;  3KA7 A;  3KU9 A;  3AEE A;  2O9Z A;  3I6D A;  2FJA A;  3L1R A;  5CQF A;  4GUV A;  4B67 A;  4RG3 A;  1NHP A;  3LOV A;  3F8P A;  4Z24 A;  3V3N A;  3NYE A;  4UDQ A;  2Z5Y A;  1CJ2 A;  1PXA A;  2YG6 A;  1K4Q A;  3GDP A;  4NTC A;  5KRQ A;  4CNK A;  1YQ3 A;  4U8K A;  2BK5 A;  3DH9 A;  2E4G A;  4JQ9 A;  2GMH A;  2RAB A;  2WP5 A;  2B7R A;  2VQ7 A;  3NLC A;  3AED A;  2GH5 A;  3AYI A;  1LV0 A;  3CPJ G;  4D03 A;  3QSM A;  3VR8 A;  1JEH A;  1P2H A;  3Q9T A;  1N4W A;  4K5R A;  1CBO A;  1CC2 A;  2B7S A;  2C73 A;  2JB2 A;  4J31 A;  5M10 A;  2EQ8 A;  2OAL A;  4OPI A;  1ZMD A;  2R0G A;  3RED A;  2C7G A;  1COY A;  3AD9 B;  5JCM A;  4AP1 A;  3BI4 A;  3P1W A;  5EB4 A;  1ELI A;  1KFY A;  5BVA A;  5FS6 A;  3SQP A;  2V3B A;  4C5O A;  4YSH A;  1Q1W A;  3CNJ A;  4UDP A;  2JK6 A;  4AT0 A;  1YQ4 A;  2EQ6 A;  1E1M A;  4MJW A;  2WDR A;  1GRG A;  1ONF A;  3BHF A;  1EL8 A;  3LZX A;  1GXF A;  1YQZ A;  4IVM B;  1PBC A;  4B64 A;  4K5S A;  3G5R A;  1Y56 B;  1M6I A;  2X3N A;  4CNJ A;  4H4R A;  4AOX A;  4J33 A;  3ICS A;  3GWF A;  4NEV A;  2YM1 A;  3GDN A;  4TM3 A;  3LJP A;  2EQ9 A;  2ZZC A;  4U8I A;  4EQS A;  2WDQ A;  1NHQ A;  2OLO A;  4FK1 C;  3CGB A;  1TDK A;  1JRX A;  2ZZ0 A;  2C64 A;  2B76 A;  1JRY A;  4H4S A;  1XHC A;  4NEW A;  4C74 A;  3P4R A;  1KSS A;  3SFE A;  1GRH A;  1S2Y A;  2GV8 A;  3KD9 A;  2BXS A;  3KPF A;  4EQR A;  2BCG G;  2WOI A;  1D4D A;  3FG2 P;  1Y0P A;  4JN9 A;  2VVM A;  4H2N A;  2NPX A;  3NYF A;  3D8X A;  1H7W A;  3UTE A;  1E1L A;  2AQJ A;  4U8J A;  3VRA A;  1ZOV A;  3BI5 A;  1Q1R A;  2VOU A;  1MXT A;  3ADA B;  2AR8 A;  2XVH A;  2VRL A;  1ZMC A;  2BA9 A;  4HA6 A;  1OJC A;  2Z5X A;  3CIR A;  3GMC A;  4U8N A;  4K22 A;  2VZ2 A;  4CRT A;  1AOG A;  2IVE A;  1D7L A;  1ZY8 A;  1DOE A;  3AYL A;  3EAN A;  4ZCD A;  3HZL A;  4X9N A;  5J7X A;  4X9M A;  2R0P A;  3UKH A;  3AE5 A;  3NK1 X;  1FL2 A;  4OPG A;  2VVL G;  3AEB A;  2YG4 A;  1PS9 A;  2BAB A;  2B9X A;  1GRT A;  3M0O A;  3GSI A;  1LPF A;  2WET A;  4JNA A;  4GF7 A;  1GTH A;  3NK0 X;  1D7Y A;  2YLZ A;  3UKL A;  3NTD A;  4U2T A;  1DJQ A;  4NTD A;  3UTG A;  3UKQ A;  2GQF A;  4H4U A;  1GRF A;  1KSU A;  3VRB A;  3V76 A;  2GMJ A;  2WP6 A;  4J34 A;  2EQ7 A;  1VQW A;  1H82 A;  3FPZ A;  2FBW A;  1BZL A;  1K0I A;  3AEF A;  1K0J A;  1GAL A;  4H4Q A;  2JB3 A;  2QA2 A;  4CCR A;  1PHH A;  2A89 A;  4C3X A;  3ITJ A;  2XFN A;  2NVK X;  2FJB A;  4A9W A;  2JBV A;  1GES A;  2YLS A;  1GSN A;  3FIM B;  1RYI A;  3UOY A;  4D04 A;  5HXI A;  2GR2 A;  1TRB A;  1D4C A;  2YLW A;  5U25 A;  1OJA A;  4U8M A;  1MOK A;  1GTE A;  1XAN A;  2X8C A;  3OC4 A;  4KPR A;  1NEN A;  1CF3 A;  1GRB A;  2BYB A;  3QSS A;  4XWR A;  1CC4 A;  2V6O A;  3COX A;  4TM1 A;  4B69 A;  2APG A;  2VRM A;  1H83 A;  3GQK A;  4H2Q A;  3RHA A;  1ZDL A;  3CNS A;  1NG3 A;  1XDI A;  3DGZ A;  3NH3 X;  4ZN0 A;  3CTY A;  4DGK A;  3GYI A;  3ATQ A;  4JY3 A;  2YM2 A;  3FBS A;  1QLB A;  3UKF A;  4B65 A;  5JCK A;  1FEA A;  2YLT A;  3IF9 A;  1XPQ A;  3BNM A;  5KXJ A;  4Y4N A;  1CJC A;  2WHD A;  3DK4 A;  2RGJ A;  5IPY A;  1CC6 A;  1O5W A;  1JU2 A;  5FS9 A;  5CKU A;  2I0Z A;  2YLR A;  2YR4 A;  3LAD A;  4YWO A;  4USQ A;  1H81 A;  4YSZ A;  2XYO A;  2ACZ A;  3L8K A;  2RGO A;  3CPI G;  4GRT A;  1H6V A;  4EIQ A;  2BS3 A;  2YWL A;  3DJE A;  1VG9 A;  4TM0 A;  4USR A;  3URH A;  1TYT A;  2BCP A;  4YTP A;  1REO A;  1CJ3 A;  3AB1 A;  1F8R A;  4IA6 A;  5KOX A;  3UCL A;  5U63 A;  1KNR A;  4TLZ A;  2R45 A;  1NHR A;  2JKC A;  4KX6 A;  1F8W A;  2PYX A;  4TM4 A;  4WCT A;  2XLP A;  3DME A;  2BK4 A;  4B1B A;  2WS3 A;  5GSN A;  5JCL A;  3EAO A;  3UOX A;  4FK1 A;  3AE1 A;  2WU5 A;  2XVE A;  2R4J A;  3NYC A;  3AEG A;  4YT0 A;  2B9W A;  2WPC A;  4ZCC A;  4H4Y A;  1F6M A;  3E1T A;  3ABV A;  4C3Y A;  1EL9 A;  2XDO A;  4FX9 A;  1IUS A;  1YKJ A;  3RP6 A;  4U8O A;  4WX1 A;  4OPC A;  2C76 A;  4B68 A;  2C65 A;  4A6N A;  1ZP0 A;  2BS2 A;  3DGH A;  5J60 A;  1GV4 A;  1JNR A;  5FS7 A;  1BWC A;  3CNT A;  1NEK A;  1FEC A;  2VQB A;  3GYX A;  1N4V A;  1PJ7 A;  1F3P A;  3SM8 A;  5L46 A;  2FJD A;  4EMJ A;  1PBE A;  4A99 A;  3CPH G;  3NKS A;  4J2W A;  1W4X A;  1FCD A;  2GVC A;  3GWD A;  4A79 A;  2C66 A;  2CDU A;  4B63 A;  2R46 A;  4OPT A;  4AP3 A;  1NPX A;  3PVC A;  1HYU A;  2GB0 A;  4H4V A;  4BJY A;  1KNP A;  2A8X A;  4ECH A;  2XFP A;  1ZKQ A;  4H4W A;  2CFY A;  2OAM A;  1IJH A;  3RP8 A;  1QO8 A;  3H4K A;  3NN6 X;  3H8I A;  4CY6 A;  3CND A;  2XFO A;  4ICY A;  5KVI A;  3IHG A;  5IQ1 A;  3VRD B;  4BV6 A;  3LB8 A;  4I59 A;  3AE7 A;  1GET A;  2YVG A;  3GD4 A;  3P4P A;  4HB9 A;  1DXL A;  1PJ5 A;  3F8R A;  1PDH A;  1RSG A;  4U2L A;  1M64 A;  3GD3 A;  2DKI A;  2BXR A;  5FS8 A;  2JAE A;  2OLN A;  3R9U A;  3I3L A;  4OPD A;  4XXG A;  4YSY A;  1LTX R;  4H4Z A;  2E1M A;  1JOA A;  3DJJ A;  1S3B A;  3NT6 A;  4H7U A;  2XVF A;  1Y56 A;  2C3C A;  2Q0K A;  2C67 A;  2XFU A;  5ER0 A;  2B9Y A;  3FMW A;  4I58 A;  4LA1 A;  4EQW A;  3ZYX A;  1L0V A;  3AE6 A;  4EIP A;  2YLX A;  5FMH A;  1B4V A;  5C3J A;  3GQH A;  5C2T A;  3ALJ A;  3EPT A;  2YR5 A;  3Q6J A;  2ZBW A;  3K30 A;  2YVF A;  2CVJ A;  3QVR A;  4JNQ A;  3SUC A;  2WP9 A;  2WOW A;  1L9C A;  1EBD A;  1NDA A;  1YY5 A;  2YVJ A;  3DA1 A;  3LXD A;  2C3D A;  1TDE A;  1KDG A;  2JB1 A;  4O5U A;  3S61 A;  3ATR A;  3CGE A;  2Y6Q A;  4LII A;  4M52 A;  2C70 A;  1GEU A;  5BUK A;  1E39 A;  1JRZ A;  1Z6L A;  3NGC X;  4YSX A;  3QFB A;  4OVI A;  2YG5 A;  1ZX9 A;  2GEW A;  1GRA A;  3B3R A;  3C4A A;  2XLR A;  1DOC A;  1PN0 A;  1OJT A;  2XLU A;  4CBQ A;  4Z26 A;  2X50 A;  3IWA A;  4H4X A;  2ZZB A;  1O94 A;  4H4T A;  4O5Q A;  2WPF A;  5KVH A;  2ARD A;  1ZK7 A;  2XVI A;  1QJD A;  4U8L A;  3CGC A;  3S5W A;  3KVE A;  3LZW A;  1CHU A;  1TDN A;  4GR1 A;  3KLJ A;  2IVD A;  1DNC A;  3DK8 A;  4IA5 A;  1GND A;  3D1C A;  4J36 A;  3NNE A;  2OA1 A;  4H2P A;  3P4Q A;  2E5V A;  2R0C A;  2WBA A;  4JY2 A;  4U2S A;  1L9E A;  1B8S A;  1IUX A;  1LJ1 A;  3ISH A;  4NZH A;  4UDR A;  1B5Q A;  4EMI A;  5EB5 A;  4NTE A;  1E7P A;  3NTA A;  3PS9 A;  3UTH A;  4Z25 A;  4J56 A;  3UKA A;  3VR9 A;  3BNU A;  2GR3 A;  3IC9 A;  3QJ4 A;  4H4P A;  1DOD A;  3SGL A;  1O95 A;  2PHH A;  2X99 A;  4EM4 A;  2GAG B;  4ADW A;  1D5T A;  5HHF A;  3C4N A;  4DSG A;  3AE4 A;  3P4S A;  4IVO B;  3KKJ A;  3ALL A;  2WDV A;  1EL5 A;  3H8L A;  4K7Z A;  2VVL A;  4J57 A;  1LQT A;  4X4J A;  4Z2U A;  1FOH A;  2WEU A;  3UP5 A;  3AWI A;  3QFA A;  3ICT A;  4A6N B;  3QSE A;  4E0V A;  3AE8 A;  3AE3 A;  1OJD A;  4K8D A;  4RSL A;  2H89 A;  4BJZ A;  3AEC A;  3RNM A;  1N4U A;  2WES A;  3F8D A;  1MO9 A;  1LQU A;  4U8P A;  1VDC A;  3T37 A;  2H88 A;  2IID A;  1H86 A;  4AOS A;  4Z2R A;  4EM3 A;  1CL0 A;  2C72 A;  4GDP A;  2XLS A;  1IUV A;  4RG4 A;  4CY8 A;  2YR6 A;  4YKG A;  5KOW A;  5HYM A;  1H84 A;  2Q6U A;  4K2X A;  4A7A A;  2Y6R A;  3OZ2 A;  4OPU A;  5U1O A;  3WE0 A;  5IQ4 A;  1B37 A;  2C75 A;  4BK3 A;  3NHO X;  1KF6 A;  2V60 A;  1DOB A;  4BK1 A;  3C96 A;  5BUL A;  1EL7 A;  1TDO A;  3M12 A;  5M0Z A;  3AEA A;  4YTM A;  4TLX A;  3RP7 A;  4C77 A;  2YQU A;  4N9X A;  4DSH A;  4PAA A;  2A87 A;  2QCU A;  3IHM A;  4EQX A;  1PBF A;  1PJ6 A;  3UTF A;  4LU6 A;  3VQR A;  3UKK A;  4CCQ A;  1NHS A;  5EOW A;  2BK3 A;  5LV9 A;  5HY5 A;  1D4E A;  1BGJ A;  3SFD A;  1NAA A;  4GCM A;  1GER A;  4A65 A;  2Q7V A;  3BHK A;  3UOZ A;  4REK A;  4Y4L A;  3AD7 B;  4DNA A;  2YG7 A;  3K7Q X;  1OJ9 A;  1TDF A;  2WPE A;  2WU2 A;  1VRQ B;  1IUU A;  1L9D A;  2XCG A;  1DJN A;  1BKW A;  5JCI A;  2WQY A;  4AT2 A;  3DK9 A;  1S2Q A;  2J3N A;  2Q0L A;  2UZZ A;  1Q9I A;  3AE9 A;  3PO7 A;  3UOV A;  4JDR A;  3ICR A;  4YTN A;  1GOS A;  1V59 A;  2TMD A;  2YAU A;  3AXB A;  3DJD A;  3BI2 A;  4FDC B;  4UP3 A;  4Z43 A;  3B6D A;  2HQM A;  4EMW A;  2W0H A;  1GRE A;  1E1K A;  1PXC A;  1VG0 A;  2QAE A; 
#chains in the Genus database with same CATH topology
 4HWF A;  4XWZ A;  4KBM B;  3UFG A;  2W2U A;  1FEB A;  5DJQ C;  2YG3 A;  5GRT A;  3PUX F;  4C5O A;  3CX7 B;  4P09 A;  4HKA A;  4FI5 A;  3ZJ2 A;  4IE5 A;  5BRT A;  4GKK T;  4A5L A;  2V6Y A;  5TR3 A;  1UKV G;  3DTO A;  3AXJ B;  4LFB T;  3AYJ A;  2NTX A;  1PXB A;  2RGH A;  3QVP A;  3TLW A;  4APN A;  5LGN B;  2R9Z A;  1NAF A;  2IC6 A;  2R4E A;  4YLH A;  3TLU A;  2XLT A;  2VKD A;  3NRN A;  2BC1 A;  1RUH 4;  1BR1 A;  2LRK A;  1CJ4 A;  4GK5 E;  3UP4 A;  4I0U A;  4BUR A;  4OYK A;  1IUT A;  1HG2 A;  2IIU A;  3NN0 X;  5FL1 A;  2BG9 B;  1X31 B;  3RIF A;  2AAQ A;  1BGN A;  4IV9 A;  1RMU 4;  2GQW A;  4OPL A;  4QXB B;  3AVS A;  3CGD A;  3ONJ A;  2LLY A;  2PY5 A;  1LVL A;  5DQW A;  1H8T D;  3G5Q A;  2BDE A;  4P0A A;  2X51 A;  4B67 A;  1OWA A;  2MBG A;  4UDQ A;  4U2Z A;  4UR9 A;  2Z5Y A;  2CXL A;  1XNR T;  4TNV A;  4Q25 A;  3FXE B;  3LSV A;  3CMM A;  5KRQ A;  3ZC1 A;  2FUP A;  3J9X 1;  3N2O A;  4H9N C;  2VQ7 A;  4J2C A;  1YW0 A;  2Z6E A;  4GK0 E;  3CPZ A;  1CC2 A;  2C73 A;  1V9D A;  2D2S A;  1ZMD A;  3CX8 B;  2C7G A;  2XQ6 A;  4U33 A;  2M6I A;  4ZS3 A;  4JEU B;  5LB7 B;  3PTR B;  4JLE A;  4UVC B;  1E1M A;  3IHR A;  4YJ3 E;  1YKE B;  1PBC A;  4B64 A;  4QH1 A;  1K5M D;  1Y56 B;  4DR5 T;  4DR3 T;  2D9D A;  3RQU A;  4HWC A;  4H4R A;  3GWF A;  1VBB 4;  2EQ9 A;  2ZZC A;  2LEH A;  2VVN A;  2XAF B;  4H9S E;  1TDK A;  3T31 A;  1JRX A;  1XHC A;  4NEW A;  2C0S A;  1IBK T;  1KSS A;  2YU1 A;  4MHC A;  1GRH A;  1S2Y A;  2GV8 A;  1IJ5 A;  3N9O A;  4DV2 T;  4JI1 T;  4ZHQ E;  3B5M A;  4HWH A;  2IAK A;  3CX6 B;  5LCY A;  2I6H A;  4LFA T;  5AFU L;  5HXS A;  3KVB A;  2VQF T;  3BI5 A;  4HA6 A;  3CIR A;  3GMC A;  4U8N A;  1DOE A;  3AYL A;  3HZL A;  4DV0 T;  2WM9 A;  4CN4 A;  3AE5 A;  2XQ5 A;  4UIG A;  3BQL A;  3ZEF B;  3A5X A;  2WET A;  4JNA A;  5JH7 E;  3NK0 X;  2H7O A;  3UKL A;  4U2T A;  1DJQ A;  4O2A E;  2LSY A;  3FZL B;  2UUC T;  3UKQ A;  3VRB A;  2GMJ A;  3PU3 A;  3LG7 A;  1H82 A;  3OYZ A;  4H4Q A;  1GAL A;  4HFC A;  4HFI A;  2JB3 A;  2QA2 A;  4CCR A;  4JI8 T;  3KPK A;  4C3X A;  2XFN A;  2NVK X;  1GSN A;  3UOY A;  1TRB A;  3FZM B;  5U25 A;  4Z90 A;  4PK6 A;  2X8C A;  3HKE E;  1CF3 A;  4XWR A;  2BYB A;  5CGM A;  4EIW A;  2XAJ B;  4TM1 A;  4PDW D;  3PV0 F;  3GQK A;  3MA9 A;  3CNS A;  1NG3 A;  1XDI A;  3NH3 X;  4UXN B;  4OX9 T;  3PJA J;  3CTY A;  2HHH T;  1MMG A;  4K0K T;  5LGT B;  2YM2 A;  1BEV 4;  1XPQ A;  3TKL B;  5KXJ A;  2WHD A;  2V7L A;  4U3C A;  3KFW X;  4PFP A;  2YR4 A;  3Q5W A;  3MZK B;  2ACZ A;  4O8S A;  5JDH A;  2CXD A;  4ZEY A;  4FJO A;  2YWL A;  2BCP A;  4TWH A;  5KNL A;  1MNE A;  1G73 A;  4IA6 A;  3RI5 A;  5KOX A;  4QHO A;  3JC6 D;  4GAV A;  1IBL T;  4TLZ A;  5JDM A;  1F8W A;  5KMP A;  3N9Q A;  1PIV 4;  2WS3 A;  5GSN A;  5HEJ A;  3UOX A;  4DR6 T;  2WU5 A;  2BZB A;  1RUF 4;  1YD8 G;  3MXZ A;  4ZCC A;  4H4Y A;  1F6M A;  4TWD A;  5JRC B;  4DV6 T;  5CA0 E;  1LVF A;  4UEM A;  3PU8 A;  3SYI A;  1IUS A;  4BAY B;  3RLF F;  3DGH A;  3AAA B;  5L47 A;  1FEC A;  3KV9 A;  2CHN A;  4HEA A;  4EMJ A;  3OYX A;  2A72 A;  3LBX B;  3CPH G;  4ILC A;  2GVC A;  4DUY T;  2C66 A;  2CDU A;  4OPT A;  2E9X C;  5H6R B;  4BJY A;  1ZKQ A;  3ZN0 B;  2OAM A;  3H8I A;  3N9N A;  3VRD B;  2PG8 A;  2IW5 B;  5A1L A;  4IT4 A;  3B13 A;  3LB8 A;  4I59 A;  2CBI A;  4H9R C;  4AQF C;  4LMJ A;  3ZN1 B;  4IL9 A;  3I0O A;  2C5K T;  1S35 A;  3X1D A;  4DND A;  1PO2 4;  1HNX T;  4X65 T;  4B3S T;  1D1A A;  3IF8 B;  3I3L A;  4OPD A;  2D0T A;  5HXE A;  1JOA A;  1S3B A;  4H7U A;  2XFU A;  2B9Y A;  2PFV A;  3SRZ A;  4LA1 A;  1BR0 A;  4EQW A;  1D0Y A;  1L0V A;  4QWN B;  3L09 A;  1KEY A;  3ZMT B;  1B4V A;  3FHN A;  1IJ6 A;  4Q4V 4;  1WR0 A;  3ZYL A;  4QXH B;  3QVR A;  4GIW A;  4IE7 A;  3SUC A;  1YY5 A;  3DA1 A;  2C3D A;  4HTE A;  4ZI2 C;  4EZH A;  3S61 A;  3ATR A;  3BQK A;  2Y6Q A;  4LII A;  5AQK B;  4WBN E;  2YG5 A;  2XUE A;  4N78 D;  2A9U A;  1GRA A;  3GWH A;  1OJT A;  2IHR 1;  5J2T E;  1O94 A;  3PUZ F;  4O5Q A;  2HPJ A;  2AE9 A;  4U8L A;  4XBF B;  5FY7 A;  3KVE A;  3QB5 K;  1G8X A;  1TDN A;  4EB6 E;  3JD7 4;  1W09 A;  4A5X A;  2LSI A;  3DK8 A;  4LML A;  1GND A;  5AQM B;  3ESL A;  3D1C A;  3EAM A;  3ZLI A;  3NNE A;  4H2P A;  1H7C A;  2R0C A;  2WBA A;  3E22 E;  4JBW F;  1LJ1 A;  4UDR A;  5EB5 A;  4NTE A;  1E7P A;  2MAW A;  3RYI E;  3BNU A;  3SGL A;  4EM4 A;  3OBV E;  5J1G A;  2CWO A;  3ALL A;  1QSD A;  3SZ0 A;  2A2F X;  2C5J A;  2QGS A;  2N2N A;  3QOF A;  3ICT A;  4C91 A;  2R6G F;  4E0V A;  1OJD A;  4IRE A;  2H89 A;  4ASK A;  2VKH A;  3AEC A;  1N4U A;  2WES A;  4ILU A;  1WLX A;  4JI4 T;  3F8D A;  4U8P A;  1VDC A;  2VQE T;  4ISS A;  1IZN B;  2QRX A;  4AOS A;  5L3E B;  4K0U A;  4NIQ A;  2EHO C;  4LMK A;  2C72 A;  4RG4 A;  4WYV A;  2YR6 A;  2B1E A;  4YKG A;  2V26 A;  3O9X A;  4OPU A;  2NTY A;  3HR0 A;  5IQ4 A;  5LMN T;  2VK9 A;  4BK3 A;  3KIN B;  2JQK A;  4EV6 A;  4IDZ A;  2ZM2 A;  3M3Z B;  2XTL A;  5LG3 A;  1TDO A;  2E2A A;  2W66 A;  3LDQ B;  4H9P C;  3IHM A;  1PJ6 A;  4ILB A;  1XNQ T;  4IDN A;  2BRA A;  5LV9 A;  4LF8 T;  4G6G A;  3NZP A;  3ZJ1 A;  1OJ9 A;  1TDF A;  2WPE A;  1IUU A;  1DJN A;  1BKW A;  2IML A;  3PE0 A;  1S2Q A;  4CQI A;  4ERR A;  2J3N A;  1Q9I A;  3ICR A;  1WYB A;  2Q9Q B;  4PJN A;  4YTN A;  4Z43 A;  3BI2 A;  2X9X A;  4UP3 A;  3B6D A;  2ODU A;  5H6Q B;  1GRE A;  3LJC A;  4H4S A;  3JAD A;  4LF5 T;  2QA1 A;  5JCN A;  1I94 T;  1HX8 A;  5HEU A;  3UKP A;  4TN7 B;  5FXV A;  1N1P A;  2UUB T;  1UX5 A;  3P9U A;  2GR0 A;  2NOX A;  1AR7 4;  3LFM A;  4WW0 A;  4Z44 A;  4U72 A;  3F2E A;  3O1J A;  3CN8 A;  3GYJ A;  3O1H A;  3AAE B;  1BF3 A;  2DCF A;  1HG5 A;  1RUI 4;  2LOS A;  2X9H A;  3BQI A;  4II2 A;  4YHH T;  3NIX A;  4IDQ A;  3V3O A;  4PJL A;  3CQX C;  3Q5D A;  4GYR A;  1F8S A;  2DNX A;  2XFQ A;  5AQI B;  2CUL A;  4DID B;  2L9Q A;  5FYM A;  3AE2 A;  3ZDN A;  3HKB E;  2YN6 A;  1HF8 A;  3JSK A;  3KA7 A;  3KU9 A;  2X5I D;  2FJA A;  1W0A A;  4HWD A;  4BJM A;  3ZSS A;  5LJN A;  4RG3 A;  1UCU A;  1NHP A;  3F31 A;  3NYE A;  2IDO B;  2RS3 4;  5BMV E;  5AQP B;  4CNK A;  2LSK A;  4ADZ A;  4JQ9 A;  5AQF B;  2RAB A;  2WP5 A;  2WWU A;  2X0Y A;  3HA4 A;  4G6H A;  3AED A;  2LM2 A;  2GH5 A;  4ZI3 D;  3AYI A;  3C64 A;  3CPJ G;  2EHO A;  3VR8 A;  1X9B A;  5FY1 A;  3NRX A;  1P2H A;  3F57 A;  2H7V C;  4O4I E;  3ZMS B;  2EQ8 A;  2OAL A;  3HYV A;  2R0G A;  1EZ3 A;  1COY A;  5JCM A;  4AP1 A;  3JAF A;  5FNV E;  5EB4 A;  4WBO A;  5BVA A;  4NNJ A;  4NUU A;  3P7I A;  1Q1W A;  3CNJ A;  4UDP A;  4AT0 A;  1W9R A;  2OLT A;  3PUA A;  2MOZ A;  3LZX A;  4YFS A;  5ETW A;  3VKH A;  4I4T E;  2ZM6 T;  4CI2 B;  1NCQ D;  1SA0 E;  3GDN A;  4EQS A;  3OTO T;  2WDQ A;  2CA5 A;  1VBC 4;  4EAH A;  2NP9 A;  4FK1 C;  2K24 A;  2V1D B;  2ZZ0 A;  4C74 A;  2BBJ A;  2YDR A;  4U74 A;  4DMV A;  4BA9 A;  3KPF A;  4EQR A;  2BCG G;  2K3W A;  1D4D A;  4TUY E;  4JN9 A;  3MAC A;  2NPX A;  3NYF A;  1E1L A;  4U8J A;  3RKG A;  3CQG B;  3ANW A;  4EZ4 A;  5ABF B;  1Q1R A;  1OED B;  1MMN A;  5FL0 A;  2VRL A;  1ZMC A;  2BA9 A;  2YOE A;  2Z5X A;  1VBA 4;  4CRT A;  2IVE A;  4NXN T;  3EAN A;  4ZCD A;  2PBI A;  4X9N A;  4QXC B;  2N9D A;  2XAG B;  4X9M A;  5J7X A;  2R0P A;  2BAB A;  1D1C A;  2B9X A;  5JVD E;  2WSS V;  3QUJ A;  3M0O A;  4KUM B;  1LPF A;  3EAB A;  5FVL A;  4U7Y A;  4PNI A;  1KSU A;  3V76 A;  4J34 A;  2JMH A;  1HNZ T;  3FPZ A;  3FBZ A;  1K0J A;  4ILA A;  5FY0 A;  1GQE A;  4X1Y E;  4A9W A;  2JBV A;  3FZF B;  4GB3 4;  2LHR A;  1RYI A;  2UUA T;  2GR2 A;  2YLW A;  4U8M A;  1MOK A;  2BVL A;  3OC4 A;  5FKY A;  4KPR A;  2XJ7 A;  4DV3 T;  3RIU C;  2V6O A;  5LGU B;  3CK6 A;  1OED A;  2VRM A;  4E7S A;  4H2Q A;  3RHA A;  4E7Z A;  5BR8 T;  3UT5 E;  1ZDL A;  3DGZ A;  1VRB A;  2WAU A;  3AA1 B;  4EOZ B;  4B65 A;  5JCK A;  1FEA A;  3IF9 A;  1AR8 4;  4KP3 C;  1CJC A;  3RPU A;  5CKU A;  4F6R C;  3LAD A;  4IIJ E;  1S94 A;  3L8K A;  1H6V A;  4CN6 A;  2BS3 A;  1D0Z A;  4EIQ A;  1VG9 A;  5AQG B;  4YTP A;  1REO A;  1CJ3 A;  3AB1 A;  2LM9 A;  2LOP A;  3JAE A;  5E0O A;  4NWZ A;  3UCL A;  3NZQ A;  5U63 A;  3R84 B;  2X67 A;  4EEB A;  4UEL A;  4KX6 A;  3V5U A;  4WCT A;  4B1B A;  5JCL A;  2RPA A;  3EAO A;  1CUN A;  4AKR B;  2VKO A;  4G63 A;  4YT0 A;  2LJL A;  5HEO A;  1EL9 A;  1KK7 A;  2XDO A;  3QK6 A;  4U8O A;  4B68 A;  2C65 A;  2BS2 A;  3P50 A;  1FIO A;  2XPK A;  4OK0 A;  1JNR A;  3AXJ A;  5FS7 A;  3RH3 A;  3EHZ A;  3GYX A;  3S4U A;  2J62 A;  2OV9 A;  1ZKE A;  1F3P A;  2FJD A;  5LHI B;  3NKS A;  5ABF A;  4IDO A;  1FCD A;  1I6Z A;  4A79 A;  4B63 A;  2R46 A;  1FMV A;  2KMF A;  2GB0 A;  1BR4 A;  1KNP A;  1UX4 A;  2HWC 4;  2CFY A;  2LHN A;  1IJH A;  3R6N A;  5IWA T;  3RP8 A;  2DLR A;  3ETV A;  3NN6 X;  2PYL A;  3UQ7 A;  4ICY A;  2PZS A;  1MMD A;  5IQ1 A;  1R09 4;  3AE7 A;  1GET A;  3AB3 B;  2BKN A;  3Q5X A;  4G9K A;  3DP7 A;  3KVA A;  3P4P A;  2K5B B;  4U2L A;  3QNU A;  4I55 E;  3UTK A;  2BXR A;  5LBQ B;  5FS8 A;  3N2G E;  1RHI 4;  4IGU A;  4YSY A;  1OOP D;  2E1M A;  4LF7 T;  3VKG A;  1LKX A;  2WMO A;  3FMW A;  3ZYX A;  3N9M A;  1SHZ C;  5L3F B;  1HR0 T;  4PJM A;  3GQH A;  3EPT A;  3MJX A;  2YR5 A;  3T1H T;  4XAX B;  4JNQ A;  4G73 A;  1NA1 D;  3H3M A;  3K8P C;  1XHZ A;  2W4X A;  2JB1 A;  4AQF A;  4M1P A;  2LT3 A;  5ABG A;  3NGC X;  4OVI A;  4X64 T;  1HX1 B;  2GEW A;  3C4A A;  1DOC A;  1PN0 A;  2XLU A;  4UV8 B;  4UF0 B;  2X50 A;  4H4X A;  2ZZB A;  5KVH A;  4DMW A;  2WPF A;  4UF0 A;  2ARD A;  2XVI A;  1QJD A;  3RRC A;  3ZMU B;  4EXT A;  5JDL A;  4HFE A;  1CHU A;  2XHE B;  1VOM A;  1DNC A;  1RUC 4;  4L9I A;  2JIW A;  2OA1 A;  2DL1 A;  4U31 A;  2DI4 A;  2JQQ A;  2EHO B;  2V7K A;  4U2S A;  1IUX A;  2WY2 A;  3PUW F;  4NZH A;  2PYJ A;  3H37 A;  4HWI B;  4EMI A;  4Z25 A;  4EED A;  3UKA A;  1XMO T;  3A7M A;  4DR7 T;  2VUR A;  3IC9 A;  4B3T T;  4H4P A;  2JRK A;  3QC9 A;  4DR1 T;  3T14 A;  2SPC A;  4IVO B;  3KKJ A;  2HN1 A;  2WDV A;  4HFB A;  4IE4 A;  4L0R A;  1EL5 A;  4HE8 A;  5LOV E;  1FOH A;  5LG4 A;  2NW7 A;  3UP5 A;  3SXI A;  4HN9 A;  3QSE A;  3AE8 A;  4LF6 T;  3C98 B;  4RSL A;  2Y6X A;  3ONL C;  1YKH B;  3T37 A;  2H88 A;  3K3N A;  5JDG A;  2YEV C;  4H63 V;  1MIY A;  1HTJ F;  4EM3 A;  1UUR A;  1ZEE A;  5HYM A;  1H84 A;  4K2X A;  4A7A A;  3L8R A;  5U1O A;  4AKG A;  4UV9 B;  1MIV A;  3HYX A;  1DOB A;  3C96 A;  1EL7 A;  4C77 A;  2XQ3 A;  2V5C A;  4N9X A;  4YJ2 E;  2W00 A;  4IE0 A;  2A87 A;  2RP4 A;  1PBF A;  5EOW A;  4WZX A;  3SFD A;  4GCM A;  2GK9 A;  4A65 A;  4Q4W 4;  3U78 A;  3UOZ A;  4REK A;  4WNK A;  1MMA A;  2YG7 A;  5AQL B;  2BKO A;  3K7Q X;  2C5I T;  1XHX A;  4QH5 A;  3IBP A;  4OFZ A;  5JCI A;  4H9Q C;  2XY8 B;  4O4L E;  4DO0 A;  3UOV A;  2H3R A;  2X0H A;  1GOS A;  3AXB A;  4FDC B;  3DJD A;  3ZYM A;  5AQT B;  3PUS A;  4IHJ E;  2W0H A;  1UGO A;  1VG0 A;  2ZM0 A;  3OKQ A;  4H63 H;  3ZT7 A;  2XAQ B;  1GT8 A;  2DKH A;  2V61 A;  3D0T A;  4O4H E;  1SEZ A;  3AD8 B;  1EV1 4;  4DVD A;  1IUW A;  4PAB A;  4YY3 T;  2WOV A;  2KT9 A;  5ABE A;  3G5S A;  4KHP T;  5HYA A;  2R07 4;  1ASJ 4;  2GR1 A;  3EVY A;  3O0H A;  4B66 A;  1ZOY A;  2W61 A;  2V5D A;  3N5L A;  3RKO A;  2RM2 4;  4Y4M A;  3DJB A;  2X8H A;  1E1N A;  2XVJ A;  1TYP A;  4GOU A;  3GRT A;  3O1I A;  2LRL A;  1K0L A;  1E1H B;  3RC8 A;  4BK2 A;  1MQT D;  2RS5 4;  4ANJ A;  1T8B A;  4Z2T A;  3DJG X;  2TPR A;  1RP0 A;  1GPE A;  4IST A;  3FZH B;  4YKF A;  3AEE A;  3I6D A;  4ZI7 E;  4B3M T;  4AIS A;  2RR1 4;  3PUV F;  1PXA A;  4NTC A;  4U8K A;  3T2Y A;  3O4X E;  3RQW A;  3JC6 C;  1LV0 A;  4MBQ A;  5LP6 E;  3T1Y T;  4D03 A;  4K5R A;  1CBO A;  4V1A v;  2B7S A;  2JB2 A;  2WB5 A;  2E9X D;  2MPK A;  4OPI A;  3RED A;  3UU3 A;  1AJ3 A;  3BI4 A;  3RYH E;  3P1W A;  2UXX B;  4JI2 T;  1XDO A;  1ELI A;  5KX5 E;  3SOL A;  5FS6 A;  4NPP A;  1OED C;  2BBH A;  2V3B A;  2JK6 A;  4DV1 T;  2EQ6 A;  3WAJ A;  2WDR A;  1GRG A;  3OJA A;  4LFC T;  1GXF A;  1YQZ A;  4EYY R;  5HWX A;  4Z8X A;  1M6I A;  2HH7 A;  3GMI A;  3KV6 A;  4AOX A;  4J33 A;  1WYC A;  1N34 T;  3PDY A;  3ZC0 A;  1NHQ A;  5AQQ B;  2CRB A;  1EAH 4;  2DHR A;  2ES0 A;  3EUH A;  4JEH B;  5LHH B;  5IUX A;  3KD9 A;  2BXS A;  2WOI A;  3FG2 P;  1Y0P A;  5FP3 A;  1H7W A;  2AQJ A;  5HCJ A;  3VRA A;  3JBG 4;  4TZ4 C;  5KMR A;  2V6X A;  3FB2 A;  2AR8 A;  2XVH A;  1VBE 4;  3JCF A;  1D7L A;  2J4G A;  4OPG A;  5LA6 E;  2YG4 A;  3AEB A;  3NBX X;  2WWV A;  4GF7 A;  1SUM B;  3CKD A;  5AQJ B;  1O3X A;  3UTG A;  2GQF A;  4H4U A;  2RA1 A;  1GRF A;  3KBU A;  1VQW A;  2FBW A;  5HEH A;  1BZL A;  2V8S V;  3AEF A;  3T2K A;  2LKG A;  5AQO B;  1PHH A;  3M65 A;  1SE7 A;  2FJB A;  2YLS A;  3FIM B;  5L2L A;  3I0Q A;  3MK7 C;  5M4Y A;  3Q9D A;  3ZST A;  1XAN A;  2CWY A;  1GRB A;  2VWA A;  3TLV A;  1M62 A;  3I1A A;  3RC3 A;  3COX A;  4P1N A;  1HNW T;  4DR2 T;  2HN2 A;  3LK2 B;  4ZN0 A;  5AQN B;  4DGK A;  3GYI A;  3ATQ A;  1PVC 4;  1OED E;  3RIU A;  2WZH A;  4CXX A;  3BNM A;  4Y4N A;  3DK4 A;  2RGJ A;  4LF4 T;  4COF A;  1CC6 A;  1O5W A;  1JU2 A;  5FS9 A;  2UXD T;  2YLR A;  4AKH A;  4USQ A;  1H81 A;  3SZW A;  4YSZ A;  2XYO A;  4A56 A;  4TM0 A;  3URH A;  3GA8 A;  3C4X A;  3CQC B;  1F8R A;  4TX5 A;  5CJ5 A;  5HAX A;  3WAK A;  1KNR A;  3UQ4 A;  1NWM X;  3EDV A;  1NHR A;  2PYX A;  5L3B B;  5IHY A;  3DME A;  2BK4 A;  2N1G A;  4PW8 A;  3AE1 A;  5L3C B;  3NYC A;  3AEG A;  2B9W A;  3E1T A;  3HL6 A;  2CMR A;  4HGA A;  1UK5 A;  2KIN B;  4FX9 A;  1YKJ A;  3RP6 A;  5ABH A;  2C76 A;  3MKD A;  4A6N A;  1ZP0 A;  4A97 A;  2ODV A;  3UUM A;  1GV4 A;  4KI0 F;  1MND A;  1BWC A;  3CNT A;  2VQB A;  1N4V A;  1PJ7 A;  5L46 A;  1T7S A;  1PBE A;  5JQG E;  4CN1 A;  5L3D B;  4J2W A;  1W4X A;  3UUN A;  3I9Y A;  4AP3 A;  1NPX A;  3PVC A;  4H4V A;  4KHZ F;  5KMG P;  2M67 A;  3HKD E;  3T8O A;  4CY6 A;  3CND A;  2XFO A;  5KVI A;  1PO1 4;  2JQH A;  1HXS 4;  1DU2 A;  2DWG A;  1PDH A;  3GD3 A;  2DKI A;  1HS7 A;  2JAE A;  1J5E T;  2OLN A;  3R9U A;  4XXG A;  1Y56 A;  2C3C A;  2Q0K A;  2C67 A;  4ZOL E;  1J1J A;  2XAH B;  5C3J A;  1D4M 4;  4O4J E;  3ALJ A;  3Q6J A;  2YVF A;  3ZT6 A;  2NW9 A;  2CLY B;  2WP9 A;  2WOW A;  3KV4 A;  1L9C A;  1EBD A;  4QX7 B;  3FBL A;  1NDA A;  4EGW A;  4PFO A;  2WZI A;  5JR9 A;  1KDG A;  4II3 A;  4O5U A;  5TAO A;  2W62 A;  3CML A;  5JR9 B;  4YHJ A;  3ZCI A;  3FXD B;  5AQU B;  5JRC A;  2C70 A;  1AR6 4;  1JRZ A;  5JTG A;  1Z6L A;  4YSX A;  3HKC E;  2DWK A;  4MFR A;  1ZX9 A;  3B3R A;  4CBQ A;  2F4V T;  4Z26 A;  2W67 A;  3C50 A;  4H4T A;  3HYW A;  5F3J A;  2LE8 A;  3S5W A;  3LZW A;  2QA7 A;  2L3L A;  5J2U E;  5LHG B;  4GR1 A;  3KLJ A;  2IVD A;  2R04 4;  2LSG A;  4IA5 A;  3C4Z A;  5FXX A;  4JY2 A;  1R8I A;  1L9E A;  1B8S A;  3B57 A;  3V5S A;  2X9Y A;  3ISH A;  5LMU T;  4IE6 A;  4CZZ B;  2YDQ A;  3VR9 A;  3QJ4 A;  2GR3 A;  1DOD A;  5HXH A;  2X99 A;  4OYJ A;  2E9X B;  3AE4 A;  3RHW A;  3ZKR A;  4DSG A;  4X66 T;  5HWY A;  3E0Z A;  2E9X A;  2XQ7 A;  1J5W A;  2D0U A;  4QX8 B;  3OPC A;  2W0G A;  4J57 A;  4JI7 T;  5FMN A;  4CXW A;  2BG9 E;  3UUX B;  3RYF E;  2WEU A;  4A6N B;  1RUG 4;  2XM2 A;  3AE3 A;  4BJZ A;  2XQ8 A;  3RNM A;  3C51 A;  4DR4 T;  4IL4 A;  1D0X A;  1MO9 A;  2VAS A;  1RVF 4;  1IBM T;  2RS1 4;  4ZS2 A;  2QYW A;  2IID A;  2IUB A;  2OA5 A;  4A98 A;  1CL0 A;  4GDP A;  4CY8 A;  2X9W A;  4JI3 T;  2Y6R A;  3OZ2 A;  3WE0 A;  2VKJ A;  1XZY A;  2KND A;  2C75 A;  2UU9 T;  3NHO X;  1YXR A;  2V60 A;  4AIU A;  3LK3 B;  2PTF A;  3RYC E;  3UUB A;  5BUL A;  3AEA A;  4YTM A;  4TLX A;  3RP7 A;  2YIN A;  1WR6 A;  2YQU A;  4DSH A;  4PAA A;  2QCU A;  3UTF A;  3UKK A;  1D1B A;  4CCQ A;  1D4E A;  1BGJ A;  5CFB A;  2XQ9 A;  3P8C D;  3AD7 B;  2E5L T;  4DV4 T;  5CA1 E;  2VB6 A;  2IC9 A;  3EI0 A;  5JDQ A;  2WU2 A;  1RUD 4;  2I0M A;  1VCS A;  2XCG A;  4AT2 A;  2Q0L A;  4IDP A;  2UZZ A;  3PO7 A;  3UUL A;  2WMN A;  4JDR A;  2YAU A;  4O2B E;  3KV5 A;  2HQM A;  1E1K A;  2YVJ A;  4X4J A;  4PAG A;  2FJE A;  2JMK A;  1E6E A;  3EF6 A;  1S3E A;  4CXY A;  4YXD A;  1NG4 A;  2BS4 A;  3M13 A;  1H7X A;  4C90 A;  3II4 A;  3N2K E;  2V3A A;  1P2E A;  2XQA A;  2V5Z A;  2F5Z A;  3K3Q C;  2QVA A;  4H2R A;  4X20 E;  2HWB 4;  2GF3 A;  2YKS A;  2BC0 A;  2LFC A;  2ZLY A;  3NG7 X;  2D5U A;  5HXR A;  4DBQ A;  4DUZ T;  4TV8 E;  3AVR A;  5HXC A;  3RGL A;  3BK9 A;  1JNZ A;  1LRZ A;  2X8G A;  2GRT A;  5DBJ A;  3CNP A;  1VBD 4;  2WCA A;  2GAH B;  1MIW A;  3K7M X;  2BAC A;  3LBX A;  3K7T A;  2I59 A;  3GRS A;  5KWF A;  4GDE A;  3ALM A;  5EBK A;  4H50 A;  3ZCJ A;  3GMB A;  3NK2 X;  1PBD A;  4OCG A;  3NRY A;  5F8P A;  1PBB A;  2AXD S;  4P9S A;  2XSB A;  4DV5 T;  2PJQ A;  5EK2 A;  3L1R A;  1UUS A;  2O9Z A;  5CQF A;  4GUV A;  2KWH A;  5L3G B;  3LOV A;  4Z24 A;  3F8P A;  3V3N A;  4B3R T;  2M6B A;  1CJ2 A;  2YG6 A;  1K4Q A;  3GDP A;  3SX6 A;  1U4Q A;  1YQ3 A;  3ZT5 A;  2NR4 A;  2BK5 A;  3DH9 A;  2L8K A;  3QB5 A;  2E4G A;  4DV7 T;  2EHO D;  5L4E A;  2GMH A;  2Q9Q D;  4JV5 T;  2B7R A;  3ETU A;  3NLC A;  2JPF A;  1HRI 4;  3QSM A;  1JEH A;  3Q9T A;  1N4W A;  1VCT A;  2MTQ A;  3GN5 A;  4I43 B;  4J31 A;  3NWI A;  5M10 A;  4NUV A;  3RRW A;  4JUY A;  3NVO A;  5LYJ E;  1RUE 4;  3AD9 B;  1FEW A;  4UVB B;  2Q9Q C;  3I9W A;  4QKN A;  1KFY A;  3SQP A;  1Z0P A;  4YSH A;  1M7K A;  2X66 A;  3PUQ A;  4Z91 A;  4HFD A;  1YQ4 A;  4MJW A;  2CBJ A;  1ONF A;  4OHF A;  4JYA T;  3BHF A;  1EL8 A;  4DBR A;  4IVM B;  2X68 A;  4ZZB A;  1ZV4 X;  4K5S A;  3G5R A;  2X3N A;  3W15 B;  4CNJ A;  4I50 E;  3ICS A;  4NEV A;  2KXP B;  2YM1 A;  4TM3 A;  3LJP A;  4TWF A;  4U8I A;  2KWI B;  2E8I A;  3OVU A;  1POV 0;  2OLO A;  3CGB A;  3AA7 B;  1U5P A;  2C64 A;  2B76 A;  1JRY A;  2UXB T;  3P4R A;  3SFE A;  3SY4 A;  2A3D A;  4AXP A;  1T72 A;  2VVM A;  4H2N A;  3D8X A;  1WCR A;  1QUU A;  3UTE A;  1BR2 A;  1ZOV A;  3J7Y q;  2VOU A;  2NW8 A;  1R08 4;  1MXT A;  3ADA B;  2ACX A;  1OJC A;  3FZK B;  3NKZ A;  5LJM A;  4K22 A;  2VZ2 A;  2PLV 4;  1AOG A;  3L3P A;  4PK4 A;  1ZY8 A;  2HPL A;  3UKH A;  3NK1 X;  1FL2 A;  3ZMZ B;  2VVL G;  1PS9 A;  1Z8U A;  1GRT A;  3AAI A;  1W0B A;  3GSI A;  5C8Y E;  1GTH A;  1D7Y A;  2YLZ A;  1ZHC A;  3NTD A;  5EK3 A;  4NTD A;  2WP6 A;  2R06 4;  2EQ7 A;  3RF1 A;  4JI5 T;  1K0I A;  5GON E;  3TLS A;  1WFD A;  2A89 A;  3AA6 B;  5IYZ E;  3ITJ A;  2PW9 A;  3HI2 A;  2G0U A;  2RMU 4;  1GES A;  4D04 A;  5HXI A;  3VU7 H;  3SZC A;  2LSJ A;  1D4C A;  1OJA A;  1GTE A;  3ZYK A;  1E2A A;  1NEN A;  1AL2 4;  3QSS A;  2KZ7 B;  3IA3 A;  1CC4 A;  3SS1 A;  5EK4 A;  5KMQ A;  1T98 A;  1KNZ A;  2CE7 A;  4B69 A;  2APG A;  2J47 A;  1H83 A;  3RIA A;  2EX3 A;  3CVR A;  5JRE A;  1AR9 4;  5LNK A;  4JY3 A;  3FBS A;  1QLB A;  3UKF A;  2YLT A;  3E08 A;  4G74 A;  2Q9Q A;  1OXZ A;  3T0K A;  3UU5 A;  3T2Z A;  2V7M A;  5IPY A;  2CPT A;  4L5G A;  4H9O C;  2I0Z A;  3ZMV B;  2ZMA A;  4F8H A;  4YWO A;  2BG9 A;  5JDF A;  4MLK A;  2RGO A;  3CPI G;  4GRT A;  5JDN A;  3DJE A;  2Y48 B;  4USR A;  1TYT A;  3UFE A;  3Q2M A;  4AQG A;  3Q5E A;  5J0Z A;  4AQY T;  1FJG T;  1N32 T;  4EYU A;  5CB4 E;  4GYS A;  3H3A A;  4GKJ T;  4PK5 A;  3N9P A;  2R45 A;  2JKC A;  1XI1 A;  4QH4 A;  4TM4 A;  2WBL A;  4CI1 B;  2XLP A;  4NXM T;  2XSA A;  4HFV A;  4FK1 A;  3PUY F;  2XVE A;  4JI0 T;  2R4J A;  2CM0 A;  1XMQ T;  2WPC A;  1X79 A;  2NWB A;  3ABV A;  4C3Y A;  2LKH A;  3A8Y C;  1HRV 4;  1XDP A;  4WX1 A;  4OPC A;  1Y64 B;  3K3O A;  5J60 A;  2JQ9 A;  1NEK A;  2W63 A;  2UXC T;  2XQY A;  3SM8 A;  4ZXL A;  1HCI A;  4HFH A;  4A99 A;  2ZM8 A;  5AQV B;  4BJN A;  2X0L B;  3AA0 B;  4G2A A;  3GWD A;  3GN5 B;  4AKL A;  1HYU A;  4U7I A;  2A8X A;  1RUJ 4;  4ECH A;  2XFP A;  5AQH B;  4H4W A;  3C4W A;  3RX6 A;  1QO8 A;  3H4K A;  1Y01 A;  3IHG A;  2CEA A;  4BV6 A;  2YVG A;  4U2Y A;  4Q4Y 4;  4X5T A;  3GD4 A;  4HB9 A;  3IEE A;  1DXL A;  5KDM C;  1PJ5 A;  2P9B A;  3F8R A;  1RSG A;  3WI3 A;  1M64 A;  2C4C A;  4JI6 T;  1Z7S 4;  1LTX R;  4H4Z A;  3DJJ A;  3NT6 A;  5EZY E;  2XVF A;  3PUG A;  5ER0 A;  4I58 A;  3K1S A;  2MYS A;  5FXW A;  3AE6 A;  4EIP A;  1WRD A;  2YLX A;  2K9A A;  5FMH A;  3VHL A;  5C2T A;  1LVK A;  2ZBW A;  3K30 A;  3ZPO A;  2CVJ A;  3UU6 A;  2V7I A;  3FI7 A;  2BKP A;  2BG9 C;  4X1I E;  5LBM A;  3LXD A;  2CHO A;  2VL8 A;  1TDE A;  5FVK A;  4TV9 E;  3CGE A;  4M52 A;  1GEU A;  5BUK A;  1E39 A;  2KSR A;  3QFB A;  3ANW B;  3PUR A;  2XLR A;  3SWH A;  3IWA A;  1ZK7 A;  5LXT E;  3CGC A;  2R7F A;  4B6X A;  4ZI2 D;  4J36 A;  3P4Q A;  2E5V A;  3KBT A;  2UXN B;  5FXZ A;  1B5Q A;  3NTA A;  3PS9 A;  3PJA A;  2Y8D A;  3UTH A;  4J56 A;  2CCQ A;  3SZF A;  1O95 A;  2PHH A;  2XM1 A;  2V7J A;  2GAG B;  2KLQ A;  5DAB A;  4ADW A;  1D5T A;  1N33 T;  3C4N A;  5HHF A;  3P4S A;  3H8L A;  5AQS B;  4K7Z A;  4X62 T;  2VVL A;  1LQT A;  4Z2U A;  2XAS B;  3AWI A;  3QFA A;  3ONX A;  5F5W A;  3U3I A;  3N9L A;  4P0B A;  3LK4 2;  5DQV A;  2V6Y B;  4K8D A;  2CXF A;  1LQU A;  2YU2 A;  3TLT A;  2YDS A;  2BVM A;  3P4W A;  5KMS A;  2YK0 A;  1H86 A;  4MAL A;  4PJJ A;  5AQR B;  2JJ9 A;  4Z2R A;  2XLS A;  1IUV A;  5KOW A;  4Q4X 4;  2Q6U A;  5HCM A;  1FMW A;  3EDU A;  4X1K E;  1B37 A;  1KF6 A;  4BK1 A;  2J1D G;  2XQ4 A;  5L4H A;  3M12 A;  5M0Z A;  3UU8 A;  5ADX L;  1VRH 4;  3UU4 A;  4CI3 B;  4XZC A;  2K48 A;  4EQX A;  2VVS A;  4TNW A;  4LU6 A;  3VQR A;  1NHS A;  2BK3 A;  2CLY C;  5HY5 A;  5JR9 C;  1XWM A;  4UVA B;  1GER A;  4AI6 A;  1NAA A;  2Q7V A;  3L39 A;  3BHK A;  4KMC A;  4Y4L A;  2XZE A;  2VL0 A;  4DNA A;  4GAP A;  1HFA A;  1VRQ B;  1N36 T;  4LF9 T;  4ZZC A;  1L9D A;  4ZI3 C;  2WQY A;  2BRY A;  3DK9 A;  1US7 B;  3CWZ B;  3AE9 A;  5HEG A;  1COV 4;  1IAP A;  1V59 A;  2TMD A;  3KDS E;  3J8F 4;  3G06 A;  4EMW A;  1B7T A;  4AKI A;  4RHV 4;  1PXC A;  2QAE A; 
#chains in the Genus database with same CATH homology
 2QA1 A;  4XWZ A;  5JCN A;  1FEB A;  2FJE A;  1E6E A;  3EF6 A;  2YG3 A;  3UKP A;  1S3E A;  5GRT A;  4YXD A;  1N1P A;  2BS4 A;  1GT8 A;  1NG4 A;  1H7X A;  2DKH A;  2V61 A;  3II4 A;  2V3A A;  3M13 A;  1P2E A;  3P9U A;  2GR0 A;  1SEZ A;  2V5Z A;  3AD8 B;  2F5Z A;  4H2R A;  4Z44 A;  5BRT A;  1IUW A;  4PAB A;  2GF3 A;  2WOV A;  3CN8 A;  4A5L A;  3G5S A;  5TR3 A;  2BC0 A;  2LFC A;  3GYJ A;  3NG7 X;  1BF3 A;  1UKV G;  3AYJ A;  1PXB A;  2RGH A;  3QVP A;  2GR1 A;  3O0H A;  4APN A;  4B66 A;  4II2 A;  1JNZ A;  2R9Z A;  1ZOY A;  2X8G A;  5DBJ A;  2GRT A;  3CNP A;  2R4E A;  4Y4M A;  2XLT A;  2X8H A;  1E1N A;  2XVJ A;  3NRN A;  1TYP A;  3GRT A;  2BC1 A;  2GAH B;  1CJ4 A;  1K0L A;  2BAC A;  3K7T A;  3K7M X;  3NIX A;  3UP4 A;  4BUR A;  1IUT A;  3GRS A;  5KWF A;  4BK2 A;  4GDE A;  3V3O A;  3ALM A;  3NN0 X;  4H50 A;  5EBK A;  1F8S A;  1X31 B;  2XFQ A;  4Z2T A;  2CUL A;  3DJG X;  2AAQ A;  1BGN A;  3GMB A;  3NK2 X;  4IV9 A;  2GQW A;  2TPR A;  4OPL A;  1PBD A;  3AE2 A;  1RP0 A;  3ZDN A;  4OCG A;  3CGD A;  1GPE A;  1PBB A;  1LVL A;  4P9S A;  4YKF A;  3G5Q A;  3JSK A;  3KA7 A;  3KU9 A;  3AEE A;  2O9Z A;  3I6D A;  2FJA A;  3L1R A;  5CQF A;  4GUV A;  4B67 A;  4RG3 A;  1NHP A;  3LOV A;  3F8P A;  4Z24 A;  3V3N A;  3NYE A;  4UDQ A;  2Z5Y A;  1CJ2 A;  1PXA A;  2YG6 A;  1K4Q A;  3GDP A;  4NTC A;  3CMM A;  5KRQ A;  3SX6 A;  4CNK A;  1YQ3 A;  4U8K A;  2BK5 A;  3DH9 A;  2E4G A;  4JQ9 A;  3T2Y A;  2GMH A;  2RAB A;  2WP5 A;  2B7R A;  2VQ7 A;  3NLC A;  3AED A;  2GH5 A;  3AYI A;  4G6H A;  1LV0 A;  3CPJ G;  4D03 A;  3QSM A;  3VR8 A;  1JEH A;  1P2H A;  3Q9T A;  1N4W A;  4K5R A;  1CBO A;  1CC2 A;  2B7S A;  2C73 A;  2JB2 A;  4J31 A;  5M10 A;  2EQ8 A;  2OAL A;  4OPI A;  1ZMD A;  3HYV A;  2R0G A;  3RED A;  2C7G A;  1COY A;  3AD9 B;  5JCM A;  4AP1 A;  3BI4 A;  3P1W A;  5EB4 A;  1ELI A;  1KFY A;  5BVA A;  5FS6 A;  3SQP A;  2V3B A;  4C5O A;  4YSH A;  4NNJ A;  1Q1W A;  3CNJ A;  4UDP A;  2JK6 A;  4AT0 A;  1YQ4 A;  2EQ6 A;  1E1M A;  4MJW A;  2WDR A;  1GRG A;  1ONF A;  3BHF A;  1EL8 A;  3LZX A;  1GXF A;  1YQZ A;  4IVM B;  1PBC A;  4B64 A;  4K5S A;  3G5R A;  1Y56 B;  1M6I A;  2X3N A;  4CNJ A;  4H4R A;  4AOX A;  4J33 A;  3ICS A;  3GWF A;  4NEV A;  2YM1 A;  3GDN A;  4TM3 A;  3LJP A;  2EQ9 A;  2ZZC A;  4U8I A;  4EQS A;  2WDQ A;  1NHQ A;  2OLO A;  4FK1 C;  3CGB A;  1TDK A;  3T31 A;  1JRX A;  2ZZ0 A;  2C64 A;  2B76 A;  1JRY A;  4H4S A;  1XHC A;  4NEW A;  4C74 A;  3P4R A;  1KSS A;  3SFE A;  3SY4 A;  1GRH A;  1S2Y A;  2GV8 A;  3KD9 A;  2BXS A;  3KPF A;  4EQR A;  2BCG G;  2WOI A;  1D4D A;  3FG2 P;  1Y0P A;  4JN9 A;  2VVM A;  4H2N A;  2NPX A;  3NYF A;  3D8X A;  1H7W A;  3UTE A;  1E1L A;  2AQJ A;  4U8J A;  3VRA A;  1ZOV A;  5KMR A;  3BI5 A;  1Q1R A;  2VOU A;  1MXT A;  3ADA B;  2AR8 A;  2XVH A;  2VRL A;  1ZMC A;  2BA9 A;  4HA6 A;  1OJC A;  2Z5X A;  3CIR A;  3GMC A;  4U8N A;  4K22 A;  2VZ2 A;  4CRT A;  1AOG A;  2IVE A;  1D7L A;  1ZY8 A;  1DOE A;  3AYL A;  3EAN A;  4ZCD A;  3HZL A;  4X9N A;  5J7X A;  4X9M A;  2R0P A;  3UKH A;  3AE5 A;  3NK1 X;  1FL2 A;  4OPG A;  2VVL G;  3AEB A;  2YG4 A;  1PS9 A;  2BAB A;  2B9X A;  1GRT A;  3M0O A;  3GSI A;  1LPF A;  2WET A;  4JNA A;  4GF7 A;  1GTH A;  3NK0 X;  1D7Y A;  2YLZ A;  3UKL A;  3NTD A;  4U2T A;  1DJQ A;  4NTD A;  3UTG A;  3UKQ A;  2GQF A;  4H4U A;  1GRF A;  1KSU A;  3VRB A;  3V76 A;  2GMJ A;  2WP6 A;  4J34 A;  2EQ7 A;  1VQW A;  1H82 A;  3FPZ A;  2FBW A;  1BZL A;  1K0I A;  3AEF A;  3T2K A;  1K0J A;  1GAL A;  4H4Q A;  2JB3 A;  2QA2 A;  4CCR A;  1PHH A;  2A89 A;  3KPK A;  3ITJ A;  2XFN A;  4C3X A;  2NVK X;  2FJB A;  4A9W A;  2JBV A;  1GES A;  2YLS A;  1GSN A;  3FIM B;  1RYI A;  3UOY A;  4D04 A;  5HXI A;  2GR2 A;  3SZC A;  1TRB A;  1D4C A;  2YLW A;  5U25 A;  1OJA A;  4U8M A;  1MOK A;  1GTE A;  1XAN A;  2X8C A;  3OC4 A;  4KPR A;  1NEN A;  1CF3 A;  1GRB A;  2BYB A;  3QSS A;  4XWR A;  1CC4 A;  2V6O A;  3COX A;  5KMQ A;  4TM1 A;  4B69 A;  2APG A;  2VRM A;  1H83 A;  3GQK A;  4H2Q A;  3RHA A;  1ZDL A;  3CNS A;  1NG3 A;  1XDI A;  3DGZ A;  3NH3 X;  4ZN0 A;  3CTY A;  4DGK A;  3GYI A;  3ATQ A;  4JY3 A;  2YM2 A;  3FBS A;  1QLB A;  3UKF A;  4B65 A;  5JCK A;  1FEA A;  2YLT A;  3IF9 A;  1XPQ A;  3BNM A;  5KXJ A;  4G74 A;  1CJC A;  2WHD A;  4Y4N A;  3T0K A;  3DK4 A;  2RGJ A;  3T2Z A;  5IPY A;  1CC6 A;  1O5W A;  1JU2 A;  5FS9 A;  5CKU A;  2I0Z A;  2YLR A;  2YR4 A;  3LAD A;  4YWO A;  4USQ A;  1H81 A;  3SZW A;  4YSZ A;  2XYO A;  2ACZ A;  3L8K A;  2RGO A;  3CPI G;  4GRT A;  1H6V A;  4EIQ A;  2BS3 A;  2YWL A;  3DJE A;  1VG9 A;  4TM0 A;  4USR A;  3URH A;  1TYT A;  2BCP A;  4YTP A;  1REO A;  1CJ3 A;  3AB1 A;  5KNL A;  1F8R A;  4IA6 A;  4NWZ A;  3UCL A;  5KOX A;  5U63 A;  4GAV A;  1KNR A;  4TLZ A;  2R45 A;  1NHR A;  2JKC A;  4KX6 A;  1F8W A;  2PYX A;  4TM4 A;  4WCT A;  5KMP A;  2XLP A;  3DME A;  2BK4 A;  4B1B A;  2WS3 A;  5GSN A;  5JCL A;  3EAO A;  3UOX A;  4FK1 A;  3AE1 A;  2WU5 A;  2XVE A;  2R4J A;  3NYC A;  3AEG A;  4YT0 A;  2B9W A;  2WPC A;  4ZCC A;  4H4Y A;  1F6M A;  3E1T A;  3ABV A;  4C3Y A;  1EL9 A;  2XDO A;  3SYI A;  4FX9 A;  1IUS A;  1YKJ A;  3RP6 A;  4U8O A;  4WX1 A;  4OPC A;  2C76 A;  4B68 A;  2C65 A;  4A6N A;  1ZP0 A;  2BS2 A;  3DGH A;  5J60 A;  1GV4 A;  1JNR A;  5FS7 A;  1BWC A;  3CNT A;  1NEK A;  1FEC A;  2VQB A;  3GYX A;  1N4V A;  1PJ7 A;  1F3P A;  3SM8 A;  5L46 A;  2FJD A;  4EMJ A;  1PBE A;  4A99 A;  3CPH G;  3NKS A;  4J2W A;  1W4X A;  1FCD A;  2GVC A;  3GWD A;  4A79 A;  2C66 A;  2CDU A;  4B63 A;  2R46 A;  4OPT A;  4AP3 A;  1NPX A;  3PVC A;  1HYU A;  2GB0 A;  4H4V A;  4BJY A;  1KNP A;  2A8X A;  4ECH A;  2XFP A;  1ZKQ A;  4H4W A;  2CFY A;  2OAM A;  1IJH A;  3RP8 A;  1QO8 A;  3H4K A;  3NN6 X;  3H8I A;  4CY6 A;  3CND A;  2XFO A;  4ICY A;  5KVI A;  3IHG A;  5IQ1 A;  3VRD B;  4BV6 A;  3LB8 A;  4I59 A;  3AE7 A;  1GET A;  2YVG A;  4G9K A;  3GD4 A;  3P4P A;  4HB9 A;  1DXL A;  1PJ5 A;  3F8R A;  1PDH A;  1RSG A;  4U2L A;  1M64 A;  3GD3 A;  2DKI A;  2BXR A;  5FS8 A;  2JAE A;  2OLN A;  3R9U A;  3I3L A;  2C4C A;  4OPD A;  4XXG A;  4YSY A;  1LTX R;  4H4Z A;  2E1M A;  1JOA A;  3DJJ A;  1S3B A;  3NT6 A;  4H7U A;  2XVF A;  1Y56 A;  2C3C A;  2Q0K A;  2C67 A;  2XFU A;  5ER0 A;  2B9Y A;  3FMW A;  4I58 A;  4LA1 A;  4EQW A;  3ZYX A;  1L0V A;  3AE6 A;  4EIP A;  2YLX A;  5FMH A;  1B4V A;  5C3J A;  3GQH A;  5C2T A;  3ALJ A;  3EPT A;  2YR5 A;  3Q6J A;  2ZBW A;  3K30 A;  2YVF A;  2CVJ A;  3QVR A;  4JNQ A;  3SUC A;  4G73 A;  2WP9 A;  2WOW A;  1L9C A;  1EBD A;  1NDA A;  1YY5 A;  2YVJ A;  3DA1 A;  3LXD A;  2C3D A;  1TDE A;  1KDG A;  2JB1 A;  4II3 A;  4O5U A;  3S61 A;  3ATR A;  3CGE A;  2Y6Q A;  4LII A;  4M52 A;  2C70 A;  1GEU A;  5BUK A;  1E39 A;  1JRZ A;  1Z6L A;  3NGC X;  4YSX A;  3QFB A;  4OVI A;  2YG5 A;  1ZX9 A;  2GEW A;  1GRA A;  3B3R A;  3C4A A;  2XLR A;  1DOC A;  1PN0 A;  1OJT A;  2XLU A;  4CBQ A;  4Z26 A;  2X50 A;  3IWA A;  4H4X A;  2ZZB A;  1O94 A;  4H4T A;  4O5Q A;  2WPF A;  5KVH A;  2ARD A;  3HYW A;  1ZK7 A;  5LV9 A;  2XVI A;  1QJD A;  4U8L A;  3CGC A;  3S5W A;  3KVE A;  3LZW A;  1CHU A;  1TDN A;  4GR1 A;  3KLJ A;  2IVD A;  1DNC A;  3DK8 A;  4IA5 A;  1GND A;  3D1C A;  4J36 A;  3NNE A;  2OA1 A;  4H2P A;  3P4Q A;  2E5V A;  2R0C A;  2WBA A;  4JY2 A;  4U2S A;  1L9E A;  1B8S A;  1IUX A;  1LJ1 A;  3ISH A;  4NZH A;  4UDR A;  1B5Q A;  4EMI A;  5EB5 A;  4NTE A;  1E7P A;  3NTA A;  3PS9 A;  3UTH A;  4Z25 A;  4J56 A;  3UKA A;  3VR9 A;  3BNU A;  2GR3 A;  3IC9 A;  3QJ4 A;  4H4P A;  1DOD A;  3SGL A;  3SZF A;  1O95 A;  2PHH A;  2X99 A;  4EM4 A;  2GAG B;  3T14 A;  4ADW A;  1D5T A;  5HHF A;  3C4N A;  4DSG A;  3AE4 A;  3P4S A;  4IVO B;  3KKJ A;  3ALL A;  3SZ0 A;  2WDV A;  1EL5 A;  3H8L A;  4K7Z A;  2VVL A;  4J57 A;  1LQT A;  4X4J A;  4Z2U A;  1FOH A;  2WEU A;  3UP5 A;  3SXI A;  3AWI A;  3QFA A;  3ICT A;  4A6N B;  3QSE A;  4E0V A;  3AE8 A;  3AE3 A;  1OJD A;  4K8D A;  4RSL A;  2H89 A;  4BJZ A;  3AEC A;  3RNM A;  1N4U A;  2WES A;  3F8D A;  1MO9 A;  1LQU A;  4U8P A;  1VDC A;  3T37 A;  2H88 A;  5KMS A;  2IID A;  1H86 A;  4AOS A;  4Z2R A;  4EM3 A;  1CL0 A;  2C72 A;  4GDP A;  2XLS A;  1IUV A;  4RG4 A;  4CY8 A;  2YR6 A;  4YKG A;  5KOW A;  5HYM A;  1H84 A;  2Q6U A;  4K2X A;  4A7A A;  2Y6R A;  3OZ2 A;  4OPU A;  5U1O A;  3WE0 A;  5IQ4 A;  1B37 A;  2C75 A;  4BK3 A;  3NHO X;  1KF6 A;  2V60 A;  3HYX A;  1DOB A;  4BK1 A;  3C96 A;  5BUL A;  1EL7 A;  1TDO A;  3M12 A;  5M0Z A;  3AEA A;  4YTM A;  4TLX A;  3RP7 A;  4C77 A;  2YQU A;  4N9X A;  4DSH A;  4PAA A;  2A87 A;  2QCU A;  3IHM A;  4EQX A;  1PBF A;  1PJ6 A;  3UTF A;  2BRA A;  4LU6 A;  3UKK A;  3VQR A;  1NHS A;  5EOW A;  2BK3 A;  4CCQ A;  5HY5 A;  1D4E A;  1BGJ A;  3SFD A;  1NAA A;  4GCM A;  1GER A;  4G6G A;  2Q7V A;  4A65 A;  3BHK A;  3UOZ A;  4REK A;  4Y4L A;  3AD7 B;  4DNA A;  2YG7 A;  4GAP A;  3K7Q X;  1OJ9 A;  1TDF A;  2WPE A;  2WU2 A;  1VRQ B;  1IUU A;  1L9D A;  2XCG A;  1DJN A;  1BKW A;  5JCI A;  2WQY A;  2BRY A;  4AT2 A;  3DK9 A;  1S2Q A;  2J3N A;  2Q0L A;  2UZZ A;  1Q9I A;  3AE9 A;  3PO7 A;  3UOV A;  4JDR A;  3ICR A;  4YTN A;  1GOS A;  1V59 A;  2TMD A;  2YAU A;  3AXB A;  3DJD A;  3BI2 A;  4FDC B;  4UP3 A;  4Z43 A;  3B6D A;  2HQM A;  4EMW A;  2W0H A;  1GRE A;  1E1K A;  1PXC A;  1VG0 A;  2QAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...