4YT0A

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 209
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4yt0A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4yt0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4yt0A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4yt0A04
4PAAA 3UP4A 3DMEA 2XVEA 3S61A 3DJJA 2QAEA 1JU2A 1NENA 3GMCA 3CTYA 3DJGX 3GDNA 4B63A 2XCGA 1H7XA 1NG3A 2UZZA 4H4ZA 2R0CA 1BZLA 4CBQA 3ABVA 1B4VA 4NTCA 3BI5A 3CPJG 1PXCA 2B76A 4USQA 4DSHA 2W0HA 2XFPA 4EMJA 4TM3A 5TR3A 2GMJA 2WHDA 3PVCA 3DGZA 3UTHA 1H81A 1KSSA 1FOHA 1LVLA 2E4GA 3LZWA 5EBKA 2WQYA 2CULA 4J34A 3CGBA 2BK3A 2NPXA 1D4EA 3AECA 2VQBA 3AE1A 3AYIA 1YY5A 1K4QA 2GAHB 5CQFA 3K7QX 1ZY8A 3NH3X 2FJDA 2GQWA 3UKHA 1GRGA 1TDOA 3M13A 2WOWA 3ALMA 4I59A 1D7LA 2XLSA 1XPQA 3UKFA 1JRZA 2DKHA 3RP8A 2YAUA 1N1PA 4YTNA 3RP6A 2OAMA 2EQ7A 2C3DA 1N4VA 2XFOA 3IC9A 1L9DA 3GQHA 1BWCA 3F8RA 3DK8A 2GH5A 2YVFA 3CNJA 4J31A 1B5QA 1FECA 3O0HA 1CF3A 3SUCA 1D7YA 4U8OA 4H4YA 1VG0A 2BC0A 3UTEA 2GMHA 3QSEA 1KFYA 2GF3A 3LADA 5EB5A 3G5QA 5J7XA 4B65A 3NN0X 2V5ZA 5U25A 1XDIA 5HHFA 3M12A 3P4PA 2XLPA 1GTHA 5FS7A 3SM8A 3AE2A 1B37A 3F8PA 1OJCA 2GB0A 2YLXA 4XWRA 3AEBA 1QJDA 3QJ4A 2YLWA 4UP3A 5C3JA 4NEVA 3NYCA 2BCPA 1PBBA 1P2EA 1EL8A 3GWDA 3DJEA 2I0ZA 1PBFA 2WPEA 5BVAA 4YKGA 4NZHA 1XANA 5KWFA 2R45A 5L46A 2DKIA 3I6DA 3AYLA 3IWAA 2YLRA 4K22A 4JN9A 4YSXA 5BULA 3UCLA 1H6VA 4RG3A 3AE3A 3M0OA 4IVMB 1KF6A 1JRYA 3WE0A 4IV9A 2IVDA 5JCMA 2B9WA 5JCKA 3NN6X 2JK6A 4K5SA 4EM3A 3ATRA 4FDCB 1GEUA 2EQ6A 3AE5A 1LV0A 2A8XA 2GQFA 2C67A 2GEWA 2WEUA 4EMIA 4YT0A 4H4VA 3KPFA 2B7RA 2V6OA 4UDPA 4A9WA 4B69A 2PYXA 1TRBA 1DJQA 1EL9A 4J36A 2E5VA 1NAAA 1NHRA 1S2QA 3RNMA 3UOVA 3DK4A 1D4DA 1ZKQA 1ZOVA 2GR1A 2R0GA 4J56A 3SFDA 1FL2A 3UTGA 2QA2A 5KVIA 1IUTA 3AE6A 1NEKA 3V3NA 2B9XA 3CGCA 1GRAA 3EAOA 2H89A 3AE8A 3PS9A 1L9CA 3V3OA 1PS9A 4KX6A 2YR6A 2WPFA 2BABA 4H2NA 1OJDA 4K5RA 1F8WA 1ZP0A 2WU2A 1E7PA 2GR2A 1Y56A 2JB3A 2OALA 2XVIA 3DJDA 2X8HA 1X31B 3QFBA 1PJ6A 4AT0A 4AOSA 2YLSA 4CCRA 1CC2A 4CY8A 1K0JA 4JY3A 3Q6JA 3KLJA 2WBAA 3QVRA 1NHPA 1UKVG 1PBEA 4A6NB 4REKA 3P1WA 3K7TA 4U8PA 1GRTA 1H7WA 2GV8A 2WP6A 3QVPA 4PABA 4C77A 3CNDA 1PHHA 1NHQA 1REOA 1H82A 1VRQB 1BGNA 3NHOX 4U2SA 5KOXA 4DSGA 2C72A 4H4UA 3D1CA 2IIDA 3OC4A 1FCDA 1Q9IA 4TLZA 4LIIA 1SEZA 3GRSA 3UTFA 1D5TA 3GD3A 4BJZA 1ZOYA 3FPZA 3CGEA 1GSNA 1ZK7A 3ALLA 2YM2A 2RGHA 2V3AA 1QO8A 2YVGA 1F8SA 4Z2RA 2RABA 1FEAA 4Y4MA 2TMDA 2V61A 1GPEA 1AOGA 2JB1A 4MJWA 4XXGA 3AB1A 2WP9A 3RP7A 1PDHA 3ICSA 1PJ5A 5IQ4A 1GV4A 4YTMA 2VVLG 3B3RA 3C4NA 3KKJA 2YLZA 4OPGA 3BI2A 2OA1A 4DNAA 4HB9A 1H83A 2BK4A 2WDRA 3T37A 3C4AA 4U8JA 1O95A 3NRNA 3CGDA 2BCGG 3GWFA 4ICYA 4TM4A 3FIMB 1KSUA 3C96A 5FS9A 3AE7A 2JAEA 4H7UA 2ZZ0A 4WX1A 1O94A 2Y6RA 2YM1A 1CL0A 3Q9TA 4C3YA 2FBWA 3UKPA 4YSHA 1BF3A 4USRA 4EMWA 3QSSA 4CY6A 3LZXA 4OPDA 2VRMA 4H4SA 1LPFA 3AE4A 2GVCA 4U8NA 4DGKA 1F8RA 2Y6QA 4RG4A 3EF6A 1RP0A 3NK1X 2BS3A 5C2TA 3VRDB 4BV6A 1YQ4A 1E1KA 5BUKA 3FG2P 3ISHA 3UP5A 4H4TA 3AWIA 1IUSA 4D04A 4YXDA 5KVHA 3CNTA 4BURA 3CN8A 1CBOA 1NHSA 3ATQA 1Y0PA 3NIXA 5JCNA 1V59A 5HYMA 1TDFA 3VR9A 4LA1A 4JDRA 4OPLA 1B8SA 1PBDA 5FMHA 2BXRA 2WETA 3QSMA 1F6MA 4A65A 1OJTA 1PN0A 2VVMA 1COYA 3FMWA 3P9UA 4AOXA 1CHUA 1H84A 1PXBA 5HXIA 4TLXA 1LTXR 5U1OA 3IHMA 1IJHA 2WPCA 1JEHA 2YG7A 4FX9A 3BNUA 2AAQA 1VDCA 2X8CA 1NG4A 1Q1RA 1CC6A 2YQUA 1EL5A 2GR3A 4OPCA 2AQJA 4KPRA 1LQUA 3LJPA 1M6IA 4JNQA 2CFYA 3B6DA 3VQRA 2X50A 2XFUA 4OPTA 3BI4A 1DOEA 1KNPA 2Q6UA 1DXLA 4YWOA 4BK3A 3D8XA 1KNRA 3AEFA 5KRQA 4N9XA 4GCMA 1ELIA 1JNZA 4UDRA 1S3EA 3AYJA 1DNCA 4J2WA 1QLBA 3GD4A 1ZMCA 1NPXA 2BC1A 1GNDA 2CVJA 3K30A 4EM4A 2APGA 3IHGA 5M10A 4U2TA 2GRTA 2GAGB 2C65A 2RGJA 4J57A 3V76A 3GYJA 2VZ2A 2AR8A 2E1MA 2IVEA 3RHAA 2BACA 3OZ2A 2ZZBA 2ZBWA 4U2LA 1JNRA 3VRBA 4C5OA 4EQWA 4APNA 1ZMDA 3GRTA 3G5RA 3NG7X 2C66A 2OLOA 2BXSA 4X4JA 4ADWA 4K2XA 3H8IA 2H88A 1F3PA 2A87A 4GDPA 3NK0X 1CJ4A 4J33A 2BA9A 2X99A 4EQRA 4Z44A 4AP3A 3E1TA 1E1LA 4HA6A 3ICRA 1PJ7A 3P4SA 2Z5XA 2C73A 4RSLA 1BGJA 4EIQA 1NDAA 1N4UA 5M0ZA 3SQPA 4M52A 4P9SA 4ZCCA 5FS8A 2YR4A 1HYUA 1O5WA 1W4XA 2PHHA 2Q0LA 1OJAA 4GUVA 2XFQA 1Y56B 3L8KA 4BJYA 2VQ7A 2QA1A 3NYFA 2BYBA 3REDA 2XFNA 2ARDA 1H86A 3UKQA 2YG5A 2YWLA 3LB8A 3ICTA 4B66A 5GSNA 2NVKX 4U8KA 4H4XA 3BHKA 2CDUA 4GF7A 2XYOA 1CJ2A 1LQTA 2V60A 2Q0KA 1IUUA 2X3NA 2YG4A 3S5WA 3II4A 4ECHA 2WESA 3NLCA 1ZDLA 1GERA 2B7SA 1IUXA 4EQSA 1TYPA 1ONFA 2XVHA 3GYXA 2BS4A 3DH9A 4OPIA 4JNAA 2FJEA 2Z5YA 3ALJA 3EPTA 2QCUA 4U8MA 3GSIA 1DJNA 5IQ1A 4AT2A 4X9MA 4H2QA 1K0IA 3L1RA 3AE9A 2YLTA 2EQ8A 2C75A 2WDQA 3COXA 4E0VA 1L9EA 5HY5A 4U8IA 4A79A 5LV9A 3NT6A 1EL7A 3NGCX 3NK2X 4Y4NA 4CCQA 5KXJA 1S3BA 2JB2A 5DBJA 3CPHG 2WS3A 3AD7B 5JCIA 4H2PA 1TDEA 4X9NA 1VG9A 2EQ9A 2XLTA 2C64A 5CKUA 3SFEA 3VR8A 2B9YA 1GETA 4O5QA 2YR5A 3FBSA 4H4QA 4NEWA 3BNMA 2JBVA 4TM0A 4AP1A 5BRTA 4NTEA 4A6NA 3NKSA 4H2RA 2VOUA 3ZYXA 3G5SA 3P4RA 4Z2TA 3NTDA 4D03A 2HQMA 5JCLA 4IA5A 2WOVA 3UKKA 5U63A 4B1BA 1M64A 2O9ZA 1OJ9A 3AEEA 1GOSA 1XHCA 2C76A 3CNSA 1P2HA 3H4KA 2XDOA 3UKLA 1BKWA 2WOIA 4Z25A 4Z2UA 2V3BA 1CJ3A 2A89A 4YTPA 3UOZA 1RYIA 4OCGA 2WU5A 1VQWA 3DGHA 4FK1A 4A5LA 5GRTA 2BS2A 1ZX9A 1GXFA 3HZLA 1DOBA 1GESA 3KU9A 2C3CA 4Z26A 4FK1C 3AEAA 1MXTA 4YSZA 1GRFA 3ADAB 3KA7A 4H50A 4NTDA 3GQKA 2YVJA 4C3XA 1Q1WA 4GR1A 4XWZA 1E6EA 1N4WA 3EANA 3IF9A 4GRTA 4B67A 1TYTA 1GRHA 4K7ZA 1GREA 1LJ1A 3K7MX 4Z43A 4C74A 3CIRA 2RGOA 5KOWA 4OPUA 4CNKA 2XVJA 3UOYA 2ACZA 3LOVA 4A7AA 3VRAA 3P4QA 1TDNA 1MO9A 3CPIG 4H4WA 4Y4LA 4BK2A 2XVFA 4IA6A 4EIPA 2R46A 4OVIA 2F5ZA 3AD8B 3AEDA 4LU6A 3F8DA 1IUWA 5FS6A 3R9UA 1YKJA 1DODA 2J3NA 1E39A 4CNJA 3AD9B 3H8LA 3QFAA 1CJCA 2R9ZA 5ER0A 4H4PA 1DOCA 4ZN0A 2C7GA 3ITJA 2JKCA 4B68A 3PO7A 4BK1A 1YQ3A 5EOWA 2C70A 3AEGA 3GMBA 4H4RA 5IPYA 1FEBA 4YKFA 5EB4A 1S2YA 3UKAA 3UOXA 2YG6A 1RSGA 4TM1A 2OLNA 4WCTA 2VRLA 4CRTA 2WP5A 3I3LA 2FJBA 4A99A 1E1MA 3CNPA 2BK5A 1Z6LA 4Z24A 2TPRA 3DA1A 1PBCA 4UDQA 2Q7VA 4O5UA 3NYEA 2LFCA 1D4CA 2YG3A 3DK9A 1GT8A 2ZZCA 4K8DA 1GTEA 2WDVA 1MOKA 1GRBA 2R4EA 3BHFA 3URHA 1EBDA 3NNEA 4U8LA 2VVLA 4B64A 2GR0A 3KD9A 1JRXA 3LXDA 4EQXA 1K0LA 4YSYA 4IVOB 3SGLA 2X8GA 1YQZA 1CC4A 3AXBA 2R4JA 4ZCDA 1E1NA 1PXAA 2FJAA 1GALA 2R0PA 3KVEA 4JY2A 2XLUA 3GDPA 3GYIA 1TDKA 4I58A 4GDEA 2XLRA 1IUVA 3NTAA 1L0VA 5J60A 3JSKA 1JOAA 4JQ9A 1KDGA 3ZDNA
chains in the Genus database with same CATH superfamily
2FUPA 3UP4A 3DMEA 1BR4A 3DJJA 4ZZCA 4AIUA 3DJGX 3GDNA 4B63A 4PJNA 4ZZBA 1NG3A 4WBNE 4EXTA 2R0CA 3AVRA 4TM3A 3UTHA 3PVCA 2L8KA 3PJAJ 3LZWA 2CULA 2Z6EA 3C50A 2A9UA 3C98B 1OEDE 4IDOA 4TV8E 2FJDA 2GQWA 1GRGA 4Q4X4 3I9YA 1MIYA 3ALMA 4I59A 1D7LA 4Z90A 4CXWA 4XZCA 2XJ7A 4K0KT 2XQ3A 2CRBA 4DR6T 2PYJA 2A72A 4J31A 1B5QA 3K3OA 3SUCA 1D7YA 3F31A 2BC0A 3UTEA 2GMHA 3QSEA 2GF3A 5J7XA 2L3LA 4UXNB 3NN0X 2V5ZA 1XDIA 5DQWA 4EEBA 5HWYA 3S4UA 3WAKA 3M12A 4PAGA 2XLPA 4X5TA 5L3DB 2C5JA 5CGMA 1B37A 1OJCA 2YLXA 1BR1A 2QVAA 3AEBA 2YLWA 2PG8A 5C3JA 1J5WA 3NYCA 5AQTB 1VBE4 4IIJE 2BCPA 1FMVA 2I0ZA 1PBFA 2MYSA 4YKGA 5KWFA 1XANA 5F8PA 4AI6A 2DKIA 3IWAA 2PY5A 2JQQA 4NPPA 1Z7S4 1JRYA 2IVDA 2NW7A 2JK6A 4QX7B 3LK42 3ATRA 2GQFA 1UCUA 2X9WA 2A8XA 2SPCA 3UFGA 1R8IA 3KPFA 4H63H 5CA0E 2V6OA 2PYXA 2K3WA 2E5VA 4KUMB 3DK4A 1D4DA 3N9PA 5FNVE 2VKDA 3SFDA 1FL2A 3UTGA 5KVIA 5BR8T 1HRI4 1GRAA 3EAOA 2D5UA 3N2KE 4LF8T 4UVAB 3ZN1B 2BABA 1OJDA 1E7PA 4C91A 5ABGA 3RKGA 3ZJ2A 3L39A 5AQRB 3LBXB 4AOSA 2JRKA 1EV14 5LBMA 3AAIA 5LOVE 4AKGA 1NHPA 1ASJ4 4REKA 3K7TA 1GRTA 2LKHA 2WP6A 5JH7E 5FXZA 1BGNA 5LHIB 2YDQA 4DSGA 3EAMA 1N36T 1DU2A 1POV0 3D1CA 1Q9IA 3GRSA 1UURA 4BJZA 5FKYA 2WCAA 3FPZA 3CGEA 1GSNA 2YM2A 5LJMA 5FXXA 3UULA 2ZMAA 2AXDS 4MLKA 1FEAA 2UXXB 2TMDA 2V61A 2YEVC 1FMWA 3PUQA 4CI2B 2WP9A 1PDHA 5E0OA 3FHNA 2IAKA 2VVLG 1OEDB 4P0AA 1OEDA 3PDYA 4DNAA 2B1EA 1E2AA 1H83A 2BK4A 1X79A 3T37A 3ONJA 4HFCA 4U8JA 3FZMB 3CGDA 4ISTA 2BG9C 3C96A 2JAEA 2ZZ0A 4WX1A 2Y6RA 2YM1A 4Z91A 2ZM6T 3Q9TA 4NXNT 4USRA 2BG9A 3FZLB 3KDSE 3T1HT 4DR4T 2VRMA 4H4SA 2GVCA 4U8NA 1HCIA 4O4HE 3EF6A 2DWKA 4HFBA 3ZSTA 1RP0A 4PJJA 2XM2A 3NK1X 4BV6A 2JMKA 4X1YE 3J7Yq 2QRXA 1E1KA 5BUKA 4UV9B 5AQNB 3T14A 3AA0B 3UP5A 2CM0A 3ONXA 5KVHA 4BURA 5HAXA 4DVDA 4DR1T 3CN8A 1CBOA 3ATQA 5JCNA 4X1IE 1HF8A 1V59A 3U78A 4LA1A 2E9XA 4U7IA 2VVMA 1K5MD 4TLXA 5U1OA 1IJHA 2YG7A 4KBMB 4JI7T 3AA6B 4BAYB 1CC6A 2WAUA 1EL5A 4OPCA 2X9HA 1W9RA 3K1SA 1NCQD 1M6IA 2CFYA 3VQRA 2X50A 4UELA 3LFMA 2XQ8A 2HH7A 2ZM0A 4DIDB 4BK3A 1AR74 1DNCA 2MAWA 3CK6A 3T31A 1MIWA 1W0AA 2BC1A 2CVJA 3K30A 3QUJA 3IHGA 2BVLA 2GAGB 1WYCA 3PE0A 2VZ2A 2K48A 2G0UA 4U2LA 3R84B 2LHRA 3GRTA 2C66A 4E7ZA 5HXSA 2OLOA 3LJCA 1HS7A 2K5BB 4X4JA 1PO24 1F3PA 4GDPA 2DLRA 3NK0X 3AA1B 1CJ4A 1HRV4 2X99A 4EQRA 3H3MA 2LSJA 1PJ7A 3P4SA 3I0QA 5LJNA 5LHGB 2BKNA 5M0ZA 2X5ID 2CXLA 4MBQA 4Q25A 1HYUA 2PTFA 4EB6E 5HWXA 1O5WA 1OJAA 1R084 4GUVA 2CLYC 5HXEA 1Y56B 4TNVA 2QA1A 2QYWA 2BYBA 4UVCB 4UR9A 2J47A 2NP9A 3GMIA 2ARDA 5FXWA 2YG5A 4V1Av 3LB8A 4CXXA 5GSNA 4GB34 4U8KA 4UEMA 2XYOA 5JDFA 3S5WA 4JI1T 3TLWA 3II4A 4ECHA 3OPCA 4HWFA 2Y8DA 2B7SA 3AXJB 2XVHA 3GYXA 2NOXA 2BS4A 2W61A 4LFCT 4JNAA 2FJEA 4OPIA 3SRZA 3LDQB 3RQUA 4AT2A 3HYXA 1SHZC 2R074 3ZT5A 2EQ8A 2C75A 3COXA 2C0SA 1EL7A 3NK2X 5JDHA 1S3BA 3AD7B 3ZC0A 3E08A 3SFEA 3VR8A 2B9YA 4OK0A 1GETA 4NEWA 3ZYMA 2JBVA 5BRTA 4NTEA 1RUD4 2VOUA 1PIV4 3G5SA 2N9DA 3N9LA 4ZS3A 1T7SA 3NTDA 1M62A 2WBLA 3RYFE 1M64A 4QHOA 4DUYT 1OJ9A 1YKHB 3CNSA 2NWBA 2XDOA 2VVSA 3O1HA 1MNEA 4IGUA 4Z25A 2X66A 5FYMA 2LM2A 5HEUA 2WU5A 5LGUB 4G63A 1ZX9A 3HZLA 1GESA 1J5ET 2WY2A 3AEAA 3KA7A 2R6GF 4NTDA 2YVJA 1D0ZA 2D0UA 4XWZA 3LG7A 3IF8B 1QSDA 5H6RB 1TYTA 3BQLA 3LK3B 5CB4E 1GRHA 2KMFA 2XZEA 4K7ZA 1LJ1A 4OPUA 4CNKA 1HTJF 4A7AA 2DL1A 1TDNA 4EIPA 2R46A 5L3CB 3F8DA 3HYVA 4CNJA 3H8LA 3ZT7A 1DOCA 2WM9A 4HN9A 4IDNA 1YQ3A 2C70A 4H4RA 4H9PC 1FEBA 3B5MA 1YW0A 4U72A 2IUBA 1UUSA 1RSGA 2WZIA 3UUNA 3CNPA 3CQXC 4DBRA 5DQVA 1Z6LA 4UDQA 5EK2A 2YOEA 4K8DA 3RIAA 2WDVA 5KX5E 1D1AA 2HN2A 1MOKA 4E7SA 2R4EA 4G9KA 3IBPA 2GR0A 3JBG4 1S35A 5FY0A 4F8HA 1E1NA 3KVEA 2XLUA 3ZYKA 3GYIA 1TDKA 2X51A 2LOSA 3NTAA 3JSKA 3P4WA 3NWIA 2QAEA 1NENA 3Q5XA 3GMCA 3ZC1A 2N1GA 1Y64B 4G6GA 5BMVE 3V5SA 2XCGA 4TZ4C 4H4ZA 1MMDA 3ABVA 2B76A 4USQA 2W0HA 2XFPA 5TR3A 4A56A 2WHDA 3DGZA 1H81A 2E4GA 1FOHA 5EBKA 4ZI3C 3UFEA 2WQYA 3N9MA 4PNIA 2IC6A 1AL24 3AE1A 4HFEA 5CQFA 3K7QX 5AQMB 4PK6A 2JQ9A 1TDOA 1VOMA 1LKXA 1XPQA 1UX5A 3DP7A 2DKHA 3RP8A 1N1PA 3N5LA 3A5XA 4I50E 2C3DA 2EQ7A 2XFOA 1BWCA 3F8RA 2X0HA 3DK8A 2YVFA 3CNJA 2LRLA 1FECA 2ODVA 3O0HA 1CF3A 4U8OA 4HWIB 1VG0A 3AXJA 1KFYA 1HNZT 4X66T 1XI1A 5U25A 1RUF4 3AB3B 2IMLA 2JQHA 5KMQA 3WI3A 4UIGA 1PBBA 1P2EA 3RGLA 3DJEA 5KNLA 4LFBT 3I6DA 4K22A 4GAPA 4TX5A 3KBTA 4ERRA 4YSXA 3RX6A 3ZLIA 3AE3A 4IV9A 5JCMA 4QWNB 3NN6X 1U5PA 4K5SA 4EM3A 3OTOT 1GEUA 4U33A 3DJBA 5IWAT 2H7OA 3B57A 2EQ6A 4AKHA 2C67A 2GEWA 4EMIA 2LHNA 4B69A 3U3IA 3RRWA 1NHRA 1US7B 3FBLA 1IUTA 2DWGA 3V3NA 3ZMSB 2B9XA 2H89A 3AE8A 4A5XA 5HYAA 2D9DA 2LJLA 3UU6A 4KX6A 3TKLB 2YR6A 1RUJ4 4TV9E 1MMNA 2WU2A 1ZP0A 1F8WA 2GR2A 2XVIA 3DJDA 2X8HA 3QFBA 1COV4 1HNXT 4AT0A 2HWC4 4A97A 5KMSA 2RR14 4CCRA 2JMHA 4WW0A 3Q6JA 4TWHA 1UKVG 1PBEA 1V9DA 4A6NB 3UU8A 4C77A 2LSKA 1PHHA 1EAH4 3C4WA 1REOA 1H82A 3T2ZA 3NHOX 2K24A 2IIDA 3NRXA 5F3JA 4TNWA 4LIIA 4Q4V4 1D5TA 1ZK7A 2H7VC 2RGHA 1QO8A 2YVGA 1MQTD 4Z2RA 3P8CD 3CMMA 2LSIA 1AOGA 5CA1E 4Q4Y4 4XXGA 1VBD4 4CZZB 5IQ4A 1GV4A 4EGWA 1ZKEA 3ESLA 2OA1A 4HB9A 3OJAA 2E2AA 2YINA 3W15B 4GKKT 3NRNA 4K0UA 3GWFA 4TM4A 2CWOA 5FS9A 2WMOA 1CL0A 3V5UA 1M7KA 2FBWA 3LZXA 3ZMVB 4OPDA 3RHWA 1LPFA 4DGKA 2AE9A 1F8RA 2P9BA 1PO14 3NBXX 3UT5E 1YQ4A 4AISA 5KMGP 3ISHA 2CBJA 2NW9A 4I55E 5HEHA 1YD8G 4D04A 4IE4A 3H3AA 1AR94 4ZI3D 1Y01A 3NIXA 2VKHA 2XSBA 3PV0F 5HYMA 3IA3A 4HGAA 4A65A 4H9SE 4X1KE 3FMWA 1CHUA 4GOUA 1PXBA 1D1CA 2YU1A 3VHLA 1VDCA 4YLHA 1KEYA 1NG4A 3BQKA 3CX8B 2CHOA 2GR3A 4JEHB 2AQJA 4KPRA 2XAJB 3LJPA 4JNQA 3B6DA 4HE8A 4OPTA 5LNKA 2WZHA 3BI4A 1DOEA 1KNPA 4PK4A 4H63V 3KVAA 4N9XA 1JNZA 3JADA 1S3EA 3AYJA 4GYSA 4J2WA 3GD4A 4TWFA 5L47A 1NPXA 4EM4A 2APGA 1QUUA 3WAJA 2YU2A 3C51A 2WSSV 5JDNA 4J57A 3GA8A 2AR8A 2IVEA 4ZI7E 3O9XA 3M3ZB 2ZBWA 4EQWA 4UV8B 3VRBA 4APNA 3NG7X 4I4TE 3RRCA 3H8IA 2H88A 4LMJA 2QA7A 2V5DA 4G74A 4CQIA 5JR9A 2BA9A 2VURA 4AP3A 3CMLA 3RC8A 1E1LA 3H37A 2RMU4 3QB5K 3BQIA 2C73A 4J2CA 4RSLA 1NDAA 4ZCCA 1W4XA 1OXZA 3RYCE 2Q0LA 1BR2A 3ZMZB 3L8KA 1VRH4 2OV9A 5H6QB 3ZEFB 2A2FX 4L0RA 2UXNB 4KHZF 2HN1A 1H86A 4EYYR 3HYWA 2NVKX 1WCRA 4H4XA 2CDUA 3MZKB 4ZS2A 2V60A 2X3NA 5JTGA 4YHHT 3NLCA 2LLYA 1ZDLA 5JDGA 1TYPA 1ONFA 3NZQA 4AKLA 4B6XA 2QCUA 4CN1A 2V5CA 4GIWA 1DJNA 4X9MA 3AA7B 4H2QA 3RIFA 3AE9A 4GAVA 1ZV4X 4U8IA 4YJ2E 3F57A 5LV9A 2JB2A 3PUSA 2WS3A 2Y6XA 3CPHG 2YN6A 2IIUA 4BA9A 1TDEA 3SWHA 2EQ9A 3EDUA 3GWHA 1MMAA 1MMGA 4O5QA 2YR5A 4A98A 2NTXA 1OOPD 3OVUA 4ILUA 2V1DB 4H2RA 3LSVA 3P4RA 4D03A 4IE6A 4IA5A 3UKKA 4DV1T 4JI0T 5EK4A 2O9ZA 4CN4A 1GOSA 5IYZE 4ANJA 1XHCA 4DR2T 4G73A 4B3MT 2RS54 4N78D 1RUI4 2YDRA 2V3BA 3UOZA 5AQVB 1N32T 1IZNB 5TAOA 5AQLB 5ETWA 4DR3T 4O2BE 5L4EA 4A5LA 5GRTA 4Q4W4 4HTEA 3HKBE 4YHJA 3PUXF 3RIUC 4FK1C 1GRFA 2HPJA 4JUYA 2VASA 4C3XA 3EVYA 2V6XA 5CFBA 1Q1WA 4AXPA 1S94A 2MOZA 3IF9A 3RH3A 4GRTA 2C5KT 3B13A 4U7YA 2PBIA 2EHOA 1VCTA 2XVJA 3UOYA 4MHCA 2D0TA 3LOVA 3VRAA 1NAFA 2VKOA 2EX3A 3P4QA 2V7KA 4IA6A 2XQAA 2RA1A 4OVIA 3AD8B 4LU6A 4DV3T 4NUVA 2M6BA 4XAXB 4ZN0A 3ITJA 2JKCA 5AQOB 3PO7A 3AEGA 4U3CA 3GMBA 5J2UE 4OYKA 2LOPA 3UKAA 2YDSA 4UF0A 3HA4A 5FP3A 4I43B 2VRLA 4CRTA 1E1MA 5LB7B 4LF9T 4JYAT 2XAGB 4O5UA 3ZT6A 1IJ5A 3NYEA 2LFCA 1D4CA 4EIWA 3BHFA 5LGTB 3NNEA 4PDWD 4EQXA 4JI4T 2DI4A 2V7LA 4P09A 1CC4A 3AXBA 1YXRA 2FJAA 1RUG4 5LGNB 1RHI4 4JQ9A 1IUVA 4LMLA 5J60A 1KDGA 5C8YE 4H4UA 3ZDNA 1IJ6A 4HFDA 4X64T 3CTYA 2BG9B 2UZZA 3T1YT 3I0OA 1BZLA 1B4VA 3CWZB 3BI5A 4DSHA 1PXCA 5ABHA 2H3RA 1J1JA 5JQGE 3TLTA 4II3A 4UF0B 1KSSA 3HKDE 2R7FA 4J34A 3CGBA 2NPXA 4QH1A 3AYIA 1HX8A 2A3DA 2VQFT 2GAHB 1D4M4 3RYHE 3M13A 2WOWA 2HWB4 2VQET 2X67A 1JRZA 3ZKRA 4AQGA 2YAUA 2RM24 4YTNA 3RP6A 2OAMA 3O1JA 3GQHA 4EZHA 2BG9E 2GH5A 2XHEB 3PUGA 1VBA4 4B3RT 3LADA 4JLEA 2XQ9A 4B65A 5ABEA 5HHFA 4RHV4 2HPLA 3P4PA 3RLFF 5FS7A 3SM8A 2GB0A 2W62A 3HKCE 2RP4A 3KBUA 1QJDA 5LMUT 3QJ4A 4JI8T 2KLQA 4DR5T 2PYLA 1EL8A 2WPEA 5L46A 5BVAA 1VBB4 4NZHA 3J8F4 1PVC4 2R45A 2YLRA 4JN9A 3UCLA 2NTYA 3WE0A 1KF6A 2LE8A 2B9WA 4FDCB 2UUBT 1LV0A 3CX6B 2VB6A 1XZYA 1HXS4 4YT0A 4H4VA 4UDPA 2B7RA 4QXHB 4A9WA 1EL9A 1TRBA 4J36A 3RNMA 2CEAA 1NAAA 2CCQA 3UOVA 2R0GA 1ZOVA 2GR1A 4O4JE 2Y48B 2BKPA 3AE6A 1NEKA 3CGCA 5FL0A 4O8SA 1L9CA 3V3OA 3A8YC 2HHHT 1PS9A 1I94T 3OYZA 1YKEB 4K5RA 4IDQA 2KSRA 1D1BA 1Y56A 1FEWA 1X31B 1O3XA 3ZCIA 1PJ6A 2LEHA 4HFVA 1G8XA 4EOZB 3T0KA 4JY3A 2E9XB 3KLJA 3EABA 3QVRA 1Z0PA 2DHRA 5LMNT 4C90A 3CQGB 1NWMX 1H7WA 2W63A 1HG5A 3KINB 1NHQA 4WYVA 4ASKA 2J1DG 3C64A 4U2SA 5KOXA 2C72A 4L5GA 5IHYA 3NRYA 4TLZA 3LK2B 1SEZA 1ZOYA 3RI5A 1FIOA 4DMWA 1AJ3A 4LF4T 3ALLA 1I6ZA 2EHOD 1F8SA 4ZEYA 4BJMA 4Y4MA 3HR0A 3ZPOA 3I1AA 3SZFA 3QOFA 1GPEA 3N9OA 2JB1A 4MJWA 1OEDC 4NNJA 3RP7A 3ICSA 5HXCA 3B3RA 3C4NA 4OPGA 2RPAA 4IDZA 4IREA 5J2TE 3ZCJA 2OA5A 1HR0T 3ZN0B 3C4AA 2EHOC 4ICYA 2BCGG 3UTKA 5JRCB 2CMRA 2LSYA 3FIMB 5JVDE 4II2A 2W4XA 4C3YA 2KT9A 2UUAT 3QSSA 2PLV4 5AQQB 4QH4A 3AE4A 4X62T 1RUH4 4RG4A 2JQKA 3A7MA 2BS3A 5C2TA 3VRDB 2E8IA 3FG2P 4H4TA 2LKGA 4YXDA 3JCFA 3VU7H 4AKRB 3JD74 4LFAT 3ANWA 4OX9T 2WB5A 4OYJA 4OPLA 1PBDA 3QSMA 1F6MA 1OJTA 1PN0A 2DNXA 1COYA 2PZSA 5AQUB 5HXIA 4HWDA 1D0XA 3IHMA 2WPCA 2AAQA 4ZI2D 1XDOA 4ISSA 4EAHA 3IHRA 3HKEE 2I0MA 3P7IA 4HWCA 4Z8XA 2XFUA 2Q6UA 3K8PC 1DXLA 3T2KA 4ADZA 3AEFA 5JDLA 3UU5A 5KRQA 1E1HB 2ES0A 3MK7C 4WNKA 2F4VT 4GK0E 5ABFA 4DUZT 1MNDA 3E0ZA 4X20E 3TLVA 4U2TA 2GRTA 2RGJA 3V76A 2CPTA 2V8SV 4O4LE 2X9XA 3MACA 4FI5A 3RHAA 2MPKA 2BACA 3OZ2A 2ZZBA 3O1IA 4C5OA 3QC9A 3CKDA 3G5RA 4K2XA 4DV5T 3PUZF 4Z44A 3UU3A 2I6HA 1N34T 4PFPA 3E1TA 3KV9A 4HA6A 1G73A 2Z5XA 1BGJA 4EIQA 3SZCA 1AR64 1N4UA 3MA9A 5FS8A 1WYBA 2V7MA 2YR4A 2R044 5FXVA 2XFQA 3FI7A 4BJYA 5LG4A 3NYFA 3SZWA 2XAQB 2BBHA 1HG2A 3UKQA 2NR4A 4B66A 1XWMA 2BRYA 2VK9A 5ABFB 5HEGA 4JI6T 5JRCA 3QNUA 2V6YA 4GF7A 1CJ2A 2XQYA 4EYUA 2Q0KA 1KNZA 4OFZA 3G06A 2WESA 4DR7T 4EEDA 1GERA 1IUXA 4X65T 4EQSA 2X0LB 3DH9A 2L9QA 3M65A 3IEEA 4U8MA 2UU9T 4LF5T 1T98A 2WDQA 1L9EA 2UXDT 5HY5A 4A79A 3NGCX 4Y4NA 4CCQA 2CXDA 5DBJA 3OYXA 5JCIA 4X9NA 5AFUL 1VG9A 5AQKB 1H7CA 1WR6A 3AAEB 4TWDA 2C64A 2XLTA 4GK5E 2CBIA 3FBSA 2XQ4A 5FMNA 1XHZA 5FY7A 2CWYA 1XMOT 3O4XE 5DJQC 3ZMTB 4NIQA 5J1GA 1N33T 2HQMA 4B1BA 5U63A 3KPKA 3SX6A 3BK9A 4ILBA 1P2HA 3H4KA 3Q5EA 2E9XC 3JC6D 2IW5B 1BKWA 3UUBA 4Z2UA 1UK5A 1CJ3A 2A89A 4YTPA 1RYIA 2V7IA 3ZMUB 4OCGA 2W0GA 5HCJA 5LG3A 3FXDB 3CX7B 2XUEA 5JR9C 4PJLA 2W67A 4Z26A 1MXTA 3ADAB 2VWAA 3GQKA 4QX8B 3JC6C 5JDQA 4KI0F 4ZI2C 3EANA 4HFHA 3CPZA 4QXBB 2DCFA 3K7MX 2EHOB 3CIRA 3D0TA 2X9YA 2RGOA 5KOWA 2XTLA 3PUAA 5EK3A 5L3FB 4H4WA 4Y4LA 2IC9A 5KMPA 3PURA 2MTQA 3AEDA 4OHFA 1DODA 2J3NA 1E39A 2KZ7B 3AD9B 2XY8B 1CJCA 2R9ZA 3K3QC 4NWZA 4UVBB 4B68A 2GK9A 2W2UA 4U2ZA 5IPYA 2CA5A 5AQGB 4JV5T 2Q9QB 5EB4A 1S2YA 3QK6A 2YG6A 4WCTA 1H8TD 2WP5A 3I3LA 2FJBA 3MJXA 4DMVA 4A99A 4NUUA 4ZHQE 4TUYE 2KNDA 2BK5A 4QH5A 1SE7A 4Z24A 3PUWF 3FXEB 3KV6A 1PBCA 2Q7VA 2X68A 2BBJA 1GT8A 2ZZCA 1GRBA 3URHA 1EBDA 4IL4A 3T2YA 3LXDA 4I0UA 4YSYA 4ZOLE 1CUNA 4U74A 3NKZA 4H9NC 4DV4T 2R4JA 4ZCDA 3KV5A 3TLUA 3GDPA 1HFAA 4I58A 4GDEA 2XM1A 2ACXA 5AQPB 4PAAA 2V7JA 3PU3A 2XVEA 3S61A 1JU2A 4EZ4A 5IUXA 1AR84 1H7XA 5HEJA 5AQFB 4CBQA 4NTCA 1T8BA 3CPJG 3Q5WA 2BKOA 5CJ5A 3Q9DA 4LF7T 4EMJA 2GMJA 4IHJE 3FBZA 1LVLA 2Q9QC 4NXMT 1RVF4 2BK3A 3CQCB 2WMNA 2MBGA 4DV6T 1D4EA 3AECA 2VQBA 1YY5A 1K4QA 1ZY8A 3NH3X 5AQIB 3UKHA 4P1NA 3L3PA 2VKJA 3LBXA 2XLSA 2WWVA 3UKFA 1X9BA 1N4VA 3E22E 3IC9A 1L9DA 4YY3T 3SXIA 3FZHB 5A1LA 4H4YA 5EB5A 2LT3A 3G5QA 1XNRT 2XAHB 2VL8A 1IBLT 2V6YB 2XSAA 3ONLC 1SA0E 1GTHA 1FJGT 2LM9A 3AE2A 3F8PA 4WZXA 4XWRA 1B7TA 3SZ0A 4UP3A 4CXYA 4NEVA 3GWDA 2UXBT 2X0YA 3AYLA 5BULA 1H6VA 4RG3A 3M0OA 4IE7A 4G2AA 4IVMB 2KXPB 5JCKA 4WBOA 2W00A 4YJ3E 3AE5A 2KINB 2WEUA 3UU4A 3ZSSA 1DJQA 5ADXL 1S2QA 1ZKQA 4J56A 4B3ST 1WR0A 2QA2A 5LYJE 2K9AA 2XASB 4KMCA 3PS9A 2QGSA 2WPFA 5L3GB 4H2NA 3FZKB 4ZXLA 2JB3A 2OALA 4U2YA 2VL0A 2IDOB 2YLSA 2PW9A 3ETUA 1CC2A 1K0JA 4CY8A 2ZM2A 4PFOA 5LCYA 2WBAA 1XMQT 2KWIB 4HFIA 3EDVA 3P1WA 4U8PA 4BJNA 1OWAA 3L8RA 4LMKA 2GV8A 3QVPA 4PABA 3CNDA 2JJ9A 3N2OA 4H9QC 4DV7T 1VRQB 3OC4A 1FCDA 2BDEA 3UTFA 3GD3A 1GQEA 4HEAA 4IDPA 2V3AA 5L3EB 3PU8A 4H9RC 2CHNA 3DTOA 3EUHA 3VKGA 2RABA 1U4QA 3PUVF 3N2GE 4AQFA 3AB1A 3JAFA 5LA6E 1PJ5A 3ANWB 2I59A 4YTMA 3KKJA 2YLZA 3BI2A 3ETVA 4KHPT 2WDRA 3RPUA 4CI1B 1O95A 2XPKA 1KSUA 3Q2MA 4IL9A 3AE7A 3NVOA 2V26A 5FL1A 4H7UA 1O94A 4DV0T 3TLSA 3UKPA 4YSHA 1BF3A 3ZJ1A 1KK7A 4EMWA 4IE5A 4CY6A 2JIWA 1WRDA 3X1DA 1BEV4 5KDMC 3UQ4A 3MKDA 2Y6QA 3R6NA 2RS34 1W09A 3FZFB 4DNDA 3K3NA 3PJAA 2JPFA 2PJQA 1IUSA 3AWIA 3C4XA 3CNTA 1XDPA 4O2AE 2Q9QD 3N9QA 1NHSA 4QXCB 2R064 3N9NA 1Y0PA 3P50A 4YFSA 3RKOA 1D0YA 3VR9A 1TDFA 3J9X1 4JDRA 1B8SA 5JR9B 5FMHA 2BXRA 2WETA 3P9UA 2CXFA 4AOXA 1HX1B 1XHXA 3HI2A 1H84A 3AVSA 1LTXR 1JEHA 3OBVE 2E5LT 4FX9A 3BNUA 2X8CA 1Q1RA 2ZLYA 3I9WA 4P0BA 2YQUA 1LQUA 5F5WA 4L9IA 2J4GA 1VCSA 4ILCA 4YWOA 3RF1A 3D8XA 1KNRA 4GCMA 1ELIA 4AQFC 3GN5A 4M1PA 4UDRA 2VVNA 2YKSA 1QLBA 5AQSB 2W66A 2KWHA 1W0BA 1ZMCA 1GNDA 3NZPA 1UGOA 5M10A 2C65A 3GYJA 2XQ6A 5J0ZA 1UX4A 1LVKA 2E1MA 3UUXB 3PUYF 5LP6E 2N2NA 1JNRA 2ZM8A 1ZMDA 3UQ7A 1RUE4 3SOLA 2BXSA 4H9OC 4ADWA 2A87A 2UXCT 4J33A 3JAEA 2C4CA 4ILAA 3ICRA 5GONE 3SQPA 3C4ZA 4M52A 4P9SA 4O4IE 2PHHA 1IBKT 2VQ7A 3REDA 2XFNA 3EHZA 2PFVA 3RC3A 2UUCT 5AQHB 4DBQA 3KFWX 4COFA 5L3BB 2YWLA 3ICTA 4DO0A 4QKNA 3RYIE 3BHKA 3EI0A 4CI3B 4PK5A 1LQTA 1IUUA 2YG4A 4LF6T 2XAFB 2D2SA 2BRAA 2Z5YA 3ALJA 3EPTA 4JI3T 3GSIA 5IQ1A 1HNWT 1K0IA 3L1RA 2YLTA 3GN5B 3PTRB 4E0VA 1ZEEA 4CN6A 3AAAB 5HCMA 3NT6A 4AKIA 5KXJA 1ZHCA 4H2PA 1EZ3A 4GKJT 1XNQT 2WWUA 5CKUA 4U31A 4H4QA 3BNMA 3L09A 3MXZA 5EZYE 5LBQB 4TM0A 4AP1A 2CE7A 5LHHB 4A6NA 4JBWF 3NKSA 4GYRA 4PW8A 4KP3C 3ZYXA 5KMRA 1R094 4Z2TA 5JCLA 2WOVA 3AEEA 2C76A 1RUC4 2LRKA 1WLXA 2IHR1 4HKAA 3UKLA 4G6HA 1MIVA 5HEOA 2WOIA 1VRBA 2J62A 1VQWA 5FVKA 3DGHA 3SYIA 3RIUA 4FK1A 3SY4A 2OLTA 2BS2A 3OKQA 1GXFA 1Z8UA 1DOBA 3KU9A 2C5IT 2C3CA 4H50A 4TN7B 4YSZA 3VKHA 4GR1A 1IBMT 2XQ7A 1E6EA 1N4WA 3Q5DA 4PJMA 2BZBA 2M67A 3SS1A 3T8OA 4B67A 1WFDA 2XQ5A 4MFRA 1GREA 4Z43A 4C74A 4JI5T 4B3TT 1SUMB 3FB2A 5HXRA 2ACZA 3CPIG 4BK2A 1MO9A 2XVFA 2M6IA 5HXHA 2F5ZA 3R9UA 5FS6A 2RS14 1IUWA 1YKJA 3QB5A 3QFAA 2ODUA 5LXTE 1NA1D 5ER0A 4H4PA 5L4HA 2C7GA 4AQYT 4BK1A 4JEUB 5FVLA 5EOWA 3HL6A 5FY1A 4HWHA 3KV4A 4YKFA 3UOXA 5DABA 4TM1A 2OLNA 3F2EA 4IT4A 5AQJB 1T72A 3KVBA 2E9XD 3ZYLA 4MALA 4JI2T 4DV2T 2TPRA 3DA1A 2YG3A 3DK9A 1GTEA 3UUMA 5JREA 1LVFA 4IE0A 1BR0A 2LSGA 4U8LA 2VVLA 4B64A 3KD9A 1JRXA 1IAPA 2NW8A 4F6RC 1K0LA 4IVOB 3SGLA 3RQWA 2BVMA 2Q9QA 2X8GA 1YQZA 5M4YA 5L2LA 3CVRA 1PXAA 4EV6A 4XBFB 1GALA 2YK0A 2R0PA 4JY2A 1LRZA 1RMU4 2CLYB 2XLRA 5JDMA 1L0VA 1JOAA 4FJOA 1VBC4
chains in the Genus database with same CATH topology
4PAAA 3UP4A 3DMEA 2XVEA 3S61A 3DJJA 2QAEA 1JU2A 1NENA 3GMCA 3CTYA 3DJGX 3GDNA 4G6GA 4B63A 2XCGA 1H7XA 1NG3A 2UZZA 4H4ZA 2R0CA 1BZLA 4CBQA 3ABVA 1B4VA 4NTCA 3BI5A 3CPJG 1PXCA 2B76A 4USQA 4DSHA 2W0HA 2XFPA 4EMJA 4TM3A 5TR3A 2GMJA 4II3A 2WHDA 3PVCA 3DGZA 3UTHA 1H81A 1KSSA 1FOHA 1LVLA 2E4GA 3LZWA 5EBKA 2WQYA 2CULA 4J34A 3CGBA 2BK3A 2NPXA 1D4EA 3AECA 2VQBA 3AE1A 3AYIA 1YY5A 1K4QA 2GAHB 5CQFA 3K7QX 1ZY8A 3NH3X 2FJDA 2GQWA 3UKHA 1GRGA 1TDOA 3M13A 2WOWA 3ALMA 4I59A 1D7LA 2XLSA 1XPQA 3UKFA 1JRZA 2DKHA 3RP8A 2YAUA 1N1PA 4YTNA 3RP6A 2OAMA 2EQ7A 2C3DA 1N4VA 2XFOA 3IC9A 1L9DA 3GQHA 1BWCA 3F8RA 3DK8A 2GH5A 2YVFA 3CNJA 4J31A 1B5QA 1FECA 3SXIA 3O0HA 1CF3A 3SUCA 1D7YA 4U8OA 4H4YA 1VG0A 2BC0A 3UTEA 2GMHA 3QSEA 1KFYA 2GF3A 3LADA 5EB5A 3G5QA 5J7XA 4B65A 3NN0X 2V5ZA 5U25A 1XDIA 5HHFA 3M12A 3P4PA 2XLPA 1GTHA 5FS7A 3SM8A 3AE2A 1B37A 3F8PA 1OJCA 2GB0A 2YLXA 4XWRA 3AEBA 1QJDA 3QJ4A 2YLWA 4UP3A 3SZ0A 5KMQA 5C3JA 4NEVA 3NYCA 2BCPA 1PBBA 1P2EA 1EL8A 3GWDA 3DJEA 2I0ZA 1PBFA 2WPEA 5BVAA 4YKGA 4NZHA 1XANA 5KWFA 2R45A 5L46A 5KNLA 2DKIA 3I6DA 3AYLA 3IWAA 2YLRA 4GAPA 4K22A 4JN9A 4YSXA 5BULA 3UCLA 1H6VA 4RG3A 3AE3A 3M0OA 4IVMB 1KF6A 1JRYA 3WE0A 4IV9A 2IVDA 5JCMA 2B9WA 5JCKA 3NN6X 2JK6A 4K5SA 4EM3A 3ATRA 4FDCB 1GEUA 2EQ6A 3AE5A 1LV0A 2A8XA 2GQFA 2C67A 2GEWA 2WEUA 4EMIA 4YT0A 4H4VA 3KPFA 2B7RA 2V6OA 4UDPA 4A9WA 4B69A 2PYXA 1TRBA 1DJQA 1EL9A 4J36A 2E5VA 1NAAA 1NHRA 1S2QA 3RNMA 3UOVA 3DK4A 1D4DA 1ZKQA 1ZOVA 2GR1A 2R0GA 4J56A 3SFDA 1FL2A 3UTGA 2QA2A 5KVIA 1IUTA 3AE6A 1NEKA 3V3NA 2B9XA 3CGCA 1GRAA 3EAOA 2H89A 3AE8A 3PS9A 1L9CA 3V3OA 1PS9A 4KX6A 2YR6A 2WPFA 2BABA 4H2NA 1OJDA 4K5RA 1F8WA 1ZP0A 2WU2A 1E7PA 2GR2A 1Y56A 2JB3A 2OALA 2XVIA 3DJDA 2X8HA 1X31B 3QFBA 1PJ6A 4AT0A 5KMSA 4AOSA 2YLSA 4CCRA 1CC2A 3T0KA 1K0JA 4JY3A 4CY8A 3Q6JA 3KLJA 2WBAA 3QVRA 1NHPA 1UKVG 1PBEA 4A6NB 4REKA 3P1WA 3K7TA 4U8PA 1GRTA 1H7WA 2GV8A 2WP6A 3QVPA 4PABA 4C77A 3CNDA 1PHHA 1NHQA 1REOA 1H82A 1VRQB 3T2ZA 1BGNA 3NHOX 4U2SA 5KOXA 4DSGA 2C72A 4H4UA 3D1CA 2IIDA 3OC4A 1FCDA 1Q9IA 4TLZA 4LIIA 1SEZA 3GRSA 3UTFA 1D5TA 3GD3A 4BJZA 1ZOYA 3FPZA 3CGEA 1GSNA 1ZK7A 3ALLA 2YM2A 2RGHA 2V3AA 1QO8A 2YVGA 1F8SA 4Z2RA 2RABA 1FEAA 3CMMA 4Y4MA 2TMDA 2V61A 3SZFA 1GPEA 1AOGA 2JB1A 4MJWA 4XXGA 3AB1A 2WP9A 4NNJA 1PDHA 3RP7A 3ICSA 1PJ5A 5IQ4A 1GV4A 4YTMA 2VVLG 3B3RA 3C4NA 3KKJA 2YLZA 4OPGA 3BI2A 2OA1A 4DNAA 4HB9A 1H83A 2BK4A 2WDRA 3T37A 3C4AA 4U8JA 1O95A 3NRNA 3CGDA 2BCGG 3GWFA 4ICYA 4TM4A 3FIMB 1KSUA 3C96A 5FS9A 3AE7A 2JAEA 4H7UA 2ZZ0A 4II2A 1O94A 2Y6RA 2YM1A 4WX1A 1CL0A 3Q9TA 4C3YA 2FBWA 3UKPA 4YSHA 1BF3A 4USRA 4EMWA 3QSSA 4CY6A 3LZXA 4OPDA 2VRMA 4H4SA 1LPFA 3AE4A 2GVCA 4U8NA 4DGKA 1F8RA 2Y6QA 4RG4A 3EF6A 1RP0A 3NK1X 2BS3A 5C2TA 3VRDB 4BV6A 1YQ4A 1E1KA 5BUKA 3FG2P 3T14A 3ISHA 3UP5A 4H4TA 3AWIA 1IUSA 4D04A 4YXDA 5KVHA 3CNTA 4BURA 3CN8A 1CBOA 1NHSA 3ATQA 1Y0PA 3NIXA 5JCNA 1V59A 5HYMA 1TDFA 3VR9A 4LA1A 4JDRA 4OPLA 1B8SA 1PBDA 5FMHA 2BXRA 2WETA 3QSMA 1F6MA 4A65A 1OJTA 1PN0A 2VVMA 1COYA 3FMWA 3P9UA 4AOXA 1CHUA 1H84A 1PXBA 5HXIA 4TLXA 1LTXR 5U1OA 3IHMA 1IJHA 2WPCA 1JEHA 2YG7A 4FX9A 3BNUA 2AAQA 1VDCA 2X8CA 1NG4A 1Q1RA 1CC6A 2YQUA 1EL5A 2GR3A 4OPCA 2AQJA 4KPRA 1LQUA 3LJPA 1M6IA 4JNQA 2CFYA 3B6DA 3VQRA 2X50A 2XFUA 4OPTA 3BI4A 1DOEA 1KNPA 2Q6UA 1DXLA 4YWOA 3T2KA 4BK3A 3D8XA 1KNRA 3AEFA 5KRQA 4N9XA 4GCMA 1ELIA 1JNZA 4UDRA 1S3EA 3AYJA 1DNCA 4J2WA 1QLBA 3GD4A 3T31A 1ZMCA 1NPXA 2BC1A 1GNDA 2CVJA 3K30A 4EM4A 2APGA 3IHGA 5M10A 4U2TA 2GRTA 2GAGB 2C65A 2RGJA 4J57A 3V76A 3GYJA 2VZ2A 2AR8A 2E1MA 2IVEA 3RHAA 2BACA 3OZ2A 2ZZBA 2ZBWA 4U2LA 1JNRA 3VRBA 4C5OA 4EQWA 4APNA 1ZMDA 3GRTA 3G5RA 3NG7X 2C66A 2OLOA 2BXSA 4X4JA 4ADWA 4K2XA 3H8IA 2H88A 1F3PA 2A87A 4GDPA 3NK0X 1CJ4A 4G74A 4J33A 2BA9A 2X99A 4EQRA 4Z44A 4AP3A 3E1TA 1E1LA 2C4CA 4HA6A 3ICRA 1PJ7A 3P4SA 2Z5XA 2C73A 4RSLA 1BGJA 4EIQA 3SZCA 1NDAA 1N4UA 5M0ZA 3SQPA 4M52A 4P9SA 4ZCCA 5FS8A 2YR4A 1HYUA 1O5WA 1W4XA 2PHHA 2Q0LA 1OJAA 4GUVA 2XFQA 1Y56B 3L8KA 4BJYA 2VQ7A 2QA1A 3NYFA 2BYBA 3SZWA 3REDA 2XFNA 2ARDA 1H86A 3UKQA 2YG5A 2YWLA 3LB8A 3ICTA 3HYWA 4B66A 2BRYA 5GSNA 2NVKX 4U8KA 4H4XA 3BHKA 2CDUA 4GF7A 2XYOA 1CJ2A 1LQTA 2V60A 2Q0KA 1IUUA 2X3NA 2YG4A 3S5WA 3II4A 4ECHA 2WESA 3NLCA 1ZDLA 1GERA 2B7SA 1IUXA 4EQSA 1TYPA 1ONFA 2BRAA 2XVHA 3GYXA 2BS4A 3DH9A 4OPIA 4JNAA 2FJEA 2Z5YA 3ALJA 3EPTA 2QCUA 4U8MA 3GSIA 1DJNA 5IQ1A 4AT2A 3HYXA 4X9MA 4H2QA 1K0IA 3L1RA 3AE9A 2YLTA 2EQ8A 4GAVA 2C75A 2WDQA 3COXA 4E0VA 1L9EA 5HY5A 4U8IA 4A79A 5LV9A 3NT6A 1EL7A 3NGCX 3NK2X 4Y4NA 4CCQA 5KXJA 1S3BA 2JB2A 5DBJA 3CPHG 2WS3A 3AD7B 5JCIA 4H2PA 1TDEA 4X9NA 1VG9A 2EQ9A 2XLTA 2C64A 5CKUA 3SFEA 3VR8A 2B9YA 1GETA 4O5QA 2YR5A 3FBSA 4H4QA 4NEWA 3BNMA 2JBVA 4TM0A 4AP1A 5BRTA 4NTEA 4A6NA 3NKSA 4H2RA 2VOUA 3ZYXA 5KMRA 3G5SA 3P4RA 4Z2TA 3NTDA 4D03A 2HQMA 5JCLA 4IA5A 2WOVA 3UKKA 5U63A 4B1BA 1M64A 2O9ZA 1OJ9A 3KPKA 3SX6A 3AEEA 1GOSA 1XHCA 2C76A 3CNSA 1P2HA 4G73A 3H4KA 2XDOA 3UKLA 4G6HA 1BKWA 2WOIA 4Z25A 4Z2UA 2V3BA 1CJ3A 2A89A 4YTPA 3UOZA 1RYIA 4OCGA 2WU5A 1VQWA 3DGHA 3SYIA 4FK1A 3SY4A 4A5LA 5GRTA 2BS2A 1ZX9A 1GXFA 3HZLA 1DOBA 1GESA 3KU9A 2C3CA 4Z26A 4FK1C 3AEAA 1MXTA 4YSZA 1GRFA 3ADAB 3KA7A 4H50A 4NTDA 3GQKA 2YVJA 4C3XA 1Q1WA 4GR1A 4XWZA 1E6EA 1N4WA 3EANA 3IF9A 4GRTA 4B67A 1TYTA 1GRHA 4K7ZA 1GREA 1LJ1A 3K7MX 4Z43A 4C74A 3CIRA 2RGOA 5KOWA 4OPUA 4CNKA 2XVJA 3UOYA 2ACZA 3LOVA 4A7AA 3VRAA 3P4QA 1TDNA 1MO9A 3CPIG 4H4WA 4Y4LA 4BK2A 2XVFA 4IA6A 5KMPA 4EIPA 2R46A 4OVIA 2F5ZA 3AD8B 3AEDA 4LU6A 3F8DA 1IUWA 5FS6A 3R9UA 1YKJA 1DODA 3HYVA 2J3NA 1E39A 4CNJA 3AD9B 3H8LA 3QFAA 1CJCA 2R9ZA 4NWZA 4H4PA 1DOCA 5ER0A 2C7GA 3ITJA 2JKCA 4B68A 4ZN0A 3PO7A 4BK1A 1YQ3A 5EOWA 2C70A 3AEGA 3GMBA 4H4RA 5IPYA 1FEBA 4YKFA 5EB4A 1S2YA 3UKAA 3UOXA 2YG6A 1RSGA 4TM1A 2OLNA 4WCTA 2VRLA 4CRTA 2WP5A 3I3LA 2FJBA 4A99A 1E1MA 3CNPA 2BK5A 1Z6LA 4Z24A 2TPRA 3DA1A 1PBCA 4UDQA 2Q7VA 4O5UA 3NYEA 2LFCA 1D4CA 2YG3A 3DK9A 1GT8A 2ZZCA 4K8DA 1GTEA 2WDVA 1MOKA 1GRBA 2R4EA 3BHFA 4G9KA 3URHA 1EBDA 3NNEA 4U8LA 2VVLA 3T2YA 4B64A 2GR0A 3KD9A 1JRXA 3LXDA 4EQXA 1K0LA 4YSYA 4IVOB 3SGLA 2X8GA 1YQZA 1CC4A 3AXBA 2R4JA 4ZCDA 1E1NA 1PXAA 2FJAA 1GALA 2R0PA 3KVEA 4JY2A 2XLUA 3GDPA 3GYIA 1TDKA 4I58A 4GDEA 2XLRA 1IUVA 3NTAA 1L0VA 5J60A 3JSKA 1JOAA 4JQ9A 1KDGA 3ZDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAA A;  3UP4 A;  3DME A;  2XVE A;  3S61 A;  3DJJ A;  2QAE A;  1JU2 A;  1NEN A;  3GMC A;  3CTY A;  3DJG X;  3GDN A;  4B63 A;  2XCG A;  1H7X A;  1NG3 A;  2UZZ A;  4H4Z A;  2R0C A;  1BZL A;  4CBQ A;  3ABV A;  1B4V A;  4NTC A;  3BI5 A;  3CPJ G;  1PXC A;  2B76 A;  4USQ A;  4DSH A;  2W0H A;  2XFP A;  4EMJ A;  4TM3 A;  5TR3 A;  2GMJ A;  2WHD A;  3PVC A;  3DGZ A;  3UTH A;  1H81 A;  1KSS A;  1FOH A;  1LVL A;  2E4G A;  3LZW A;  5EBK A;  2WQY A;  2CUL A;  4J34 A;  3CGB A;  2BK3 A;  2NPX A;  1D4E A;  3AEC A;  2VQB A;  3AE1 A;  3AYI A;  1YY5 A;  1K4Q A;  2GAH B;  5CQF A;  3K7Q X;  1ZY8 A;  3NH3 X;  2FJD A;  2GQW A;  3UKH A;  1GRG A;  1TDO A;  3M13 A;  2WOW A;  3ALM A;  4I59 A;  1D7L A;  2XLS A;  1XPQ A;  3UKF A;  1JRZ A;  2DKH A;  3RP8 A;  2YAU A;  1N1P A;  4YTN A;  3RP6 A;  2OAM A;  2EQ7 A;  2C3D A;  1N4V A;  2XFO A;  3IC9 A;  1L9D A;  3GQH A;  1BWC A;  3F8R A;  3DK8 A;  2GH5 A;  2YVF A;  3CNJ A;  4J31 A;  1B5Q A;  1FEC A;  3O0H A;  1CF3 A;  3SUC A;  1D7Y A;  4U8O A;  4H4Y A;  1VG0 A;  2BC0 A;  3UTE A;  2GMH A;  3QSE A;  1KFY A;  2GF3 A;  3LAD A;  5EB5 A;  3G5Q A;  5J7X A;  4B65 A;  3NN0 X;  2V5Z A;  5U25 A;  1XDI A;  5HHF A;  3M12 A;  3P4P A;  2XLP A;  1GTH A;  5FS7 A;  3SM8 A;  3AE2 A;  1B37 A;  3F8P A;  1OJC A;  2GB0 A;  2YLX A;  4XWR A;  3AEB A;  1QJD A;  3QJ4 A;  2YLW A;  4UP3 A;  5C3J A;  4NEV A;  3NYC A;  2BCP A;  1PBB A;  1P2E A;  1EL8 A;  3GWD A;  3DJE A;  2I0Z A;  1PBF A;  2WPE A;  5BVA A;  4YKG A;  4NZH A;  1XAN A;  5KWF A;  2R45 A;  5L46 A;  2DKI A;  3I6D A;  3AYL A;  3IWA A;  2YLR A;  4K22 A;  4JN9 A;  4YSX A;  5BUL A;  3UCL A;  1H6V A;  4RG3 A;  3AE3 A;  3M0O A;  4IVM B;  1KF6 A;  1JRY A;  3WE0 A;  4IV9 A;  2IVD A;  5JCM A;  2B9W A;  5JCK A;  3NN6 X;  2JK6 A;  4K5S A;  4EM3 A;  3ATR A;  4FDC B;  1GEU A;  2EQ6 A;  3AE5 A;  1LV0 A;  2A8X A;  2GQF A;  2C67 A;  2GEW A;  2WEU A;  4EMI A;  4YT0 A;  4H4V A;  3KPF A;  2B7R A;  2V6O A;  4UDP A;  4A9W A;  4B69 A;  2PYX A;  1TRB A;  1DJQ A;  1EL9 A;  4J36 A;  2E5V A;  1NAA A;  1NHR A;  1S2Q A;  3RNM A;  3UOV A;  3DK4 A;  1D4D A;  1ZKQ A;  1ZOV A;  2GR1 A;  2R0G A;  4J56 A;  3SFD A;  1FL2 A;  3UTG A;  2QA2 A;  5KVI A;  1IUT A;  3AE6 A;  1NEK A;  3V3N A;  2B9X A;  3CGC A;  1GRA A;  3EAO A;  2H89 A;  3AE8 A;  3PS9 A;  1L9C A;  3V3O A;  1PS9 A;  4KX6 A;  2YR6 A;  2WPF A;  2BAB A;  4H2N A;  1OJD A;  4K5R A;  1F8W A;  1ZP0 A;  2WU2 A;  1E7P A;  2GR2 A;  1Y56 A;  2JB3 A;  2OAL A;  2XVI A;  3DJD A;  2X8H A;  1X31 B;  3QFB A;  1PJ6 A;  4AT0 A;  4AOS A;  2YLS A;  4CCR A;  1CC2 A;  4CY8 A;  1K0J A;  4JY3 A;  3Q6J A;  3KLJ A;  2WBA A;  3QVR A;  1NHP A;  1UKV G;  1PBE A;  4A6N B;  4REK A;  3P1W A;  3K7T A;  4U8P A;  1GRT A;  1H7W A;  2GV8 A;  2WP6 A;  3QVP A;  4PAB A;  4C77 A;  3CND A;  1PHH A;  1NHQ A;  1REO A;  1H82 A;  1VRQ B;  1BGN A;  3NHO X;  4U2S A;  5KOX A;  4DSG A;  2C72 A;  4H4U A;  3D1C A;  2IID A;  3OC4 A;  1FCD A;  1Q9I A;  4TLZ A;  4LII A;  1SEZ A;  3GRS A;  3UTF A;  1D5T A;  3GD3 A;  4BJZ A;  1ZOY A;  3FPZ A;  3CGE A;  1GSN A;  1ZK7 A;  3ALL A;  2YM2 A;  2RGH A;  2V3A A;  1QO8 A;  2YVG A;  1F8S A;  4Z2R A;  2RAB A;  1FEA A;  4Y4M A;  2TMD A;  2V61 A;  1GPE A;  1AOG A;  2JB1 A;  4MJW A;  4XXG A;  3AB1 A;  2WP9 A;  3RP7 A;  1PDH A;  3ICS A;  1PJ5 A;  5IQ4 A;  1GV4 A;  4YTM A;  2VVL G;  3B3R A;  3C4N A;  3KKJ A;  2YLZ A;  4OPG A;  3BI2 A;  2OA1 A;  4DNA A;  4HB9 A;  1H83 A;  2BK4 A;  2WDR A;  3T37 A;  3C4A A;  4U8J A;  1O95 A;  3NRN A;  3CGD A;  2BCG G;  3GWF A;  4ICY A;  4TM4 A;  3FIM B;  1KSU A;  3C96 A;  5FS9 A;  3AE7 A;  2JAE A;  4H7U A;  2ZZ0 A;  4WX1 A;  1O94 A;  2Y6R A;  2YM1 A;  1CL0 A;  3Q9T A;  4C3Y A;  2FBW A;  3UKP A;  4YSH A;  1BF3 A;  4USR A;  4EMW A;  3QSS A;  4CY6 A;  3LZX A;  4OPD A;  2VRM A;  4H4S A;  1LPF A;  3AE4 A;  2GVC A;  4U8N A;  4DGK A;  1F8R A;  2Y6Q A;  4RG4 A;  3EF6 A;  1RP0 A;  3NK1 X;  2BS3 A;  5C2T A;  3VRD B;  4BV6 A;  1YQ4 A;  1E1K A;  5BUK A;  3FG2 P;  3ISH A;  3UP5 A;  4H4T A;  3AWI A;  1IUS A;  4D04 A;  4YXD A;  5KVH A;  3CNT A;  4BUR A;  3CN8 A;  1CBO A;  1NHS A;  3ATQ A;  1Y0P A;  3NIX A;  5JCN A;  1V59 A;  5HYM A;  1TDF A;  3VR9 A;  4LA1 A;  4JDR A;  4OPL A;  1B8S A;  1PBD A;  5FMH A;  2BXR A;  2WET A;  3QSM A;  1F6M A;  4A65 A;  1OJT A;  1PN0 A;  2VVM A;  1COY A;  3FMW A;  3P9U A;  4AOX A;  1CHU A;  1H84 A;  1PXB A;  5HXI A;  4TLX A;  1LTX R;  5U1O A;  3IHM A;  1IJH A;  2WPC A;  1JEH A;  2YG7 A;  4FX9 A;  3BNU A;  2AAQ A;  1VDC A;  2X8C A;  1NG4 A;  1Q1R A;  1CC6 A;  2YQU A;  1EL5 A;  2GR3 A;  4OPC A;  2AQJ A;  4KPR A;  1LQU A;  3LJP A;  1M6I A;  4JNQ A;  2CFY A;  3B6D A;  3VQR A;  2X50 A;  2XFU A;  4OPT A;  3BI4 A;  1DOE A;  1KNP A;  2Q6U A;  1DXL A;  4YWO A;  4BK3 A;  3D8X A;  1KNR A;  3AEF A;  5KRQ A;  4N9X A;  4GCM A;  1ELI A;  1JNZ A;  4UDR A;  1S3E A;  3AYJ A;  1DNC A;  4J2W A;  1QLB A;  3GD4 A;  1ZMC A;  1NPX A;  2BC1 A;  1GND A;  2CVJ A;  3K30 A;  4EM4 A;  2APG A;  3IHG A;  5M10 A;  4U2T A;  2GRT A;  2GAG B;  2C65 A;  2RGJ A;  4J57 A;  3V76 A;  3GYJ A;  2VZ2 A;  2AR8 A;  2E1M A;  2IVE A;  3RHA A;  2BAC A;  3OZ2 A;  2ZZB A;  2ZBW A;  4U2L A;  1JNR A;  3VRB A;  4C5O A;  4EQW A;  4APN A;  1ZMD A;  3GRT A;  3G5R A;  3NG7 X;  2C66 A;  2OLO A;  2BXS A;  4X4J A;  4ADW A;  4K2X A;  3H8I A;  2H88 A;  1F3P A;  2A87 A;  4GDP A;  3NK0 X;  1CJ4 A;  4J33 A;  2BA9 A;  2X99 A;  4EQR A;  4Z44 A;  4AP3 A;  3E1T A;  1E1L A;  4HA6 A;  3ICR A;  1PJ7 A;  3P4S A;  2Z5X A;  2C73 A;  4RSL A;  1BGJ A;  4EIQ A;  1NDA A;  1N4U A;  5M0Z A;  3SQP A;  4M52 A;  4P9S A;  4ZCC A;  5FS8 A;  2YR4 A;  1HYU A;  1O5W A;  1W4X A;  2PHH A;  2Q0L A;  1OJA A;  4GUV A;  2XFQ A;  1Y56 B;  3L8K A;  4BJY A;  2VQ7 A;  2QA1 A;  3NYF A;  2BYB A;  3RED A;  2XFN A;  2ARD A;  1H86 A;  3UKQ A;  2YG5 A;  2YWL A;  3LB8 A;  3ICT A;  4B66 A;  5GSN A;  2NVK X;  4U8K A;  4H4X A;  3BHK A;  2CDU A;  4GF7 A;  2XYO A;  1CJ2 A;  1LQT A;  2V60 A;  2Q0K A;  1IUU A;  2X3N A;  2YG4 A;  3S5W A;  3II4 A;  4ECH A;  2WES A;  3NLC A;  1ZDL A;  1GER A;  2B7S A;  1IUX A;  4EQS A;  1TYP A;  1ONF A;  2XVH A;  3GYX A;  2BS4 A;  3DH9 A;  4OPI A;  4JNA A;  2FJE A;  2Z5Y A;  3ALJ A;  3EPT A;  2QCU A;  4U8M A;  3GSI A;  1DJN A;  5IQ1 A;  4AT2 A;  4X9M A;  4H2Q A;  1K0I A;  3L1R A;  3AE9 A;  2YLT A;  2EQ8 A;  2C75 A;  2WDQ A;  3COX A;  4E0V A;  1L9E A;  5HY5 A;  4U8I A;  4A79 A;  5LV9 A;  3NT6 A;  1EL7 A;  3NGC X;  3NK2 X;  4Y4N A;  4CCQ A;  5KXJ A;  1S3B A;  2JB2 A;  5DBJ A;  3CPH G;  2WS3 A;  3AD7 B;  5JCI A;  4H2P A;  1TDE A;  4X9N A;  1VG9 A;  2EQ9 A;  2XLT A;  2C64 A;  5CKU A;  3SFE A;  3VR8 A;  2B9Y A;  1GET A;  4O5Q A;  2YR5 A;  3FBS A;  4H4Q A;  4NEW A;  3BNM A;  2JBV A;  4TM0 A;  4AP1 A;  5BRT A;  4NTE A;  4A6N A;  3NKS A;  4H2R A;  2VOU A;  3ZYX A;  3G5S A;  3P4R A;  4Z2T A;  3NTD A;  4D03 A;  2HQM A;  5JCL A;  4IA5 A;  2WOV A;  3UKK A;  5U63 A;  4B1B A;  1M64 A;  2O9Z A;  1OJ9 A;  3AEE A;  1GOS A;  1XHC A;  2C76 A;  3CNS A;  1P2H A;  3H4K A;  2XDO A;  3UKL A;  1BKW A;  2WOI A;  4Z25 A;  4Z2U A;  2V3B A;  1CJ3 A;  2A89 A;  4YTP A;  3UOZ A;  1RYI A;  4OCG A;  2WU5 A;  1VQW A;  3DGH A;  4FK1 A;  4A5L A;  5GRT A;  2BS2 A;  1ZX9 A;  1GXF A;  3HZL A;  1DOB A;  1GES A;  3KU9 A;  2C3C A;  4Z26 A;  4FK1 C;  3AEA A;  1MXT A;  4YSZ A;  1GRF A;  3ADA B;  3KA7 A;  4H50 A;  4NTD A;  3GQK A;  2YVJ A;  4C3X A;  1Q1W A;  4GR1 A;  4XWZ A;  1E6E A;  1N4W A;  3EAN A;  3IF9 A;  4GRT A;  4B67 A;  1TYT A;  1GRH A;  4K7Z A;  1GRE A;  1LJ1 A;  3K7M X;  4Z43 A;  4C74 A;  3CIR A;  2RGO A;  5KOW A;  4OPU A;  4CNK A;  2XVJ A;  3UOY A;  2ACZ A;  3LOV A;  4A7A A;  3VRA A;  3P4Q A;  1TDN A;  1MO9 A;  3CPI G;  4H4W A;  4Y4L A;  4BK2 A;  2XVF A;  4IA6 A;  4EIP A;  2R46 A;  4OVI A;  2F5Z A;  3AD8 B;  3AED A;  4LU6 A;  3F8D A;  1IUW A;  5FS6 A;  3R9U A;  1YKJ A;  1DOD A;  2J3N A;  1E39 A;  4CNJ A;  3AD9 B;  3H8L A;  3QFA A;  1CJC A;  2R9Z A;  5ER0 A;  4H4P A;  1DOC A;  4ZN0 A;  2C7G A;  3ITJ A;  2JKC A;  4B68 A;  3PO7 A;  4BK1 A;  1YQ3 A;  5EOW A;  2C70 A;  3AEG A;  3GMB A;  4H4R A;  5IPY A;  1FEB A;  4YKF A;  5EB4 A;  1S2Y A;  3UKA A;  3UOX A;  2YG6 A;  1RSG A;  4TM1 A;  2OLN A;  4WCT A;  2VRL A;  4CRT A;  2WP5 A;  3I3L A;  2FJB A;  4A99 A;  1E1M A;  3CNP A;  2BK5 A;  1Z6L A;  4Z24 A;  2TPR A;  3DA1 A;  1PBC A;  4UDQ A;  2Q7V A;  4O5U A;  3NYE A;  2LFC A;  1D4C A;  2YG3 A;  3DK9 A;  1GT8 A;  2ZZC A;  4K8D A;  1GTE A;  2WDV A;  1MOK A;  1GRB A;  2R4E A;  3BHF A;  3URH A;  1EBD A;  3NNE A;  4U8L A;  2VVL A;  4B64 A;  2GR0 A;  3KD9 A;  1JRX A;  3LXD A;  4EQX A;  1K0L A;  4YSY A;  4IVO B;  3SGL A;  2X8G A;  1YQZ A;  1CC4 A;  3AXB A;  2R4J A;  4ZCD A;  1E1N A;  1PXA A;  2FJA A;  1GAL A;  2R0P A;  3KVE A;  4JY2 A;  2XLU A;  3GDP A;  3GYI A;  1TDK A;  4I58 A;  4GDE A;  2XLR A;  1IUV A;  3NTA A;  1L0V A;  5J60 A;  3JSK A;  1JOA A;  4JQ9 A;  1KDG A;  3ZDN A; 
#chains in the Genus database with same CATH topology
 2FUP A;  3UP4 A;  3DME A;  1BR4 A;  3DJJ A;  4ZZC A;  4AIU A;  3DJG X;  3GDN A;  4B63 A;  4PJN A;  4ZZB A;  1NG3 A;  4WBN E;  4EXT A;  2R0C A;  3AVR A;  4TM3 A;  3UTH A;  3PVC A;  2L8K A;  3PJA J;  3LZW A;  2CUL A;  2Z6E A;  3C50 A;  2A9U A;  3C98 B;  1OED E;  4IDO A;  4TV8 E;  2FJD A;  2GQW A;  1GRG A;  4Q4X 4;  3I9Y A;  1MIY A;  3ALM A;  4I59 A;  1D7L A;  4Z90 A;  4CXW A;  4XZC A;  2XJ7 A;  4K0K T;  2XQ3 A;  2CRB A;  4DR6 T;  2PYJ A;  2A72 A;  4J31 A;  1B5Q A;  3K3O A;  3SUC A;  1D7Y A;  3F31 A;  2BC0 A;  3UTE A;  2GMH A;  3QSE A;  2GF3 A;  5J7X A;  2L3L A;  4UXN B;  3NN0 X;  2V5Z A;  1XDI A;  5DQW A;  4EEB A;  5HWY A;  3S4U A;  3WAK A;  3M12 A;  4PAG A;  2XLP A;  4X5T A;  5L3D B;  2C5J A;  5CGM A;  1B37 A;  1OJC A;  2YLX A;  1BR1 A;  2QVA A;  3AEB A;  2YLW A;  2PG8 A;  5C3J A;  1J5W A;  3NYC A;  5AQT B;  1VBE 4;  4IIJ E;  2BCP A;  1FMV A;  2I0Z A;  1PBF A;  2MYS A;  4YKG A;  5KWF A;  1XAN A;  5F8P A;  4AI6 A;  2DKI A;  3IWA A;  2PY5 A;  2JQQ A;  4NPP A;  1Z7S 4;  1JRY A;  2IVD A;  2NW7 A;  2JK6 A;  4QX7 B;  3LK4 2;  3ATR A;  2GQF A;  1UCU A;  2X9W A;  2A8X A;  2SPC A;  3UFG A;  1R8I A;  3KPF A;  4H63 H;  5CA0 E;  2V6O A;  2PYX A;  2K3W A;  2E5V A;  4KUM B;  3DK4 A;  1D4D A;  3N9P A;  5FNV E;  2VKD A;  3SFD A;  1FL2 A;  3UTG A;  5KVI A;  5BR8 T;  1HRI 4;  1GRA A;  3EAO A;  2D5U A;  3N2K E;  4LF8 T;  4UVA B;  3ZN1 B;  2BAB A;  1OJD A;  1E7P A;  4C91 A;  5ABG A;  3RKG A;  3ZJ2 A;  3L39 A;  5AQR B;  3LBX B;  4AOS A;  2JRK A;  1EV1 4;  5LBM A;  3AAI A;  5LOV E;  4AKG A;  1NHP A;  1ASJ 4;  4REK A;  3K7T A;  1GRT A;  2LKH A;  2WP6 A;  5JH7 E;  5FXZ A;  1BGN A;  5LHI B;  2YDQ A;  4DSG A;  3EAM A;  1N36 T;  1DU2 A;  1POV 0;  3D1C A;  1Q9I A;  3GRS A;  1UUR A;  4BJZ A;  5FKY A;  2WCA A;  3FPZ A;  3CGE A;  1GSN A;  2YM2 A;  5LJM A;  5FXX A;  3UUL A;  2ZMA A;  2AXD S;  4MLK A;  1FEA A;  2UXX B;  2TMD A;  2V61 A;  2YEV C;  1FMW A;  3PUQ A;  4CI2 B;  2WP9 A;  1PDH A;  5E0O A;  3FHN A;  2IAK A;  2VVL G;  1OED B;  4P0A A;  1OED A;  3PDY A;  4DNA A;  2B1E A;  1E2A A;  1H83 A;  2BK4 A;  1X79 A;  3T37 A;  3ONJ A;  4HFC A;  4U8J A;  3FZM B;  3CGD A;  4IST A;  2BG9 C;  3C96 A;  2JAE A;  2ZZ0 A;  4WX1 A;  2Y6R A;  2YM1 A;  4Z91 A;  2ZM6 T;  3Q9T A;  4NXN T;  4USR A;  2BG9 A;  3FZL B;  3KDS E;  3T1H T;  4DR4 T;  2VRM A;  4H4S A;  2GVC A;  4U8N A;  1HCI A;  4O4H E;  3EF6 A;  2DWK A;  4HFB A;  3ZST A;  1RP0 A;  4PJJ A;  2XM2 A;  3NK1 X;  4BV6 A;  2JMK A;  4X1Y E;  3J7Y q;  2QRX A;  1E1K A;  5BUK A;  4UV9 B;  5AQN B;  3T14 A;  3AA0 B;  3UP5 A;  2CM0 A;  3ONX A;  5KVH A;  4BUR A;  5HAX A;  4DVD A;  4DR1 T;  3CN8 A;  1CBO A;  3ATQ A;  5JCN A;  4X1I E;  1HF8 A;  1V59 A;  3U78 A;  4LA1 A;  2E9X A;  4U7I A;  2VVM A;  1K5M D;  4TLX A;  5U1O A;  1IJH A;  2YG7 A;  4KBM B;  4JI7 T;  3AA6 B;  4BAY B;  1CC6 A;  2WAU A;  1EL5 A;  4OPC A;  2X9H A;  1W9R A;  3K1S A;  1NCQ D;  1M6I A;  2CFY A;  3VQR A;  2X50 A;  4UEL A;  3LFM A;  2XQ8 A;  2HH7 A;  2ZM0 A;  4DID B;  4BK3 A;  1AR7 4;  1DNC A;  2MAW A;  3CK6 A;  3T31 A;  1MIW A;  1W0A A;  2BC1 A;  2CVJ A;  3K30 A;  3QUJ A;  3IHG A;  2BVL A;  2GAG B;  1WYC A;  3PE0 A;  2VZ2 A;  2K48 A;  2G0U A;  4U2L A;  3R84 B;  2LHR A;  3GRT A;  2C66 A;  4E7Z A;  5HXS A;  2OLO A;  3LJC A;  1HS7 A;  2K5B B;  4X4J A;  1PO2 4;  1F3P A;  4GDP A;  2DLR A;  3NK0 X;  3AA1 B;  1CJ4 A;  1HRV 4;  2X99 A;  4EQR A;  3H3M A;  2LSJ A;  1PJ7 A;  3P4S A;  3I0Q A;  5LJN A;  5LHG B;  2BKN A;  5M0Z A;  2X5I D;  2CXL A;  4MBQ A;  4Q25 A;  1HYU A;  2PTF A;  4EB6 E;  5HWX A;  1O5W A;  1OJA A;  1R08 4;  4GUV A;  2CLY C;  5HXE A;  1Y56 B;  4TNV A;  2QA1 A;  2QYW A;  2BYB A;  4UVC B;  4UR9 A;  2J47 A;  2NP9 A;  3GMI A;  2ARD A;  5FXW A;  2YG5 A;  4V1A v;  3LB8 A;  4CXX A;  5GSN A;  4GB3 4;  4U8K A;  4UEM A;  2XYO A;  5JDF A;  3S5W A;  4JI1 T;  3TLW A;  3II4 A;  4ECH A;  3OPC A;  4HWF A;  2Y8D A;  2B7S A;  3AXJ B;  2XVH A;  3GYX A;  2NOX A;  2BS4 A;  2W61 A;  4LFC T;  4JNA A;  2FJE A;  4OPI A;  3SRZ A;  3LDQ B;  3RQU A;  4AT2 A;  3HYX A;  1SHZ C;  2R07 4;  3ZT5 A;  2EQ8 A;  2C75 A;  3COX A;  2C0S A;  1EL7 A;  3NK2 X;  5JDH A;  1S3B A;  3AD7 B;  3ZC0 A;  3E08 A;  3SFE A;  3VR8 A;  2B9Y A;  4OK0 A;  1GET A;  4NEW A;  3ZYM A;  2JBV A;  5BRT A;  4NTE A;  1RUD 4;  2VOU A;  1PIV 4;  3G5S A;  2N9D A;  3N9L A;  4ZS3 A;  1T7S A;  3NTD A;  1M62 A;  2WBL A;  3RYF E;  1M64 A;  4QHO A;  4DUY T;  1OJ9 A;  1YKH B;  3CNS A;  2NWB A;  2XDO A;  2VVS A;  3O1H A;  1MNE A;  4IGU A;  4Z25 A;  2X66 A;  5FYM A;  2LM2 A;  5HEU A;  2WU5 A;  5LGU B;  4G63 A;  1ZX9 A;  3HZL A;  1GES A;  1J5E T;  2WY2 A;  3AEA A;  3KA7 A;  2R6G F;  4NTD A;  2YVJ A;  1D0Z A;  2D0U A;  4XWZ A;  3LG7 A;  3IF8 B;  1QSD A;  5H6R B;  1TYT A;  3BQL A;  3LK3 B;  5CB4 E;  1GRH A;  2KMF A;  2XZE A;  4K7Z A;  1LJ1 A;  4OPU A;  4CNK A;  1HTJ F;  4A7A A;  2DL1 A;  1TDN A;  4EIP A;  2R46 A;  5L3C B;  3F8D A;  3HYV A;  4CNJ A;  3H8L A;  3ZT7 A;  1DOC A;  2WM9 A;  4HN9 A;  4IDN A;  1YQ3 A;  2C70 A;  4H4R A;  4H9P C;  1FEB A;  3B5M A;  1YW0 A;  4U72 A;  2IUB A;  1UUS A;  1RSG A;  2WZI A;  3UUN A;  3CNP A;  3CQX C;  4DBR A;  5DQV A;  1Z6L A;  4UDQ A;  5EK2 A;  2YOE A;  4K8D A;  3RIA A;  2WDV A;  5KX5 E;  1D1A A;  2HN2 A;  1MOK A;  4E7S A;  2R4E A;  4G9K A;  3IBP A;  2GR0 A;  3JBG 4;  1S35 A;  5FY0 A;  4F8H A;  1E1N A;  3KVE A;  2XLU A;  3ZYK A;  3GYI A;  1TDK A;  2X51 A;  2LOS A;  3NTA A;  3JSK A;  3P4W A;  3NWI A;  2QAE A;  1NEN A;  3Q5X A;  3GMC A;  3ZC1 A;  2N1G A;  1Y64 B;  4G6G A;  5BMV E;  3V5S A;  2XCG A;  4TZ4 C;  4H4Z A;  1MMD A;  3ABV A;  2B76 A;  4USQ A;  2W0H A;  2XFP A;  5TR3 A;  4A56 A;  2WHD A;  3DGZ A;  1H81 A;  2E4G A;  1FOH A;  5EBK A;  4ZI3 C;  3UFE A;  2WQY A;  3N9M A;  4PNI A;  2IC6 A;  1AL2 4;  3AE1 A;  4HFE A;  5CQF A;  3K7Q X;  5AQM B;  4PK6 A;  2JQ9 A;  1TDO A;  1VOM A;  1LKX A;  1XPQ A;  1UX5 A;  3DP7 A;  2DKH A;  3RP8 A;  1N1P A;  3N5L A;  3A5X A;  4I50 E;  2C3D A;  2EQ7 A;  2XFO A;  1BWC A;  3F8R A;  2X0H A;  3DK8 A;  2YVF A;  3CNJ A;  2LRL A;  1FEC A;  2ODV A;  3O0H A;  1CF3 A;  4U8O A;  4HWI B;  1VG0 A;  3AXJ A;  1KFY A;  1HNZ T;  4X66 T;  1XI1 A;  5U25 A;  1RUF 4;  3AB3 B;  2IML A;  2JQH A;  5KMQ A;  3WI3 A;  4UIG A;  1PBB A;  1P2E A;  3RGL A;  3DJE A;  5KNL A;  4LFB T;  3I6D A;  4K22 A;  4GAP A;  4TX5 A;  3KBT A;  4ERR A;  4YSX A;  3RX6 A;  3ZLI A;  3AE3 A;  4IV9 A;  5JCM A;  4QWN B;  3NN6 X;  1U5P A;  4K5S A;  4EM3 A;  3OTO T;  1GEU A;  4U33 A;  3DJB A;  5IWA T;  2H7O A;  3B57 A;  2EQ6 A;  4AKH A;  2C67 A;  2GEW A;  4EMI A;  2LHN A;  4B69 A;  3U3I A;  3RRW A;  1NHR A;  1US7 B;  3FBL A;  1IUT A;  2DWG A;  3V3N A;  3ZMS B;  2B9X A;  2H89 A;  3AE8 A;  4A5X A;  5HYA A;  2D9D A;  2LJL A;  3UU6 A;  4KX6 A;  3TKL B;  2YR6 A;  1RUJ 4;  4TV9 E;  1MMN A;  2WU2 A;  1ZP0 A;  1F8W A;  2GR2 A;  2XVI A;  3DJD A;  2X8H A;  3QFB A;  1COV 4;  1HNX T;  4AT0 A;  2HWC 4;  4A97 A;  5KMS A;  2RR1 4;  4CCR A;  2JMH A;  4WW0 A;  3Q6J A;  4TWH A;  1UKV G;  1PBE A;  1V9D A;  4A6N B;  3UU8 A;  4C77 A;  2LSK A;  1PHH A;  1EAH 4;  3C4W A;  1REO A;  1H82 A;  3T2Z A;  3NHO X;  2K24 A;  2IID A;  3NRX A;  5F3J A;  4TNW A;  4LII A;  4Q4V 4;  1D5T A;  1ZK7 A;  2H7V C;  2RGH A;  1QO8 A;  2YVG A;  1MQT D;  4Z2R A;  3P8C D;  3CMM A;  2LSI A;  1AOG A;  5CA1 E;  4Q4Y 4;  4XXG A;  1VBD 4;  4CZZ B;  5IQ4 A;  1GV4 A;  4EGW A;  1ZKE A;  3ESL A;  2OA1 A;  4HB9 A;  3OJA A;  2E2A A;  2YIN A;  3W15 B;  4GKK T;  3NRN A;  4K0U A;  3GWF A;  4TM4 A;  2CWO A;  5FS9 A;  2WMO A;  1CL0 A;  3V5U A;  1M7K A;  2FBW A;  3LZX A;  3ZMV B;  4OPD A;  3RHW A;  1LPF A;  4DGK A;  2AE9 A;  1F8R A;  2P9B A;  1PO1 4;  3NBX X;  3UT5 E;  1YQ4 A;  4AIS A;  5KMG P;  3ISH A;  2CBJ A;  2NW9 A;  4I55 E;  5HEH A;  1YD8 G;  4D04 A;  4IE4 A;  3H3A A;  1AR9 4;  4ZI3 D;  1Y01 A;  3NIX A;  2VKH A;  2XSB A;  3PV0 F;  5HYM A;  3IA3 A;  4HGA A;  4A65 A;  4H9S E;  4X1K E;  3FMW A;  1CHU A;  4GOU A;  1PXB A;  1D1C A;  2YU1 A;  3VHL A;  1VDC A;  4YLH A;  1KEY A;  1NG4 A;  3BQK A;  3CX8 B;  2CHO A;  2GR3 A;  4JEH B;  2AQJ A;  4KPR A;  2XAJ B;  3LJP A;  4JNQ A;  3B6D A;  4HE8 A;  4OPT A;  5LNK A;  2WZH A;  3BI4 A;  1DOE A;  1KNP A;  4PK4 A;  4H63 V;  3KVA A;  4N9X A;  1JNZ A;  3JAD A;  1S3E A;  3AYJ A;  4GYS A;  4J2W A;  3GD4 A;  4TWF A;  5L47 A;  1NPX A;  4EM4 A;  2APG A;  1QUU A;  3WAJ A;  2YU2 A;  3C51 A;  2WSS V;  5JDN A;  4J57 A;  3GA8 A;  2AR8 A;  2IVE A;  4ZI7 E;  3O9X A;  3M3Z B;  2ZBW A;  4EQW A;  4UV8 B;  3VRB A;  4APN A;  3NG7 X;  4I4T E;  3RRC A;  3H8I A;  2H88 A;  4LMJ A;  2QA7 A;  2V5D A;  4G74 A;  4CQI A;  5JR9 A;  2BA9 A;  2VUR A;  4AP3 A;  3CML A;  3RC8 A;  1E1L A;  3H37 A;  2RMU 4;  3QB5 K;  3BQI A;  2C73 A;  4J2C A;  4RSL A;  1NDA A;  4ZCC A;  1W4X A;  1OXZ A;  3RYC E;  2Q0L A;  1BR2 A;  3ZMZ B;  3L8K A;  1VRH 4;  2OV9 A;  5H6Q B;  3ZEF B;  2A2F X;  4L0R A;  2UXN B;  4KHZ F;  2HN1 A;  1H86 A;  4EYY R;  3HYW A;  2NVK X;  1WCR A;  4H4X A;  2CDU A;  3MZK B;  4ZS2 A;  2V60 A;  2X3N A;  5JTG A;  4YHH T;  3NLC A;  2LLY A;  1ZDL A;  5JDG A;  1TYP A;  1ONF A;  3NZQ A;  4AKL A;  4B6X A;  2QCU A;  4CN1 A;  2V5C A;  4GIW A;  1DJN A;  4X9M A;  3AA7 B;  4H2Q A;  3RIF A;  3AE9 A;  4GAV A;  1ZV4 X;  4U8I A;  4YJ2 E;  3F57 A;  5LV9 A;  2JB2 A;  3PUS A;  2WS3 A;  2Y6X A;  3CPH G;  2YN6 A;  2IIU A;  4BA9 A;  1TDE A;  3SWH A;  2EQ9 A;  3EDU A;  3GWH A;  1MMA A;  1MMG A;  4O5Q A;  2YR5 A;  4A98 A;  2NTX A;  1OOP D;  3OVU A;  4ILU A;  2V1D B;  4H2R A;  3LSV A;  3P4R A;  4D03 A;  4IE6 A;  4IA5 A;  3UKK A;  4DV1 T;  4JI0 T;  5EK4 A;  2O9Z A;  4CN4 A;  1GOS A;  5IYZ E;  4ANJ A;  1XHC A;  4DR2 T;  4G73 A;  4B3M T;  2RS5 4;  4N78 D;  1RUI 4;  2YDR A;  2V3B A;  3UOZ A;  5AQV B;  1N32 T;  1IZN B;  5TAO A;  5AQL B;  5ETW A;  4DR3 T;  4O2B E;  5L4E A;  4A5L A;  5GRT A;  4Q4W 4;  4HTE A;  3HKB E;  4YHJ A;  3PUX F;  3RIU C;  4FK1 C;  1GRF A;  2HPJ A;  4JUY A;  2VAS A;  4C3X A;  3EVY A;  2V6X A;  5CFB A;  1Q1W A;  4AXP A;  1S94 A;  2MOZ A;  3IF9 A;  3RH3 A;  4GRT A;  2C5K T;  3B13 A;  4U7Y A;  2PBI A;  2EHO A;  1VCT A;  2XVJ A;  3UOY A;  4MHC A;  2D0T A;  3LOV A;  3VRA A;  1NAF A;  2VKO A;  2EX3 A;  3P4Q A;  2V7K A;  4IA6 A;  2XQA A;  2RA1 A;  4OVI A;  3AD8 B;  4LU6 A;  4DV3 T;  4NUV A;  2M6B A;  4XAX B;  4ZN0 A;  3ITJ A;  2JKC A;  5AQO B;  3PO7 A;  3AEG A;  4U3C A;  3GMB A;  5J2U E;  4OYK A;  2LOP A;  3UKA A;  2YDS A;  4UF0 A;  3HA4 A;  5FP3 A;  4I43 B;  2VRL A;  4CRT A;  1E1M A;  5LB7 B;  4LF9 T;  4JYA T;  2XAG B;  4O5U A;  3ZT6 A;  1IJ5 A;  3NYE A;  2LFC A;  1D4C A;  4EIW A;  3BHF A;  5LGT B;  3NNE A;  4PDW D;  4EQX A;  4JI4 T;  2DI4 A;  2V7L A;  4P09 A;  1CC4 A;  3AXB A;  1YXR A;  2FJA A;  1RUG 4;  5LGN B;  1RHI 4;  4JQ9 A;  1IUV A;  4LML A;  5J60 A;  1KDG A;  5C8Y E;  4H4U A;  3ZDN A;  1IJ6 A;  4HFD A;  4X64 T;  3CTY A;  2BG9 B;  2UZZ A;  3T1Y T;  3I0O A;  1BZL A;  1B4V A;  3CWZ B;  3BI5 A;  4DSH A;  1PXC A;  5ABH A;  2H3R A;  1J1J A;  5JQG E;  3TLT A;  4II3 A;  4UF0 B;  1KSS A;  3HKD E;  2R7F A;  4J34 A;  3CGB A;  2NPX A;  4QH1 A;  3AYI A;  1HX8 A;  2A3D A;  2VQF T;  2GAH B;  1D4M 4;  3RYH E;  3M13 A;  2WOW A;  2HWB 4;  2VQE T;  2X67 A;  1JRZ A;  3ZKR A;  4AQG A;  2YAU A;  2RM2 4;  4YTN A;  3RP6 A;  2OAM A;  3O1J A;  3GQH A;  4EZH A;  2BG9 E;  2GH5 A;  2XHE B;  3PUG A;  1VBA 4;  4B3R T;  3LAD A;  4JLE A;  2XQ9 A;  4B65 A;  5ABE A;  5HHF A;  4RHV 4;  2HPL A;  3P4P A;  3RLF F;  5FS7 A;  3SM8 A;  2GB0 A;  2W62 A;  3HKC E;  2RP4 A;  3KBU A;  1QJD A;  5LMU T;  3QJ4 A;  4JI8 T;  2KLQ A;  4DR5 T;  2PYL A;  1EL8 A;  2WPE A;  5L46 A;  5BVA A;  1VBB 4;  4NZH A;  3J8F 4;  1PVC 4;  2R45 A;  2YLR A;  4JN9 A;  3UCL A;  2NTY A;  3WE0 A;  1KF6 A;  2LE8 A;  2B9W A;  4FDC B;  2UUB T;  1LV0 A;  3CX6 B;  2VB6 A;  1XZY A;  1HXS 4;  4YT0 A;  4H4V A;  4UDP A;  2B7R A;  4QXH B;  4A9W A;  1EL9 A;  1TRB A;  4J36 A;  3RNM A;  2CEA A;  1NAA A;  2CCQ A;  3UOV A;  2R0G A;  1ZOV A;  2GR1 A;  4O4J E;  2Y48 B;  2BKP A;  3AE6 A;  1NEK A;  3CGC A;  5FL0 A;  4O8S A;  1L9C A;  3V3O A;  3A8Y C;  2HHH T;  1PS9 A;  1I94 T;  3OYZ A;  1YKE B;  4K5R A;  4IDQ A;  2KSR A;  1D1B A;  1Y56 A;  1FEW A;  1X31 B;  1O3X A;  3ZCI A;  1PJ6 A;  2LEH A;  4HFV A;  1G8X A;  4EOZ B;  3T0K A;  4JY3 A;  2E9X B;  3KLJ A;  3EAB A;  3QVR A;  1Z0P A;  2DHR A;  5LMN T;  4C90 A;  3CQG B;  1NWM X;  1H7W A;  2W63 A;  1HG5 A;  3KIN B;  1NHQ A;  4WYV A;  4ASK A;  2J1D G;  3C64 A;  4U2S A;  5KOX A;  2C72 A;  4L5G A;  5IHY A;  3NRY A;  4TLZ A;  3LK2 B;  1SEZ A;  1ZOY A;  3RI5 A;  1FIO A;  4DMW A;  1AJ3 A;  4LF4 T;  3ALL A;  1I6Z A;  2EHO D;  1F8S A;  4ZEY A;  4BJM A;  4Y4M A;  3HR0 A;  3ZPO A;  3I1A A;  3SZF A;  3QOF A;  1GPE A;  3N9O A;  2JB1 A;  4MJW A;  1OED C;  4NNJ A;  3RP7 A;  3ICS A;  5HXC A;  3B3R A;  3C4N A;  4OPG A;  2RPA A;  4IDZ A;  4IRE A;  5J2T E;  3ZCJ A;  2OA5 A;  1HR0 T;  3ZN0 B;  3C4A A;  2EHO C;  4ICY A;  2BCG G;  3UTK A;  5JRC B;  2CMR A;  2LSY A;  3FIM B;  5JVD E;  4II2 A;  2W4X A;  4C3Y A;  2KT9 A;  2UUA T;  3QSS A;  2PLV 4;  5AQQ B;  4QH4 A;  3AE4 A;  4X62 T;  1RUH 4;  4RG4 A;  2JQK A;  3A7M A;  2BS3 A;  5C2T A;  3VRD B;  2E8I A;  3FG2 P;  4H4T A;  2LKG A;  4YXD A;  3JCF A;  3VU7 H;  4AKR B;  3JD7 4;  4LFA T;  3ANW A;  4OX9 T;  2WB5 A;  4OYJ A;  4OPL A;  1PBD A;  3QSM A;  1F6M A;  1OJT A;  1PN0 A;  2DNX A;  1COY A;  2PZS A;  5AQU B;  5HXI A;  4HWD A;  1D0X A;  3IHM A;  2WPC A;  2AAQ A;  4ZI2 D;  1XDO A;  4ISS A;  4EAH A;  3IHR A;  3HKE E;  2I0M A;  3P7I A;  4HWC A;  4Z8X A;  2XFU A;  2Q6U A;  3K8P C;  1DXL A;  3T2K A;  4ADZ A;  3AEF A;  5JDL A;  3UU5 A;  5KRQ A;  1E1H B;  2ES0 A;  3MK7 C;  4WNK A;  2F4V T;  4GK0 E;  5ABF A;  4DUZ T;  1MND A;  3E0Z A;  4X20 E;  3TLV A;  4U2T A;  2GRT A;  2RGJ A;  3V76 A;  2CPT A;  2V8S V;  4O4L E;  2X9X A;  3MAC A;  4FI5 A;  3RHA A;  2MPK A;  2BAC A;  3OZ2 A;  2ZZB A;  3O1I A;  4C5O A;  3QC9 A;  3CKD A;  3G5R A;  4K2X A;  4DV5 T;  3PUZ F;  4Z44 A;  3UU3 A;  2I6H A;  1N34 T;  4PFP A;  3E1T A;  3KV9 A;  4HA6 A;  1G73 A;  2Z5X A;  1BGJ A;  4EIQ A;  3SZC A;  1AR6 4;  1N4U A;  3MA9 A;  5FS8 A;  1WYB A;  2V7M A;  2YR4 A;  2R04 4;  5FXV A;  2XFQ A;  3FI7 A;  4BJY A;  5LG4 A;  3NYF A;  3SZW A;  2XAQ B;  2BBH A;  1HG2 A;  3UKQ A;  2NR4 A;  4B66 A;  1XWM A;  2BRY A;  2VK9 A;  5ABF B;  5HEG A;  4JI6 T;  5JRC A;  3QNU A;  2V6Y A;  4GF7 A;  1CJ2 A;  2XQY A;  4EYU A;  2Q0K A;  1KNZ A;  4OFZ A;  3G06 A;  2WES A;  4DR7 T;  4EED A;  1GER A;  1IUX A;  4X65 T;  4EQS A;  2X0L B;  3DH9 A;  2L9Q A;  3M65 A;  3IEE A;  4U8M A;  2UU9 T;  4LF5 T;  1T98 A;  2WDQ A;  1L9E A;  2UXD T;  5HY5 A;  4A79 A;  3NGC X;  4Y4N A;  4CCQ A;  2CXD A;  5DBJ A;  3OYX A;  5JCI A;  4X9N A;  5AFU L;  1VG9 A;  5AQK B;  1H7C A;  1WR6 A;  3AAE B;  4TWD A;  2C64 A;  2XLT A;  4GK5 E;  2CBI A;  3FBS A;  2XQ4 A;  5FMN A;  1XHZ A;  5FY7 A;  2CWY A;  1XMO T;  3O4X E;  5DJQ C;  3ZMT B;  4NIQ A;  5J1G A;  1N33 T;  2HQM A;  4B1B A;  5U63 A;  3KPK A;  3SX6 A;  3BK9 A;  4ILB A;  1P2H A;  3H4K A;  3Q5E A;  2E9X C;  3JC6 D;  2IW5 B;  1BKW A;  3UUB A;  4Z2U A;  1UK5 A;  1CJ3 A;  2A89 A;  4YTP A;  1RYI A;  2V7I A;  3ZMU B;  4OCG A;  2W0G A;  5HCJ A;  5LG3 A;  3FXD B;  3CX7 B;  2XUE A;  5JR9 C;  4PJL A;  2W67 A;  4Z26 A;  1MXT A;  3ADA B;  2VWA A;  3GQK A;  4QX8 B;  3JC6 C;  5JDQ A;  4KI0 F;  4ZI2 C;  3EAN A;  4HFH A;  3CPZ A;  4QXB B;  2DCF A;  3K7M X;  2EHO B;  3CIR A;  3D0T A;  2X9Y A;  2RGO A;  5KOW A;  2XTL A;  3PUA A;  5EK3 A;  5L3F B;  4H4W A;  4Y4L A;  2IC9 A;  5KMP A;  3PUR A;  2MTQ A;  3AED A;  4OHF A;  1DOD A;  2J3N A;  1E39 A;  2KZ7 B;  3AD9 B;  2XY8 B;  1CJC A;  2R9Z A;  3K3Q C;  4NWZ A;  4UVB B;  4B68 A;  2GK9 A;  2W2U A;  4U2Z A;  5IPY A;  2CA5 A;  5AQG B;  4JV5 T;  2Q9Q B;  5EB4 A;  1S2Y A;  3QK6 A;  2YG6 A;  4WCT A;  1H8T D;  2WP5 A;  3I3L A;  2FJB A;  3MJX A;  4DMV A;  4A99 A;  4NUU A;  4ZHQ E;  4TUY E;  2KND A;  2BK5 A;  4QH5 A;  1SE7 A;  4Z24 A;  3PUW F;  3FXE B;  3KV6 A;  1PBC A;  2Q7V A;  2X68 A;  2BBJ A;  1GT8 A;  2ZZC A;  1GRB A;  3URH A;  1EBD A;  4IL4 A;  3T2Y A;  3LXD A;  4I0U A;  4YSY A;  4ZOL E;  1CUN A;  4U74 A;  3NKZ A;  4H9N C;  4DV4 T;  2R4J A;  4ZCD A;  3KV5 A;  3TLU A;  3GDP A;  1HFA A;  4I58 A;  4GDE A;  2XM1 A;  2ACX A;  5AQP B;  4PAA A;  2V7J A;  3PU3 A;  2XVE A;  3S61 A;  1JU2 A;  4EZ4 A;  5IUX A;  1AR8 4;  1H7X A;  5HEJ A;  5AQF B;  4CBQ A;  4NTC A;  1T8B A;  3CPJ G;  3Q5W A;  2BKO A;  5CJ5 A;  3Q9D A;  4LF7 T;  4EMJ A;  2GMJ A;  4IHJ E;  3FBZ A;  1LVL A;  2Q9Q C;  4NXM T;  1RVF 4;  2BK3 A;  3CQC B;  2WMN A;  2MBG A;  4DV6 T;  1D4E A;  3AEC A;  2VQB A;  1YY5 A;  1K4Q A;  1ZY8 A;  3NH3 X;  5AQI B;  3UKH A;  4P1N A;  3L3P A;  2VKJ A;  3LBX A;  2XLS A;  2WWV A;  3UKF A;  1X9B A;  1N4V A;  3E22 E;  3IC9 A;  1L9D A;  4YY3 T;  3SXI A;  3FZH B;  5A1L A;  4H4Y A;  5EB5 A;  2LT3 A;  3G5Q A;  1XNR T;  2XAH B;  2VL8 A;  1IBL T;  2V6Y B;  2XSA A;  3ONL C;  1SA0 E;  1GTH A;  1FJG T;  2LM9 A;  3AE2 A;  3F8P A;  4WZX A;  4XWR A;  1B7T A;  3SZ0 A;  4UP3 A;  4CXY A;  4NEV A;  3GWD A;  2UXB T;  2X0Y A;  3AYL A;  5BUL A;  1H6V A;  4RG3 A;  3M0O A;  4IE7 A;  4G2A A;  4IVM B;  2KXP B;  5JCK A;  4WBO A;  2W00 A;  4YJ3 E;  3AE5 A;  2KIN B;  2WEU A;  3UU4 A;  3ZSS A;  1DJQ A;  5ADX L;  1S2Q A;  1ZKQ A;  4J56 A;  4B3S T;  1WR0 A;  2QA2 A;  5LYJ E;  2K9A A;  2XAS B;  4KMC A;  3PS9 A;  2QGS A;  2WPF A;  5L3G B;  4H2N A;  3FZK B;  4ZXL A;  2JB3 A;  2OAL A;  4U2Y A;  2VL0 A;  2IDO B;  2YLS A;  2PW9 A;  3ETU A;  1CC2 A;  1K0J A;  4CY8 A;  2ZM2 A;  4PFO A;  5LCY A;  2WBA A;  1XMQ T;  2KWI B;  4HFI A;  3EDV A;  3P1W A;  4U8P A;  4BJN A;  1OWA A;  3L8R A;  4LMK A;  2GV8 A;  3QVP A;  4PAB A;  3CND A;  2JJ9 A;  3N2O A;  4H9Q C;  4DV7 T;  1VRQ B;  3OC4 A;  1FCD A;  2BDE A;  3UTF A;  3GD3 A;  1GQE A;  4HEA A;  4IDP A;  2V3A A;  5L3E B;  3PU8 A;  4H9R C;  2CHN A;  3DTO A;  3EUH A;  3VKG A;  2RAB A;  1U4Q A;  3PUV F;  3N2G E;  4AQF A;  3AB1 A;  3JAF A;  5LA6 E;  1PJ5 A;  3ANW B;  2I59 A;  4YTM A;  3KKJ A;  2YLZ A;  3BI2 A;  3ETV A;  4KHP T;  2WDR A;  3RPU A;  4CI1 B;  1O95 A;  2XPK A;  1KSU A;  3Q2M A;  4IL9 A;  3AE7 A;  3NVO A;  2V26 A;  5FL1 A;  4H7U A;  1O94 A;  4DV0 T;  3TLS A;  3UKP A;  4YSH A;  1BF3 A;  3ZJ1 A;  1KK7 A;  4EMW A;  4IE5 A;  4CY6 A;  2JIW A;  1WRD A;  3X1D A;  1BEV 4;  5KDM C;  3UQ4 A;  3MKD A;  2Y6Q A;  3R6N A;  2RS3 4;  1W09 A;  3FZF B;  4DND A;  3K3N A;  3PJA A;  2JPF A;  2PJQ A;  1IUS A;  3AWI A;  3C4X A;  3CNT A;  1XDP A;  4O2A E;  2Q9Q D;  3N9Q A;  1NHS A;  4QXC B;  2R06 4;  3N9N A;  1Y0P A;  3P50 A;  4YFS A;  3RKO A;  1D0Y A;  3VR9 A;  1TDF A;  3J9X 1;  4JDR A;  1B8S A;  5JR9 B;  5FMH A;  2BXR A;  2WET A;  3P9U A;  2CXF A;  4AOX A;  1HX1 B;  1XHX A;  3HI2 A;  1H84 A;  3AVS A;  1LTX R;  1JEH A;  3OBV E;  2E5L T;  4FX9 A;  3BNU A;  2X8C A;  1Q1R A;  2ZLY A;  3I9W A;  4P0B A;  2YQU A;  1LQU A;  5F5W A;  4L9I A;  2J4G A;  1VCS A;  4ILC A;  4YWO A;  3RF1 A;  3D8X A;  1KNR A;  4GCM A;  1ELI A;  4AQF C;  3GN5 A;  4M1P A;  4UDR A;  2VVN A;  2YKS A;  1QLB A;  5AQS B;  2W66 A;  2KWH A;  1W0B A;  1ZMC A;  1GND A;  3NZP A;  1UGO A;  5M10 A;  2C65 A;  3GYJ A;  2XQ6 A;  5J0Z A;  1UX4 A;  1LVK A;  2E1M A;  3UUX B;  3PUY F;  5LP6 E;  2N2N A;  1JNR A;  2ZM8 A;  1ZMD A;  3UQ7 A;  1RUE 4;  3SOL A;  2BXS A;  4H9O C;  4ADW A;  2A87 A;  2UXC T;  4J33 A;  3JAE A;  2C4C A;  4ILA A;  3ICR A;  5GON E;  3SQP A;  3C4Z A;  4M52 A;  4P9S A;  4O4I E;  2PHH A;  1IBK T;  2VQ7 A;  3RED A;  2XFN A;  3EHZ A;  2PFV A;  3RC3 A;  2UUC T;  5AQH B;  4DBQ A;  3KFW X;  4COF A;  5L3B B;  2YWL A;  3ICT A;  4DO0 A;  4QKN A;  3RYI E;  3BHK A;  3EI0 A;  4CI3 B;  4PK5 A;  1LQT A;  1IUU A;  2YG4 A;  4LF6 T;  2XAF B;  2D2S A;  2BRA A;  2Z5Y A;  3ALJ A;  3EPT A;  4JI3 T;  3GSI A;  5IQ1 A;  1HNW T;  1K0I A;  3L1R A;  2YLT A;  3GN5 B;  3PTR B;  4E0V A;  1ZEE A;  4CN6 A;  3AAA B;  5HCM A;  3NT6 A;  4AKI A;  5KXJ A;  1ZHC A;  4H2P A;  1EZ3 A;  4GKJ T;  1XNQ T;  2WWU A;  5CKU A;  4U31 A;  4H4Q A;  3BNM A;  3L09 A;  3MXZ A;  5EZY E;  5LBQ B;  4TM0 A;  4AP1 A;  2CE7 A;  5LHH B;  4A6N A;  4JBW F;  3NKS A;  4GYR A;  4PW8 A;  4KP3 C;  3ZYX A;  5KMR A;  1R09 4;  4Z2T A;  5JCL A;  2WOV A;  3AEE A;  2C76 A;  1RUC 4;  2LRK A;  1WLX A;  2IHR 1;  4HKA A;  3UKL A;  4G6H A;  1MIV A;  5HEO A;  2WOI A;  1VRB A;  2J62 A;  1VQW A;  5FVK A;  3DGH A;  3SYI A;  3RIU A;  4FK1 A;  3SY4 A;  2OLT A;  2BS2 A;  3OKQ A;  1GXF A;  1Z8U A;  1DOB A;  3KU9 A;  2C5I T;  2C3C A;  4H50 A;  4TN7 B;  4YSZ A;  3VKH A;  4GR1 A;  1IBM T;  2XQ7 A;  1E6E A;  1N4W A;  3Q5D A;  4PJM A;  2BZB A;  2M67 A;  3SS1 A;  3T8O A;  4B67 A;  1WFD A;  2XQ5 A;  4MFR A;  1GRE A;  4Z43 A;  4C74 A;  4JI5 T;  4B3T T;  1SUM B;  3FB2 A;  5HXR A;  2ACZ A;  3CPI G;  4BK2 A;  1MO9 A;  2XVF A;  2M6I A;  5HXH A;  2F5Z A;  3R9U A;  5FS6 A;  2RS1 4;  1IUW A;  1YKJ A;  3QB5 A;  3QFA A;  2ODU A;  5LXT E;  1NA1 D;  5ER0 A;  4H4P A;  5L4H A;  2C7G A;  4AQY T;  4BK1 A;  4JEU B;  5FVL A;  5EOW A;  3HL6 A;  5FY1 A;  4HWH A;  3KV4 A;  4YKF A;  3UOX A;  5DAB A;  4TM1 A;  2OLN A;  3F2E A;  4IT4 A;  5AQJ B;  1T72 A;  3KVB A;  2E9X D;  3ZYL A;  4MAL A;  4JI2 T;  4DV2 T;  2TPR A;  3DA1 A;  2YG3 A;  3DK9 A;  1GTE A;  3UUM A;  5JRE A;  1LVF A;  4IE0 A;  1BR0 A;  2LSG A;  4U8L A;  2VVL A;  4B64 A;  3KD9 A;  1JRX A;  1IAP A;  2NW8 A;  4F6R C;  1K0L A;  4IVO B;  3SGL A;  3RQW A;  2BVM A;  2Q9Q A;  2X8G A;  1YQZ A;  5M4Y A;  5L2L A;  3CVR A;  1PXA A;  4EV6 A;  4XBF B;  1GAL A;  2YK0 A;  2R0P A;  4JY2 A;  1LRZ A;  1RMU 4;  2CLY B;  2XLR A;  5JDM A;  1L0V A;  1JOA A;  4FJO A;  1VBC 4; 
#chains in the Genus database with same CATH homology
 4PAA A;  3UP4 A;  3DME A;  2XVE A;  3S61 A;  3DJJ A;  2QAE A;  1JU2 A;  1NEN A;  3GMC A;  3CTY A;  3DJG X;  3GDN A;  4G6G A;  4B63 A;  2XCG A;  1H7X A;  1NG3 A;  2UZZ A;  4H4Z A;  2R0C A;  1BZL A;  4CBQ A;  3ABV A;  1B4V A;  4NTC A;  3BI5 A;  3CPJ G;  1PXC A;  2B76 A;  4USQ A;  4DSH A;  2W0H A;  2XFP A;  4EMJ A;  4TM3 A;  5TR3 A;  2GMJ A;  4II3 A;  2WHD A;  3PVC A;  3DGZ A;  3UTH A;  1H81 A;  1KSS A;  1FOH A;  1LVL A;  2E4G A;  3LZW A;  5EBK A;  2WQY A;  2CUL A;  4J34 A;  3CGB A;  2BK3 A;  2NPX A;  1D4E A;  3AEC A;  2VQB A;  3AE1 A;  3AYI A;  1YY5 A;  1K4Q A;  2GAH B;  5CQF A;  3K7Q X;  1ZY8 A;  3NH3 X;  2FJD A;  2GQW A;  3UKH A;  1GRG A;  1TDO A;  3M13 A;  2WOW A;  3ALM A;  4I59 A;  1D7L A;  2XLS A;  1XPQ A;  3UKF A;  1JRZ A;  2DKH A;  3RP8 A;  2YAU A;  1N1P A;  4YTN A;  3RP6 A;  2OAM A;  2EQ7 A;  2C3D A;  1N4V A;  2XFO A;  3IC9 A;  1L9D A;  3GQH A;  1BWC A;  3F8R A;  3DK8 A;  2GH5 A;  2YVF A;  3CNJ A;  4J31 A;  1B5Q A;  1FEC A;  3SXI A;  3O0H A;  1CF3 A;  3SUC A;  1D7Y A;  4U8O A;  4H4Y A;  1VG0 A;  2BC0 A;  3UTE A;  2GMH A;  3QSE A;  1KFY A;  2GF3 A;  3LAD A;  5EB5 A;  3G5Q A;  5J7X A;  4B65 A;  3NN0 X;  2V5Z A;  5U25 A;  1XDI A;  5HHF A;  3M12 A;  3P4P A;  2XLP A;  1GTH A;  5FS7 A;  3SM8 A;  3AE2 A;  1B37 A;  3F8P A;  1OJC A;  2GB0 A;  2YLX A;  4XWR A;  3AEB A;  1QJD A;  3QJ4 A;  2YLW A;  4UP3 A;  3SZ0 A;  5KMQ A;  5C3J A;  4NEV A;  3NYC A;  2BCP A;  1PBB A;  1P2E A;  1EL8 A;  3GWD A;  3DJE A;  2I0Z A;  1PBF A;  2WPE A;  5BVA A;  4YKG A;  4NZH A;  1XAN A;  5KWF A;  2R45 A;  5L46 A;  5KNL A;  2DKI A;  3I6D A;  3AYL A;  3IWA A;  2YLR A;  4GAP A;  4K22 A;  4JN9 A;  4YSX A;  5BUL A;  3UCL A;  1H6V A;  4RG3 A;  3AE3 A;  3M0O A;  4IVM B;  1KF6 A;  1JRY A;  3WE0 A;  4IV9 A;  2IVD A;  5JCM A;  2B9W A;  5JCK A;  3NN6 X;  2JK6 A;  4K5S A;  4EM3 A;  3ATR A;  4FDC B;  1GEU A;  2EQ6 A;  3AE5 A;  1LV0 A;  2A8X A;  2GQF A;  2C67 A;  2GEW A;  2WEU A;  4EMI A;  4YT0 A;  4H4V A;  3KPF A;  2B7R A;  2V6O A;  4UDP A;  4A9W A;  4B69 A;  2PYX A;  1TRB A;  1DJQ A;  1EL9 A;  4J36 A;  2E5V A;  1NAA A;  1NHR A;  1S2Q A;  3RNM A;  3UOV A;  3DK4 A;  1D4D A;  1ZKQ A;  1ZOV A;  2GR1 A;  2R0G A;  4J56 A;  3SFD A;  1FL2 A;  3UTG A;  2QA2 A;  5KVI A;  1IUT A;  3AE6 A;  1NEK A;  3V3N A;  2B9X A;  3CGC A;  1GRA A;  3EAO A;  2H89 A;  3AE8 A;  3PS9 A;  1L9C A;  3V3O A;  1PS9 A;  4KX6 A;  2YR6 A;  2WPF A;  2BAB A;  4H2N A;  1OJD A;  4K5R A;  1F8W A;  1ZP0 A;  2WU2 A;  1E7P A;  2GR2 A;  1Y56 A;  2JB3 A;  2OAL A;  2XVI A;  3DJD A;  2X8H A;  1X31 B;  3QFB A;  1PJ6 A;  4AT0 A;  5KMS A;  4AOS A;  2YLS A;  4CCR A;  1CC2 A;  3T0K A;  1K0J A;  4JY3 A;  4CY8 A;  3Q6J A;  3KLJ A;  2WBA A;  3QVR A;  1NHP A;  1UKV G;  1PBE A;  4A6N B;  4REK A;  3P1W A;  3K7T A;  4U8P A;  1GRT A;  1H7W A;  2GV8 A;  2WP6 A;  3QVP A;  4PAB A;  4C77 A;  3CND A;  1PHH A;  1NHQ A;  1REO A;  1H82 A;  1VRQ B;  3T2Z A;  1BGN A;  3NHO X;  4U2S A;  5KOX A;  4DSG A;  2C72 A;  4H4U A;  3D1C A;  2IID A;  3OC4 A;  1FCD A;  1Q9I A;  4TLZ A;  4LII A;  1SEZ A;  3GRS A;  3UTF A;  1D5T A;  3GD3 A;  4BJZ A;  1ZOY A;  3FPZ A;  3CGE A;  1GSN A;  1ZK7 A;  3ALL A;  2YM2 A;  2RGH A;  2V3A A;  1QO8 A;  2YVG A;  1F8S A;  4Z2R A;  2RAB A;  1FEA A;  3CMM A;  4Y4M A;  2TMD A;  2V61 A;  3SZF A;  1GPE A;  1AOG A;  2JB1 A;  4MJW A;  4XXG A;  3AB1 A;  2WP9 A;  4NNJ A;  1PDH A;  3RP7 A;  3ICS A;  1PJ5 A;  5IQ4 A;  1GV4 A;  4YTM A;  2VVL G;  3B3R A;  3C4N A;  3KKJ A;  2YLZ A;  4OPG A;  3BI2 A;  2OA1 A;  4DNA A;  4HB9 A;  1H83 A;  2BK4 A;  2WDR A;  3T37 A;  3C4A A;  4U8J A;  1O95 A;  3NRN A;  3CGD A;  2BCG G;  3GWF A;  4ICY A;  4TM4 A;  3FIM B;  1KSU A;  3C96 A;  5FS9 A;  3AE7 A;  2JAE A;  4H7U A;  2ZZ0 A;  4II2 A;  1O94 A;  2Y6R A;  2YM1 A;  4WX1 A;  1CL0 A;  3Q9T A;  4C3Y A;  2FBW A;  3UKP A;  4YSH A;  1BF3 A;  4USR A;  4EMW A;  3QSS A;  4CY6 A;  3LZX A;  4OPD A;  2VRM A;  4H4S A;  1LPF A;  3AE4 A;  2GVC A;  4U8N A;  4DGK A;  1F8R A;  2Y6Q A;  4RG4 A;  3EF6 A;  1RP0 A;  3NK1 X;  2BS3 A;  5C2T A;  3VRD B;  4BV6 A;  1YQ4 A;  1E1K A;  5BUK A;  3FG2 P;  3T14 A;  3ISH A;  3UP5 A;  4H4T A;  3AWI A;  1IUS A;  4D04 A;  4YXD A;  5KVH A;  3CNT A;  4BUR A;  3CN8 A;  1CBO A;  1NHS A;  3ATQ A;  1Y0P A;  3NIX A;  5JCN A;  1V59 A;  5HYM A;  1TDF A;  3VR9 A;  4LA1 A;  4JDR A;  4OPL A;  1B8S A;  1PBD A;  5FMH A;  2BXR A;  2WET A;  3QSM A;  1F6M A;  4A65 A;  1OJT A;  1PN0 A;  2VVM A;  1COY A;  3FMW A;  3P9U A;  4AOX A;  1CHU A;  1H84 A;  1PXB A;  5HXI A;  4TLX A;  1LTX R;  5U1O A;  3IHM A;  1IJH A;  2WPC A;  1JEH A;  2YG7 A;  4FX9 A;  3BNU A;  2AAQ A;  1VDC A;  2X8C A;  1NG4 A;  1Q1R A;  1CC6 A;  2YQU A;  1EL5 A;  2GR3 A;  4OPC A;  2AQJ A;  4KPR A;  1LQU A;  3LJP A;  1M6I A;  4JNQ A;  2CFY A;  3B6D A;  3VQR A;  2X50 A;  2XFU A;  4OPT A;  3BI4 A;  1DOE A;  1KNP A;  2Q6U A;  1DXL A;  4YWO A;  3T2K A;  4BK3 A;  3D8X A;  1KNR A;  3AEF A;  5KRQ A;  4N9X A;  4GCM A;  1ELI A;  1JNZ A;  4UDR A;  1S3E A;  3AYJ A;  1DNC A;  4J2W A;  1QLB A;  3GD4 A;  3T31 A;  1ZMC A;  1NPX A;  2BC1 A;  1GND A;  2CVJ A;  3K30 A;  4EM4 A;  2APG A;  3IHG A;  5M10 A;  4U2T A;  2GRT A;  2GAG B;  2C65 A;  2RGJ A;  4J57 A;  3V76 A;  3GYJ A;  2VZ2 A;  2AR8 A;  2E1M A;  2IVE A;  3RHA A;  2BAC A;  3OZ2 A;  2ZZB A;  2ZBW A;  4U2L A;  1JNR A;  3VRB A;  4C5O A;  4EQW A;  4APN A;  1ZMD A;  3GRT A;  3G5R A;  3NG7 X;  2C66 A;  2OLO A;  2BXS A;  4X4J A;  4ADW A;  4K2X A;  3H8I A;  2H88 A;  1F3P A;  2A87 A;  4GDP A;  3NK0 X;  1CJ4 A;  4G74 A;  4J33 A;  2BA9 A;  2X99 A;  4EQR A;  4Z44 A;  4AP3 A;  3E1T A;  1E1L A;  2C4C A;  4HA6 A;  3ICR A;  1PJ7 A;  3P4S A;  2Z5X A;  2C73 A;  4RSL A;  1BGJ A;  4EIQ A;  3SZC A;  1NDA A;  1N4U A;  5M0Z A;  3SQP A;  4M52 A;  4P9S A;  4ZCC A;  5FS8 A;  2YR4 A;  1HYU A;  1O5W A;  1W4X A;  2PHH A;  2Q0L A;  1OJA A;  4GUV A;  2XFQ A;  1Y56 B;  3L8K A;  4BJY A;  2VQ7 A;  2QA1 A;  3NYF A;  2BYB A;  3SZW A;  3RED A;  2XFN A;  2ARD A;  1H86 A;  3UKQ A;  2YG5 A;  2YWL A;  3LB8 A;  3ICT A;  3HYW A;  4B66 A;  2BRY A;  5GSN A;  2NVK X;  4U8K A;  4H4X A;  3BHK A;  2CDU A;  4GF7 A;  2XYO A;  1CJ2 A;  1LQT A;  2V60 A;  2Q0K A;  1IUU A;  2X3N A;  2YG4 A;  3S5W A;  3II4 A;  4ECH A;  2WES A;  3NLC A;  1ZDL A;  1GER A;  2B7S A;  1IUX A;  4EQS A;  1TYP A;  1ONF A;  2BRA A;  2XVH A;  3GYX A;  2BS4 A;  3DH9 A;  4OPI A;  4JNA A;  2FJE A;  2Z5Y A;  3ALJ A;  3EPT A;  2QCU A;  4U8M A;  3GSI A;  1DJN A;  5IQ1 A;  4AT2 A;  3HYX A;  4X9M A;  4H2Q A;  1K0I A;  3L1R A;  3AE9 A;  2YLT A;  2EQ8 A;  4GAV A;  2C75 A;  2WDQ A;  3COX A;  4E0V A;  1L9E A;  5HY5 A;  4U8I A;  4A79 A;  5LV9 A;  3NT6 A;  1EL7 A;  3NGC X;  3NK2 X;  4Y4N A;  4CCQ A;  5KXJ A;  1S3B A;  2JB2 A;  5DBJ A;  3CPH G;  2WS3 A;  3AD7 B;  5JCI A;  4H2P A;  1TDE A;  4X9N A;  1VG9 A;  2EQ9 A;  2XLT A;  2C64 A;  5CKU A;  3SFE A;  3VR8 A;  2B9Y A;  1GET A;  4O5Q A;  2YR5 A;  3FBS A;  4H4Q A;  4NEW A;  3BNM A;  2JBV A;  4TM0 A;  4AP1 A;  5BRT A;  4NTE A;  4A6N A;  3NKS A;  4H2R A;  2VOU A;  3ZYX A;  5KMR A;  3G5S A;  3P4R A;  4Z2T A;  3NTD A;  4D03 A;  2HQM A;  5JCL A;  4IA5 A;  2WOV A;  3UKK A;  5U63 A;  4B1B A;  1M64 A;  2O9Z A;  1OJ9 A;  3KPK A;  3SX6 A;  3AEE A;  1GOS A;  1XHC A;  2C76 A;  3CNS A;  1P2H A;  4G73 A;  3H4K A;  2XDO A;  3UKL A;  4G6H A;  1BKW A;  2WOI A;  4Z25 A;  4Z2U A;  2V3B A;  1CJ3 A;  2A89 A;  4YTP A;  3UOZ A;  1RYI A;  4OCG A;  2WU5 A;  1VQW A;  3DGH A;  3SYI A;  4FK1 A;  3SY4 A;  4A5L A;  5GRT A;  2BS2 A;  1ZX9 A;  1GXF A;  3HZL A;  1DOB A;  1GES A;  3KU9 A;  2C3C A;  4Z26 A;  4FK1 C;  3AEA A;  1MXT A;  4YSZ A;  1GRF A;  3ADA B;  3KA7 A;  4H50 A;  4NTD A;  3GQK A;  2YVJ A;  4C3X A;  1Q1W A;  4GR1 A;  4XWZ A;  1E6E A;  1N4W A;  3EAN A;  3IF9 A;  4GRT A;  4B67 A;  1TYT A;  1GRH A;  4K7Z A;  1GRE A;  1LJ1 A;  3K7M X;  4Z43 A;  4C74 A;  3CIR A;  2RGO A;  5KOW A;  4OPU A;  4CNK A;  2XVJ A;  3UOY A;  2ACZ A;  3LOV A;  4A7A A;  3VRA A;  3P4Q A;  1TDN A;  1MO9 A;  3CPI G;  4H4W A;  4Y4L A;  4BK2 A;  2XVF A;  4IA6 A;  5KMP A;  4EIP A;  2R46 A;  4OVI A;  2F5Z A;  3AD8 B;  3AED A;  4LU6 A;  3F8D A;  1IUW A;  5FS6 A;  3R9U A;  1YKJ A;  1DOD A;  3HYV A;  2J3N A;  1E39 A;  4CNJ A;  3AD9 B;  3H8L A;  3QFA A;  1CJC A;  2R9Z A;  4NWZ A;  4H4P A;  1DOC A;  5ER0 A;  2C7G A;  3ITJ A;  2JKC A;  4B68 A;  4ZN0 A;  3PO7 A;  4BK1 A;  1YQ3 A;  5EOW A;  2C70 A;  3AEG A;  3GMB A;  4H4R A;  5IPY A;  1FEB A;  4YKF A;  5EB4 A;  1S2Y A;  3UKA A;  3UOX A;  2YG6 A;  1RSG A;  4TM1 A;  2OLN A;  4WCT A;  2VRL A;  4CRT A;  2WP5 A;  3I3L A;  2FJB A;  4A99 A;  1E1M A;  3CNP A;  2BK5 A;  1Z6L A;  4Z24 A;  2TPR A;  3DA1 A;  1PBC A;  4UDQ A;  2Q7V A;  4O5U A;  3NYE A;  2LFC A;  1D4C A;  2YG3 A;  3DK9 A;  1GT8 A;  2ZZC A;  4K8D A;  1GTE A;  2WDV A;  1MOK A;  1GRB A;  2R4E A;  3BHF A;  4G9K A;  3URH A;  1EBD A;  3NNE A;  4U8L A;  2VVL A;  3T2Y A;  4B64 A;  2GR0 A;  3KD9 A;  1JRX A;  3LXD A;  4EQX A;  1K0L A;  4YSY A;  4IVO B;  3SGL A;  2X8G A;  1YQZ A;  1CC4 A;  3AXB A;  2R4J A;  4ZCD A;  1E1N A;  1PXA A;  2FJA A;  1GAL A;  2R0P A;  3KVE A;  4JY2 A;  2XLU A;  3GDP A;  3GYI A;  1TDK A;  4I58 A;  4GDE A;  2XLR A;  1IUV A;  3NTA A;  1L0V A;  5J60 A;  3JSK A;  1JOA A;  4JQ9 A;  1KDG A;  3ZDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...