4YT0A

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 209
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4yt0A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4yt0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4yt0A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4yt0A04
3UOZA 2UZZA 3P4SA 1GESA 2BS2A 1BGJA 2I0ZA 2XFPA 3M12A 2YM1A 4CNKA 2W0HA 4JNQA 3VR9A 3ISHA 2GVCA 1GRAA 5BVAA 1IUWA 1KF6A 4K22A 3AEFA 2XVJA 4JN9A 3EAOA 2Z5XA 4U8KA 1GRBA 5FS9A 3G5RA 2XVFA 5CQFA 4OPDA 4AT2A 3QSMA 3GMBA 4UDPA 1JRXA 2H88A 3AE2A 5KVIA 3UCLA 4NTEA 2CFYA 3AEAA 1K4QA 1SEZA 2YG7A 1JOAA 4EIPA 3P9UA 1JEHA 4TM0A 1NHPA 1IUTA 4B1BA 4BJYA 5TR3A 3S5WA 2C75A 1N1PA 2WDRA 3KKJA 4NZHA 1ZP0A 5JCKA 3AE3A 4BV6A 1TDKA 4B69A 2C72A 3CGDA 2QAEA 4AOSA 3AECA 3UOVA 2C66A 3ITJA 1DOEA 3ZDNA 1CF3A 4GR1A 2GR2A 3UOXA 4H4ZA 1COYA 4Z43A 2WQYA 3NTAA 4E0VA 4ZN0A 4B66A 2FJDA 3UTFA 1GRHA 2GR1A 2VRLA 3NIXA 2YR5A 3WE0A 4AP1A 1GSNA 4CRTA 3IHGA 3CGEA 1O94A 1ZKQA 1DOCA 4A5LA 2OA1A 2YG3A 4Z2RA 1FEAA 3AE9A 2YLTA 3QSSA 4X9NA 5JCLA 3DJDA 3SFEA 5FMHA 2WP9A 4ECHA 3NNEA 2WDQA 1EL9A 2YG5A 3JSKA 4EMWA 3GYXA 5KWFA 3HZLA 1Y56B 3KLJA 2XLPA 3AE6A 1KNRA 1DJQA 1GTEA 3AD7B 4TLZA 1EL8A 2R4JA 2GAGB 2WP5A 3DJJA 3LOVA 4CCQA 4H7UA 1OJCA 2Y6QA 1KDGA 3GQKA 3AE1A 2GEWA 1LQUA 4PABA 2GH5A 4YKGA 2R0GA 1LPFA 4H2NA 4B63A 3NYCA 1O95A 3D1CA 4RG3A 2VQ7A 2BXRA 4Z2TA 3DK8A 3AXBA 4APNA 2GF3A 4UDQA 2AQJA 1Q9IA 2YR4A 3GRSA 1JNZA 1BWCA 4C74A 1ZOYA 4U8NA 3FBSA 4CBQA 2XFQA 3RP7A 2WESA 1F8RA 2APGA 2OAMA 3FMWA 5KVHA 4DSHA 2VOUA 2BYBA 5KRQA 1CHUA 3DMEA 2Q0KA 3UTEA 1D5TA 4X9MA 1KSSA 3AEEA 2EQ8A 1JU2A 1YQZA 5U1OA 2VQBA 3SM8A 3AYLA 4EM4A 5GSNA 4OPCA 4KX6A 1FOHA 2AAQA 2NVKX 1JNRA 1P2EA 1N4WA 3SUCA 3AD8B 2BABA 1Y0PA 2GV8A 1S2QA 2GMHA 2A8XA 3GD4A 1ZMCA 4IVOB 4YWOA 1L9CA 4BJZA 1MOKA 4FK1A 3GDPA 5IQ4A 1GV4A 3PO7A 2BCPA 3EPTA 2XLUA 2DKIA 3GDNA 1N4UA 1TYPA 5EB4A 3LZXA 3OC4A 1CBOA 1GTHA 4N9XA 2BA9A 2GQWA 1PBBA 3B3RA 1PBEA 3DJGX 2YLZA 4A99A 3UKPA 2CULA 2OALA 4JDRA 5U63A 2C70A 4J57A 4GF7A 1NHSA 4WX1A 5KOXA 3GYIA 4WCTA 1GREA 4EQSA 4JQ9A 1B8SA 1ZDLA 2YWLA 3ICTA 1LQTA 3ZYXA 4O5QA 3AEDA 1BZLA 2BC1A 2V6OA 3QSEA 1IUVA 3ALMA 1D4DA 3EANA 3NLCA 3PVCA 4K5SA 1KFYA 2XVEA 4Z2UA 4Z26A 4TM1A 4YTNA 3V3NA 3G5QA 1X31B 2JB3A 4M52A 5HY5A 1GT8A 2WOWA 4UDRA 4C3YA 1QJDA 2BK5A 3CPHG 1RP0A 3SQPA 1JRYA 1H86A 2CDUA 4NTDA 4H2QA 1F8SA 4JY3A 3PS9A 1NHQA 2QCUA 2XYOA 2X8HA 4K8DA 2GB0A 1BGNA 5IQ1A 4K7ZA 2IIDA 3GRTA 4H4UA 3LADA 3AYIA 1M6IA 3H8IA 1L0VA 3KVEA 4DNAA 2E1MA 3IHMA 1RYIA 1K0LA 2WU2A 5BULA 3AB1A 2E5VA 3CTYA 1NPXA 1GEUA 3LJPA 4HA6A 4H4SA 4D04A 2ACZA 3D8XA 1CJ4A 3UTGA 2WPCA 2OLOA 2LFCA 1KNPA 1CJCA 1GOSA 3F8PA 4X4JA 4A79A 2V3AA 4A7AA 4Z44A 1ZOVA 2EQ7A 2JKCA 3ATRA 4USQA 4B64A 2Z5YA 2BK4A 2VVLG 2WPEA 3RP6A 5M10A 2O9ZA 4ICYA 5C2TA 2WOIA 4H4RA 1NG4A 3RNMA 4EQRA 5M0ZA 1GERA 1ZK7A 2FJEA 3CGBA 1TYTA 4BK1A 4A6NA 4YXDA 4U8PA 1YY5A 4K5RA 2BC0A 2B76A 3NGCX 3UKHA 4DSGA 2YG4A 3REDA 1ONFA 1PBFA 2YLRA 1MXTA 2C73A 2WETA 3ICSA 4U8MA 1H6VA 5JCMA 3KD9A 5EOWA 3DA1A 2RGJA 4NTCA 2YM2A 4Y4MA 2WOVA 1OJDA 5BUKA 3NT6A 3GWFA 1E39A 1GALA 4J31A 4AOXA 2YLWA 2XVHA 4H4YA 4YSZA 4H4QA 1B37A 1FECA 1DJNA 1H84A 2GRTA 2ZBWA 2X3NA 3AEBA 1BF3A 4GCMA 1K0JA 4U8IA 4KPRA 3O0HA 4A65A 5FS7A 4H50A 3CGCA 2ARDA 3VRAA 2B9XA 2Q6UA 4TM4A 2BACA 3R9UA 3UP4A 5BRTA 3CN8A 5JCNA 2XLRA 1F8WA 1VG9A 4U8OA 4J33A 1N4VA 2Y6RA 2R9ZA 2WS3A 2ZZ0A 1EL7A 1PXAA 3H8LA 4FX9A 4CNJA 3NN0X 4CCRA 2JB1A 4NEWA 4B67A 3UKQA 2YLXA 3GSIA 5U25A 1PXBA 4OVIA 3UOYA 1B4VA 2A89A 4DGKA 1S2YA 1CC6A 3VRDB 4J2WA 1W4XA 3UP5A 4EMIA 2GQFA 4JNAA 3NH3X 3AE7A 2QA2A 3II4A 5KOWA 2B7RA 2VVMA 1H83A 1HYUA 1VDCA 3C96A 3LXDA 2V3BA 1XPQA 1ELIA 2X8GA 4FK1C 3RP8A 1H82A 4EM3A 3ALLA 2VVLA 2JK6A 3K30A 4EIQA 5JCIA 3I6DA 1ZY8A 4J56A 1VQWA 2ZZBA 3GWDA 2X50A 3C4NA 2C7GA 5HYMA 4PAAA 2BS3A 1XANA 4AP3A 5J60A 4H4VA 1TDFA 2Q7VA 2YAUA 1L9DA 4K2XA 3GD3A 4OPGA 4EQXA 1NDAA 2R0PA 3DGZA 2H89A 3DK4A 4GRTA 1QLBA 3QFBA 3K7MX 4I59A 4OPTA 4BK2A 1VRQB 2WHDA 1S3EA 1EL5A 1NHRA 5CKUA 2BS4A 4Y4NA 5FS6A 4OCGA 4A9WA 2PHHA 4LIIA 3UKFA 1D7YA 1XDIA 4I58A 4CY8A 2C64A 4YSYA 2EQ6A 2R0CA 4TM3A 1GRFA 4GDEA 2GMJA 1TDNA 3NTDA 3LZWA 1V59A 4C5OA 1H7WA 4Z25A 4XWZA 4NEVA 2TPRA 4BURA 4OPIA 1OJAA 3CNTA 2E4GA 4AT0A 3NKSA 2XVIA 3M13A 3K7QX 3GMCA 4IA5A 4B68A 3V3OA 3P4QA 2GR3A 3COXA 4C3XA 1IUXA 3BI2A 1RSGA 2WP6A 4IV9A 3OZ2A 2R4EA 4J36A 1PBCA 3CNDA 3S61A 1FEBA 3KU9A 3AYJA 1XHCA 1CC4A 3QVPA 5EB5A 3IC9A 2WU5A 4GDPA 1NENA 1D4CA 4YSHA 1IUUA 2YG6A 3ALJA 3CNPA 4RSLA 1FCDA 3DH9A 3E1TA 3F8RA 3C4AA 2YVJA 1E1LA 3P4RA 3DJEA 4U2TA 3SGLA 3GYJA 2RGHA 4ZCCA 4TLXA 2AR8A 3FPZA 5HXIA 1AOGA 2R46A 3I3LA 2OLNA 3IF9A 4JY2A 5IPYA 3L1RA 2V61A 1IUSA 2F5ZA 2XCGA 2DKHA 1DXLA 3BNMA 3M0OA 4H2RA 2B9YA 4U8LA 1DODA 3LB8A 1NG3A 3Q6JA 3QVRA 2J3NA 3AD9B 5EBKA 1FL2A 1JRZA 2C76A 3CPJG 1LJ1A 2YVGA 1OJTA 3NK1X 4YSXA 2BCGG 4XWRA 4LU6A 5HHFA 1S3BA 1H81A 2HQMA 2XDOA 1GRGA 2YQUA 3AEGA 2PYXA 2R45A 2X99A 1LVLA 1UKVG 4J34A 4C77A 1OJ9A 1F6MA 3BI5A 4MJWA 3CNJA 2XFUA 1PS9A 1KSUA 4YKFA 1PHHA 1PN0A 4O5UA 4Z24A 3UKKA 2JB2A 3BNUA 2XLTA 1QO8A 3K7TA 1E1NA 1TDOA 1TRBA 2WBAA 2XLSA 4BK3A 2C3DA 3AE8A 2BK3A 2V60A 4P9SA 1NEKA 1YKJA 1ZX9A 1LTXR 4IA6A 3NYFA 4XXGA 4YTPA 3KPFA 5FS8A 3GQHA 3AE5A 3G5SA 5L46A 1NAAA 3CPIG 4H2PA 2WDVA 4GUVA 1B5QA 2B7SA 2B9WA 1P2HA 3BHFA 2C3CA 1Q1RA 4HB9A 4Y4LA 2C65A 3FG2P 3QJ4A 1D4EA 1YQ3A 2X8CA 3UTHA 3VRBA 4REKA 4LA1A 1E7PA 1DOBA 1LV0A 1EBDA 3ICRA 2IVDA 4CY6A 2JAEA 2Q0LA 3NYEA 2IVEA 2ZZCA 2RGOA 3ATQA 3ADAB 1F3PA 5DBJA 3L8KA 1BKWA 2EQ9A 4OPUA 3RHAA 3NK2X 2FJBA 2XFOA 4B65A 4U2SA 1CL0A 1K0IA 1IJHA 1PJ7A 1O5WA 3BHKA 3FIMB 2GR0A 3AE4A 2WPFA 3NHOX 5ER0A 3V76A 2V5ZA 2RABA 5KXJA 3P1WA 2NPXA 4OPLA 3NRNA 2JBVA 2QA1A 1DNCA 1PBDA 3T37A 1GRTA 1TDEA 3B6DA 3KA7A 2YR6A 3CNSA 5LV9A 1E1KA 1L9EA 4IVMB 3VR8A 2CVJA 2VRMA 1Q1WA 3URHA 1CC2A 4ZCDA 3DGHA 1CJ3A 1PDHA 1GPEA 1CJ2A 2C67A 2TMDA 2A87A 4U8JA 4D03A 1Y56A 2FJAA 1YQ4A 4YTMA 3UKLA 4ADWA 1E1MA 2WEUA 1REOA 1M64A 4A6NB 4H4WA 1E6EA 1GXFA 3BI4A 4U2LA 3IWAA 2FBWA 3CIRA 1D7LA 3F8DA 2BXSA 3NN6X 3NK0X 4H4TA 4RG4A 5J7XA 3SFDA 1PXCA 1VG0A 5GRTA 3Q9TA 1GNDA 4H4PA 2VZ2A 3EF6A 4UP3A 4FDCB 4USRA 4EQWA 1H7XA 3UKAA 4YT0A 3H4KA 1MO9A 5C3JA 1Z6LA 3AWIA 3DK9A 1PJ6A 3P4PA 1ZMDA 2YVFA 3QFAA 2XFNA 4EMJA 1GETA 2GAHB 3NG7X 4H4XA 3VQRA 2YLSA 3ABVA 1PJ5A
chains in the Genus database with same CATH superfamily
5AQRB 3ZYMA 3UOZA 2UZZA 1GESA 2XFPA 3M12A 2BBHA 4CNKA 3ISHA 2GVCA 2L8KA 4LF9T 2J62A 3AEFA 4H9OC 3J8F4 2NW8A 2ES0A 2KINB 5A1LA 4IHJE 3GN5B 4HN9A 3NVOA 4C91A 2E5LT 1JRXA 3VKGA 5IWAT 3IHRA 3HKDE 3HYXA 2CFYA 2WY2A 1SEZA 4TM0A 4DR6T 3H3MA 1IUTA 4I4TE 5TR3A 2C75A 4EIWA 2LKGA 4ILBA 5BMVE 3ZMUB 5KMQA 1D1CA 2C72A 1CUNA 2QAEA 3L39A 3AECA 3UUNA 3UOVA 1CF3A 4PJLA 2XM1A 2GR2A 2K48A 4K0KT 3ZSSA 2RP4A 5LCYA 4Z43A 4DV2T 1DU2A 4B66A 2FJDA 3UTFA 4G6GA 3WE0A 1DOCA 3AA7B 2OA1A 1FEAA 5JCLA 4X1IE 2MPKA 3DJDA 3ZEFB 4H9QC 4HWHA 2YG5A 4EMWA 4X62T 4QH1A 2XLPA 3Q5WA 1XMOT 3AD7B 2CBJA 2IHR1 2WP5A 4CCQA 2Y6QA 4MFRA 3KV5A 1LQUA 2R0GA 4H2NA 1IJ6A 1UGOA 2BRYA 3NYCA 2BXRA 4FI5A 4PK6A 3OKQA 1HRI4 2AQJA 5LHGB 4I43B 2YEVC 4QXHB 4C90A 4U8NA 3EDVA 1F8RA 3RRWA 4DSHA 2BYBA 5LG3A 5KRQA 2Q0KA 1D5TA 2W62A 4X9MA 3H3AA 2EQ8A 2KZ7B 2OLTA 2PYJA 2W2UA 3PUZF 5AQHB 1MNEA 2CXFA 2NVKX 1BR1A 3N9LA 2VQET 4EYYR 3SUCA 1W0BA 5CJ5A 3PJAJ 2A8XA 4YWOA 1MOKA 2CCQA 5F5WA 3HKEE 2N9DA 2UXCT 3EPTA 4PK5A 2DKIA 3GDNA 3I0QA 5LJNA 3EAMA 1AJ3A 1PBEA 2LOPA 4X65T 2C70A 5KMGP 5JTGA 4HWCA 4EEBA 1RUG4 3RI5A 3ICTA 4AXPA 5F3JA 4B3ST 3LBXB 3T1YT 1LQTA 1HTJF 2PTFA 4O5QA 3AEDA 4CXXA 2HH7A 3LK42 4K5SA 3M3ZB 4Z2UA 1IJ5A 4AKIA 4LF6T 4Q25A 1GT8A 4ZZCA 4C3YA 4IDZA 2JJ9A 3EI0A 1XDPA 2CXDA 3CQCB 4H2QA 3PS9A 4ASKA 2KSRA 2QCUA 2XYOA 1BGNA 3QNUA 2IIDA 4H4UA 3RF1A 1RYIA 4P0BA 3ZYLA 2Y6XA 1FMWA 1RUI4 3T0KA 4OYKA 2RPAA 1AR64 3PDYA 2ACZA 5L3FB 3UTGA 3OYZA 2JKCA 2DI4A 1D0XA 2Z5YA 5HCJA 1NCQD 4ILCA 4AQYT 1XNQT 2XQ4A 2JQKA 5GONE 2UXNB 4ICYA 3ZMVB 2XQ7A 3RNMA 5M0ZA 4EQRA 5FY1A 2FJEA 5LMUT 1ASJ4 1YY5A 4K5RA 2BC0A 2B76A 3UKHA 4AQFA 3IEEA 1PBFA 1MXTA 2WETA 4OX9T 2CHOA 3AXJA 1VOMA 2V8SV 1M62A 2VKHA 5LJMA 4NTCA 4PNIA 3IF8B 2YM2A 4AOXA 3AB3B 4YSZA 2BG9B 4QKNA 2X3NA 4ILAA 4GCMA 1K0JA 2XQ8A 3SOLA 4A65A 2PYLA 5LXTE 4H50A 4RHV4 3UP4A 2BACA 1F8WA 2Y6RA 2WS3A 1EL7A 4FX9A 4H63V 3NN0X 4CCRA 3B13A 5FVLA 1RMU4 3OYXA 2YLXA 2Q9QC 4HEAA 4OVIA 3UOYA 2LHNA 3GMIA 4DGKA 1S2YA 1FMVA 2H7VC 3VRDB 3IA3A 1NWMX 4EMIA 4QH5A 5IYZE 4ISTA 3AE7A 2QA2A 3II4A 2MTQA 2VVMA 3C96A 2V3BA 2X8GA 4FK1C 4GAPA 4IIJE 1H82A 2KT9A 3NZQA 5CA0E 4UVCB 3N9MA 3I6DA 2KWHA 3GWHA 2VK9A 4NNJA 2KLQA 2XASB 3BK9A 3GWDA 5JDLA 3C4NA 4DBRA 4AP3A 4UV8B 3ZLIA 3F2EA 1TDFA 4IE6A 4EQXA 4L5GA 3DGZA 1OWAA 2W66A 4QWNB 4QX7B 2C5JA 4BK2A 2BS4A 5FS6A 2A72A 2PHHA 3QC9A 4LIIA 1D7YA 1XDIA 2VKJA 4N78D 1H8TD 1TDNA 2QYWA 4BA9A 1HF8A 1NA1D 1YKEB 3ZMZB 2J47A 4OPIA 2E4GA 4ILUA 3RRCA 4O4JE 3K7QX 2XQ9A 5AQJB 4CXWA 2GR3A 3COXA 4C3XA 1RSGA 4IV9A 2VURA 2R064 4TWFA 3X1DA 3EUHA 2R4EA 4J36A 5LGNB 3S61A 1XNRT 1FEBA 5AQMB 4GDPA 3DP7A 5BR8T 5JDGA 1IUUA 3ALJA 5AQTB 4TV9E 4COFA 4RSLA 3O1JA 2LRKA 3AVRA 4V1Av 1FCDA 3DH9A 5KMRA 2ZM8A 3CKDA 3C4AA 4TLXA 2R46A 4U31A 2OLNA 2IUBA 2WB5A 2H3RA 2OA5A 3PUWF 4L0RA 4EYUA 4PJJA 3R84B 3ETVA 2DKHA 1DXLA 4H2RA 3JD74 3UUXB 4JLEA 2UUCT 2XZEA 3CPJG 3B57A 3CMMA 2YVGA 1OJTA 3NK1X 5KDMC 4LU6A 2MOZA 1H81A 2HQMA 3TLVA 3DTOA 2C0SA 3ZKRA 3CPZA 4C77A 1I94T 1J5WA 3I9WA 1PS9A 3TKLB 1KSUA 1PHHA 3KBUA 1PN0A 1EAH4 3UKKA 4JI7T 4BJMA 4TNVA 2XLTA 4O4HE 4DVDA 1TDOA 4GOUA 1VBD4 3R6NA 3U78A 2V7LA 3AE8A 4HFDA 2BK3A 1NEKA 3ZJ1A 2ODUA 2E9XC 2HPJA 1LVKA 4YTPA 4XXGA 5FS8A 1SUMB 4H2PA 2XPKA 4P09A 3SYIA 1MMNA 2B9WA 1P2HA 3BHFA 4HB9A 4PFOA 3FG2P 3QJ4A 4L9IA 1YQ3A 2X8CA 2CMRA 3UTHA 3VRBA 1E7PA 3LFMA 1DOBA 3TLUA 4ISSA 2Q0LA 3PUVF 2IVEA 3ZJ2A 5DBJA 4JI6T 3T14A 2I59A 4MLKA 1PJ7A 3AE4A 4B3MT 2WPFA 3V76A 5ER0A 2V5ZA 2NPXA 4OPLA 3NRNA 1DNCA 1PBDA 5HWXA 2XSBA 1UX4A 3ZT5A 1G73A 4IVMB 2CVJA 1CC2A 1GPEA 2WMNA 2C67A 2A87A 4U8JA 4HFBA 1YQ4A 3B5MA 5JDFA 1QSDA 3BQKA 5L3GB 4JBWF 4H4WA 2DCFA 5AQOB 1E6EA 3V5UA 1GXFA 2ZMAA 4KHPT 3BI4A 3IWAA 4WW0A 1UK5A 3NN6X 1XHZA 4RG4A 3AXJB 1VG0A 1GNDA 1J1JA 2ZM2A 3EF6A 4H4PA 4EQWA 1H7XA 2KWIB 5LYJE 3P4PA 4HWFA 5M4YA 4IREA 3NG7X 4H4XA 3VQRA 2YLSA 4O2BE 4FJOA 2XAQB 2IMLA 4DUYT 2K9AA 1RUF4 2XJ7A 2WZHA 4I0UA 3PUYF 3Q5XA 5BVAA 1KF6A 3OJAA 2UUAT 5FS9A 2LM2A 3G5RA 3UU8A 2RS14 4IGUA 1EV14 3QSMA 2H88A 2PFVA 2X9XA 5KVIA 4NTEA 2GK9A 1X79A 1SE7A 1MMAA 1K5MD 3CQXC 4EIPA 1JEHA 1NHPA 3SZFA 2L9QA 2XUEA 1N1PA 3JAFA 4NZHA 4KI0F 4NPPA 4AOSA 3ITJA 3ZDNA 5J1GA 4ZS2A 4GR1A 3UOXA 4H4ZA 3CMLA 2WQYA 4ZN0A 2UU9T 4A5XA 3NIXA 4AP1A 2V7IA 3CGEA 1ZKQA 3SWHA 3SZ0A 4ECHA 2D5UA 3RX6A 4GKKT 2XQ6A 1OEDC 3JC6D 3HZLA 3KLJA 4GIWA 4TWDA 3AE6A 3LOVA 4H7UA 5FXZA 4PABA 4U7YA 2GH5A 2PJQA 2XM2A 4YKGA 2V7JA 1O95A 2W61A 3KV9A 2ZM6T 2VQ7A 4APNA 3GRSA 1HNXT 1IAPA 3FZMB 4CBQA 3HL6A 2I6HA 2SPCA 3L3PA 2APGA 2OAMA 3E0ZA 2VOUA 2IAKA 4MBQA 4CZZB 3UTEA 1XWMA 2CE7A 5U1OA 3SM8A 4GYSA 5GSNA 1QUUA 4KX6A 2AXDS 2UXXB 4U33A 4BJNA 1Z7S4 2R6GF 2BABA 2GV8A 4IL9A 1L9CA 3GDPA 4ZI2D 1N34T 3MK7C 1HG5A 1RUH4 4A97A 1N4UA 2EHOD 4IDOA 3LZXA 3PU3A 4U3CA 3EABA 5LGTB 2CULA 2CXLA 3RIAA 3L09A 2YOEA 2J1DG 5JDMA 3GYIA 1GREA 4EQSA 4CN1A 4B6XA 1ZDLA 5LG4A 3ZC0A 3ZYXA 1M7KA 4U7IA 1IUVA 3PVCA 2YDQA 2XVEA 2X5ID 4TM1A 5IHYA 2JB3A 1XI1A 4TV8E 4M52A 3W15B 2WAUA 2WOWA 4UDRA 1QJDA 5LHHB 3MXZA 4B3RT 4A56A 2EHOA 1H86A 1MIVA 3ZT6A 4NTDA 1NHQA 2X8HA 4CN4A 3NWIA 3GRTA 2YU1A 1M6IA 1L0VA 2E1MA 4I50E 1K0LA 2OV9A 5BULA 2X66A 3KFWX 5L2LA 5CGMA 1NPXA 2YK0A 4D04A 3EDUA 3D8XA 1CJ4A 5AQVB 4JUYA 1KNPA 1CJCA 1GOSA 4X4JA 4A79A 1VCTA 2EQ7A 4USQA 2V6YA 4YFSA 4QXCB 1HNWT 5M10A 2JQHA 3P8CD 3SZCA 1GERA 3ZCJA 5HXEA 3CGBA 4A6NA 2XAGB 3UU3A 3NGCX 2K24A 2Q9QB 2JMHA 1RUE4 3WI3A 4U8MA 5AQUB 3KD9A 2R044 2NTXA 3CX8B 3ESLA 3AAAB 4HFEA 1FIOA 2XQ5A 4H9NC 3ZSTA 5JVDE 3AAIA 4X64T 2XAHB 2D2SA 2V1DB 2XVHA 2VASA 3PUGA 5FP3A 1B37A 1DJNA 2GRTA 2EX3A 5KMPA 4U8IA 1BR0A 5FS7A 5AQSB 2ARDA 3VRAA 2B9XA 4ADZA 4DR7T 4PDWD 4DUZT 2XLRA 1VG9A 3CK6A 4U8OA 4J33A 4G74A 5JR9A 2XQYA 5IUXA 2VQFT 1I6ZA 1N4VA 2R9ZA 2ZZ0A 2A2FX 3O4XE 3G06A 3UQ7A 2JB1A 4NEWA 4X5TA 3GSIA 5LBQB 3FXDB 4JI5T 1PO14 4BAYB 3UP5A 2GQFA 4JNAA 5KOWA 2B7RA 1H83A 2NW9A 4KMCA 3ALLA 3EHZA 5FXVA 2WWVA 2B1EA 3C98B 4J56A 1VQWA 5DQWA 4TN7B 2X50A 2C7GA 3RPUA 4PAAA 2H7OA 3RIFA 2YAUA 2QVAA 3MJXA 4K2XA 4PJMA 4DV0T 2R0PA 3K1SA 1HFAA 4CI1B 3WAJA 4I59A 1QLBA 3FHNA 1VRQB 2WHDA 3RIUC 4P1NA 4Y4NA 4OCGA 4G6HA 1N33T 3P50A 2EQ6A 4DV6T 3UU4A 2GMJA 1S94A 4C5OA 3LG7A 2LEHA 3BQIA 4BURA 3C51A 3JADA 4PK4A 3RKGA 3V5SA 4IA5A 3C50A 3P4QA 3KVAA 2CWOA 3DJBA 4TZ4C 2W00A 1LRZA 4OYJA 1PBCA 5FY0A 1WRDA 3AYJA 3QVPA 2WU5A 1D4CA 3CNPA 2NR4A 3E1TA 4TWHA 3P4RA 3CQGB 3GYJA 1AR84 2E2AA 3FPZA 5HXIA 5HXCA 1AOGA 3I3LA 4UV9B 2E9XB 2UXBT 2F5ZA 5LB7B 2XCGA 4ZI3C 1FEWA 2MBGA 3BNMA 5LHIB 2B9YA 3LB8A 5KNLA 2C76A 3J9X1 2C5IT 4YSXA 2BCGG 4XWRA 3AA0B 3AEGA 2FUPA 2X99A 4J34A 4MJWA 4YKFA 2XFUA 4Q4Y4 3NZPA 4Z24A 2JB2A 1HNZT 4IDPA 1QO8A 5CFBA 1HCIA 1E1NA 4YY3T 1TRBA 4LFBT 2XLSA 2V60A 5KX5E 1YKJA 3KPFA 3G5SA 2WDVA 4Q4W4 4M1PA 2C3CA 4JEHB 1Y01A 2VB6A 2JAEA 3ADAB 2EHOB 3P7IA 3AA6B 3L8KA 4OPUA 3RHAA 3NK2X 1U5PA 4NXMT 4B65A 1K0IA 3BHKA 1O5WA 3FIMB 3FZHB 3ZMSB 4UELA 4GK5E 3NHOX 1BEV4 4U72A 2JBVA 2JMKA 4MALA 1L9EA 3VR8A 2BKOA 1Q1WA 2X0LB 4F8HA 1CJ2A 1OEDE 4GB34 3C4WA 2V6YB 4DV7T 2N2NA 2HPLA 5HYAA 3UKLA 4ADWA 4JI4T 1M64A 4NXNT 4AQGA 1REOA 4A6NB 2KNDA 2FBWA 1X9BA 2WBLA 4JI1T 3NK0X 5J7XA 3PUQA 5L4EA 1O3XA 4QH4A 2VZ2A 3UKAA 4YT0A 1PJ6A 2D0TA 5JH7E 4EMJA 4E7ZA 2MAWA 2GAHB 3C4ZA 3ABVA 2LSGA 2DLRA 2I0ZA 2BS2A 2IIUA 2UXDT 2A9UA 1KEYA 2CWYA 2W0HA 1GQEA 5FL0A 1GRAA 4JN9A 3EAOA 5JR9B 1AR94 2PZSA 1D1AA 2XVFA 5FXWA 1VBE4 4UDPA 1KK7A 2X9YA 2DNXA 3UCLA 4EAHA 2XSAA 3AEAA 1K4QA 2YG7A 1JOAA 5L4HA 3TLSA 3PUXF 3P9UA 3AVSA 3QK6A 4AIUA 4YHJA 3S5WA 3KKJA 2WDRA 1XMQT 1ZP0A 4TX5A 5JCKA 3JAEA 3AE3A 4DR2T 1Y64B 1TDKA 4B69A 3KPKA 4WYVA 3CGDA 5ABGA 1B7TA 3CWZB 1DOEA 2V7KA 4LMLA 1R094 4EB6E 1COYA 4E0VA 4AI6A 2GR1A 2VRLA 1GSNA 4YJ2E 3IHGA 5J2UE 3Q5EA 4Z2RA 2YLTA 3QSSA 4X9NA 2WM9A 2LE8A 3N2GE 3NNEA 1T8BA 1EL9A 3JSKA 2G0UA 3KV6A 2LSJA 5KWFA 3AA1B 1Y56B 1KNRA 1DJQA 1GTEA 4DMWA 2Q9QD 4UF0B 4TLZA 1EL8A 2GAGB 3GQKA 2X0HA 1OJCA 2V6XA 4O2AE 5HEUA 2CLYC 2GEWA 4II3A 5FMNA 1T7SA 4X1YE 5EK4A 3ZMTB 1XZYA 3D1CA 3RC8A 4GKJT 2JPFA 1XHXA 4Q4X4 1COV4 3DK8A 3AXBA 3ZC1A 2GF3A 4UDQA 1FJGT 2BVLA 4DV5T 3FBSA 2XFQA 2WESA 2V5CA 3E08A 3DMEA 4ZEYA 5EK2A 4U74A 1KSSA 3AEEA 1JU2A 2LLYA 4LMKA 2DL1A 5HEHA 2Q9QA 4MHCA 3NKZA 3UQ4A 4OPCA 2AAQA 2LKHA 3HYVA 3CVRA 5FKYA 1Y0PA 2WSSV 1H7CA 1S2QA 2Y8DA 2GMHA 3AAEB 3GD4A 2BG9C 4BJZA 2C5KT 4FK1A 5IQ4A 2XQ3A 2CPTA 2BCPA 2A3DA 1RUJ4 4A98A 4EZ4A 5EB4A 3OC4A 1CBOA 2BA9A 1PBBA 3B3RA 3DJGX 3UKPA 2OALA 4HFHA 4JDRA 4GF7A 4WX1A 5KOXA 4WCTA 5DJQC 4JQ9A 2BVMA 4AKGA 2YWLA 1RHI4 2Z6EA 5HXRA 4PAGA 4AISA 2BC1A 2V6OA 3PJAA 3QSEA 1VBC4 3NLCA 2R074 3QOFA 4Z26A 4YTNA 3V3NA 3G5QA 2CRBA 3HKCE 1MMGA 3ZYKA 3CPHG 1RP0A 1U4QA 2NTYA 4JY3A 1V9DA 2RA1A 4IE0A 2GB0A 1VCSA 2HWB4 2XY8B 1BR2A 3UFEA 3RYCE 3KVEA 2YN6A 1T98A 3IHMA 5JRCA 3LJCA 1IZNB 3LJPA 1WLXA 4HA6A 4H4SA 3P4WA 2P9BA 1HX1B 2BZBA 1IBKT 3F8PA 4K0UA 5HAXA 3ATRA 4AKRB 4LF7T 2BK4A 5AQIB 2WPEA 4ZI7E 5C2TA 4H4RA 5AQQB 1NG4A 4ZS3A 1ZK7A 4BK1A 1TYTA 4YXDA 1D0ZA 1OXZA 3IBPA 4H9RC 1YKHB 4DSGA 2RR14 2I0MA 4PW8A 2E9XD 3SY4A 2C73A 3ICSA 1AL24 1H6VA 5JCMA 1Z8UA 2X67A 2C4CA 4LFAT 2RGJA 2NOXA 4G63A 4G2AA 4IL4A 4DO0A 5BUKA 4XZCA 3GWFA 2X0YA 1UURA 4H4YA 2IC6A 2X9WA 4KPRA 4KHZF 1Z0PA 3CGCA 4TM4A 2IDOB 3T2YA 5ABHA 2XHEB 4P0AA 4JYAT 2E9XA 3H8LA 3UUBA 2PW9A 3HI2A 5U25A 4IDQA 1PXBA 3FZLB 4DR4T 1B4VA 2A89A 1CC6A 3K3NA 3O9XA 2HN1A 2XQAA 4J2WA 1W4XA 3NH3X 1VDCA 2X51A 3C64A 3I0OA 1XPQA 1ELIA 4IE7A 3RP8A 4EM3A 5HXHA 2YINA 3CX6B 3K30A 2JK6A 4EIQA 1ZY8A 5L3CB 2ZZBA 3ONLC 4HFVA 4CXYA 1ZKEA 5HYMA 2BS3A 5H6QB 2Q7VA 1AR74 3GD3A 1XDOA 5HXSA 4AKLA 3RYHE 2H89A 3QFBA 3K7MX 1VRBA 1EL5A 1NHRA 5CKUA 4A9WA 3PTRB 4CY8A 4JEUB 4I58A 1MQTD 2C64A 4YSYA 3MACA 2R0CA 4TM3A 2HWC4 4Z25A 4NEVA 3CNTA 1WR6A 1ZEEA 3KINB 3GMCA 4B68A 5LBMA 5FL1A 2YDRA 3UTKA 2W67A 2KXPB 3BI2A 3OZ2A 2M67A 4HWDA 3CNDA 1HX8A 3KU9A 1XHCA 4O4IE 4DR1T 3I1AA 2YG6A 2LJLA 3SX6A 2YVJA 1E1LA 3DJEA 3SGLA 2RGHA 2HN2A 4H9PC 3OBVE 4WNKA 4YLHA 5IPYA 3IF9A 5ABFB 2V61A 2JIWA 1IUSA 4DIDB 4KUMB 2LSIA 1LKXA 4AQFC 3VU7H 4U8LA 1PO24 3RQWA 3QVRA 1NG3A 3Q6JA 1FL2A 1JRZA 2LRLA 2V5DA 1UUSA 1IBMT 2WZIA 4WBNE 4LMJA 3D0TA 5HHFA 1S3BA 2XDOA 2BKNA 1MMDA 2CA5A 2YQUA 2PYXA 2R45A 1LVLA 1UKVG 1OJ9A 1F6MA 3HYWA 1ZV4X 3CNJA 2E8IA 4TUYE 4O5UA 2NWBA 4OK0A 5FYMA 3PU8A 3K7TA 4BK3A 2C3DA 2RS34 4E7SA 4PJNA 5LOVE 1LTXR 4ZZBA 3GQHA 2JQ9A 3A5XA 1NAAA 1B5QA 5LA6E 2C65A 3PV0F 1OEDA 5LMNT 1D4EA 4B3TT 4ZXLA 1VRH4 4DR3T 2F4VT 4NUUA 3ICRA 3ONJA 2IVDA 4CY6A 3N9PA 3UUMA 4CI2B 3ATQA 1HG2A 4DMVA 2HHHT 1F3PA 1BKWA 2EQ9A 4H9SE 2XFOA 1WCRA 3KBTA 1CL0A 2D9DA 1IJHA 2X68A 2GR0A 4UEMA 5JRCB 3ONXA 2RABA 5KXJA 3P1WA 2QGSA 5FY7A 2RS54 5JDQA 5CA1E 1WR0A 5HEJA 3HKBE 5J2TE 3RHWA 1GRTA 1TDEA 3B6DA 3KA7A 3T37A 3CNSA 5LV9A 4HGAA 3T31A 4HWIB 5L3EB 4QHOA 1CJ3A 1EZ3A 5F8PA 1PDHA 5H6RB 3SRZA 1R084 2W0GA 2TMDA 4D03A 1Y56A 4YTMA 4UF0A 2RM24 3E22E 4XBFB 5DABA 3OPCA 3RQUA 3FBZA 1J5ET 4DR5T 3PE0A 4U2LA 3F8DA 2BXSA 3FI7A 1PXCA 1POV0 3PUAA 3Q9TA 4USRA 3LDQB 3H4KA 1MO9A 5C3JA 3AWIA 3DK9A 5HWYA 1ZMDA 2VL8A 2L3LA 2XFNA 1GETA 3TLWA 2CEAA 4ANJA 1US7B 1SHZC 3O1HA 3P4SA 1BGJA 2YM1A 1N36T 4JNQA 2K5BB 3VR9A 3N9OA 3RYFE 3OTOT 3U3IA 1IUWA 4K22A 4JI8T 3ANWB 2XVJA 2Z5XA 2ZLYA 4DV1T 3SXIA 4U8KA 1GRBA 1W09A 4X66T 2BG9E 2XAFB 4IE5A 5CQFA 4OPDA 3F57A 2YKSA 4AT2A 1VBB4 3GMBA 4LF8T 3AE2A 3FZFB 2Y48B 5AFUL 5JDNA 4EV6A 4J2CA 1RUD4 3NRXA 4B1BA 3T2ZA 4BJYA 2CLYB 4U2YA 4BV6A 3QB5K 5AQKB 2C66A 1MNDA 5EK3A 4X1KE 1D0YA 4F6RC 3NTAA 1GRHA 5AQLB 2YR5A 4CRTA 4YJ3E 5CB4E 1HRV4 1O94A 4A5LA 4UR9A 5ABEA 2YG3A 2AE9A 2XAJB 4KP3C 2VKDA 3AE9A 3SFEA 5FMHA 2WP9A 2KMFA 3FXEB 2WDQA 3GYXA 5J0ZA 2BDEA 3UU6A 2R4JA 3DJJA 1KDGA 3AE1A 5TAOA 1LPFA 4B63A 3K3QC 4RG3A 4Z2TA 5ADXL 1Q9IA 2YR4A 1JNZA 1BWCA 4C74A 1ZOYA 5LGUB 3RP7A 4EXTA 4LF4T 3FMWA 5KVHA 1CHUA 2QA7A 3T8OA 3RGLA 1YQZA 2VQBA 5E0OA 4I55E 3AYLA 4EM4A 3K3OA 1WYCA 2M6BA 1YD8G 1FOHA 1JNRA 1P2EA 1N4WA 4EGWA 3AD8B 2XTLA 1RUC4 1ZMCA 4IVOB 3RC3A 2ODVA 1KNZA 4UVAB 1GV4A 4WZXA 3PO7A 3UU5A 3N2KE 2XLUA 1PIV4 4X20E 1TYPA 1YXRA 3GA8A 3LK2B 4IDNA 1GTHA 3UFGA 2GQWA 4N9XA 2YLZA 4A99A 2WCAA 4II2A 5U63A 3ZT7A 3TLTA 4J57A 2ZM0A 2DHRA 1NHSA 2WWUA 2LOSA 5ETWA 3ZN1B 1B8SA 3F31A 2CBIA 1BZLA 3MZKB 3RIUA 1D4DA 2QRXA 2MYSA 3ALMA 3EANA 1KFYA 1SA0E 1X31B 4NUVA 5HY5A 4IT4A 2BK5A 1HS7A 5AQFB 3KVBA 3SQPA 4HKAA 1JRYA 2CDUA 1F8SA 2PLV4 2VKOA 4K8DA 1T72A 2LSYA 5IQ1A 4K7ZA 3O1IA 3LADA 3AYIA 3H8IA 4DNAA 4Z91A 4ZI3D 5JDHA 4PFPA 1OEDB 2WU2A 2YU2A 3AB1A 2E5VA 3NBXX 3CTYA 3N9QA 1D1BA 1GEUA 1VBA4 3LSVA 4GAVA 3RYIE 4KBMB 5FVKA 2OLOA 2WPCA 2LFCA 1WYBA 4A7AA 2V3AA 4Z44A 2PBIA 1ZOVA 4B64A 2VVLG 3MA9A 3RP6A 2O9ZA 2WOIA 2UUBT 4TNWA 3Q5DA 1LVFA 5LP6E 2JQQA 3LK3B 3KDSE 1NAFA 4U8PA 2V7MA 2YG4A 3REDA 1ONFA 2YLRA 3I9YA 4G73A 3PUSA 4XAXB 5EOWA 3DA1A 3ZN0B 4Y4MA 2WOVA 1OJDA 4QXBB 3NT6A 1E39A 1GALA 4J31A 2YLWA 2LM9A 4H4QA 1FECA 1H84A 2ZBWA 4ZOLE 3AEBA 1BF3A 3BQLA 3OVUA 3O0HA 1D4M4 2Q6UA 5BRTA 5HEGA 3R9UA 3CN8A 5JCNA 1IBLT 2X9HA 2VVNA 1PXAA 5ABFA 4CNJA 3JC6C 2LSKA 4JI2T 3GN5A 4YHHT 3Q2MA 4B67A 2ACXA 3UKQA 4UVBB 1E1HB 4DNDA 4LF5T 1WFDA 1R8IA 5FNVE 2J4GA 2VWAA 4CI3B 4HFCA 1HYUA 3LXDA 4G9KA 4JV5T 4ZHQE 3N5LA 1UX5A 2YDSA 2VVLA 5HCMA 2BBJA 3Q9DA 5JCIA 1ZHCA 5EZYE 1XANA 5J60A 4AKHA 3VHLA 4H4VA 3FB2A 3ETUA 1L9DA 3S4UA 4OPGA 1NDAA 2N1GA 3FBLA 3DK4A 4GRTA 4OPTA 2R7FA 4U2ZA 4JI0T 1S3EA 1MIYA 3RH3A 4O8SA 3MKDA 3A8YC 1E2AA 3UKFA 4ZI2C 4OFZA 1GRFA 3A7MA 4CN6A 4GDEA 4CQIA 3NTDA 1PVC4 3LZWA 1V59A 1H7WA 2EHOC 2LHRA 4XWZA 2V26A 2TPRA 1OJAA 2W63A 4AT0A 3NKSA 2XVIA 3M13A 3V3OA 4O4LE 3JBG4 5DQVA 2JRKA 3FZKB 1IUXA 3M65A 2WP6A 4EOZB 3H37A 5AQGB 5EB5A 1CC4A 5LNKA 3IC9A 1NENA 2RMU4 4YSHA 4ERRA 2M6IA 1S35A 3F8RA 4UXNB 4U2TA 4ZCCA 1N32T 4QX8B 2AR8A 2BRAA 3J7Yq 4HE8A 4H63H 4JY2A 4EEDA 4Q4V4 3L1RA 3HR0A 3N2OA 3ZPOA 1W9RA 3SS1A 3M0OA 2D0UA 1DODA 3QUJA 2J3NA 3AD9B 3ZCIA 4NWZA 5EBKA 3NRYA 1LJ1A 4NIQA 3N9NA 1BR4A 2NP9A 2PG8A 3L8RA 5AQPB 1GRGA 3LBXA 4LFCT 3BI5A 2K3WA 3VKHA 4UIGA 2IC9A 5L3BB 1HR0T 4JI3T 2CHNA 3UT5E 3BNUA 3JCFA 5JQGE 4Z8XA 5FXXA 2WBAA 3RKOA 1UCUA 5JR9C 4P9SA 2BKPA 1ZX9A 3QB5A 3ANWA 4IA6A 3NYFA 3K8PC 3KV4A 1YW0A 3AE5A 5L46A 3PURA 3CPIG 4GUVA 2B7SA 4DV3T 1Q1RA 4Y4LA 5L3DB 3EVYA 4HFIA 3CX7B 5HEOA 4REKA 4LA1A 2IW5B 1LV0A 1EBDA 3RLFF 4HTEA 4DV4T 2WMOA 3NYEA 2ZZCA 2RGOA 2LT3A 2VVSA 3WAKA 5AQNB 2DWGA 2NW7A 2FJBA 4DBQA 4U2SA 4GK0E 3HA4A 3C4XA 2QA1A 1HXS4 2YR6A 1E1KA 5KMSA 3URHA 2VRMA 4IE4A 4ZCDA 3DGHA 1RVF4 2CM0A 2FJAA 4Z90A 1G8XA 2PY5A 2DWKA 5C8YE 2BG9A 4EZHA 1E1MA 2WEUA 4OHFA 3UULA 2VL0A 3CIRA 1D7LA 5L47A 4GYRA 4H4TA 3SFDA 5GRTA 2W4XA 3T1HT 4WBOA 4UP3A 4FDCB 5JREA 1W0AA 1Z6LA 2YVFA 3QFAA 1MIWA 3SZWA 1OOPD 3T2KA 1PJ5A
chains in the Genus database with same CATH topology
3UOZA 2UZZA 3P4SA 1GESA 2BS2A 1BGJA 2I0ZA 2XFPA 3M12A 2YM1A 4CNKA 2W0HA 4JNQA 3VR9A 3ISHA 2GVCA 1GRAA 5BVAA 1IUWA 1KF6A 4K22A 3AEFA 2XVJA 4JN9A 3EAOA 2Z5XA 3SXIA 4U8KA 1GRBA 5FS9A 3G5RA 2XVFA 5CQFA 4OPDA 4AT2A 3QSMA 3GMBA 4UDPA 1JRXA 2H88A 3AE2A 5KVIA 3HYXA 3UCLA 4NTEA 2CFYA 3AEAA 1K4QA 1SEZA 2YG7A 1JOAA 4EIPA 3P9UA 1JEHA 4TM0A 1NHPA 1IUTA 3SZFA 4B1BA 3T2ZA 5TR3A 4BJYA 3S5WA 2C75A 1N1PA 2WDRA 3KKJA 4NZHA 1ZP0A 5JCKA 5KMQA 3AE3A 4BV6A 1TDKA 4B69A 2C72A 3KPKA 3CGDA 2QAEA 4AOSA 3AECA 3UOVA 2C66A 3ITJA 1DOEA 3ZDNA 1CF3A 4GR1A 2GR2A 3UOXA 4H4ZA 1COYA 4Z43A 2WQYA 3NTAA 4E0VA 4ZN0A 4B66A 2FJDA 3UTFA 1GRHA 2GR1A 2VRLA 3NIXA 2YR5A 4G6GA 3WE0A 1GSNA 4AP1A 4CRTA 3IHGA 3CGEA 1O94A 1ZKQA 1DOCA 4A5LA 2OA1A 2YG3A 4Z2RA 1FEAA 3AE9A 2YLTA 3QSSA 4X9NA 5JCLA 3DJDA 3SFEA 5FMHA 2WP9A 3SZ0A 3NNEA 4ECHA 2WDQA 1EL9A 2YG5A 3GYXA 3JSKA 4EMWA 5KWFA 3HZLA 1Y56B 3KLJA 2XLPA 3AE6A 1KNRA 1DJQA 1GTEA 3AD7B 4TLZA 1EL8A 2R4JA 2GAGB 2WP5A 3DJJA 3LOVA 4CCQA 4H7UA 1OJCA 2Y6QA 1KDGA 3GQKA 3AE1A 2GEWA 4II3A 1LQUA 4PABA 2GH5A 4YKGA 2R0GA 1LPFA 4H2NA 4B63A 2BRYA 3NYCA 1O95A 3D1CA 4RG3A 2VQ7A 2BXRA 4Z2TA 3DK8A 3AXBA 4APNA 2GF3A 4UDQA 2AQJA 1Q9IA 2YR4A 3GRSA 1JNZA 1BWCA 4C74A 1ZOYA 4U8NA 3FBSA 4CBQA 2XFQA 3RP7A 2WESA 1F8RA 2APGA 2OAMA 3FMWA 5KVHA 4DSHA 2VOUA 2BYBA 5KRQA 1CHUA 3DMEA 2Q0KA 3UTEA 1D5TA 4X9MA 1KSSA 3AEEA 2EQ8A 1JU2A 1YQZA 5U1OA 2VQBA 3SM8A 3AYLA 4EM4A 5GSNA 4OPCA 4KX6A 1FOHA 2AAQA 2NVKX 1JNRA 1P2EA 3HYVA 1N4WA 3SUCA 3AD8B 2BABA 1Y0PA 2GV8A 1S2QA 2GMHA 2A8XA 3GD4A 1ZMCA 4IVOB 4YWOA 1L9CA 4BJZA 1MOKA 4FK1A 3GDPA 5IQ4A 1GV4A 3PO7A 2BCPA 3EPTA 2XLUA 2DKIA 3GDNA 1N4UA 1TYPA 5EB4A 3LZXA 3OC4A 1CBOA 1GTHA 4N9XA 2BA9A 2GQWA 1PBBA 3B3RA 1PBEA 3DJGX 2YLZA 4A99A 3UKPA 2CULA 2OALA 4JDRA 4II2A 5U63A 2C70A 4J57A 4GF7A 1NHSA 4WX1A 5KOXA 3GYIA 4WCTA 1GREA 4EQSA 4JQ9A 1B8SA 1ZDLA 2YWLA 3ICTA 1LQTA 3ZYXA 4O5QA 3AEDA 1BZLA 2BC1A 2V6OA 3QSEA 1IUVA 3ALMA 1D4DA 3EANA 3NLCA 3PVCA 4K5SA 1KFYA 2XVEA 4Z2UA 4Z26A 4TM1A 4YTNA 3V3NA 3G5QA 1X31B 2JB3A 4M52A 5HY5A 1GT8A 2WOWA 4UDRA 4C3YA 1QJDA 2BK5A 3CPHG 1RP0A 3SQPA 1JRYA 1H86A 2CDUA 4NTDA 4H2QA 1F8SA 4JY3A 3PS9A 1NHQA 2QCUA 2XYOA 2X8HA 4K8DA 2GB0A 1BGNA 5IQ1A 4K7ZA 2IIDA 3GRTA 4H4UA 3LADA 3AYIA 1M6IA 3H8IA 1L0VA 3KVEA 4DNAA 2E1MA 3IHMA 1RYIA 1K0LA 2WU2A 5BULA 3AB1A 2E5VA 3CTYA 1NPXA 1GEUA 3T0KA 3LJPA 4HA6A 4H4SA 4D04A 4GAVA 2ACZA 3D8XA 1CJ4A 3UTGA 2WPCA 2OLOA 2LFCA 1KNPA 1CJCA 1GOSA 3F8PA 4X4JA 4A79A 2V3AA 4A7AA 4Z44A 1ZOVA 2EQ7A 2JKCA 3ATRA 4USQA 4B64A 2Z5YA 2BK4A 2VVLG 2WPEA 3RP6A 5M10A 2O9ZA 4ICYA 5C2TA 2WOIA 4H4RA 3SZCA 1NG4A 3RNMA 4EQRA 5M0ZA 1GERA 1ZK7A 2FJEA 3CGBA 1TYTA 4BK1A 4A6NA 4YXDA 4U8PA 1YY5A 4K5RA 2BC0A 2B76A 3NGCX 3UKHA 4DSGA 2YG4A 3REDA 1ONFA 1PBFA 2YLRA 1MXTA 2C73A 2WETA 3ICSA 4U8MA 1H6VA 4G73A 3SY4A 5JCMA 3KD9A 2C4CA 5EOWA 3DA1A 2RGJA 4NTCA 2YM2A 4Y4MA 2WOVA 1OJDA 5BUKA 3NT6A 3GWFA 1E39A 1GALA 4J31A 4AOXA 2YLWA 2XVHA 4H4YA 4YSZA 4H4QA 1B37A 1FECA 1DJNA 1H84A 2GRTA 2ZBWA 2X3NA 3AEBA 1BF3A 4GCMA 1K0JA 4U8IA 5KMPA 4KPRA 3O0HA 4A65A 5FS7A 4H50A 3CGCA 2ARDA 3VRAA 2B9XA 2Q6UA 4TM4A 2BACA 3R9UA 3T2YA 3UP4A 3CN8A 5JCNA 2XLRA 1F8WA 1VG9A 4U8OA 4J33A 4G74A 1N4VA 2Y6RA 2R9ZA 2WS3A 2ZZ0A 1EL7A 1PXAA 3H8LA 4FX9A 4CNJA 3NN0X 4CCRA 2JB1A 4NEWA 4B67A 3UKQA 2YLXA 3GSIA 5U25A 1PXBA 4OVIA 3UOYA 1B4VA 2A89A 4DGKA 1S2YA 1CC6A 3VRDB 4J2WA 1W4XA 3UP5A 4EMIA 2GQFA 4JNAA 3NH3X 3AE7A 2QA2A 3II4A 5KOWA 2B7RA 2VVMA 1H83A 1HYUA 1VDCA 3C96A 3LXDA 4G9KA 2V3BA 1XPQA 1ELIA 2X8GA 4FK1C 4GAPA 3RP8A 1H82A 4EM3A 3ALLA 2VVLA 2JK6A 3K30A 4EIQA 5JCIA 3I6DA 1ZY8A 4NNJA 4J56A 1VQWA 2ZZBA 3GWDA 2X50A 3C4NA 2C7GA 5HYMA 4PAAA 2BS3A 1XANA 4AP3A 5J60A 4H4VA 1TDFA 2Q7VA 2YAUA 1L9DA 4K2XA 3GD3A 4OPGA 4EQXA 1NDAA 2R0PA 3DGZA 2H89A 3DK4A 4GRTA 1QLBA 3QFBA 3K7MX 4I59A 4OPTA 4BK2A 1VRQB 2WHDA 1S3EA 1EL5A 1NHRA 5CKUA 2BS4A 4Y4NA 5FS6A 4OCGA 4A9WA 2PHHA 4LIIA 4G6HA 3UKFA 1D7YA 1XDIA 4I58A 4CY8A 2C64A 4YSYA 2EQ6A 2R0CA 4TM3A 1GRFA 4GDEA 2GMJA 1TDNA 3NTDA 3LZWA 1V59A 4C5OA 1H7WA 4Z25A 4XWZA 4NEVA 2TPRA 4BURA 4OPIA 1OJAA 3CNTA 2E4GA 4AT0A 3NKSA 2XVIA 3M13A 3K7QX 3GMCA 4IA5A 4B68A 3V3OA 3P4QA 2GR3A 3COXA 4C3XA 1IUXA 3BI2A 1RSGA 2WP6A 4IV9A 3OZ2A 2R4EA 4J36A 1PBCA 3CNDA 3S61A 1FEBA 3KU9A 3AYJA 1XHCA 1CC4A 3QVPA 5EB5A 3IC9A 2WU5A 4GDPA 1NENA 1D4CA 4YSHA 1IUUA 2YG6A 3ALJA 3CNPA 4RSLA 3SX6A 1FCDA 3DH9A 3E1TA 5KMRA 3F8RA 3C4AA 2YVJA 1E1LA 3P4RA 3DJEA 4U2TA 3SGLA 3GYJA 2RGHA 4ZCCA 4TLXA 2AR8A 2BRAA 3FPZA 5HXIA 1AOGA 2R46A 3I3LA 2OLNA 3IF9A 4JY2A 5IPYA 3L1RA 2V61A 1IUSA 2F5ZA 2XCGA 2DKHA 1DXLA 3BNMA 3M0OA 4H2RA 2B9YA 4U8LA 1DODA 3LB8A 1NG3A 3Q6JA 3QVRA 2J3NA 3AD9B 4NWZA 5EBKA 1FL2A 1JRZA 2C76A 3CPJG 1LJ1A 5KNLA 3CMMA 2YVGA 1OJTA 3NK1X 4YSXA 2BCGG 4XWRA 4LU6A 5HHFA 1S3BA 1H81A 2HQMA 2XDOA 1GRGA 2YQUA 3AEGA 2PYXA 2R45A 2X99A 1LVLA 1UKVG 4J34A 4C77A 1OJ9A 1F6MA 3BI5A 3HYWA 4MJWA 3CNJA 2XFUA 1PS9A 1KSUA 4YKFA 1PHHA 1PN0A 4O5UA 4Z24A 3UKKA 2JB2A 3BNUA 2XLTA 1QO8A 3K7TA 1E1NA 1TDOA 1TRBA 2WBAA 2XLSA 4BK3A 2C3DA 3AE8A 2BK3A 2V60A 4P9SA 1NEKA 1YKJA 1ZX9A 1LTXR 4IA6A 3NYFA 4XXGA 4YTPA 3KPFA 5FS8A 3GQHA 3AE5A 3G5SA 5L46A 1NAAA 3CPIG 4H2PA 2WDVA 4GUVA 3SYIA 1B5QA 2B7SA 2B9WA 1P2HA 3BHFA 2C3CA 1Q1RA 4HB9A 4Y4LA 2C65A 3FG2P 3QJ4A 1D4EA 1YQ3A 2X8CA 3UTHA 3VRBA 4REKA 4LA1A 1E7PA 1DOBA 1LV0A 1EBDA 3ICRA 2IVDA 4CY6A 2JAEA 2Q0LA 3NYEA 2IVEA 2ZZCA 2RGOA 3ATQA 3ADAB 1F3PA 5DBJA 3L8KA 1BKWA 2EQ9A 4OPUA 3RHAA 3NK2X 3T14A 2FJBA 2XFOA 4B65A 4U2SA 1CL0A 1K0IA 1IJHA 1PJ7A 1O5WA 3BHKA 3FIMB 2GR0A 3AE4A 2WPFA 3NHOX 5ER0A 3V76A 2V5ZA 2RABA 5KXJA 3P1WA 2NPXA 4OPLA 3NRNA 2JBVA 2QA1A 1DNCA 1PBDA 3T37A 1GRTA 1TDEA 3B6DA 3KA7A 2YR6A 3CNSA 5LV9A 3T31A 1E1KA 5KMSA 1L9EA 4IVMB 3VR8A 2CVJA 2VRMA 1Q1WA 3URHA 1CC2A 4ZCDA 3DGHA 1CJ3A 1PDHA 1GPEA 1CJ2A 2C67A 5BRTA 2TMDA 2A87A 4U8JA 4D03A 1Y56A 2FJAA 1YQ4A 4YTMA 3UKLA 4ADWA 1E1MA 2WEUA 1REOA 1M64A 4A6NB 4H4WA 1E6EA 1GXFA 3BI4A 4U2LA 3IWAA 2FBWA 3CIRA 1D7LA 3F8DA 2BXSA 3NN6X 3NK0X 4H4TA 4RG4A 5J7XA 3SFDA 1PXCA 1VG0A 5GRTA 3Q9TA 1GNDA 4H4PA 2VZ2A 3EF6A 4UP3A 4FDCB 4USRA 4EQWA 1H7XA 3UKAA 4YT0A 3H4KA 1MO9A 5C3JA 1Z6LA 3AWIA 3DK9A 1PJ6A 3P4PA 1ZMDA 2YVFA 3QFAA 2XFNA 4EMJA 3SZWA 1GETA 2GAHB 3NG7X 4H4XA 3T2KA 3VQRA 2YLSA 3ABVA 1PJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOZ A;  2UZZ A;  3P4S A;  1GES A;  2BS2 A;  1BGJ A;  2I0Z A;  2XFP A;  3M12 A;  2YM1 A;  4CNK A;  2W0H A;  4JNQ A;  3VR9 A;  3ISH A;  2GVC A;  1GRA A;  5BVA A;  1IUW A;  1KF6 A;  4K22 A;  3AEF A;  2XVJ A;  4JN9 A;  3EAO A;  2Z5X A;  4U8K A;  1GRB A;  5FS9 A;  3G5R A;  2XVF A;  5CQF A;  4OPD A;  4AT2 A;  3QSM A;  3GMB A;  4UDP A;  1JRX A;  2H88 A;  3AE2 A;  5KVI A;  3UCL A;  4NTE A;  2CFY A;  3AEA A;  1K4Q A;  1SEZ A;  2YG7 A;  1JOA A;  4EIP A;  3P9U A;  1JEH A;  4TM0 A;  1NHP A;  1IUT A;  4B1B A;  4BJY A;  5TR3 A;  3S5W A;  2C75 A;  1N1P A;  2WDR A;  3KKJ A;  4NZH A;  1ZP0 A;  5JCK A;  3AE3 A;  4BV6 A;  1TDK A;  4B69 A;  2C72 A;  3CGD A;  2QAE A;  4AOS A;  3AEC A;  3UOV A;  2C66 A;  3ITJ A;  1DOE A;  3ZDN A;  1CF3 A;  4GR1 A;  2GR2 A;  3UOX A;  4H4Z A;  1COY A;  4Z43 A;  2WQY A;  3NTA A;  4E0V A;  4ZN0 A;  4B66 A;  2FJD A;  3UTF A;  1GRH A;  2GR1 A;  2VRL A;  3NIX A;  2YR5 A;  3WE0 A;  4AP1 A;  1GSN A;  4CRT A;  3IHG A;  3CGE A;  1O94 A;  1ZKQ A;  1DOC A;  4A5L A;  2OA1 A;  2YG3 A;  4Z2R A;  1FEA A;  3AE9 A;  2YLT A;  3QSS A;  4X9N A;  5JCL A;  3DJD A;  3SFE A;  5FMH A;  2WP9 A;  4ECH A;  3NNE A;  2WDQ A;  1EL9 A;  2YG5 A;  3JSK A;  4EMW A;  3GYX A;  5KWF A;  3HZL A;  1Y56 B;  3KLJ A;  2XLP A;  3AE6 A;  1KNR A;  1DJQ A;  1GTE A;  3AD7 B;  4TLZ A;  1EL8 A;  2R4J A;  2GAG B;  2WP5 A;  3DJJ A;  3LOV A;  4CCQ A;  4H7U A;  1OJC A;  2Y6Q A;  1KDG A;  3GQK A;  3AE1 A;  2GEW A;  1LQU A;  4PAB A;  2GH5 A;  4YKG A;  2R0G A;  1LPF A;  4H2N A;  4B63 A;  3NYC A;  1O95 A;  3D1C A;  4RG3 A;  2VQ7 A;  2BXR A;  4Z2T A;  3DK8 A;  3AXB A;  4APN A;  2GF3 A;  4UDQ A;  2AQJ A;  1Q9I A;  2YR4 A;  3GRS A;  1JNZ A;  1BWC A;  4C74 A;  1ZOY A;  4U8N A;  3FBS A;  4CBQ A;  2XFQ A;  3RP7 A;  2WES A;  1F8R A;  2APG A;  2OAM A;  3FMW A;  5KVH A;  4DSH A;  2VOU A;  2BYB A;  5KRQ A;  1CHU A;  3DME A;  2Q0K A;  3UTE A;  1D5T A;  4X9M A;  1KSS A;  3AEE A;  2EQ8 A;  1JU2 A;  1YQZ A;  5U1O A;  2VQB A;  3SM8 A;  3AYL A;  4EM4 A;  5GSN A;  4OPC A;  4KX6 A;  1FOH A;  2AAQ A;  2NVK X;  1JNR A;  1P2E A;  1N4W A;  3SUC A;  3AD8 B;  2BAB A;  1Y0P A;  2GV8 A;  1S2Q A;  2GMH A;  2A8X A;  3GD4 A;  1ZMC A;  4IVO B;  4YWO A;  1L9C A;  4BJZ A;  1MOK A;  4FK1 A;  3GDP A;  5IQ4 A;  1GV4 A;  3PO7 A;  2BCP A;  3EPT A;  2XLU A;  2DKI A;  3GDN A;  1N4U A;  1TYP A;  5EB4 A;  3LZX A;  3OC4 A;  1CBO A;  1GTH A;  4N9X A;  2BA9 A;  2GQW A;  1PBB A;  3B3R A;  1PBE A;  3DJG X;  2YLZ A;  4A99 A;  3UKP A;  2CUL A;  2OAL A;  4JDR A;  5U63 A;  2C70 A;  4J57 A;  4GF7 A;  1NHS A;  4WX1 A;  5KOX A;  3GYI A;  4WCT A;  1GRE A;  4EQS A;  4JQ9 A;  1B8S A;  1ZDL A;  2YWL A;  3ICT A;  1LQT A;  3ZYX A;  4O5Q A;  3AED A;  1BZL A;  2BC1 A;  2V6O A;  3QSE A;  1IUV A;  3ALM A;  1D4D A;  3EAN A;  3NLC A;  3PVC A;  4K5S A;  1KFY A;  2XVE A;  4Z2U A;  4Z26 A;  4TM1 A;  4YTN A;  3V3N A;  3G5Q A;  1X31 B;  2JB3 A;  4M52 A;  5HY5 A;  1GT8 A;  2WOW A;  4UDR A;  4C3Y A;  1QJD A;  2BK5 A;  3CPH G;  1RP0 A;  3SQP A;  1JRY A;  1H86 A;  2CDU A;  4NTD A;  4H2Q A;  1F8S A;  4JY3 A;  3PS9 A;  1NHQ A;  2QCU A;  2XYO A;  2X8H A;  4K8D A;  2GB0 A;  1BGN A;  5IQ1 A;  4K7Z A;  2IID A;  3GRT A;  4H4U A;  3LAD A;  3AYI A;  1M6I A;  3H8I A;  1L0V A;  3KVE A;  4DNA A;  2E1M A;  3IHM A;  1RYI A;  1K0L A;  2WU2 A;  5BUL A;  3AB1 A;  2E5V A;  3CTY A;  1NPX A;  1GEU A;  3LJP A;  4HA6 A;  4H4S A;  4D04 A;  2ACZ A;  3D8X A;  1CJ4 A;  3UTG A;  2WPC A;  2OLO A;  2LFC A;  1KNP A;  1CJC A;  1GOS A;  3F8P A;  4X4J A;  4A79 A;  2V3A A;  4A7A A;  4Z44 A;  1ZOV A;  2EQ7 A;  2JKC A;  3ATR A;  4USQ A;  4B64 A;  2Z5Y A;  2BK4 A;  2VVL G;  2WPE A;  3RP6 A;  5M10 A;  2O9Z A;  4ICY A;  5C2T A;  2WOI A;  4H4R A;  1NG4 A;  3RNM A;  4EQR A;  5M0Z A;  1GER A;  1ZK7 A;  2FJE A;  3CGB A;  1TYT A;  4BK1 A;  4A6N A;  4YXD A;  4U8P A;  1YY5 A;  4K5R A;  2BC0 A;  2B76 A;  3NGC X;  3UKH A;  4DSG A;  2YG4 A;  3RED A;  1ONF A;  1PBF A;  2YLR A;  1MXT A;  2C73 A;  2WET A;  3ICS A;  4U8M A;  1H6V A;  5JCM A;  3KD9 A;  5EOW A;  3DA1 A;  2RGJ A;  4NTC A;  2YM2 A;  4Y4M A;  2WOV A;  1OJD A;  5BUK A;  3NT6 A;  3GWF A;  1E39 A;  1GAL A;  4J31 A;  4AOX A;  2YLW A;  2XVH A;  4H4Y A;  4YSZ A;  4H4Q A;  1B37 A;  1FEC A;  1DJN A;  1H84 A;  2GRT A;  2ZBW A;  2X3N A;  3AEB A;  1BF3 A;  4GCM A;  1K0J A;  4U8I A;  4KPR A;  3O0H A;  4A65 A;  5FS7 A;  4H50 A;  3CGC A;  2ARD A;  3VRA A;  2B9X A;  2Q6U A;  4TM4 A;  2BAC A;  3R9U A;  3UP4 A;  5BRT A;  3CN8 A;  5JCN A;  2XLR A;  1F8W A;  1VG9 A;  4U8O A;  4J33 A;  1N4V A;  2Y6R A;  2R9Z A;  2WS3 A;  2ZZ0 A;  1EL7 A;  1PXA A;  3H8L A;  4FX9 A;  4CNJ A;  3NN0 X;  4CCR A;  2JB1 A;  4NEW A;  4B67 A;  3UKQ A;  2YLX A;  3GSI A;  5U25 A;  1PXB A;  4OVI A;  3UOY A;  1B4V A;  2A89 A;  4DGK A;  1S2Y A;  1CC6 A;  3VRD B;  4J2W A;  1W4X A;  3UP5 A;  4EMI A;  2GQF A;  4JNA A;  3NH3 X;  3AE7 A;  2QA2 A;  3II4 A;  5KOW A;  2B7R A;  2VVM A;  1H83 A;  1HYU A;  1VDC A;  3C96 A;  3LXD A;  2V3B A;  1XPQ A;  1ELI A;  2X8G A;  4FK1 C;  3RP8 A;  1H82 A;  4EM3 A;  3ALL A;  2VVL A;  2JK6 A;  3K30 A;  4EIQ A;  5JCI A;  3I6D A;  1ZY8 A;  4J56 A;  1VQW A;  2ZZB A;  3GWD A;  2X50 A;  3C4N A;  2C7G A;  5HYM A;  4PAA A;  2BS3 A;  1XAN A;  4AP3 A;  5J60 A;  4H4V A;  1TDF A;  2Q7V A;  2YAU A;  1L9D A;  4K2X A;  3GD3 A;  4OPG A;  4EQX A;  1NDA A;  2R0P A;  3DGZ A;  2H89 A;  3DK4 A;  4GRT A;  1QLB A;  3QFB A;  3K7M X;  4I59 A;  4OPT A;  4BK2 A;  1VRQ B;  2WHD A;  1S3E A;  1EL5 A;  1NHR A;  5CKU A;  2BS4 A;  4Y4N A;  5FS6 A;  4OCG A;  4A9W A;  2PHH A;  4LII A;  3UKF A;  1D7Y A;  1XDI A;  4I58 A;  4CY8 A;  2C64 A;  4YSY A;  2EQ6 A;  2R0C A;  4TM3 A;  1GRF A;  4GDE A;  2GMJ A;  1TDN A;  3NTD A;  3LZW A;  1V59 A;  4C5O A;  1H7W A;  4Z25 A;  4XWZ A;  4NEV A;  2TPR A;  4BUR A;  4OPI A;  1OJA A;  3CNT A;  2E4G A;  4AT0 A;  3NKS A;  2XVI A;  3M13 A;  3K7Q X;  3GMC A;  4IA5 A;  4B68 A;  3V3O A;  3P4Q A;  2GR3 A;  3COX A;  4C3X A;  1IUX A;  3BI2 A;  1RSG A;  2WP6 A;  4IV9 A;  3OZ2 A;  2R4E A;  4J36 A;  1PBC A;  3CND A;  3S61 A;  1FEB A;  3KU9 A;  3AYJ A;  1XHC A;  1CC4 A;  3QVP A;  5EB5 A;  3IC9 A;  2WU5 A;  4GDP A;  1NEN A;  1D4C A;  4YSH A;  1IUU A;  2YG6 A;  3ALJ A;  3CNP A;  4RSL A;  1FCD A;  3DH9 A;  3E1T A;  3F8R A;  3C4A A;  2YVJ A;  1E1L A;  3P4R A;  3DJE A;  4U2T A;  3SGL A;  3GYJ A;  2RGH A;  4ZCC A;  4TLX A;  2AR8 A;  3FPZ A;  5HXI A;  1AOG A;  2R46 A;  3I3L A;  2OLN A;  3IF9 A;  4JY2 A;  5IPY A;  3L1R A;  2V61 A;  1IUS A;  2F5Z A;  2XCG A;  2DKH A;  1DXL A;  3BNM A;  3M0O A;  4H2R A;  2B9Y A;  4U8L A;  1DOD A;  3LB8 A;  1NG3 A;  3Q6J A;  3QVR A;  2J3N A;  3AD9 B;  5EBK A;  1FL2 A;  1JRZ A;  2C76 A;  3CPJ G;  1LJ1 A;  2YVG A;  1OJT A;  3NK1 X;  4YSX A;  2BCG G;  4XWR A;  4LU6 A;  5HHF A;  1S3B A;  1H81 A;  2HQM A;  2XDO A;  1GRG A;  2YQU A;  3AEG A;  2PYX A;  2R45 A;  2X99 A;  1LVL A;  1UKV G;  4J34 A;  4C77 A;  1OJ9 A;  1F6M A;  3BI5 A;  4MJW A;  3CNJ A;  2XFU A;  1PS9 A;  1KSU A;  4YKF A;  1PHH A;  1PN0 A;  4O5U A;  4Z24 A;  3UKK A;  2JB2 A;  3BNU A;  2XLT A;  1QO8 A;  3K7T A;  1E1N A;  1TDO A;  1TRB A;  2WBA A;  2XLS A;  4BK3 A;  2C3D A;  3AE8 A;  2BK3 A;  2V60 A;  4P9S A;  1NEK A;  1YKJ A;  1ZX9 A;  1LTX R;  4IA6 A;  3NYF A;  4XXG A;  4YTP A;  3KPF A;  5FS8 A;  3GQH A;  3AE5 A;  3G5S A;  5L46 A;  1NAA A;  3CPI G;  4H2P A;  2WDV A;  4GUV A;  1B5Q A;  2B7S A;  2B9W A;  1P2H A;  3BHF A;  2C3C A;  1Q1R A;  4HB9 A;  4Y4L A;  2C65 A;  3FG2 P;  3QJ4 A;  1D4E A;  1YQ3 A;  2X8C A;  3UTH A;  3VRB A;  4REK A;  4LA1 A;  1E7P A;  1DOB A;  1LV0 A;  1EBD A;  3ICR A;  2IVD A;  4CY6 A;  2JAE A;  2Q0L A;  3NYE A;  2IVE A;  2ZZC A;  2RGO A;  3ATQ A;  3ADA B;  1F3P A;  5DBJ A;  3L8K A;  1BKW A;  2EQ9 A;  4OPU A;  3RHA A;  3NK2 X;  2FJB A;  2XFO A;  4B65 A;  4U2S A;  1CL0 A;  1K0I A;  1IJH A;  1PJ7 A;  1O5W A;  3BHK A;  3FIM B;  2GR0 A;  3AE4 A;  2WPF A;  3NHO X;  5ER0 A;  3V76 A;  2V5Z A;  2RAB A;  5KXJ A;  3P1W A;  2NPX A;  4OPL A;  3NRN A;  2JBV A;  2QA1 A;  1DNC A;  1PBD A;  3T37 A;  1GRT A;  1TDE A;  3B6D A;  3KA7 A;  2YR6 A;  3CNS A;  5LV9 A;  1E1K A;  1L9E A;  4IVM B;  3VR8 A;  2CVJ A;  2VRM A;  1Q1W A;  3URH A;  1CC2 A;  4ZCD A;  3DGH A;  1CJ3 A;  1PDH A;  1GPE A;  1CJ2 A;  2C67 A;  2TMD A;  2A87 A;  4U8J A;  4D03 A;  1Y56 A;  2FJA A;  1YQ4 A;  4YTM A;  3UKL A;  4ADW A;  1E1M A;  2WEU A;  1REO A;  1M64 A;  4A6N B;  4H4W A;  1E6E A;  1GXF A;  3BI4 A;  4U2L A;  3IWA A;  2FBW A;  3CIR A;  1D7L A;  3F8D A;  2BXS A;  3NN6 X;  3NK0 X;  4H4T A;  4RG4 A;  5J7X A;  3SFD A;  1PXC A;  1VG0 A;  5GRT A;  3Q9T A;  1GND A;  4H4P A;  2VZ2 A;  3EF6 A;  4UP3 A;  4FDC B;  4USR A;  4EQW A;  1H7X A;  3UKA A;  4YT0 A;  3H4K A;  1MO9 A;  5C3J A;  1Z6L A;  3AWI A;  3DK9 A;  1PJ6 A;  3P4P A;  1ZMD A;  2YVF A;  3QFA A;  2XFN A;  4EMJ A;  1GET A;  2GAH B;  3NG7 X;  4H4X A;  3VQR A;  2YLS A;  3ABV A;  1PJ5 A; 
#chains in the Genus database with same CATH topology
 5AQR B;  3ZYM A;  3UOZ A;  2UZZ A;  1GES A;  2XFP A;  3M12 A;  2BBH A;  4CNK A;  3ISH A;  2GVC A;  2L8K A;  4LF9 T;  2J62 A;  3AEF A;  4H9O C;  3J8F 4;  2NW8 A;  2ES0 A;  2KIN B;  5A1L A;  4IHJ E;  3GN5 B;  4HN9 A;  3NVO A;  4C91 A;  2E5L T;  1JRX A;  3VKG A;  5IWA T;  3IHR A;  3HKD E;  3HYX A;  2CFY A;  2WY2 A;  1SEZ A;  4TM0 A;  4DR6 T;  3H3M A;  1IUT A;  4I4T E;  5TR3 A;  2C75 A;  4EIW A;  2LKG A;  4ILB A;  5BMV E;  3ZMU B;  5KMQ A;  1D1C A;  2C72 A;  1CUN A;  2QAE A;  3L39 A;  3AEC A;  3UUN A;  3UOV A;  1CF3 A;  4PJL A;  2XM1 A;  2GR2 A;  2K48 A;  4K0K T;  3ZSS A;  2RP4 A;  5LCY A;  4Z43 A;  4DV2 T;  1DU2 A;  4B66 A;  2FJD A;  3UTF A;  4G6G A;  3WE0 A;  1DOC A;  3AA7 B;  2OA1 A;  1FEA A;  5JCL A;  4X1I E;  2MPK A;  3DJD A;  3ZEF B;  4H9Q C;  4HWH A;  2YG5 A;  4EMW A;  4X62 T;  4QH1 A;  2XLP A;  3Q5W A;  1XMO T;  3AD7 B;  2CBJ A;  2IHR 1;  2WP5 A;  4CCQ A;  2Y6Q A;  4MFR A;  3KV5 A;  1LQU A;  2R0G A;  4H2N A;  1IJ6 A;  1UGO A;  2BRY A;  3NYC A;  2BXR A;  4FI5 A;  4PK6 A;  3OKQ A;  1HRI 4;  2AQJ A;  5LHG B;  4I43 B;  2YEV C;  4QXH B;  4C90 A;  4U8N A;  3EDV A;  1F8R A;  3RRW A;  4DSH A;  2BYB A;  5LG3 A;  5KRQ A;  2Q0K A;  1D5T A;  2W62 A;  4X9M A;  3H3A A;  2EQ8 A;  2KZ7 B;  2OLT A;  2PYJ A;  2W2U A;  3PUZ F;  5AQH B;  1MNE A;  2CXF A;  2NVK X;  1BR1 A;  3N9L A;  2VQE T;  4EYY R;  3SUC A;  1W0B A;  5CJ5 A;  3PJA J;  2A8X A;  4YWO A;  1MOK A;  2CCQ A;  5F5W A;  3HKE E;  2N9D A;  2UXC T;  3EPT A;  4PK5 A;  2DKI A;  3GDN A;  3I0Q A;  5LJN A;  3EAM A;  1AJ3 A;  1PBE A;  2LOP A;  4X65 T;  2C70 A;  5KMG P;  5JTG A;  4HWC A;  4EEB A;  1RUG 4;  3RI5 A;  3ICT A;  4AXP A;  5F3J A;  4B3S T;  3LBX B;  3T1Y T;  1LQT A;  1HTJ F;  2PTF A;  4O5Q A;  3AED A;  4CXX A;  2HH7 A;  3LK4 2;  4K5S A;  3M3Z B;  4Z2U A;  1IJ5 A;  4AKI A;  4LF6 T;  4Q25 A;  1GT8 A;  4ZZC A;  4C3Y A;  4IDZ A;  2JJ9 A;  3EI0 A;  1XDP A;  2CXD A;  3CQC B;  4H2Q A;  3PS9 A;  4ASK A;  2KSR A;  2QCU A;  2XYO A;  1BGN A;  3QNU A;  2IID A;  4H4U A;  3RF1 A;  1RYI A;  4P0B A;  3ZYL A;  2Y6X A;  1FMW A;  1RUI 4;  3T0K A;  4OYK A;  2RPA A;  1AR6 4;  3PDY A;  2ACZ A;  5L3F B;  3UTG A;  3OYZ A;  2JKC A;  2DI4 A;  1D0X A;  2Z5Y A;  5HCJ A;  1NCQ D;  4ILC A;  4AQY T;  1XNQ T;  2XQ4 A;  2JQK A;  5GON E;  2UXN B;  4ICY A;  3ZMV B;  2XQ7 A;  3RNM A;  5M0Z A;  4EQR A;  5FY1 A;  2FJE A;  5LMU T;  1ASJ 4;  1YY5 A;  4K5R A;  2BC0 A;  2B76 A;  3UKH A;  4AQF A;  3IEE A;  1PBF A;  1MXT A;  2WET A;  4OX9 T;  2CHO A;  3AXJ A;  1VOM A;  2V8S V;  1M62 A;  2VKH A;  5LJM A;  4NTC A;  4PNI A;  3IF8 B;  2YM2 A;  4AOX A;  3AB3 B;  4YSZ A;  2BG9 B;  4QKN A;  2X3N A;  4ILA A;  4GCM A;  1K0J A;  2XQ8 A;  3SOL A;  4A65 A;  2PYL A;  5LXT E;  4H50 A;  4RHV 4;  3UP4 A;  2BAC A;  1F8W A;  2Y6R A;  2WS3 A;  1EL7 A;  4FX9 A;  4H63 V;  3NN0 X;  4CCR A;  3B13 A;  5FVL A;  1RMU 4;  3OYX A;  2YLX A;  2Q9Q C;  4HEA A;  4OVI A;  3UOY A;  2LHN A;  3GMI A;  4DGK A;  1S2Y A;  1FMV A;  2H7V C;  3VRD B;  3IA3 A;  1NWM X;  4EMI A;  4QH5 A;  5IYZ E;  4IST A;  3AE7 A;  2QA2 A;  3II4 A;  2MTQ A;  2VVM A;  3C96 A;  2V3B A;  2X8G A;  4FK1 C;  4GAP A;  4IIJ E;  1H82 A;  2KT9 A;  3NZQ A;  5CA0 E;  4UVC B;  3N9M A;  3I6D A;  2KWH A;  3GWH A;  2VK9 A;  4NNJ A;  2KLQ A;  2XAS B;  3BK9 A;  3GWD A;  5JDL A;  3C4N A;  4DBR A;  4AP3 A;  4UV8 B;  3ZLI A;  3F2E A;  1TDF A;  4IE6 A;  4EQX A;  4L5G A;  3DGZ A;  1OWA A;  2W66 A;  4QWN B;  4QX7 B;  2C5J A;  4BK2 A;  2BS4 A;  5FS6 A;  2A72 A;  2PHH A;  3QC9 A;  4LII A;  1D7Y A;  1XDI A;  2VKJ A;  4N78 D;  1H8T D;  1TDN A;  2QYW A;  4BA9 A;  1HF8 A;  1NA1 D;  1YKE B;  3ZMZ B;  2J47 A;  4OPI A;  2E4G A;  4ILU A;  3RRC A;  4O4J E;  3K7Q X;  2XQ9 A;  5AQJ B;  4CXW A;  2GR3 A;  3COX A;  4C3X A;  1RSG A;  4IV9 A;  2VUR A;  2R06 4;  4TWF A;  3X1D A;  3EUH A;  2R4E A;  4J36 A;  5LGN B;  3S61 A;  1XNR T;  1FEB A;  5AQM B;  4GDP A;  3DP7 A;  5BR8 T;  5JDG A;  1IUU A;  3ALJ A;  5AQT B;  4TV9 E;  4COF A;  4RSL A;  3O1J A;  2LRK A;  3AVR A;  4V1A v;  1FCD A;  3DH9 A;  5KMR A;  2ZM8 A;  3CKD A;  3C4A A;  4TLX A;  2R46 A;  4U31 A;  2OLN A;  2IUB A;  2WB5 A;  2H3R A;  2OA5 A;  3PUW F;  4L0R A;  4EYU A;  4PJJ A;  3R84 B;  3ETV A;  2DKH A;  1DXL A;  4H2R A;  3JD7 4;  3UUX B;  4JLE A;  2UUC T;  2XZE A;  3CPJ G;  3B57 A;  3CMM A;  2YVG A;  1OJT A;  3NK1 X;  5KDM C;  4LU6 A;  2MOZ A;  1H81 A;  2HQM A;  3TLV A;  3DTO A;  2C0S A;  3ZKR A;  3CPZ A;  4C77 A;  1I94 T;  1J5W A;  3I9W A;  1PS9 A;  3TKL B;  1KSU A;  1PHH A;  3KBU A;  1PN0 A;  1EAH 4;  3UKK A;  4JI7 T;  4BJM A;  4TNV A;  2XLT A;  4O4H E;  4DVD A;  1TDO A;  4GOU A;  1VBD 4;  3R6N A;  3U78 A;  2V7L A;  3AE8 A;  4HFD A;  2BK3 A;  1NEK A;  3ZJ1 A;  2ODU A;  2E9X C;  2HPJ A;  1LVK A;  4YTP A;  4XXG A;  5FS8 A;  1SUM B;  4H2P A;  2XPK A;  4P09 A;  3SYI A;  1MMN A;  2B9W A;  1P2H A;  3BHF A;  4HB9 A;  4PFO A;  3FG2 P;  3QJ4 A;  4L9I A;  1YQ3 A;  2X8C A;  2CMR A;  3UTH A;  3VRB A;  1E7P A;  3LFM A;  1DOB A;  3TLU A;  4ISS A;  2Q0L A;  3PUV F;  2IVE A;  3ZJ2 A;  5DBJ A;  4JI6 T;  3T14 A;  2I59 A;  4MLK A;  1PJ7 A;  3AE4 A;  4B3M T;  2WPF A;  3V76 A;  5ER0 A;  2V5Z A;  2NPX A;  4OPL A;  3NRN A;  1DNC A;  1PBD A;  5HWX A;  2XSB A;  1UX4 A;  3ZT5 A;  1G73 A;  4IVM B;  2CVJ A;  1CC2 A;  1GPE A;  2WMN A;  2C67 A;  2A87 A;  4U8J A;  4HFB A;  1YQ4 A;  3B5M A;  5JDF A;  1QSD A;  3BQK A;  5L3G B;  4JBW F;  4H4W A;  2DCF A;  5AQO B;  1E6E A;  3V5U A;  1GXF A;  2ZMA A;  4KHP T;  3BI4 A;  3IWA A;  4WW0 A;  1UK5 A;  3NN6 X;  1XHZ A;  4RG4 A;  3AXJ B;  1VG0 A;  1GND A;  1J1J A;  2ZM2 A;  3EF6 A;  4H4P A;  4EQW A;  1H7X A;  2KWI B;  5LYJ E;  3P4P A;  4HWF A;  5M4Y A;  4IRE A;  3NG7 X;  4H4X A;  3VQR A;  2YLS A;  4O2B E;  4FJO A;  2XAQ B;  2IML A;  4DUY T;  2K9A A;  1RUF 4;  2XJ7 A;  2WZH A;  4I0U A;  3PUY F;  3Q5X A;  5BVA A;  1KF6 A;  3OJA A;  2UUA T;  5FS9 A;  2LM2 A;  3G5R A;  3UU8 A;  2RS1 4;  4IGU A;  1EV1 4;  3QSM A;  2H88 A;  2PFV A;  2X9X A;  5KVI A;  4NTE A;  2GK9 A;  1X79 A;  1SE7 A;  1MMA A;  1K5M D;  3CQX C;  4EIP A;  1JEH A;  1NHP A;  3SZF A;  2L9Q A;  2XUE A;  1N1P A;  3JAF A;  4NZH A;  4KI0 F;  4NPP A;  4AOS A;  3ITJ A;  3ZDN A;  5J1G A;  4ZS2 A;  4GR1 A;  3UOX A;  4H4Z A;  3CML A;  2WQY A;  4ZN0 A;  2UU9 T;  4A5X A;  3NIX A;  4AP1 A;  2V7I A;  3CGE A;  1ZKQ A;  3SWH A;  3SZ0 A;  4ECH A;  2D5U A;  3RX6 A;  4GKK T;  2XQ6 A;  1OED C;  3JC6 D;  3HZL A;  3KLJ A;  4GIW A;  4TWD A;  3AE6 A;  3LOV A;  4H7U A;  5FXZ A;  4PAB A;  4U7Y A;  2GH5 A;  2PJQ A;  2XM2 A;  4YKG A;  2V7J A;  1O95 A;  2W61 A;  3KV9 A;  2ZM6 T;  2VQ7 A;  4APN A;  3GRS A;  1HNX T;  1IAP A;  3FZM B;  4CBQ A;  3HL6 A;  2I6H A;  2SPC A;  3L3P A;  2APG A;  2OAM A;  3E0Z A;  2VOU A;  2IAK A;  4MBQ A;  4CZZ B;  3UTE A;  1XWM A;  2CE7 A;  5U1O A;  3SM8 A;  4GYS A;  5GSN A;  1QUU A;  4KX6 A;  2AXD S;  2UXX B;  4U33 A;  4BJN A;  1Z7S 4;  2R6G F;  2BAB A;  2GV8 A;  4IL9 A;  1L9C A;  3GDP A;  4ZI2 D;  1N34 T;  3MK7 C;  1HG5 A;  1RUH 4;  4A97 A;  1N4U A;  2EHO D;  4IDO A;  3LZX A;  3PU3 A;  4U3C A;  3EAB A;  5LGT B;  2CUL A;  2CXL A;  3RIA A;  3L09 A;  2YOE A;  2J1D G;  5JDM A;  3GYI A;  1GRE A;  4EQS A;  4CN1 A;  4B6X A;  1ZDL A;  5LG4 A;  3ZC0 A;  3ZYX A;  1M7K A;  4U7I A;  1IUV A;  3PVC A;  2YDQ A;  2XVE A;  2X5I D;  4TM1 A;  5IHY A;  2JB3 A;  1XI1 A;  4TV8 E;  4M52 A;  3W15 B;  2WAU A;  2WOW A;  4UDR A;  1QJD A;  5LHH B;  3MXZ A;  4B3R T;  4A56 A;  2EHO A;  1H86 A;  1MIV A;  3ZT6 A;  4NTD A;  1NHQ A;  2X8H A;  4CN4 A;  3NWI A;  3GRT A;  2YU1 A;  1M6I A;  1L0V A;  2E1M A;  4I50 E;  1K0L A;  2OV9 A;  5BUL A;  2X66 A;  3KFW X;  5L2L A;  5CGM A;  1NPX A;  2YK0 A;  4D04 A;  3EDU A;  3D8X A;  1CJ4 A;  5AQV B;  4JUY A;  1KNP A;  1CJC A;  1GOS A;  4X4J A;  4A79 A;  1VCT A;  2EQ7 A;  4USQ A;  2V6Y A;  4YFS A;  4QXC B;  1HNW T;  5M10 A;  2JQH A;  3P8C D;  3SZC A;  1GER A;  3ZCJ A;  5HXE A;  3CGB A;  4A6N A;  2XAG B;  3UU3 A;  3NGC X;  2K24 A;  2Q9Q B;  2JMH A;  1RUE 4;  3WI3 A;  4U8M A;  5AQU B;  3KD9 A;  2R04 4;  2NTX A;  3CX8 B;  3ESL A;  3AAA B;  4HFE A;  1FIO A;  2XQ5 A;  4H9N C;  3ZST A;  5JVD E;  3AAI A;  4X64 T;  2XAH B;  2D2S A;  2V1D B;  2XVH A;  2VAS A;  3PUG A;  5FP3 A;  1B37 A;  1DJN A;  2GRT A;  2EX3 A;  5KMP A;  4U8I A;  1BR0 A;  5FS7 A;  5AQS B;  2ARD A;  3VRA A;  2B9X A;  4ADZ A;  4DR7 T;  4PDW D;  4DUZ T;  2XLR A;  1VG9 A;  3CK6 A;  4U8O A;  4J33 A;  4G74 A;  5JR9 A;  2XQY A;  5IUX A;  2VQF T;  1I6Z A;  1N4V A;  2R9Z A;  2ZZ0 A;  2A2F X;  3O4X E;  3G06 A;  3UQ7 A;  2JB1 A;  4NEW A;  4X5T A;  3GSI A;  5LBQ B;  3FXD B;  4JI5 T;  1PO1 4;  4BAY B;  3UP5 A;  2GQF A;  4JNA A;  5KOW A;  2B7R A;  1H83 A;  2NW9 A;  4KMC A;  3ALL A;  3EHZ A;  5FXV A;  2WWV A;  2B1E A;  3C98 B;  4J56 A;  1VQW A;  5DQW A;  4TN7 B;  2X50 A;  2C7G A;  3RPU A;  4PAA A;  2H7O A;  3RIF A;  2YAU A;  2QVA A;  3MJX A;  4K2X A;  4PJM A;  4DV0 T;  2R0P A;  3K1S A;  1HFA A;  4CI1 B;  3WAJ A;  4I59 A;  1QLB A;  3FHN A;  1VRQ B;  2WHD A;  3RIU C;  4P1N A;  4Y4N A;  4OCG A;  4G6H A;  1N33 T;  3P50 A;  2EQ6 A;  4DV6 T;  3UU4 A;  2GMJ A;  1S94 A;  4C5O A;  3LG7 A;  2LEH A;  3BQI A;  4BUR A;  3C51 A;  3JAD A;  4PK4 A;  3RKG A;  3V5S A;  4IA5 A;  3C50 A;  3P4Q A;  3KVA A;  2CWO A;  3DJB A;  4TZ4 C;  2W00 A;  1LRZ A;  4OYJ A;  1PBC A;  5FY0 A;  1WRD A;  3AYJ A;  3QVP A;  2WU5 A;  1D4C A;  3CNP A;  2NR4 A;  3E1T A;  4TWH A;  3P4R A;  3CQG B;  3GYJ A;  1AR8 4;  2E2A A;  3FPZ A;  5HXI A;  5HXC A;  1AOG A;  3I3L A;  4UV9 B;  2E9X B;  2UXB T;  2F5Z A;  5LB7 B;  2XCG A;  4ZI3 C;  1FEW A;  2MBG A;  3BNM A;  5LHI B;  2B9Y A;  3LB8 A;  5KNL A;  2C76 A;  3J9X 1;  2C5I T;  4YSX A;  2BCG G;  4XWR A;  3AA0 B;  3AEG A;  2FUP A;  2X99 A;  4J34 A;  4MJW A;  4YKF A;  2XFU A;  4Q4Y 4;  3NZP A;  4Z24 A;  2JB2 A;  1HNZ T;  4IDP A;  1QO8 A;  5CFB A;  1HCI A;  1E1N A;  4YY3 T;  1TRB A;  4LFB T;  2XLS A;  2V60 A;  5KX5 E;  1YKJ A;  3KPF A;  3G5S A;  2WDV A;  4Q4W 4;  4M1P A;  2C3C A;  4JEH B;  1Y01 A;  2VB6 A;  2JAE A;  3ADA B;  2EHO B;  3P7I A;  3AA6 B;  3L8K A;  4OPU A;  3RHA A;  3NK2 X;  1U5P A;  4NXM T;  4B65 A;  1K0I A;  3BHK A;  1O5W A;  3FIM B;  3FZH B;  3ZMS B;  4UEL A;  4GK5 E;  3NHO X;  1BEV 4;  4U72 A;  2JBV A;  2JMK A;  4MAL A;  1L9E A;  3VR8 A;  2BKO A;  1Q1W A;  2X0L B;  4F8H A;  1CJ2 A;  1OED E;  4GB3 4;  3C4W A;  2V6Y B;  4DV7 T;  2N2N A;  2HPL A;  5HYA A;  3UKL A;  4ADW A;  4JI4 T;  1M64 A;  4NXN T;  4AQG A;  1REO A;  4A6N B;  2KND A;  2FBW A;  1X9B A;  2WBL A;  4JI1 T;  3NK0 X;  5J7X A;  3PUQ A;  5L4E A;  1O3X A;  4QH4 A;  2VZ2 A;  3UKA A;  4YT0 A;  1PJ6 A;  2D0T A;  5JH7 E;  4EMJ A;  4E7Z A;  2MAW A;  2GAH B;  3C4Z A;  3ABV A;  2LSG A;  2DLR A;  2I0Z A;  2BS2 A;  2IIU A;  2UXD T;  2A9U A;  1KEY A;  2CWY A;  2W0H A;  1GQE A;  5FL0 A;  1GRA A;  4JN9 A;  3EAO A;  5JR9 B;  1AR9 4;  2PZS A;  1D1A A;  2XVF A;  5FXW A;  1VBE 4;  4UDP A;  1KK7 A;  2X9Y A;  2DNX A;  3UCL A;  4EAH A;  2XSA A;  3AEA A;  1K4Q A;  2YG7 A;  1JOA A;  5L4H A;  3TLS A;  3PUX F;  3P9U A;  3AVS A;  3QK6 A;  4AIU A;  4YHJ A;  3S5W A;  3KKJ A;  2WDR A;  1XMQ T;  1ZP0 A;  4TX5 A;  5JCK A;  3JAE A;  3AE3 A;  4DR2 T;  1Y64 B;  1TDK A;  4B69 A;  3KPK A;  4WYV A;  3CGD A;  5ABG A;  1B7T A;  3CWZ B;  1DOE A;  2V7K A;  4LML A;  1R09 4;  4EB6 E;  1COY A;  4E0V A;  4AI6 A;  2GR1 A;  2VRL A;  1GSN A;  4YJ2 E;  3IHG A;  5J2U E;  3Q5E A;  4Z2R A;  2YLT A;  3QSS A;  4X9N A;  2WM9 A;  2LE8 A;  3N2G E;  3NNE A;  1T8B A;  1EL9 A;  3JSK A;  2G0U A;  3KV6 A;  2LSJ A;  5KWF A;  3AA1 B;  1Y56 B;  1KNR A;  1DJQ A;  1GTE A;  4DMW A;  2Q9Q D;  4UF0 B;  4TLZ A;  1EL8 A;  2GAG B;  3GQK A;  2X0H A;  1OJC A;  2V6X A;  4O2A E;  5HEU A;  2CLY C;  2GEW A;  4II3 A;  5FMN A;  1T7S A;  4X1Y E;  5EK4 A;  3ZMT B;  1XZY A;  3D1C A;  3RC8 A;  4GKJ T;  2JPF A;  1XHX A;  4Q4X 4;  1COV 4;  3DK8 A;  3AXB A;  3ZC1 A;  2GF3 A;  4UDQ A;  1FJG T;  2BVL A;  4DV5 T;  3FBS A;  2XFQ A;  2WES A;  2V5C A;  3E08 A;  3DME A;  4ZEY A;  5EK2 A;  4U74 A;  1KSS A;  3AEE A;  1JU2 A;  2LLY A;  4LMK A;  2DL1 A;  5HEH A;  2Q9Q A;  4MHC A;  3NKZ A;  3UQ4 A;  4OPC A;  2AAQ A;  2LKH A;  3HYV A;  3CVR A;  5FKY A;  1Y0P A;  2WSS V;  1H7C A;  1S2Q A;  2Y8D A;  2GMH A;  3AAE B;  3GD4 A;  2BG9 C;  4BJZ A;  2C5K T;  4FK1 A;  5IQ4 A;  2XQ3 A;  2CPT A;  2BCP A;  2A3D A;  1RUJ 4;  4A98 A;  4EZ4 A;  5EB4 A;  3OC4 A;  1CBO A;  2BA9 A;  1PBB A;  3B3R A;  3DJG X;  3UKP A;  2OAL A;  4HFH A;  4JDR A;  4GF7 A;  4WX1 A;  5KOX A;  4WCT A;  5DJQ C;  4JQ9 A;  2BVM A;  4AKG A;  2YWL A;  1RHI 4;  2Z6E A;  5HXR A;  4PAG A;  4AIS A;  2BC1 A;  2V6O A;  3PJA A;  3QSE A;  1VBC 4;  3NLC A;  2R07 4;  3QOF A;  4Z26 A;  4YTN A;  3V3N A;  3G5Q A;  2CRB A;  3HKC E;  1MMG A;  3ZYK A;  3CPH G;  1RP0 A;  1U4Q A;  2NTY A;  4JY3 A;  1V9D A;  2RA1 A;  4IE0 A;  2GB0 A;  1VCS A;  2HWB 4;  2XY8 B;  1BR2 A;  3UFE A;  3RYC E;  3KVE A;  2YN6 A;  1T98 A;  3IHM A;  5JRC A;  3LJC A;  1IZN B;  3LJP A;  1WLX A;  4HA6 A;  4H4S A;  3P4W A;  2P9B A;  1HX1 B;  2BZB A;  1IBK T;  3F8P A;  4K0U A;  5HAX A;  3ATR A;  4AKR B;  4LF7 T;  2BK4 A;  5AQI B;  2WPE A;  4ZI7 E;  5C2T A;  4H4R A;  5AQQ B;  1NG4 A;  4ZS3 A;  1ZK7 A;  4BK1 A;  1TYT A;  4YXD A;  1D0Z A;  1OXZ A;  3IBP A;  4H9R C;  1YKH B;  4DSG A;  2RR1 4;  2I0M A;  4PW8 A;  2E9X D;  3SY4 A;  2C73 A;  3ICS A;  1AL2 4;  1H6V A;  5JCM A;  1Z8U A;  2X67 A;  2C4C A;  4LFA T;  2RGJ A;  2NOX A;  4G63 A;  4G2A A;  4IL4 A;  4DO0 A;  5BUK A;  4XZC A;  3GWF A;  2X0Y A;  1UUR A;  4H4Y A;  2IC6 A;  2X9W A;  4KPR A;  4KHZ F;  1Z0P A;  3CGC A;  4TM4 A;  2IDO B;  3T2Y A;  5ABH A;  2XHE B;  4P0A A;  4JYA T;  2E9X A;  3H8L A;  3UUB A;  2PW9 A;  3HI2 A;  5U25 A;  4IDQ A;  1PXB A;  3FZL B;  4DR4 T;  1B4V A;  2A89 A;  1CC6 A;  3K3N A;  3O9X A;  2HN1 A;  2XQA A;  4J2W A;  1W4X A;  3NH3 X;  1VDC A;  2X51 A;  3C64 A;  3I0O A;  1XPQ A;  1ELI A;  4IE7 A;  3RP8 A;  4EM3 A;  5HXH A;  2YIN A;  3CX6 B;  3K30 A;  2JK6 A;  4EIQ A;  1ZY8 A;  5L3C B;  2ZZB A;  3ONL C;  4HFV A;  4CXY A;  1ZKE A;  5HYM A;  2BS3 A;  5H6Q B;  2Q7V A;  1AR7 4;  3GD3 A;  1XDO A;  5HXS A;  4AKL A;  3RYH E;  2H89 A;  3QFB A;  3K7M X;  1VRB A;  1EL5 A;  1NHR A;  5CKU A;  4A9W A;  3PTR B;  4CY8 A;  4JEU B;  4I58 A;  1MQT D;  2C64 A;  4YSY A;  3MAC A;  2R0C A;  4TM3 A;  2HWC 4;  4Z25 A;  4NEV A;  3CNT A;  1WR6 A;  1ZEE A;  3KIN B;  3GMC A;  4B68 A;  5LBM A;  5FL1 A;  2YDR A;  3UTK A;  2W67 A;  2KXP B;  3BI2 A;  3OZ2 A;  2M67 A;  4HWD A;  3CND A;  1HX8 A;  3KU9 A;  1XHC A;  4O4I E;  4DR1 T;  3I1A A;  2YG6 A;  2LJL A;  3SX6 A;  2YVJ A;  1E1L A;  3DJE A;  3SGL A;  2RGH A;  2HN2 A;  4H9P C;  3OBV E;  4WNK A;  4YLH A;  5IPY A;  3IF9 A;  5ABF B;  2V61 A;  2JIW A;  1IUS A;  4DID B;  4KUM B;  2LSI A;  1LKX A;  4AQF C;  3VU7 H;  4U8L A;  1PO2 4;  3RQW A;  3QVR A;  1NG3 A;  3Q6J A;  1FL2 A;  1JRZ A;  2LRL A;  2V5D A;  1UUS A;  1IBM T;  2WZI A;  4WBN E;  4LMJ A;  3D0T A;  5HHF A;  1S3B A;  2XDO A;  2BKN A;  1MMD A;  2CA5 A;  2YQU A;  2PYX A;  2R45 A;  1LVL A;  1UKV G;  1OJ9 A;  1F6M A;  3HYW A;  1ZV4 X;  3CNJ A;  2E8I A;  4TUY E;  4O5U A;  2NWB A;  4OK0 A;  5FYM A;  3PU8 A;  3K7T A;  4BK3 A;  2C3D A;  2RS3 4;  4E7S A;  4PJN A;  5LOV E;  1LTX R;  4ZZB A;  3GQH A;  2JQ9 A;  3A5X A;  1NAA A;  1B5Q A;  5LA6 E;  2C65 A;  3PV0 F;  1OED A;  5LMN T;  1D4E A;  4B3T T;  4ZXL A;  1VRH 4;  4DR3 T;  2F4V T;  4NUU A;  3ICR A;  3ONJ A;  2IVD A;  4CY6 A;  3N9P A;  3UUM A;  4CI2 B;  3ATQ A;  1HG2 A;  4DMV A;  2HHH T;  1F3P A;  1BKW A;  2EQ9 A;  4H9S E;  2XFO A;  1WCR A;  3KBT A;  1CL0 A;  2D9D A;  1IJH A;  2X68 A;  2GR0 A;  4UEM A;  5JRC B;  3ONX A;  2RAB A;  5KXJ A;  3P1W A;  2QGS A;  5FY7 A;  2RS5 4;  5JDQ A;  5CA1 E;  1WR0 A;  5HEJ A;  3HKB E;  5J2T E;  3RHW A;  1GRT A;  1TDE A;  3B6D A;  3KA7 A;  3T37 A;  3CNS A;  5LV9 A;  4HGA A;  3T31 A;  4HWI B;  5L3E B;  4QHO A;  1CJ3 A;  1EZ3 A;  5F8P A;  1PDH A;  5H6R B;  3SRZ A;  1R08 4;  2W0G A;  2TMD A;  4D03 A;  1Y56 A;  4YTM A;  4UF0 A;  2RM2 4;  3E22 E;  4XBF B;  5DAB A;  3OPC A;  3RQU A;  3FBZ A;  1J5E T;  4DR5 T;  3PE0 A;  4U2L A;  3F8D A;  2BXS A;  3FI7 A;  1PXC A;  1POV 0;  3PUA A;  3Q9T A;  4USR A;  3LDQ B;  3H4K A;  1MO9 A;  5C3J A;  3AWI A;  3DK9 A;  5HWY A;  1ZMD A;  2VL8 A;  2L3L A;  2XFN A;  1GET A;  3TLW A;  2CEA A;  4ANJ A;  1US7 B;  1SHZ C;  3O1H A;  3P4S A;  1BGJ A;  2YM1 A;  1N36 T;  4JNQ A;  2K5B B;  3VR9 A;  3N9O A;  3RYF E;  3OTO T;  3U3I A;  1IUW A;  4K22 A;  4JI8 T;  3ANW B;  2XVJ A;  2Z5X A;  2ZLY A;  4DV1 T;  3SXI A;  4U8K A;  1GRB A;  1W09 A;  4X66 T;  2BG9 E;  2XAF B;  4IE5 A;  5CQF A;  4OPD A;  3F57 A;  2YKS A;  4AT2 A;  1VBB 4;  3GMB A;  4LF8 T;  3AE2 A;  3FZF B;  2Y48 B;  5AFU L;  5JDN A;  4EV6 A;  4J2C A;  1RUD 4;  3NRX A;  4B1B A;  3T2Z A;  4BJY A;  2CLY B;  4U2Y A;  4BV6 A;  3QB5 K;  5AQK B;  2C66 A;  1MND A;  5EK3 A;  4X1K E;  1D0Y A;  4F6R C;  3NTA A;  1GRH A;  5AQL B;  2YR5 A;  4CRT A;  4YJ3 E;  5CB4 E;  1HRV 4;  1O94 A;  4A5L A;  4UR9 A;  5ABE A;  2YG3 A;  2AE9 A;  2XAJ B;  4KP3 C;  2VKD A;  3AE9 A;  3SFE A;  5FMH A;  2WP9 A;  2KMF A;  3FXE B;  2WDQ A;  3GYX A;  5J0Z A;  2BDE A;  3UU6 A;  2R4J A;  3DJJ A;  1KDG A;  3AE1 A;  5TAO A;  1LPF A;  4B63 A;  3K3Q C;  4RG3 A;  4Z2T A;  5ADX L;  1Q9I A;  2YR4 A;  1JNZ A;  1BWC A;  4C74 A;  1ZOY A;  5LGU B;  3RP7 A;  4EXT A;  4LF4 T;  3FMW A;  5KVH A;  1CHU A;  2QA7 A;  3T8O A;  3RGL A;  1YQZ A;  2VQB A;  5E0O A;  4I55 E;  3AYL A;  4EM4 A;  3K3O A;  1WYC A;  2M6B A;  1YD8 G;  1FOH A;  1JNR A;  1P2E A;  1N4W A;  4EGW A;  3AD8 B;  2XTL A;  1RUC 4;  1ZMC A;  4IVO B;  3RC3 A;  2ODV A;  1KNZ A;  4UVA B;  1GV4 A;  4WZX A;  3PO7 A;  3UU5 A;  3N2K E;  2XLU A;  1PIV 4;  4X20 E;  1TYP A;  1YXR A;  3GA8 A;  3LK2 B;  4IDN A;  1GTH A;  3UFG A;  2GQW A;  4N9X A;  2YLZ A;  4A99 A;  2WCA A;  4II2 A;  5U63 A;  3ZT7 A;  3TLT A;  4J57 A;  2ZM0 A;  2DHR A;  1NHS A;  2WWU A;  2LOS A;  5ETW A;  3ZN1 B;  1B8S A;  3F31 A;  2CBI A;  1BZL A;  3MZK B;  3RIU A;  1D4D A;  2QRX A;  2MYS A;  3ALM A;  3EAN A;  1KFY A;  1SA0 E;  1X31 B;  4NUV A;  5HY5 A;  4IT4 A;  2BK5 A;  1HS7 A;  5AQF B;  3KVB A;  3SQP A;  4HKA A;  1JRY A;  2CDU A;  1F8S A;  2PLV 4;  2VKO A;  4K8D A;  1T72 A;  2LSY A;  5IQ1 A;  4K7Z A;  3O1I A;  3LAD A;  3AYI A;  3H8I A;  4DNA A;  4Z91 A;  4ZI3 D;  5JDH A;  4PFP A;  1OED B;  2WU2 A;  2YU2 A;  3AB1 A;  2E5V A;  3NBX X;  3CTY A;  3N9Q A;  1D1B A;  1GEU A;  1VBA 4;  3LSV A;  4GAV A;  3RYI E;  4KBM B;  5FVK A;  2OLO A;  2WPC A;  2LFC A;  1WYB A;  4A7A A;  2V3A A;  4Z44 A;  2PBI A;  1ZOV A;  4B64 A;  2VVL G;  3MA9 A;  3RP6 A;  2O9Z A;  2WOI A;  2UUB T;  4TNW A;  3Q5D A;  1LVF A;  5LP6 E;  2JQQ A;  3LK3 B;  3KDS E;  1NAF A;  4U8P A;  2V7M A;  2YG4 A;  3RED A;  1ONF A;  2YLR A;  3I9Y A;  4G73 A;  3PUS A;  4XAX B;  5EOW A;  3DA1 A;  3ZN0 B;  4Y4M A;  2WOV A;  1OJD A;  4QXB B;  3NT6 A;  1E39 A;  1GAL A;  4J31 A;  2YLW A;  2LM9 A;  4H4Q A;  1FEC A;  1H84 A;  2ZBW A;  4ZOL E;  3AEB A;  1BF3 A;  3BQL A;  3OVU A;  3O0H A;  1D4M 4;  2Q6U A;  5BRT A;  5HEG A;  3R9U A;  3CN8 A;  5JCN A;  1IBL T;  2X9H A;  2VVN A;  1PXA A;  5ABF A;  4CNJ A;  3JC6 C;  2LSK A;  4JI2 T;  3GN5 A;  4YHH T;  3Q2M A;  4B67 A;  2ACX A;  3UKQ A;  4UVB B;  1E1H B;  4DND A;  4LF5 T;  1WFD A;  1R8I A;  5FNV E;  2J4G A;  2VWA A;  4CI3 B;  4HFC A;  1HYU A;  3LXD A;  4G9K A;  4JV5 T;  4ZHQ E;  3N5L A;  1UX5 A;  2YDS A;  2VVL A;  5HCM A;  2BBJ A;  3Q9D A;  5JCI A;  1ZHC A;  5EZY E;  1XAN A;  5J60 A;  4AKH A;  3VHL A;  4H4V A;  3FB2 A;  3ETU A;  1L9D A;  3S4U A;  4OPG A;  1NDA A;  2N1G A;  3FBL A;  3DK4 A;  4GRT A;  4OPT A;  2R7F A;  4U2Z A;  4JI0 T;  1S3E A;  1MIY A;  3RH3 A;  4O8S A;  3MKD A;  3A8Y C;  1E2A A;  3UKF A;  4ZI2 C;  4OFZ A;  1GRF A;  3A7M A;  4CN6 A;  4GDE A;  4CQI A;  3NTD A;  1PVC 4;  3LZW A;  1V59 A;  1H7W A;  2EHO C;  2LHR A;  4XWZ A;  2V26 A;  2TPR A;  1OJA A;  2W63 A;  4AT0 A;  3NKS A;  2XVI A;  3M13 A;  3V3O A;  4O4L E;  3JBG 4;  5DQV A;  2JRK A;  3FZK B;  1IUX A;  3M65 A;  2WP6 A;  4EOZ B;  3H37 A;  5AQG B;  5EB5 A;  1CC4 A;  5LNK A;  3IC9 A;  1NEN A;  2RMU 4;  4YSH A;  4ERR A;  2M6I A;  1S35 A;  3F8R A;  4UXN B;  4U2T A;  4ZCC A;  1N32 T;  4QX8 B;  2AR8 A;  2BRA A;  3J7Y q;  4HE8 A;  4H63 H;  4JY2 A;  4EED A;  4Q4V 4;  3L1R A;  3HR0 A;  3N2O A;  3ZPO A;  1W9R A;  3SS1 A;  3M0O A;  2D0U A;  1DOD A;  3QUJ A;  2J3N A;  3AD9 B;  3ZCI A;  4NWZ A;  5EBK A;  3NRY A;  1LJ1 A;  4NIQ A;  3N9N A;  1BR4 A;  2NP9 A;  2PG8 A;  3L8R A;  5AQP B;  1GRG A;  3LBX A;  4LFC T;  3BI5 A;  2K3W A;  3VKH A;  4UIG A;  2IC9 A;  5L3B B;  1HR0 T;  4JI3 T;  2CHN A;  3UT5 E;  3BNU A;  3JCF A;  5JQG E;  4Z8X A;  5FXX A;  2WBA A;  3RKO A;  1UCU A;  5JR9 C;  4P9S A;  2BKP A;  1ZX9 A;  3QB5 A;  3ANW A;  4IA6 A;  3NYF A;  3K8P C;  3KV4 A;  1YW0 A;  3AE5 A;  5L46 A;  3PUR A;  3CPI G;  4GUV A;  2B7S A;  4DV3 T;  1Q1R A;  4Y4L A;  5L3D B;  3EVY A;  4HFI A;  3CX7 B;  5HEO A;  4REK A;  4LA1 A;  2IW5 B;  1LV0 A;  1EBD A;  3RLF F;  4HTE A;  4DV4 T;  2WMO A;  3NYE A;  2ZZC A;  2RGO A;  2LT3 A;  2VVS A;  3WAK A;  5AQN B;  2DWG A;  2NW7 A;  2FJB A;  4DBQ A;  4U2S A;  4GK0 E;  3HA4 A;  3C4X A;  2QA1 A;  1HXS 4;  2YR6 A;  1E1K A;  5KMS A;  3URH A;  2VRM A;  4IE4 A;  4ZCD A;  3DGH A;  1RVF 4;  2CM0 A;  2FJA A;  4Z90 A;  1G8X A;  2PY5 A;  2DWK A;  5C8Y E;  2BG9 A;  4EZH A;  1E1M A;  2WEU A;  4OHF A;  3UUL A;  2VL0 A;  3CIR A;  1D7L A;  5L47 A;  4GYR A;  4H4T A;  3SFD A;  5GRT A;  2W4X A;  3T1H T;  4WBO A;  4UP3 A;  4FDC B;  5JRE A;  1W0A A;  1Z6L A;  2YVF A;  3QFA A;  1MIW A;  3SZW A;  1OOP D;  3T2K A;  1PJ5 A; 
#chains in the Genus database with same CATH homology
 3UOZ A;  2UZZ A;  3P4S A;  1GES A;  2BS2 A;  1BGJ A;  2I0Z A;  2XFP A;  3M12 A;  2YM1 A;  4CNK A;  2W0H A;  4JNQ A;  3VR9 A;  3ISH A;  2GVC A;  1GRA A;  5BVA A;  1IUW A;  1KF6 A;  4K22 A;  3AEF A;  2XVJ A;  4JN9 A;  3EAO A;  2Z5X A;  3SXI A;  4U8K A;  1GRB A;  5FS9 A;  3G5R A;  2XVF A;  5CQF A;  4OPD A;  4AT2 A;  3QSM A;  3GMB A;  4UDP A;  1JRX A;  2H88 A;  3AE2 A;  5KVI A;  3HYX A;  3UCL A;  4NTE A;  2CFY A;  3AEA A;  1K4Q A;  1SEZ A;  2YG7 A;  1JOA A;  4EIP A;  3P9U A;  1JEH A;  4TM0 A;  1NHP A;  1IUT A;  3SZF A;  4B1B A;  3T2Z A;  5TR3 A;  4BJY A;  3S5W A;  2C75 A;  1N1P A;  2WDR A;  3KKJ A;  4NZH A;  1ZP0 A;  5JCK A;  5KMQ A;  3AE3 A;  4BV6 A;  1TDK A;  4B69 A;  2C72 A;  3KPK A;  3CGD A;  2QAE A;  4AOS A;  3AEC A;  3UOV A;  2C66 A;  3ITJ A;  1DOE A;  3ZDN A;  1CF3 A;  4GR1 A;  2GR2 A;  3UOX A;  4H4Z A;  1COY A;  4Z43 A;  2WQY A;  3NTA A;  4E0V A;  4ZN0 A;  4B66 A;  2FJD A;  3UTF A;  1GRH A;  2GR1 A;  2VRL A;  3NIX A;  2YR5 A;  4G6G A;  3WE0 A;  1GSN A;  4AP1 A;  4CRT A;  3IHG A;  3CGE A;  1O94 A;  1ZKQ A;  1DOC A;  4A5L A;  2OA1 A;  2YG3 A;  4Z2R A;  1FEA A;  3AE9 A;  2YLT A;  3QSS A;  4X9N A;  5JCL A;  3DJD A;  3SFE A;  5FMH A;  2WP9 A;  3SZ0 A;  3NNE A;  4ECH A;  2WDQ A;  1EL9 A;  2YG5 A;  3GYX A;  3JSK A;  4EMW A;  5KWF A;  3HZL A;  1Y56 B;  3KLJ A;  2XLP A;  3AE6 A;  1KNR A;  1DJQ A;  1GTE A;  3AD7 B;  4TLZ A;  1EL8 A;  2R4J A;  2GAG B;  2WP5 A;  3DJJ A;  3LOV A;  4CCQ A;  4H7U A;  1OJC A;  2Y6Q A;  1KDG A;  3GQK A;  3AE1 A;  2GEW A;  4II3 A;  1LQU A;  4PAB A;  2GH5 A;  4YKG A;  2R0G A;  1LPF A;  4H2N A;  4B63 A;  2BRY A;  3NYC A;  1O95 A;  3D1C A;  4RG3 A;  2VQ7 A;  2BXR A;  4Z2T A;  3DK8 A;  3AXB A;  4APN A;  2GF3 A;  4UDQ A;  2AQJ A;  1Q9I A;  2YR4 A;  3GRS A;  1JNZ A;  1BWC A;  4C74 A;  1ZOY A;  4U8N A;  3FBS A;  4CBQ A;  2XFQ A;  3RP7 A;  2WES A;  1F8R A;  2APG A;  2OAM A;  3FMW A;  5KVH A;  4DSH A;  2VOU A;  2BYB A;  5KRQ A;  1CHU A;  3DME A;  2Q0K A;  3UTE A;  1D5T A;  4X9M A;  1KSS A;  3AEE A;  2EQ8 A;  1JU2 A;  1YQZ A;  5U1O A;  2VQB A;  3SM8 A;  3AYL A;  4EM4 A;  5GSN A;  4OPC A;  4KX6 A;  1FOH A;  2AAQ A;  2NVK X;  1JNR A;  1P2E A;  3HYV A;  1N4W A;  3SUC A;  3AD8 B;  2BAB A;  1Y0P A;  2GV8 A;  1S2Q A;  2GMH A;  2A8X A;  3GD4 A;  1ZMC A;  4IVO B;  4YWO A;  1L9C A;  4BJZ A;  1MOK A;  4FK1 A;  3GDP A;  5IQ4 A;  1GV4 A;  3PO7 A;  2BCP A;  3EPT A;  2XLU A;  2DKI A;  3GDN A;  1N4U A;  1TYP A;  5EB4 A;  3LZX A;  3OC4 A;  1CBO A;  1GTH A;  4N9X A;  2BA9 A;  2GQW A;  1PBB A;  3B3R A;  1PBE A;  3DJG X;  2YLZ A;  4A99 A;  3UKP A;  2CUL A;  2OAL A;  4JDR A;  4II2 A;  5U63 A;  2C70 A;  4J57 A;  4GF7 A;  1NHS A;  4WX1 A;  5KOX A;  3GYI A;  4WCT A;  1GRE A;  4EQS A;  4JQ9 A;  1B8S A;  1ZDL A;  2YWL A;  3ICT A;  1LQT A;  3ZYX A;  4O5Q A;  3AED A;  1BZL A;  2BC1 A;  2V6O A;  3QSE A;  1IUV A;  3ALM A;  1D4D A;  3EAN A;  3NLC A;  3PVC A;  4K5S A;  1KFY A;  2XVE A;  4Z2U A;  4Z26 A;  4TM1 A;  4YTN A;  3V3N A;  3G5Q A;  1X31 B;  2JB3 A;  4M52 A;  5HY5 A;  1GT8 A;  2WOW A;  4UDR A;  4C3Y A;  1QJD A;  2BK5 A;  3CPH G;  1RP0 A;  3SQP A;  1JRY A;  1H86 A;  2CDU A;  4NTD A;  4H2Q A;  1F8S A;  4JY3 A;  3PS9 A;  1NHQ A;  2QCU A;  2XYO A;  2X8H A;  4K8D A;  2GB0 A;  1BGN A;  5IQ1 A;  4K7Z A;  2IID A;  3GRT A;  4H4U A;  3LAD A;  3AYI A;  1M6I A;  3H8I A;  1L0V A;  3KVE A;  4DNA A;  2E1M A;  3IHM A;  1RYI A;  1K0L A;  2WU2 A;  5BUL A;  3AB1 A;  2E5V A;  3CTY A;  1NPX A;  1GEU A;  3T0K A;  3LJP A;  4HA6 A;  4H4S A;  4D04 A;  4GAV A;  2ACZ A;  3D8X A;  1CJ4 A;  3UTG A;  2WPC A;  2OLO A;  2LFC A;  1KNP A;  1CJC A;  1GOS A;  3F8P A;  4X4J A;  4A79 A;  2V3A A;  4A7A A;  4Z44 A;  1ZOV A;  2EQ7 A;  2JKC A;  3ATR A;  4USQ A;  4B64 A;  2Z5Y A;  2BK4 A;  2VVL G;  2WPE A;  3RP6 A;  5M10 A;  2O9Z A;  4ICY A;  5C2T A;  2WOI A;  4H4R A;  3SZC A;  1NG4 A;  3RNM A;  4EQR A;  5M0Z A;  1GER A;  1ZK7 A;  2FJE A;  3CGB A;  1TYT A;  4BK1 A;  4A6N A;  4YXD A;  4U8P A;  1YY5 A;  4K5R A;  2BC0 A;  2B76 A;  3NGC X;  3UKH A;  4DSG A;  2YG4 A;  3RED A;  1ONF A;  1PBF A;  2YLR A;  1MXT A;  2C73 A;  2WET A;  3ICS A;  4U8M A;  1H6V A;  4G73 A;  3SY4 A;  5JCM A;  3KD9 A;  2C4C A;  5EOW A;  3DA1 A;  2RGJ A;  4NTC A;  2YM2 A;  4Y4M A;  2WOV A;  1OJD A;  5BUK A;  3NT6 A;  3GWF A;  1E39 A;  1GAL A;  4J31 A;  4AOX A;  2YLW A;  2XVH A;  4H4Y A;  4YSZ A;  4H4Q A;  1B37 A;  1FEC A;  1DJN A;  1H84 A;  2GRT A;  2ZBW A;  2X3N A;  3AEB A;  1BF3 A;  4GCM A;  1K0J A;  4U8I A;  5KMP A;  4KPR A;  3O0H A;  4A65 A;  5FS7 A;  4H50 A;  3CGC A;  2ARD A;  3VRA A;  2B9X A;  2Q6U A;  4TM4 A;  2BAC A;  3R9U A;  3T2Y A;  3UP4 A;  3CN8 A;  5JCN A;  2XLR A;  1F8W A;  1VG9 A;  4U8O A;  4J33 A;  4G74 A;  1N4V A;  2Y6R A;  2R9Z A;  2WS3 A;  2ZZ0 A;  1EL7 A;  1PXA A;  3H8L A;  4FX9 A;  4CNJ A;  3NN0 X;  4CCR A;  2JB1 A;  4NEW A;  4B67 A;  3UKQ A;  2YLX A;  3GSI A;  5U25 A;  1PXB A;  4OVI A;  3UOY A;  1B4V A;  2A89 A;  4DGK A;  1S2Y A;  1CC6 A;  3VRD B;  4J2W A;  1W4X A;  3UP5 A;  4EMI A;  2GQF A;  4JNA A;  3NH3 X;  3AE7 A;  2QA2 A;  3II4 A;  5KOW A;  2B7R A;  2VVM A;  1H83 A;  1HYU A;  1VDC A;  3C96 A;  3LXD A;  4G9K A;  2V3B A;  1XPQ A;  1ELI A;  2X8G A;  4FK1 C;  4GAP A;  3RP8 A;  1H82 A;  4EM3 A;  3ALL A;  2VVL A;  2JK6 A;  3K30 A;  4EIQ A;  5JCI A;  3I6D A;  1ZY8 A;  4NNJ A;  4J56 A;  1VQW A;  2ZZB A;  3GWD A;  2X50 A;  3C4N A;  2C7G A;  5HYM A;  4PAA A;  2BS3 A;  1XAN A;  4AP3 A;  5J60 A;  4H4V A;  1TDF A;  2Q7V A;  2YAU A;  1L9D A;  4K2X A;  3GD3 A;  4OPG A;  4EQX A;  1NDA A;  2R0P A;  3DGZ A;  2H89 A;  3DK4 A;  4GRT A;  1QLB A;  3QFB A;  3K7M X;  4I59 A;  4OPT A;  4BK2 A;  1VRQ B;  2WHD A;  1S3E A;  1EL5 A;  1NHR A;  5CKU A;  2BS4 A;  4Y4N A;  5FS6 A;  4OCG A;  4A9W A;  2PHH A;  4LII A;  4G6H A;  3UKF A;  1D7Y A;  1XDI A;  4I58 A;  4CY8 A;  2C64 A;  4YSY A;  2EQ6 A;  2R0C A;  4TM3 A;  1GRF A;  4GDE A;  2GMJ A;  1TDN A;  3NTD A;  3LZW A;  1V59 A;  4C5O A;  1H7W A;  4Z25 A;  4XWZ A;  4NEV A;  2TPR A;  4BUR A;  4OPI A;  1OJA A;  3CNT A;  2E4G A;  4AT0 A;  3NKS A;  2XVI A;  3M13 A;  3K7Q X;  3GMC A;  4IA5 A;  4B68 A;  3V3O A;  3P4Q A;  2GR3 A;  3COX A;  4C3X A;  1IUX A;  3BI2 A;  1RSG A;  2WP6 A;  4IV9 A;  3OZ2 A;  2R4E A;  4J36 A;  1PBC A;  3CND A;  3S61 A;  1FEB A;  3KU9 A;  3AYJ A;  1XHC A;  1CC4 A;  3QVP A;  5EB5 A;  3IC9 A;  2WU5 A;  4GDP A;  1NEN A;  1D4C A;  4YSH A;  1IUU A;  2YG6 A;  3ALJ A;  3CNP A;  4RSL A;  3SX6 A;  1FCD A;  3DH9 A;  3E1T A;  5KMR A;  3F8R A;  3C4A A;  2YVJ A;  1E1L A;  3P4R A;  3DJE A;  4U2T A;  3SGL A;  3GYJ A;  2RGH A;  4ZCC A;  4TLX A;  2AR8 A;  2BRA A;  3FPZ A;  5HXI A;  1AOG A;  2R46 A;  3I3L A;  2OLN A;  3IF9 A;  4JY2 A;  5IPY A;  3L1R A;  2V61 A;  1IUS A;  2F5Z A;  2XCG A;  2DKH A;  1DXL A;  3BNM A;  3M0O A;  4H2R A;  2B9Y A;  4U8L A;  1DOD A;  3LB8 A;  1NG3 A;  3Q6J A;  3QVR A;  2J3N A;  3AD9 B;  4NWZ A;  5EBK A;  1FL2 A;  1JRZ A;  2C76 A;  3CPJ G;  1LJ1 A;  5KNL A;  3CMM A;  2YVG A;  1OJT A;  3NK1 X;  4YSX A;  2BCG G;  4XWR A;  4LU6 A;  5HHF A;  1S3B A;  1H81 A;  2HQM A;  2XDO A;  1GRG A;  2YQU A;  3AEG A;  2PYX A;  2R45 A;  2X99 A;  1LVL A;  1UKV G;  4J34 A;  4C77 A;  1OJ9 A;  1F6M A;  3BI5 A;  3HYW A;  4MJW A;  3CNJ A;  2XFU A;  1PS9 A;  1KSU A;  4YKF A;  1PHH A;  1PN0 A;  4O5U A;  4Z24 A;  3UKK A;  2JB2 A;  3BNU A;  2XLT A;  1QO8 A;  3K7T A;  1E1N A;  1TDO A;  1TRB A;  2WBA A;  2XLS A;  4BK3 A;  2C3D A;  3AE8 A;  2BK3 A;  2V60 A;  4P9S A;  1NEK A;  1YKJ A;  1ZX9 A;  1LTX R;  4IA6 A;  3NYF A;  4XXG A;  4YTP A;  3KPF A;  5FS8 A;  3GQH A;  3AE5 A;  3G5S A;  5L46 A;  1NAA A;  3CPI G;  4H2P A;  2WDV A;  4GUV A;  3SYI A;  1B5Q A;  2B7S A;  2B9W A;  1P2H A;  3BHF A;  2C3C A;  1Q1R A;  4HB9 A;  4Y4L A;  2C65 A;  3FG2 P;  3QJ4 A;  1D4E A;  1YQ3 A;  2X8C A;  3UTH A;  3VRB A;  4REK A;  4LA1 A;  1E7P A;  1DOB A;  1LV0 A;  1EBD A;  3ICR A;  2IVD A;  4CY6 A;  2JAE A;  2Q0L A;  3NYE A;  2IVE A;  2ZZC A;  2RGO A;  3ATQ A;  3ADA B;  1F3P A;  5DBJ A;  3L8K A;  1BKW A;  2EQ9 A;  4OPU A;  3RHA A;  3NK2 X;  3T14 A;  2FJB A;  2XFO A;  4B65 A;  4U2S A;  1CL0 A;  1K0I A;  1IJH A;  1PJ7 A;  1O5W A;  3BHK A;  3FIM B;  2GR0 A;  3AE4 A;  2WPF A;  3NHO X;  5ER0 A;  3V76 A;  2V5Z A;  2RAB A;  5KXJ A;  3P1W A;  2NPX A;  4OPL A;  3NRN A;  2JBV A;  2QA1 A;  1DNC A;  1PBD A;  3T37 A;  1GRT A;  1TDE A;  3B6D A;  3KA7 A;  2YR6 A;  3CNS A;  5LV9 A;  3T31 A;  1E1K A;  5KMS A;  1L9E A;  4IVM B;  3VR8 A;  2CVJ A;  2VRM A;  1Q1W A;  3URH A;  1CC2 A;  4ZCD A;  3DGH A;  1CJ3 A;  1PDH A;  1GPE A;  1CJ2 A;  2C67 A;  5BRT A;  2TMD A;  2A87 A;  4U8J A;  4D03 A;  1Y56 A;  2FJA A;  1YQ4 A;  4YTM A;  3UKL A;  4ADW A;  1E1M A;  2WEU A;  1REO A;  1M64 A;  4A6N B;  4H4W A;  1E6E A;  1GXF A;  3BI4 A;  4U2L A;  3IWA A;  2FBW A;  3CIR A;  1D7L A;  3F8D A;  2BXS A;  3NN6 X;  3NK0 X;  4H4T A;  4RG4 A;  5J7X A;  3SFD A;  1PXC A;  1VG0 A;  5GRT A;  3Q9T A;  1GND A;  4H4P A;  2VZ2 A;  3EF6 A;  4UP3 A;  4FDC B;  4USR A;  4EQW A;  1H7X A;  3UKA A;  4YT0 A;  3H4K A;  1MO9 A;  5C3J A;  1Z6L A;  3AWI A;  3DK9 A;  1PJ6 A;  3P4P A;  1ZMD A;  2YVF A;  3QFA A;  2XFN A;  4EMJ A;  3SZW A;  1GET A;  2GAH B;  3NG7 X;  4H4X A;  3T2K A;  3VQR A;  2YLS A;  3ABV A;  1PJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...