4YT0A

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
616
structure length
616
Chain Sequence
b'SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 209
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4yt0A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4yt0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4yt0A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4yt0A04
4ZCDA 4CNKA 1CHUA 1TDKA 1D7LA 3AWIA 2YVJA 1COYA 1PJ7A 3CTYA 2XLSA 2C66A 2YR4A 4J33A 1TYTA 4YTNA 4OPGA 3VQRA 3NK1X 2C70A 3VRBA 3S5WA 3AE8A 1TDNA 3OC4A 2BC1A 2C65A 2EQ7A 2XFOA 1GREA 5GSNA 3F8DA 3H4KA 1OJDA 3CGDA 3CNDA 3CGCA 3SGLA 2YG7A 1TDEA 2CVJA 3IC9A 3NIXA 4O5UA 2DKHA 3DJGX 3GYXA 1F6MA 4GDPA 1GOSA 3FIMB 4BK2A 1NDAA 2WETA 5IPYA 1Y56A 2BABA 3UTEA 4B66A 3HZLA 1OJCA 4EMJA 2RGHA 1P2EA 4EM4A 1B37A 5CKUA 4LA1A 2FBWA 4U8OA 3V76A 4JY3A 2BXRA 1KNPA 2WDVA 1DXLA 1VRQB 2H89A 1PN0A 3FMWA 2DKIA 1NENA 3LZWA 5LV9A 3AE3A 4IVOB 3CGEA 4ECHA 1GSNA 2WOWA 1BGJA 4OVIA 2YM2A 4WX1A 1H84A 1OJAA 3QJ4A 2OA1A 2OLOA 4OCGA 1O94A 1K0IA 4OPUA 2VOUA 2Y6RA 2VVMA 1DNCA 1B5QA 2JB2A 3E1TA 1LJ1A 2C73A 4AOSA 1TDOA 2BC0A 2X99A 4U8JA 2ZZBA 2Y6QA 5BRTA 2GRTA 4KX6A 4NEVA 1L9DA 3P4PA 4XWZA 3B3RA 4O5QA 2FJEA 2XYOA 4M52A 1NHSA 5KXJA 3AD8B 4A5LA 3GYJA 4GF7A 4YSHA 4DSHA 2H88A 2FJAA 1QLBA 1GV4A 1PBEA 3BHKA 3IHGA 1KDGA 4Y4MA 1LQUA 1RYIA 3NN6X 3DK4A 4H4TA 4RG4A 3GDNA 3AEGA 2WQYA 1H82A 3ALMA 3DK8A 3SM8A 2YR6A 4H4WA 3UKLA 3AE7A 1PBBA 1YY5A 3LJPA 3KVEA 2V61A 4EQWA 4DSGA 2XFPA 4FK1A 5M0ZA 1JNZA 1M64A 1REOA 1VQWA 2TMDA 3GYIA 2IVDA 3H8IA 2CULA 1MXTA 3ICSA 3LZXA 3QSSA 4JY2A 4X4JA 3UKPA 3T37A 3NG7X 5KVIA 2WPFA 4NTDA 1CL0A 1GRBA 3ATQA 2GQFA 4CCQA 1ZK7A 3FG2P 2GB0A 1RSGA 3LOVA 4H2RA 2WP9A 3NTDA 5KOXA 3P1WA 2GAGB 2GVCA 2JK6A 2BCGG 4AT0A 3AE6A 3C96A 3CPIG 4USRA 1UKVG 1XPQA 3UKAA 2YQUA 2BS3A 1LPFA 3AE5A 5C3JA 2A87A 3O0HA 1F3PA 3CPHG 1IUVA 2XCGA 3GWFA 3KLJA 2C72A 1QJDA 2V3AA 2YVGA 2JBVA 4AOXA 2X8GA 3G5RA 1GTEA 5KRQA 4D03A 3NTAA 4H4XA 4JN9A 1B8SA 2NPXA 2C75A 3IWAA 4DGKA 4C5OA 2FJBA 3VR9A 1FEAA 2XFNA 4C3YA 4RG3A 4ZCCA 3SQPA 1BGNA 2GMJA 2YAUA 1XDIA 3GMCA 3M0OA 1CJ2A 2NVKX 2QCUA 5EBKA 4AT2A 2ACZA 5M10A 3LADA 3WE0A 1E1NA 4U8LA 3COXA 4HB9A 2W0HA 1IUWA 3LXDA 3PO7A 3DMEA 2XFQA 2UZZA 3VR8A 1EBDA 1S2YA 2C64A 3BI4A 2V6OA 2BCPA 1JRYA 1DOBA 3GRSA 2B7SA 3R9UA 1BKWA 3NK2X 2C3DA 4FX9A 1L0VA 4BK1A 4I58A 1FOHA 4RSLA 2XLPA 1ZMCA 2B76A 3ABVA 2JB3A 1GPEA 2YG5A 1S3BA 1ZOYA 1M6IA 3FPZA 1BF3A 1TDFA 4UP3A 1XANA 2APGA 1GRTA 3K7TA 4A99A 3ICTA 4K22A 3UKHA 1E1LA 1FECA 1GRFA 1Q1WA 1S3EA 2QAEA 2GAHB 2R4JA 1QO8A 2GEWA 3IHMA 2B9WA 4REKA 1KNRA 2VRMA 2OAMA 4IA6A 1EL5A 1L9EA 2YWLA 2XLTA 2XVIA 5FS9A 3CNTA 3KKJA 1TRBA 1NHPA 1CC6A 3AE9A 2WEUA 3NKSA 4Z2UA 3KPFA 2VZ2A 3AB1A 2C67A 2JAEA 1FCDA 3QVRA 1K0JA 1TYPA 4OPLA 3AEBA 1GT8A 3G5SA 1D4DA 3NNEA 3UTHA 3I3LA 2ZZ0A 2VQ7A 1ZDLA 1H7XA 4A7AA 4JQ9A 5J60A 3EANA 2C7GA 3ISHA 5HXIA 1PS9A 3AEDA 1ELIA 2BS2A 1EL8A 1EL9A 5J7XA 3DGZA 4B65A 4TM1A 3BNUA 3P4SA 1DOEA 4U8NA 3UKKA 4H2NA 3KA7A 3K30A 4J2WA 1HYUA 1D4EA 2B9XA 2R4EA 2BS4A 2R9ZA 3ALJA 1CJ4A 3L8KA 2V5ZA 3QVPA 4X9NA 4YT0A 3DJJA 3GRTA 1ZMDA 2BYBA 1OJTA 2WOIA 1IJHA 2R46A 3AEFA 2WP5A 4U8PA 2X8CA 1DOCA 4X9MA 4A79A 4D04A 4GCMA 3UKFA 1PHHA 2B7RA 2JKCA 3F8PA 4A6NB 1VG0A 1ZX9A 3SUCA 1Q1RA 2C3CA 1XHCA 4GDEA 4N9XA 2JB1A 3PVCA 4Y4NA 4CNJA 1H7WA 4YXDA 2EQ9A 2RABA 2GV8A 2IIDA 4UDQA 1PBDA 3QFAA 1NG3A 2YG4A 2WU5A 1H6VA 3AE2A 5KOWA 1IUUA 4CRTA 3SFEA 2XLUA 4U2TA 3DK9A 1F8WA 4YSXA 4A9WA 4TLZA 4EIPA 4Z24A 4H4ZA 1GTHA 2EQ8A 3CPJG 4C77A 4H50A 4UDPA 5KVHA 3AEAA 4JNQA 2GR2A 2XFUA 4HA6A 2V3BA 4H2PA 4K5RA 4JNAA 1GALA 1D5TA 3Q9TA 4Z25A 4IVMB 2Z5XA 1NG4A 3JSKA 2GR0A 4J31A 4EQSA 2WP6A 5HY5A 2Q0LA 3NYEA 3NLCA 3VRAA 2I0ZA 1H83A 3P9UA 4BJYA 3DA1A 5U1OA 5JCKA 1NHRA 3CN8A 3REDA 3GMBA 3GQKA 1E6EA 1EL7A 1VG9A 3AD7B 1F8SA 4AP1A 1KFYA 3CNJA 1D7YA 3II4A 3NYCA 4YKGA 4XWRA 2WPCA 4EM3A 4GRTA 3ATRA 3BI5A 3S61A 2Q7VA 2O9ZA 4OPCA 3CNSA 2BK3A 2R0CA 4H2QA 3NN0X 2AQJA 2GF3A 2WOVA 1KSUA 3M13A 5FS7A 4NTEA 1E39A 2WBAA 3P4RA 2YG3A 1YKJA 4PAAA 1Z6LA 4YWOA 4DNAA 3NT6A 3BNMA 2HQMA 5C2TA 2YLWA 4B68A 4CCRA 1CBOA 2A89A 1LV0A 3UOYA 4ICYA 3NYFA 4P9SA 5L46A 4B67A 2J3NA 2WS3A 2QA1A 1NHQA 2BK4A 2R0PA 4H7UA 4IA5A 3UOVA 4H4SA 2R0GA 1KSSA 2CFYA 3UTGA 1CC4A 4TM4A 4Z2TA 1MO9A 3SFDA 1BZLA 2VVLG 4CY8A 3CIRA 4EIQA 2YLTA 3C4AA 3RP8A 4B63A 2YLSA 1ZOVA 4H4QA 1O95A 1O5WA 1PXCA 1YQZA 4YTMA 2Q6UA 5U25A 5GRTA 5JCMA 5HYMA 1OJ9A 1LVLA 2XLRA 4B64A 2OLNA 4BJZA 1GEUA 1VDCA 1JU2A 3UCLA 2YVFA 3AYLA 4CBQA 1E1MA 1N4VA 3AD9B 3QSMA 4J57A 1GNDA 1IUSA 1PBFA 4GUVA 2RGJA 2R45A 1GXFA 3ITJA 1E7PA 4H4YA 3FBSA 3V3OA 1K4QA 2GH5A 4K2XA 4OPIA 4UDRA 2WU2A 2BXSA 3GD4A 4K7ZA 3DH9A 5U63A 1W4XA 5EB5A 3NRNA 2BACA 2E5VA 3NK0X 4K5SA 4Z2RA 3CGBA 1SEZA 2WPEA 5CQFA 3VRDB 3F8RA 4YSZA 2YLRA 3URHA 1V59A 4I59A 1PJ5A 3PS9A 1FL2A 3UOZA 3K7QX 4H4VA 3UKQA 5BVAA 5ER0A 1GRGA 3M12A 5IQ1A 3UTFA 4MJWA 2XVJA 1NAAA 4OPTA 3V3NA 2XVFA 1H81A 1X31B 1JNRA 2WDQA 3EF6A 4U8IA 1YQ3A 2V60A 4USQA 4A65A 5IQ4A 4K8DA 2GQWA 4H4UA 5FMHA 1CJCA 2X8HA 3RP6A 1DJQA 4B1BA 3RNMA 2FJDA 1ZKQA 3ALLA 3BHFA 3NHOX 1N4WA 3D8XA 2Z5YA 4KPRA 2F5ZA 4U8MA 3AEEA 2X50A 2X3NA 4NEWA 3RP7A 4Z44A 2E4GA 3UOXA 3ZDNA 4J56A 3IF9A 1GRHA 1GESA 3OZ2A 2WHDA 4EMWA 4WCTA 2ARDA 5DBJA 1Y0PA 4U8KA 1N4UA 1PDHA 4LIIA 5TR3A 2YG6A 1PJ6A 3H8LA 3QSEA 1E1KA 2ZBWA 5JCIA 3GSIA 2Q0KA 5EOWA 2VQBA 4ZN0A 2YR5A 4IV9A 4FK1C 3NH3X 1ZY8A 3LB8A 4C74A 1YQ4A 2TPRA 4NZHA 3EAOA 2PYXA 4AP3A 3NGCX 5KWFA 1GRAA 2XVEA 3B6DA 4JDRA 3DJEA 4J34A 1FEBA 1D4CA 4EQRA 2YLXA 3D1CA 3AXBA 4CY6A 1LTXR 2E1MA 2OALA 4BURA 1GETA 3AYIA 4BV6A 1Q9IA 2IVEA 4U2SA 4EMIA 1NEKA 2GR1A 3ADAB 2XVHA 4EQXA 3GWDA 3DGHA 3EPTA 1Y56B 3KU9A 3DJDA 4C3XA 1CC2A 1CF3A 1PXAA 4U2LA 1H86A 2YM1A 3BI2A 5BULA 2CDUA 4TM0A 4Y4LA 2VRLA 1N1PA 2WDRA 4FDCB 1CJ3A 1RP0A 2BK5A 2EQ6A 1JRXA 3AYJA 2BA9A 1JEHA 4NTCA 4B69A 3CNPA 3ICRA 1ONFA 4Z43A 2GMHA 4TLXA 2RGOA 3C4NA 2C76A 2PHHA 1ZP0A 1K0LA 3K7MX 1P2HA 2A8XA 2YLZA 4GR1A 4ADWA 2QA2A 3QFBA 5HHFA 2VVLA 4J36A 4OPDA 1KF6A 3RHAA 3AE4A 4LU6A 4BK3A 1IUTA 1JOAA 3G5QA 2AR8A 4H4PA 3ZYXA 2WESA 5EB4A 1IUXA 4E0VA 1MOKA 1DJNA 3GD3A 4PABA 4YSYA 2GR3A 1GERA 5BUKA 2AAQA 4A6NA 2ZZCA 1NPXA 3GDPA 1F8RA 4TM3A 5FS6A 4YKFA 1BWCA 3AECA 1PBCA 3P4QA 1DODA 4H4RA 3UP4A 1JRZA 3I6DA 3KD9A 5JCLA 1PXBA 2LFCA 3GQHA 3L1RA 1L9CA 3Q6JA 2B9YA 5FS8A 4APNA 4XXGA 1S2QA 2XDOA 1AOGA 4YTPA 3UP5A 1LQTA 3AE1A 5JCNA 4Z26A 1B4VA
chains in the Genus database with same CATH superfamily
1CHUA 4IDOA 3KFWX 3L8RA 5GONE 1PJ7A 2YVJA 2K5BB 5JTGA 1SA0E 1U4QA 2YR4A 1TYTA 3NK1X 3VRBA 3S5WA 3AE8A 2BC1A 2C65A 2EQ7A 4GK5E 2EHOB 3F8DA 2BG9C 5IUXA 5KMSA 3JAFA 4IL9A 3CGCA 2YG7A 4WYVA 2HN2A 3DJGX 2A72A 4GDPA 3I0QA 3FIMB 4BK2A 5LXTE 4TWDA 1UX4A 3HZLA 1OJCA 2JMKA 1P2EA 5FY0A 4YHHT 4EM4A 2PZSA 2FBWA 4QXBB 3V76A 3IBPA 4JV5T 2X5ID 2PYJA 2H89A 3FMWA 3LZWA 3C4WA 1HCIA 2QVAA 2QA7A 1H84A 1HS7A 3QJ4A 2OA1A 2Y6RA 4X64T 4L5GA 4G74A 5FNVE 2VK9A 4AOSA 4GAPA 5HXEA 4U8JA 1RVF4 1MIYA 5HCMA 1AR64 3P4PA 4XWZA 4M52A 2BKPA 2CWYA 4GF7A 4YSHA 2D0UA 2CHOA 3BHKA 4Y4MA 4LFAT 4H4TA 3GDNA 3AEGA 3ALMA 1AL24 3CMMA 3SM8A 4H4WA 5KDMC 3A7MA 3ZKRA 5L4HA 1YY5A 5ABFA 2V61A 3IHRA 2XFPA 4LFBT 3B57A 1MXTA 3LZXA 3FZKB 4H9PC 3SRZA 3UQ4A 3UKPA 3PUAA 3T37A 4ILCA 3D0TA 5KVIA 2J1DG 2UXDT 2X66A 2GQFA 4CCQA 3FG2P 1RSGA 1HF8A 4H63H 3ZT5A 3OYZA 4EZHA 3C96A 3CPIG 1RUF4 1XPQA 3UKAA 3CK6A 4PDWD 2A87A 4I50E 2DL1A 1IUVA 2X9YA 4IIJE 4GOUA 4XAXB 3LBXA 1QJDA 5CA0E 2C72A 4H9NC 2X8GA 1GTEA 2NOXA 3NTAA 4H4XA 3C4ZA 4ERRA 4U72A 1FEAA 5FP3A 4DNDA 1RUG4 4IDPA 4IHJE 5FYMA 5F5WA 5EBKA 2KXPB 2VQET 5M10A 2LKGA 1WYCA 2XAFB 1IUWA 3LXDA 2XFQA 3PJAJ 3W15B 5LNKA 1DOBA 2J4GA 3Q5DA 4BK1A 4QH5A 2XLPA 2XQ3A 2E8IA 2B76A 3ABVA 2IIUA 5AQKB 3TKLB 4UP3A 2APGA 1NAFA 4A99A 1I94T 3ICTA 3ETUA 4K22A 2VWAA 2UXNB 1IBLT 5J2UE 3T14A 2VRMA 2OAMA 5HEHA 1EL5A 4G6HA 2XLTA 2XVIA 3ZYMA 1CC6A 4Z2UA 3FXEB 1HG2A 2W67A 2GK9A 3I1AA 1K0JA 4OPLA 3C50A 5FVLA 3NNEA 3UTHA 2ZZ0A 5JDGA 2BG9A 3KBUA 4A7AA 4JQ9A 3LFMA 2C7GA 4HFBA 2D2SA 1M7KA 3N9PA 3PV0F 1EL8A 5J7XA 4DVDA 2HWB4 4TM1A 3TLSA 3KA7A 1HYUA 1IBKT 2V6XA 1D4EA 2B9XA 1OEDC 2RP4A 2BS4A 4X9NA 3L8KA 3NRYA 1CJ4A 3VKHA 4YT0A 1RUD4 4DR3T 1WR0A 1IJHA 3AEFA 1KK7A 2CRBA 1AR74 2CE7A 3QUJA 4OYJA 4A6NB 2C3CA 1XHCA 2Q9QA 4U31A 4O8SA 3KPKA 3QFAA 1NG3A 2CLYC 2JPFA 2WU5A 3AE2A 4PW8A 3TLVA 2R074 4CRTA 4Q4Y4 2XLUA 4JI7T 1F8WA 4A9WA 4H4ZA 3RH3A 1GTHA 5FVKA 4C77A 5JR9B 2E9XD 5DJQC 5LCYA 5AQVB 4YY3T 1VBB4 5JRCB 3AEAA 4JNQA 2D5UA 3MKDA 2WB5A 4K5RA 2V7MA 2R6GF 2MYSA 5JDMA 3ONXA 4TN7B 5HY5A 3NYEA 4BJMA 2I0ZA 1H83A 3HI2A 5JCKA 3CN8A 1Z7S4 3GQKA 3V5SA 1EL7A 1F8SA 3RGLA 2BZBA 2WPCA 3S61A 3NN0X 2LKHA 3M13A 1BR1A 4NTEA 2WBAA 4KBMB 2DLRA 4IREA 4GKJT 5F3JA 1V9DA 4BAYB 1Z6LA 5J2TE 4JLEA 3NT6A 3P8CD 5HXHA 5C2TA 2LSJA 2WCAA 4CCRA 4IT4A 3UOYA 4DMVA 4HGAA 2BK4A 1BEV4 3KVBA 2BKNA 3R84B 3UOVA 5AQIB 5EZYE 4CY8A 2JQKA 4NWZA 4B63A 3BQKA 3EABA 1HG5A 3ZT6A 1HRI4 5LYJE 1OJ9A 3AA7B 4B64A 3SZ0A 3AYLA 1BR2A 4CBQA 1E1MA 3AD9B 4HFCA 1UCUA 1FMVA 4PFPA 5TAOA 4LF4T 1GNDA 4GUVA 3K8PC 4ZOLE 1VBA4 3ITJA 1E7PA 4H4YA 3FBSA 3V3OA 2GH5A 3DH9A 5U63A 1YKEB 2NWBA 2BRYA 2V5DA 3AA6B 3CGBA 4LMJA 3F8RA 4I59A 3PS9A 2XHEB 2VKDA 5ER0A 4NPPA 3M12A 3V3NA 2E9XC 2XVJA 1NAAA 4UIGA 2XQAA 4YLHA 2XQYA 1JNRA 3EF6A 4CQIA 3MJXA 2W4XA 2LEHA 3CQXC 2YINA 2WZHA 1VRBA 1ZKQA 1R094 4ZS2A 2WY2A 3D8XA 2Z5YA 2RR14 4U8MA 3AEEA 2PBIA 4MFRA 1N32T 3F31A 3J9X1 1OEDA 3PUGA 3ZDNA 4J56A 3T31A 2WWVA 3AA0B 2WHDA 4WCTA 3ZN0B 1Y0PA 1N4UA 1PDHA 5TR3A 3QSEA 3H8LA 4PK5A 2V6YB 4Q4V4 3SZFA 3GSIA 4U2ZA 5KNLA 2Q0KA 1AR84 4IV9A 3VHLA 4ZI3D 4FK1C 4AKLA 4BA9A 4C74A 4TWFA 1HX1B 4GB34 4P0AA 2TPRA 4NZHA 3NGCX 3R6NA 3RYFE 3N9MA 3NVOA 4JDRA 4J34A 3RKGA 1LTXR 2E1MA 4HWDA 1Q9IA 2IVEA 4U2SA 5JREA 2IMLA 4AQFC 3UU8A 2N9DA 3E08A 3DGHA 4U2LA 3RIFA 2RS14 4N78D 2WM9A 4IE6A 2YM1A 4WBOA 4TM0A 1N1PA 4CI1B 2BA9A 1JEHA 1U5PA 3O4XE 3AVSA 4TLXA 3K7MX 1P2HA 2IDOB 2YLZA 5HHFA 3PUQA 3AE4A 3M3ZB 5EB4A 4DUZT 4X62T 4IE4A 2J62A 1W09A 4PABA 5L3EB 4YSYA 1XDOA 4TM3A 1BWCA 3K3QC 1PBCA 3UUXB 4X5TA 4Z8XA 2MBGA 5HEGA 3L1RA 2XJ7A 2B9YA 3UU4A 2LSIA 2IUBA 4CN6A 3U3IA 3ESLA 3UP5A 3NRXA 3NBXX 5JCNA 5AQQB 1D7LA 3AWIA 1COYA 2PW9A 3RPUA 2C66A 4IE5A 2NW9A 1IAPA 4OPGA 5HWYA 1TDNA 4QH4A 2NP9A 5GSNA 3H4KA 3CNDA 3IC9A 4U3CA 4O5UA 3LSVA 2DKHA 4ZI3C 3GYXA 2BABA 1OWAA 3SX6A 3ZMTB 1S35A 2G0UA 2BXRA 1VRQB 2YEVC 1PN0A 2VASA 5LV9A 4DV6T 4IVOB 1GSNA 1R8IA 4OVIA 4WX1A 2RS54 2OLOA 2E9XA 1O94A 5ADXL 1K0IA 4OPUA 3LK3B 2VOUA 3UQ7A 3Q5EA 4WW0A 1B5QA 3E1TA 3NZQA 1LJ1A 3U78A 4O2BE 3I9WA 3AXJA 1TDOA 2IW5B 3ZT7A 1HNWT 5BRTA 2Y6QA 2GRTA 5BMVE 4NXMT 4NEVA 3N9LA 2FJEA 5JDHA 4EZ4A 2JJ9A 2H88A 4A98A 1M62A 1QLBA 1XNQT 3A8YC 1KDGA 3FBLA 1RYIA 3IEEA 2OV9A 4M1PA 3TLUA 2EX3A 2WQYA 3HKDE 1MNDA 2PY5A 2QGSA 5LG4A 4EQWA 4FK1A 2TMDA 4OFZA 4Z90A 2CULA 3QSSA 4X4JA 5CGMA 2Y48B 1Y01A 5CA1E 2BKOA 2Q9QD 2WPFA 5LP6E 4DV5T 2CXFA 3ATQA 3BK9A 2WP9A 1VBC4 3AB3B 3P1WA 2CWOA 2GVCA 4AT0A 4AQFA 1HXS4 2BS3A 1XMQT 4UVAB 3AE5A 5C3JA 3O0HA 2XCGA 3GWFA 2V3AA 2PTFA 2JBVA 5HEOA 5L2LA 3G5RA 3QNUA 4NIQA 1B8SA 3MK7C 3IWAA 3HL6A 4C3YA 4QH1A 4RG3A 4ZCCA 1BGNA 3SWHA 2YAUA 1VOMA 1E2AA 4DV3T 1CJ2A 2NVKX 2QCUA 2BBHA 4LF8T 4HB9A 4MBQA 3DMEA 3JC6D 2LHRA 1I6ZA 1S2YA 1SHZC 1MNEA 4ZS3A 3HKCE 2V6OA 4IDZA 2B7SA 3LK42 2C3DA 4FX9A 1L0VA 2V7KA 4I58A 4P0BA 4RSLA 5AQJB 3QB5K 2YG5A 2PG8A 3EDUA 4CXXA 1TDFA 1XANA 3UKHA 3RIUA 2GAHB 1QO8A 3T2ZA 2B9WA 4KUMB 4IA6A 5FS9A 3H3AA 3AE9A 5KMGP 4G73A 2C67A 4DR5T 3C64A 3KV4A 3QVRA 1TYPA 3AEBA 3G5SA 2ODUA 4ZI2C 3I3LA 3GA8A 2V26A 3OVUA 1ZDLA 2UU9T 5J60A 5HXIA 3ISHA 1PS9A 3AEDA 4U8NA 3UKKA 3SZWA 2Q9QC 2R4EA 3ALJA 3QVPA 4IDQA 3KV9A 4U8PA 2X8CA 1DOCA 4A79A 1PVC4 5CFBA 4PK6A 1HNZT 4H9RC 3UKFA 2JKCA 2WBLA 3F8PA 5FKYA 2ZM2A 4N9XA 2CXLA 2JB1A 3I9YA 3VKGA 3PU8A 2EQ9A 4YXDA 2VURA 4UEMA 1H6VA 1ZKEA 4PJMA 1IUUA 3DK9A 2VVSA 4YSXA 4EIPA 2V7IA 4H50A 3JC6C 5KVHA 2GR2A 3PDYA 3P7IA 5J0ZA 2KLQA 2XFUA 4WBNE 1H7CA 1W9RA 5E0OA 3VU7H 1GALA 3Q9TA 4Z25A 4IVMB 1POV0 1BR4A 3JSKA 3ZC1A 2Q0LA 5ETWA 3P9UA 2XAHB 2KNDA 3REDA 4PNIA 3GMBA 1E6EA 2CBIA 1VG9A 4YKGA 2DNXA 4TNVA 4DV0T 3BI5A 1W0AA 5HXSA 1XHXA 5IHYA 4OPCA 4DBQA 2BK3A 4DV2T 4OHFA 4AQGA 1KSUA 5FS7A 1E39A 3ZJ2A 4YWOA 2C5IT 1H8TD 4H9SE 4HN9A 1PO24 3F2EA 4HTEA 4JI0T 2YN6A 1UUSA 5HCJA 4B68A 5EK2A 4OX9T 3Q2MA 1LV0A 3PTRB 5H6QB 2XAGB 2LOSA 1B7TA 2QA1A 5FXXA 2E5LT 4TM4A 2VVLG 4EIQA 1QUUA 4DBRA 2YLTA 2YLSA 1ZOVA 1O5WA 2NTYA 2RM24 4HFEA 1MIWA 2K3WA 2N2NA 4YTMA 4EYUA 2Q6UA 5U25A 5HYMA 1LVLA 2XLRA 3TLWA 1GEUA 1JU2A 2KMFA 2WZIA 2W61A 4J57A 1PBFA 1IUSA 2NW8A 3FB2A 5JR9A 2RGJA 1UGOA 4OPIA 5AQTB 5LHGB 4UDRA 2WU2A 2BXSA 3GD4A 1D4M4 4K7ZA 2IHR1 4HKAA 1W4XA 2HHHT 3NRNA 2E5VA 3NK0X 4Z2RA 2YLRA 3URHA 1PJ5A 2F4VT 4B3RT 3C98B 4U2YA 1GRGA 5LMUT 4F6RC 5IQ1A 2PLV4 2XVFA 3KDSE 3CKDA 3LDQB 4I4TE 3CMLA 3HYWA 5ABHA 3LBXB 4B6XA 5IQ4A 1CJCA 2X8HA 3RP6A 1MMNA 4B1BA 3GN5B 1G8XA 3NHOX 4KPRA 3EUHA 2F5ZA 4F8HA 5JDFA 2X3NA 5ABEA 3UOXA 1MMAA 1GRHA 3OZ2A 4EMWA 2ARDA 4JBWF 4U8KA 2LRKA 4MHCA 1E1KA 1EV14 1VRH4 5EOWA 2YR5A 1GQEA 4EEBA 2KINB 3A5XA 4OK0A 4ZI7E 3ANWA 1FIOA 2MOZA 3GMIA 5EK4A 5LBMA 1LRZA 2PYXA 4DR4T 5FL1A 2I6HA 3AAAB 1AR94 4UV9B 2C5JA 1GRAA 2V7JA 4TV8E 2P9BA 3AXBA 1R084 3B5MA 2OALA 4JI2T 2JMHA 4ZHQE 1GETA 4BV6A 4BURA 3P50A 4GKKT 1NEKA 3PUZF 2GR1A 3ADAB 1ASJ4 3J8F4 2M6BA 3Q5XA 1Y56B 4FI5A 4QKNA 3UU6A 3CVRA 1CC2A 4UXNB 1PXAA 2VB6A 2BG9B 2VRLA 2QRXA 3RLFF 3FI7A 1CJ3A 2EQ6A 1JRXA 5LJNA 4NTCA 3ZMZB 1ONFA 4QX7B 2XAQB 2PHHA 4GR1A 4ADWA 3QFBA 3RHAA 2XZEA 3JAEA 2M67A 5H6RB 4LU6A 4Q25A 4BK3A 1IUTA 2VL0A 1J5ET 3MZKB 2AR8A 2EHOD 5C8YE 4UV8B 2WESA 4CZZB 1IUXA 2Y8DA 2ES0A 4ILBA 1MOKA 2B1EA 1DJNA 3GD3A 2GR3A 1GERA 4YFSA 2AAQA 5FS6A 3RC3A 1DODA 1PXBA 4TZ4C 3PUXF 3EVYA 5JQGE 4YTPA 4H9OC 1B4VA 2NTXA 1VQWA 1TDKA 4ZCDA 4CNKA 1XMOT 5KMPA 3CPZA 4ZZBA 3CTYA 2ZM6T 5LHHB 3OC4A 1IJ6A 3EAMA 1GREA 1OJDA 1XNRT 1TDEA 5DQWA 3NIXA 3ONJA 2MTQA 1F6MA 1NDAA 3O1JA 2WETA 1RUE4 1D1AA 1J1JA 2A2FX 3UTEA 4B66A 4GYRA 2RGHA 5CKUA 4WZXA 1X9BA 4JY3A 2WDVA 1DXLA 4P1NA 2CPTA 2RPAA 3K3OA 5L4EA 5FY1A 1NENA 1WR6A 2CMRA 3OBVE 2D0TA 4ECHA 3S4UA 4V1Av 4PJLA 2VVMA 4UVBB 1DNCA 3EDVA 2C73A 2BC0A 1O3XA 4P09A 2ZZBA 1D0YA 2PYLA 3NKZA 1L9DA 4I55E 3B3RA 4LFCT 1NHSA 5KX5E 5KXJA 3AD8B 4A5LA 3GYJA 3WAJA 2ODVA 5FXWA 4L0RA 2FJAA 1PBEA 2JQHA 1HNXT 2A9UA 1LQUA 3NN6X 1UURA 1W0BA 1RUI4 2EHOC 4RG4A 3DP7A 1H82A 3L3PA 4KP3C 2H7VC 3ZEFB 3SOLA 3AE7A 4B3TT 3ONLC 4UF0A 3LJPA 1N34T 1M64A 1REOA 1Z0PA 3GYIA 4YJ2E 3ICSA 1HR0T 4JY2A 4NTDA 5DABA 5AQNB 2CA5A 2V1DB 1ZK7A 2CM0A 4PK4A 3LOVA 5LA6E 3NTDA 5LMNT 4LMLA 2JK6A 2BCGG 2WAUA 1LPFA 3OPCA 3T2KA 1VCTA 4AOXA 1KNZA 4JN9A 2FUPA 3ZJ1A 2ZMAA 5L3BB 2C75A 2NPXA 4DGKA 3UUNA 2XFNA 2GMJA 5LG3A 1HX8A 4EGWA 2LLYA 3M0OA 4AT2A 2ACZA 1E1NA 3PE0A 3WAKA 1FJGT 3COXA 4U8LA 2V7LA 1OEDB 2DWKA 3RIUC 1EBDA 2XUEA 4KHPT 3BI4A 4GAVA 3O9XA 3ZLIA 3GRSA 3R9UA 1BKWA 3NK2X 2D9DA 4DMWA 1FOHA 1GPEA 1S3BA 1ZOYA 4MALA 4QXCB 2K9AA 2YKSA 1BF3A 4CN4A 3O1IA 1NA1D 3K7TA 4CN1A 3O1HA 3PUWF 2H7OA 5LJMA 1FECA 4ISSA 5AQGB 1Q1WA 1S3EA 2R4JA 2GEWA 3CQGB 4JYAT 1IBMT 1KNRA 2YWLA 2R7FA 2CLYB 2JRKA 1NHPA 3NKSA 3OTOT 3KPFA 4HE8A 4JUYA 2JAEA 1FCDA 2KZ7B 5A1LA 2JQ9A 5L3GB 3RX6A 1D4DA 2VQ7A 1D1BA 2XM1A 3EANA 4KMCA 3HA4A 1ELIA 4EB6E 2BS2A 4AKGA 1EL9A 2CHNA 4O4HE 4O2AE 4JI4T 4H2NA 3ZN1B 4EEDA 2HWC4 3NWIA 4GIWA 3AVRA 2V5ZA 2UXXB 2C4CA 4AKIA 3UFEA 4B3ST 4U33A 2BYBA 2XSAA 3OYXA 1N36T 4D04A 4GCMA 1RUJ4 3M65A 2B7RA 3SUCA 1VG0A 4GDEA 2XPKA 3FXDB 1H7WA 2RABA 2GV8A 2IIDA 4UDQA 5M4YA 2YG4A 4U2TA 4C91A 3K3NA 4TLZA 4Z24A 4LF6T 2Z6EA 3CPJG 2RMU4 2EHOA 3JADA 2VKOA 4HA6A 2MPKA 3KBTA 2V3BA 4JNAA 4DR2T 1D5TA 2Z5XA 1NG4A 3FHNA 4J31A 4U74A 1HRV4 3NLCA 1Z8UA 3DA1A 3T8OA 5U1OA 3L09A 3OKQA 3AD7B 4AP1A 3NYCA 3CNJA 4TV9E 3II4A 5L3CB 4XWRA 4GRTA 3ATRA 2W62A 4HWHA 5IWAT 2O9ZA 2W63A 4QHOA 5AFUL 2R0CA 4ZXLA 4H2QA 4TX5A 2AQJA 2GF3A 2WOVA 2YG3A 3P4RA 1YKJA 2E9XB 4HEAA 2UUBT 3RHWA 3ZCJA 3AA1B 2A89A 4BJNA 3NYFA 3AXJB 4P9SA 3P4WA 1UX5A 2J3NA 4HFVA 2R0PA 4NUUA 2R0GA 1KSSA 2CFYA 5CJ5A 2X9WA 3SFDA 1BZLA 3CIRA 5JR9C 3RP8A 3RI5A 4H4QA 1PXCA 4JEUB 5IYZE 5DQVA 1WFDA 4KI0F 2CBJA 2NW7A 1SE7A 4QXHB 1GXFA 4HFIA 4JI1T 4DV1T 2OA5A 4XBFB 4DR6T 5EB5A 2ACXA 2BACA 2KSRA 3ZC0A 2WPEA 2BG9E 4YSZA 2K24A 5AQLB 1FL2A 3K7QX 4DR7T 4H4VA 3UKQA 2AXDS 4X1IE 3T1HT 1H81A 1D0XA 2I0MA 3N9OA 2WDQA 3ZMVB 4A97A 3KV5A 4K8DA 4H4UA 4YHJA 5FMHA 1IZNB 2XQ5A 1DJQA 3RNMA 2FJDA 5AQMB 4WNKA 4COFA 1N4WA 2PFVA 5LBQB 2N1GA 2C0SA 3HYVA 2VL8A 2X0LB 4NEWA 2LE8A 4DIDB 1GESA 5DBJA 5AQHB 2HN1A 4LIIA 2YG6A 3N2GE 4IGUA 2W0GA 2VQBA 3ZSTA 1VBD4 2JQQA 3NH3X 3T0KA 3LB8A 3X1DA 1ZEEA 1YQ4A 2YDRA 4LF9T 3ETVA 4UELA 4G6GA 3UUMA 3MACA 2DHRA 2HH7A 3CWZB 2XVEA 2YK0A 2BRAA 1FEBA 4C90A 1D4CA 3D1CA 4CY6A 4EQRA 4AKHA 1ZV4X 4TWHA 5JDLA 3IF8B 4CXWA 4NUVA 3MA9A 2LJLA 4EQXA 1EZ3A 3EPTA 4II3A 3DJDA 4HWCA 4II2A 5LB7B 2W66A 3BI2A 5BULA 2CDUA 1XI1A 2VKJA 2WDRA 1RP0A 5J1GA 4B69A 3CNPA 3ICRA 4O4LE 5JVDE 2LRLA 2GMHA 4DV4T 2C76A 1ZP0A 4J36A 4OPDA 1KF6A 3Q5WA 3G5QA 5AQSB 1D0ZA 4LF5T 3ZYXA 4E0VA 4IE7A 1CUNA 3GN5A 2RA1A 2YOEA 4TNWA 4Q4W4 2BVLA 5CB4E 3TLTA 4A6NA 1G73A 3GDPA 1XHZA 3UT5E 4YKFA 3AECA 1JRZA 2WMOA 4G9KA 3RQUA 3RQWA 3DTOA 4ADZA 2LFCA 3RC8A 3GQHA 2DI4A 5HAXA 4UVCB 1S2QA 2XDOA 1AOGA 2XY8B 1LQTA 4TUYE 3AE1A 4Z26A 3N2KE 2ZLYA 5ABFB 3ZPOA 2XLSA 4EAHA 5L3FB 5JRCA 4J33A 3VQRA 3E0ZA 2XQ8A 4YTNA 2C70A 2R044 2XFOA 4X66T 1LKXA 5BR8T 3CGDA 3SGLA 2CVJA 5LHIB 2LOPA 5JDQA 1E1HB 4HWFA 1GOSA 5AQFB 5IPYA 1KEYA 1SUMB 4ZZCA 1Y56A 4EMJA 2XAJB 4PAGA 3UUBA 1B37A 4LA1A 4U8OA 2QYWA 4AKRB 1KNPA 3C51A 4J2CA 4A5XA 1RUH4 3T2YA 2DKIA 3AE3A 4DUYT 5HEUA 3CGEA 2YU1A 2V5CA 2WOWA 1BGJA 2YM2A 3FZFB 1OJAA 4AXPA 4OCGA 2PJQA 3QK6A 3KVAA 4RHV4 1LVFA 4JI5T 2JB2A 1VCSA 4CI2B 2LHNA 3PJAA 1PO14 1OEDE 2X99A 2XQ7A 5JDNA 4KX6A 2W00A 3RRCA 3ZSSA 2XYOA 3QB5A 3V5UA 4O5QA 3QC9A 3RYCE 4AQYT 4NXNT 1HFAA 4DSHA 4EIWA 5AQOB 1RMU4 1GV4A 3IHGA 2KT9A 2JIWA 4DR1T 2UXBT 3DK4A 3DK8A 5HYAA 2YR6A 3UKLA 4LMKA 4O4IE 3RYIE 1PBBA 3KVEA 4DSGA 5AQRB 5M0ZA 1JNZA 2IVDA 3H8IA 1RUC4 4E7ZA 2X51A 2AE9A 3NG7X 1CL0A 2UXCT 4AI6A 1GRBA 2GB0A 2SPCA 4UR9A 4DV7T 4H2RA 5KOXA 2GAGB 3AE6A 2I59A 5EK3A 4USRA 1T98A 1UKVG 3UTKA 2YQUA 2DCFA 4MLKA 1F3PA 3CPHG 3KLJA 5ABGA 5KMQA 2NR4A 2YVGA 2XM2A 2VKHA 1XZYA 5KRQA 2XQ9A 4D03A 1J5WA 1FMWA 4JI6T 4C5OA 2FJBA 2UUCT 3VR9A 2X68A 3SQPA 3EI0A 1Y64B 4CI3B 1XDIA 3GMCA 4Z91A 2WMNA 3LADA 3WE0A 3AAIA 3PURA 4G63A 3N2OA 2W0HA 3PO7A 2BDEA 2Q9QB 2UZZA 2HPLA 2J47A 4HFDA 3VR8A 2C64A 2V6YA 4GK0E 2BCPA 1JRYA 3RYHE 5F8PA 4X1YE 4KHZF 2XQ6A 1ZMCA 2JB3A 3KV6A 2W2UA 3RF1A 1DU2A 1M6IA 3FPZA 4CXYA 1GRTA 2LT3A 4K0UA 3ANWB 2IC9A 4PJJA 5LGUB 1E1LA 1GRFA 2QAEA 3IHMA 3F57A 4REKA 5HWXA 3JCFA 1AJ3A 4H63V 3UU5A 1L9EA 2CCQA 3CNTA 3KKJA 1WYBA 1TRBA 2WEUA 2VZ2A 3CX6B 2X9HA 3AB1A 2Y6XA 4EYYR 4O4JE 1GT8A 2LSGA 5FY7A 4U7YA 1YD8G 1OOPD 2V8SV 1X79A 3OJAA 1H7XA 2XSBA 3C4XA 4EV6A 4I0UA 4QX8B 1WCRA 3DGZA 4B65A 1D1CA 3BNUA 3P4SA 1DOEA 2X0YA 3H37A 3K30A 4J2WA 4PFOA 4H9QC 2KWHA 3PUVF 1VBE4 2R9ZA 3DJJA 3GRTA 1ZMDA 1COV4 2LM2A 1OJTA 2WOIA 2L9QA 2R46A 2WP5A 3CX7B 2LSYA 4X9MA 3B13A 3N9QA 3ZMUB 2KWIB 1PHHA 4PJNA 3E22E 1ZX9A 3N5LA 1Q1RA 4G2AA 3PVCA 2YDQA 4LF7T 5L47A 4GYSA 4Y4NA 4CNJA 3RRWA 3SY4A 4U7IA 1PBDA 1QSDA 5KOWA 5FMNA 4EOZB 3SFEA 2L3LA 1WRDA 3CX8B 2X9XA 1N33T 2EQ8A 5AQUB 1LVKA 4IL4A 4UDPA 3EHZA 3PUYF 2L8KA 3GWHA 3HYXA 4H2PA 3L39A 2GR0A 1UK5A 2WP6A 4EQSA 3SYIA 3UULA 3VRAA 4BJYA 4IDNA 4NNJA 1NHRA 2XTLA 2LM9A 2H3RA 1KFYA 1D7YA 4EM3A 2UUAT 2Q7VA 3HKBE 3CNSA 3LJCA 4ASKA 3LG7A 3ZCIA 4PAAA 2XQ4A 4DNAA 1NWMX 4X20E 3BNMA 2HQMA 2YLWA 1CBOA 4FJOA 4ICYA 5L46A 4B67A 2WS3A 1NHQA 4H7UA 4IA5A 1WLXA 4YJ3E 4H4SA 3PUSA 3UTGA 1CC4A 5KMRA 4Z2TA 1MO9A 3FZHB 5JH7E 3H3MA 3WI3A 2RS34 2VVNA 1NCQD 1YXRA 3MXZA 3C4AA 1O95A 1T7SA 2HPJA 2M6IA 4AISA 1YQZA 4ILUA 2VQFT 5GRTA 5JCMA 4ANJA 3I0OA 3RIAA 2OLNA 4BJZA 1VDCA 4JI3T 3UCLA 2YVFA 1N4VA 2A3DA 3QSMA 4UF0B 3T1YT 3IA3A 4AIUA 2R45A 1MQTD 2ZM8A 1K4QA 4K2XA 4IE0A 4A56A 4K5SA 1SEZA 5CQFA 3VRDB 2ZM0A 5AQPB 1V59A 1T72A 1K5MD 3UOZA 5BVAA 3NZPA 3UTFA 2C5KT 3ZYLA 4MJWA 4OPTA 5HXRA 3LK2B 3G06A 1X31B 4U8IA 1YQ3A 2V60A 3ZYKA 4USQA 3SZCA 2WSSV 2BVMA 4A65A 3SXIA 2GQWA 2E2AA 1T8BA 2IAKA 3ALLA 3BHFA 2XASB 2X50A 1PIV4 4HWIB 3DJBA 3AAEB 3UU3A 3RP7A 4Z44A 2E4GA 1YW0A 3IF9A 4K0KT 2MAWA 4ISTA 2OLTA 4X65T 2YU2A 1PJ6A 2ZBWA 2BBJA 5JCIA 1MMGA 3Q9DA 2CEAA 3N9NA 4ZN0A 1RHI4 5LGNB 1ZY8A 1IJ5A 2K48A 2LSKA 1S94A 1HTJF 1XDPA 4DO0A 4ZI2D 3KINB 3BQIA 5L3DB 3EAOA 4AP3A 5KWFA 1OXZA 3B6DA 3DJEA 2YLXA 2CXDA 1MIVA 3AYIA 4X1KE 4EMIA 2DWGA 2XVHA 2X67A 5FXVA 4Q4X4 3GWDA 3HKEE 3ZMSB 3K1SA 3KU9A 4C3XA 1CF3A 3QOFA 1H86A 3JD74 4Y4LA 4FDCB 2BK5A 3AYJA 3BQLA 5HXCA 4Z43A 3PU3A 4EXTA 2RGOA 3C4NA 3FBZA 1K0LA 2IC6A 3RKOA 2A8XA 4JI8T 2QA2A 2VVLA 5LOVE 5FXZA 1XWMA 4B3MT 5FL0A 1JOAA 2R064 4H4PA 1BR0A 1MMDA 4L9IA 1ZHCA 4JEHB 4HFHA 1US7B 5HEJA 2X0HA 2WWUA 3UFGA 1EAH4 3CQCB 4E7SA 5BUKA 4OYKA 2ZZCA 4ILAA 1NPXA 4XZCA 3FZMB 1F8RA 3HR0A 3UP4A 3P4QA 3J7Yq 4H4RA 1FEWA 3I6DA 3KD9A 5JCLA 4QWNB 3SS1A 3Q6JA 4ZEYA 1L9CA 1YKHB 2YDSA 4APNA 4I43B 5LGTB 4XXGA 3JBG4 3FZLB 5FS8A
chains in the Genus database with same CATH topology
4ZCDA 4CNKA 1CHUA 1TDKA 1D7LA 5KMPA 3AWIA 2YVJA 1COYA 1PJ7A 3CTYA 2XLSA 2C66A 2YR4A 4J33A 1TYTA 4YTNA 4OPGA 3VQRA 3NK1X 2C70A 3VRBA 3S5WA 3AE8A 1TDNA 3OC4A 2BC1A 2C65A 2EQ7A 2XFOA 1GREA 5GSNA 3F8DA 3H4KA 1OJDA 5KMSA 3CGDA 3CNDA 3CGCA 3SGLA 2YG7A 1TDEA 2CVJA 3IC9A 3NIXA 4O5UA 2DKHA 3DJGX 3GYXA 1F6MA 4GDPA 1GOSA 3FIMB 4BK2A 1NDAA 2WETA 5IPYA 1Y56A 2BABA 3UTEA 4B66A 3HZLA 1OJCA 4EMJA 3SX6A 2RGHA 1P2EA 4EM4A 1B37A 5CKUA 4LA1A 2FBWA 4U8OA 3V76A 4JY3A 2BXRA 1KNPA 2WDVA 1DXLA 1VRQB 2H89A 1PN0A 3FMWA 3T2YA 2DKIA 1NENA 3LZWA 5LV9A 3AE3A 4IVOB 3CGEA 4ECHA 1GSNA 2WOWA 1BGJA 4OVIA 2YM2A 4WX1A 1H84A 1OJAA 3QJ4A 2OA1A 2OLOA 4OCGA 1O94A 1K0IA 4OPUA 2VOUA 2Y6RA 2VVMA 1DNCA 1B5QA 2JB2A 3E1TA 4G74A 1LJ1A 2C73A 4AOSA 1TDOA 2BC0A 2X99A 4GAPA 4U8JA 2ZZBA 2Y6QA 5BRTA 2GRTA 4KX6A 4NEVA 1L9DA 3P4PA 4XWZA 3B3RA 4O5QA 2FJEA 2XYOA 4M52A 1NHSA 5KXJA 3AD8B 4A5LA 3GYJA 4GF7A 4YSHA 4DSHA 2H88A 2FJAA 1QLBA 1GV4A 1PBEA 3BHKA 3IHGA 1KDGA 4Y4MA 1LQUA 1RYIA 3NN6X 3DK4A 4H4TA 4RG4A 3GDNA 3AEGA 2WQYA 1H82A 3ALMA 3DK8A 3CMMA 3SM8A 2YR6A 4H4WA 3UKLA 3AE7A 1PBBA 1YY5A 3LJPA 3KVEA 2V61A 4EQWA 4DSGA 2XFPA 4FK1A 5M0ZA 1JNZA 1M64A 1REOA 1VQWA 2TMDA 3GYIA 2IVDA 3H8IA 2CULA 1MXTA 3ICSA 3LZXA 3QSSA 4JY2A 4X4JA 3UKPA 3T37A 3NG7X 5KVIA 2WPFA 4NTDA 1CL0A 1GRBA 3ATQA 2GQFA 4CCQA 1ZK7A 3FG2P 2GB0A 1RSGA 3LOVA 4H2RA 2WP9A 3NTDA 5KOXA 3P1WA 2GAGB 2GVCA 2JK6A 2BCGG 4AT0A 3AE6A 3C96A 3CPIG 4USRA 1UKVG 1XPQA 3UKAA 2YQUA 2BS3A 1LPFA 3AE5A 5C3JA 2A87A 3O0HA 1F3PA 3CPHG 1IUVA 2XCGA 3GWFA 3KLJA 3T2KA 2C72A 1QJDA 2V3AA 5KMQA 2YVGA 2JBVA 4AOXA 2X8GA 3G5RA 1GTEA 5KRQA 4D03A 3NTAA 4H4XA 4JN9A 1B8SA 2NPXA 2C75A 3IWAA 4DGKA 4C5OA 2FJBA 3VR9A 1FEAA 2XFNA 4C3YA 4RG3A 4ZCCA 3SQPA 1BGNA 2GMJA 2YAUA 1XDIA 3GMCA 3M0OA 1CJ2A 2NVKX 2QCUA 5EBKA 4AT2A 2ACZA 5M10A 3LADA 3WE0A 1E1NA 4U8LA 3COXA 4HB9A 2W0HA 1IUWA 3LXDA 3PO7A 3DMEA 2XFQA 2UZZA 3VR8A 1EBDA 1S2YA 2C64A 3BI4A 4GAVA 2V6OA 2BCPA 1JRYA 1DOBA 3GRSA 2B7SA 3R9UA 1BKWA 3NK2X 2C3DA 4FX9A 1L0VA 4BK1A 4I58A 1FOHA 4RSLA 2XLPA 1ZMCA 2B76A 3ABVA 2JB3A 1GPEA 2YG5A 1S3BA 1ZOYA 1M6IA 3FPZA 1BF3A 1TDFA 4UP3A 1XANA 2APGA 1GRTA 3K7TA 4A99A 3ICTA 4K22A 3UKHA 1E1LA 1FECA 1GRFA 1Q1WA 1S3EA 2QAEA 2GAHB 2R4JA 1QO8A 2GEWA 3IHMA 2B9WA 4REKA 3T14A 3T2ZA 1KNRA 2VRMA 2OAMA 4IA6A 1EL5A 1L9EA 2YWLA 4G6HA 2XLTA 2XVIA 5FS9A 3CNTA 3KKJA 1TRBA 1NHPA 1CC6A 3AE9A 2WEUA 3NKSA 4Z2UA 3KPFA 2VZ2A 4G73A 3AB1A 2C67A 2JAEA 1FCDA 3QVRA 1K0JA 1TYPA 4OPLA 3AEBA 1GT8A 3G5SA 1D4DA 3NNEA 3UTHA 3I3LA 2ZZ0A 2VQ7A 1ZDLA 1H7XA 4A7AA 4JQ9A 5J60A 3EANA 2C7GA 3ISHA 5HXIA 1PS9A 3AEDA 1ELIA 2BS2A 1EL8A 1EL9A 5J7XA 3DGZA 4B65A 4TM1A 3BNUA 3P4SA 1DOEA 4U8NA 3UKKA 4H2NA 3KA7A 3K30A 4J2WA 1HYUA 1D4EA 3SZWA 2B9XA 2R4EA 2BS4A 2R9ZA 3ALJA 1CJ4A 3L8KA 2V5ZA 3QVPA 4X9NA 2C4CA 4YT0A 3DJJA 3GRTA 1ZMDA 2BYBA 1OJTA 2WOIA 1IJHA 2R46A 3AEFA 2WP5A 4U8PA 2X8CA 1DOCA 4X9MA 4A79A 4D04A 4GCMA 3UKFA 1PHHA 2B7RA 2JKCA 3F8PA 4A6NB 1VG0A 1ZX9A 3SUCA 1Q1RA 2C3CA 1XHCA 4GDEA 4N9XA 2JB1A 3PVCA 4Y4NA 4CNJA 3KPKA 1H7WA 4YXDA 2EQ9A 2RABA 2GV8A 2IIDA 3SY4A 4UDQA 1PBDA 3QFAA 1NG3A 2YG4A 2WU5A 1H6VA 3AE2A 5KOWA 1IUUA 4CRTA 3SFEA 2XLUA 4U2TA 3DK9A 1F8WA 4YSXA 4A9WA 4TLZA 4EIPA 4Z24A 4H4ZA 1GTHA 2EQ8A 3CPJG 4C77A 4H50A 4UDPA 5KVHA 3AEAA 4JNQA 2GR2A 2XFUA 4HA6A 3HYXA 2V3BA 4H2PA 4K5RA 4JNAA 1GALA 1D5TA 3Q9TA 4Z25A 4IVMB 2Z5XA 1NG4A 3JSKA 2GR0A 4J31A 4EQSA 2WP6A 5HY5A 2Q0LA 3NYEA 3SYIA 3NLCA 3VRAA 2I0ZA 1H83A 3P9UA 4BJYA 3DA1A 5U1OA 4NNJA 1NHRA 3CN8A 3REDA 5JCKA 3GMBA 3GQKA 1E6EA 1EL7A 1VG9A 3AD7B 1F8SA 4AP1A 1KFYA 3CNJA 1D7YA 3II4A 3NYCA 4YKGA 4XWRA 2WPCA 4EM3A 4GRTA 3ATRA 3BI5A 3S61A 2Q7VA 2O9ZA 4OPCA 3CNSA 2BK3A 2R0CA 4H2QA 3NN0X 2AQJA 2GF3A 2WOVA 1KSUA 3M13A 5FS7A 4NTEA 1E39A 2WBAA 3P4RA 2YG3A 1YKJA 4PAAA 1Z6LA 4YWOA 4DNAA 3NT6A 3BNMA 2HQMA 5C2TA 2YLWA 4B68A 4CCRA 1CBOA 2A89A 1LV0A 3UOYA 4ICYA 3NYFA 4P9SA 5L46A 4B67A 2J3NA 2WS3A 2QA1A 1NHQA 2BK4A 2R0PA 4H7UA 4IA5A 3UOVA 4H4SA 2R0GA 1KSSA 2CFYA 3UTGA 1CC4A 4TM4A 5KMRA 4Z2TA 1MO9A 3SFDA 1BZLA 2VVLG 4CY8A 3CIRA 4EIQA 4NWZA 2YLTA 3C4AA 3RP8A 4B63A 2YLSA 1ZOVA 4H4QA 1O95A 1O5WA 1PXCA 1YQZA 4YTMA 2Q6UA 5U25A 5GRTA 5JCMA 5HYMA 1OJ9A 1LVLA 2XLRA 4B64A 2OLNA 3SZ0A 4BJZA 1GEUA 1VDCA 1JU2A 3UCLA 2YVFA 3AYLA 4CBQA 1E1MA 1N4VA 3AD9B 3QSMA 4J57A 1GNDA 1IUSA 1PBFA 4GUVA 2RGJA 2R45A 1GXFA 3ITJA 1E7PA 4H4YA 3FBSA 3V3OA 1K4QA 2GH5A 4K2XA 4OPIA 4UDRA 2WU2A 2BXSA 3GD4A 4K7ZA 3DH9A 5U63A 1W4XA 5EB5A 3NRNA 2BRYA 2BACA 2E5VA 3NK0X 4K5SA 4Z2RA 3CGBA 1SEZA 2WPEA 5CQFA 3VRDB 3F8RA 4YSZA 2YLRA 3URHA 1V59A 4I59A 1PJ5A 3PS9A 1FL2A 3UOZA 3K7QX 4H4VA 3UKQA 5BVAA 5ER0A 1GRGA 3M12A 5IQ1A 3UTFA 4MJWA 2XVJA 1NAAA 4OPTA 3V3NA 2XVFA 1H81A 1X31B 1JNRA 2WDQA 3EF6A 3HYWA 4U8IA 1YQ3A 2V60A 4USQA 3SZCA 4A65A 5IQ4A 3SXIA 4K8DA 2GQWA 4H4UA 5FMHA 1CJCA 2X8HA 3RP6A 1DJQA 4B1BA 3RNMA 2FJDA 1ZKQA 3ALLA 3BHFA 3NHOX 1N4WA 3D8XA 2Z5YA 4KPRA 2F5ZA 4U8MA 3AEEA 2X50A 3HYVA 2X3NA 4NEWA 3RP7A 4Z44A 2E4GA 3UOXA 3ZDNA 4J56A 3IF9A 1GRHA 1GESA 3T31A 3OZ2A 2WHDA 4EMWA 4WCTA 2ARDA 5DBJA 1Y0PA 4U8KA 1N4UA 1PDHA 4LIIA 5TR3A 2YG6A 1PJ6A 3H8LA 3QSEA 1E1KA 2ZBWA 3SZFA 3GSIA 5JCIA 5KNLA 2Q0KA 5EOWA 2VQBA 4ZN0A 2YR5A 4IV9A 4FK1C 3NH3X 3T0KA 1ZY8A 3LB8A 4C74A 1YQ4A 2TPRA 4NZHA 3EAOA 2PYXA 4G6GA 4AP3A 3NGCX 5KWFA 1GRAA 2XVEA 3B6DA 4JDRA 3DJEA 2BRAA 4J34A 1FEBA 1D4CA 4EQRA 2YLXA 3D1CA 3AXBA 4CY6A 1LTXR 2E1MA 2OALA 4BURA 1GETA 3AYIA 4BV6A 1Q9IA 2IVEA 4U2SA 4EMIA 1NEKA 2GR1A 3ADAB 2XVHA 4EQXA 3GWDA 3DGHA 3EPTA 4II3A 1Y56B 3KU9A 3DJDA 4C3XA 1CC2A 1CF3A 1PXAA 4U2LA 4II2A 1H86A 2YM1A 3BI2A 5BULA 2CDUA 4TM0A 4Y4LA 2VRLA 1N1PA 2WDRA 4FDCB 1CJ3A 1RP0A 2BK5A 2EQ6A 1JRXA 3AYJA 2BA9A 1JEHA 4NTCA 4B69A 3CNPA 3ICRA 1ONFA 4Z43A 2GMHA 4TLXA 2RGOA 3C4NA 2C76A 2PHHA 1ZP0A 1K0LA 3K7MX 1P2HA 2A8XA 2YLZA 4GR1A 4ADWA 2QA2A 3QFBA 5HHFA 2VVLA 4J36A 4OPDA 1KF6A 3RHAA 3AE4A 4LU6A 4BK3A 1IUTA 1JOAA 3G5QA 2AR8A 4H4PA 3ZYXA 2WESA 5EB4A 1IUXA 4E0VA 1MOKA 1DJNA 3GD3A 4PABA 4YSYA 2GR3A 1GERA 5BUKA 2AAQA 4A6NA 2ZZCA 1NPXA 3GDPA 1F8RA 4TM3A 5FS6A 4YKFA 1BWCA 3AECA 1PBCA 3P4QA 1DODA 4H4RA 3UP4A 1JRZA 3I6DA 4G9KA 3KD9A 5JCLA 1PXBA 2LFCA 3GQHA 3L1RA 1L9CA 3Q6JA 2B9YA 5FS8A 4APNA 4XXGA 1S2QA 2XDOA 1AOGA 4YTPA 3UP5A 1LQTA 3AE1A 5JCNA 4Z26A 1B4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCD A;  4CNK A;  1CHU A;  1TDK A;  1D7L A;  3AWI A;  2YVJ A;  1COY A;  1PJ7 A;  3CTY A;  2XLS A;  2C66 A;  2YR4 A;  4J33 A;  1TYT A;  4YTN A;  4OPG A;  3VQR A;  3NK1 X;  2C70 A;  3VRB A;  3S5W A;  3AE8 A;  1TDN A;  3OC4 A;  2BC1 A;  2C65 A;  2EQ7 A;  2XFO A;  1GRE A;  5GSN A;  3F8D A;  3H4K A;  1OJD A;  3CGD A;  3CND A;  3CGC A;  3SGL A;  2YG7 A;  1TDE A;  2CVJ A;  3IC9 A;  3NIX A;  4O5U A;  2DKH A;  3DJG X;  3GYX A;  1F6M A;  4GDP A;  1GOS A;  3FIM B;  4BK2 A;  1NDA A;  2WET A;  5IPY A;  1Y56 A;  2BAB A;  3UTE A;  4B66 A;  3HZL A;  1OJC A;  4EMJ A;  2RGH A;  1P2E A;  4EM4 A;  1B37 A;  5CKU A;  4LA1 A;  2FBW A;  4U8O A;  3V76 A;  4JY3 A;  2BXR A;  1KNP A;  2WDV A;  1DXL A;  1VRQ B;  2H89 A;  1PN0 A;  3FMW A;  2DKI A;  1NEN A;  3LZW A;  5LV9 A;  3AE3 A;  4IVO B;  3CGE A;  4ECH A;  1GSN A;  2WOW A;  1BGJ A;  4OVI A;  2YM2 A;  4WX1 A;  1H84 A;  1OJA A;  3QJ4 A;  2OA1 A;  2OLO A;  4OCG A;  1O94 A;  1K0I A;  4OPU A;  2VOU A;  2Y6R A;  2VVM A;  1DNC A;  1B5Q A;  2JB2 A;  3E1T A;  1LJ1 A;  2C73 A;  4AOS A;  1TDO A;  2BC0 A;  2X99 A;  4U8J A;  2ZZB A;  2Y6Q A;  5BRT A;  2GRT A;  4KX6 A;  4NEV A;  1L9D A;  3P4P A;  4XWZ A;  3B3R A;  4O5Q A;  2FJE A;  2XYO A;  4M52 A;  1NHS A;  5KXJ A;  3AD8 B;  4A5L A;  3GYJ A;  4GF7 A;  4YSH A;  4DSH A;  2H88 A;  2FJA A;  1QLB A;  1GV4 A;  1PBE A;  3BHK A;  3IHG A;  1KDG A;  4Y4M A;  1LQU A;  1RYI A;  3NN6 X;  3DK4 A;  4H4T A;  4RG4 A;  3GDN A;  3AEG A;  2WQY A;  1H82 A;  3ALM A;  3DK8 A;  3SM8 A;  2YR6 A;  4H4W A;  3UKL A;  3AE7 A;  1PBB A;  1YY5 A;  3LJP A;  3KVE A;  2V61 A;  4EQW A;  4DSG A;  2XFP A;  4FK1 A;  5M0Z A;  1JNZ A;  1M64 A;  1REO A;  1VQW A;  2TMD A;  3GYI A;  2IVD A;  3H8I A;  2CUL A;  1MXT A;  3ICS A;  3LZX A;  3QSS A;  4JY2 A;  4X4J A;  3UKP A;  3T37 A;  3NG7 X;  5KVI A;  2WPF A;  4NTD A;  1CL0 A;  1GRB A;  3ATQ A;  2GQF A;  4CCQ A;  1ZK7 A;  3FG2 P;  2GB0 A;  1RSG A;  3LOV A;  4H2R A;  2WP9 A;  3NTD A;  5KOX A;  3P1W A;  2GAG B;  2GVC A;  2JK6 A;  2BCG G;  4AT0 A;  3AE6 A;  3C96 A;  3CPI G;  4USR A;  1UKV G;  1XPQ A;  3UKA A;  2YQU A;  2BS3 A;  1LPF A;  3AE5 A;  5C3J A;  2A87 A;  3O0H A;  1F3P A;  3CPH G;  1IUV A;  2XCG A;  3GWF A;  3KLJ A;  2C72 A;  1QJD A;  2V3A A;  2YVG A;  2JBV A;  4AOX A;  2X8G A;  3G5R A;  1GTE A;  5KRQ A;  4D03 A;  3NTA A;  4H4X A;  4JN9 A;  1B8S A;  2NPX A;  2C75 A;  3IWA A;  4DGK A;  4C5O A;  2FJB A;  3VR9 A;  1FEA A;  2XFN A;  4C3Y A;  4RG3 A;  4ZCC A;  3SQP A;  1BGN A;  2GMJ A;  2YAU A;  1XDI A;  3GMC A;  3M0O A;  1CJ2 A;  2NVK X;  2QCU A;  5EBK A;  4AT2 A;  2ACZ A;  5M10 A;  3LAD A;  3WE0 A;  1E1N A;  4U8L A;  3COX A;  4HB9 A;  2W0H A;  1IUW A;  3LXD A;  3PO7 A;  3DME A;  2XFQ A;  2UZZ A;  3VR8 A;  1EBD A;  1S2Y A;  2C64 A;  3BI4 A;  2V6O A;  2BCP A;  1JRY A;  1DOB A;  3GRS A;  2B7S A;  3R9U A;  1BKW A;  3NK2 X;  2C3D A;  4FX9 A;  1L0V A;  4BK1 A;  4I58 A;  1FOH A;  4RSL A;  2XLP A;  1ZMC A;  2B76 A;  3ABV A;  2JB3 A;  1GPE A;  2YG5 A;  1S3B A;  1ZOY A;  1M6I A;  3FPZ A;  1BF3 A;  1TDF A;  4UP3 A;  1XAN A;  2APG A;  1GRT A;  3K7T A;  4A99 A;  3ICT A;  4K22 A;  3UKH A;  1E1L A;  1FEC A;  1GRF A;  1Q1W A;  1S3E A;  2QAE A;  2GAH B;  2R4J A;  1QO8 A;  2GEW A;  3IHM A;  2B9W A;  4REK A;  1KNR A;  2VRM A;  2OAM A;  4IA6 A;  1EL5 A;  1L9E A;  2YWL A;  2XLT A;  2XVI A;  5FS9 A;  3CNT A;  3KKJ A;  1TRB A;  1NHP A;  1CC6 A;  3AE9 A;  2WEU A;  3NKS A;  4Z2U A;  3KPF A;  2VZ2 A;  3AB1 A;  2C67 A;  2JAE A;  1FCD A;  3QVR A;  1K0J A;  1TYP A;  4OPL A;  3AEB A;  1GT8 A;  3G5S A;  1D4D A;  3NNE A;  3UTH A;  3I3L A;  2ZZ0 A;  2VQ7 A;  1ZDL A;  1H7X A;  4A7A A;  4JQ9 A;  5J60 A;  3EAN A;  2C7G A;  3ISH A;  5HXI A;  1PS9 A;  3AED A;  1ELI A;  2BS2 A;  1EL8 A;  1EL9 A;  5J7X A;  3DGZ A;  4B65 A;  4TM1 A;  3BNU A;  3P4S A;  1DOE A;  4U8N A;  3UKK A;  4H2N A;  3KA7 A;  3K30 A;  4J2W A;  1HYU A;  1D4E A;  2B9X A;  2R4E A;  2BS4 A;  2R9Z A;  3ALJ A;  1CJ4 A;  3L8K A;  2V5Z A;  3QVP A;  4X9N A;  4YT0 A;  3DJJ A;  3GRT A;  1ZMD A;  2BYB A;  1OJT A;  2WOI A;  1IJH A;  2R46 A;  3AEF A;  2WP5 A;  4U8P A;  2X8C A;  1DOC A;  4X9M A;  4A79 A;  4D04 A;  4GCM A;  3UKF A;  1PHH A;  2B7R A;  2JKC A;  3F8P A;  4A6N B;  1VG0 A;  1ZX9 A;  3SUC A;  1Q1R A;  2C3C A;  1XHC A;  4GDE A;  4N9X A;  2JB1 A;  3PVC A;  4Y4N A;  4CNJ A;  1H7W A;  4YXD A;  2EQ9 A;  2RAB A;  2GV8 A;  2IID A;  4UDQ A;  1PBD A;  3QFA A;  1NG3 A;  2YG4 A;  2WU5 A;  1H6V A;  3AE2 A;  5KOW A;  1IUU A;  4CRT A;  3SFE A;  2XLU A;  4U2T A;  3DK9 A;  1F8W A;  4YSX A;  4A9W A;  4TLZ A;  4EIP A;  4Z24 A;  4H4Z A;  1GTH A;  2EQ8 A;  3CPJ G;  4C77 A;  4H50 A;  4UDP A;  5KVH A;  3AEA A;  4JNQ A;  2GR2 A;  2XFU A;  4HA6 A;  2V3B A;  4H2P A;  4K5R A;  4JNA A;  1GAL A;  1D5T A;  3Q9T A;  4Z25 A;  4IVM B;  2Z5X A;  1NG4 A;  3JSK A;  2GR0 A;  4J31 A;  4EQS A;  2WP6 A;  5HY5 A;  2Q0L A;  3NYE A;  3NLC A;  3VRA A;  2I0Z A;  1H83 A;  3P9U A;  4BJY A;  3DA1 A;  5U1O A;  5JCK A;  1NHR A;  3CN8 A;  3RED A;  3GMB A;  3GQK A;  1E6E A;  1EL7 A;  1VG9 A;  3AD7 B;  1F8S A;  4AP1 A;  1KFY A;  3CNJ A;  1D7Y A;  3II4 A;  3NYC A;  4YKG A;  4XWR A;  2WPC A;  4EM3 A;  4GRT A;  3ATR A;  3BI5 A;  3S61 A;  2Q7V A;  2O9Z A;  4OPC A;  3CNS A;  2BK3 A;  2R0C A;  4H2Q A;  3NN0 X;  2AQJ A;  2GF3 A;  2WOV A;  1KSU A;  3M13 A;  5FS7 A;  4NTE A;  1E39 A;  2WBA A;  3P4R A;  2YG3 A;  1YKJ A;  4PAA A;  1Z6L A;  4YWO A;  4DNA A;  3NT6 A;  3BNM A;  2HQM A;  5C2T A;  2YLW A;  4B68 A;  4CCR A;  1CBO A;  2A89 A;  1LV0 A;  3UOY A;  4ICY A;  3NYF A;  4P9S A;  5L46 A;  4B67 A;  2J3N A;  2WS3 A;  2QA1 A;  1NHQ A;  2BK4 A;  2R0P A;  4H7U A;  4IA5 A;  3UOV A;  4H4S A;  2R0G A;  1KSS A;  2CFY A;  3UTG A;  1CC4 A;  4TM4 A;  4Z2T A;  1MO9 A;  3SFD A;  1BZL A;  2VVL G;  4CY8 A;  3CIR A;  4EIQ A;  2YLT A;  3C4A A;  3RP8 A;  4B63 A;  2YLS A;  1ZOV A;  4H4Q A;  1O95 A;  1O5W A;  1PXC A;  1YQZ A;  4YTM A;  2Q6U A;  5U25 A;  5GRT A;  5JCM A;  5HYM A;  1OJ9 A;  1LVL A;  2XLR A;  4B64 A;  2OLN A;  4BJZ A;  1GEU A;  1VDC A;  1JU2 A;  3UCL A;  2YVF A;  3AYL A;  4CBQ A;  1E1M A;  1N4V A;  3AD9 B;  3QSM A;  4J57 A;  1GND A;  1IUS A;  1PBF A;  4GUV A;  2RGJ A;  2R45 A;  1GXF A;  3ITJ A;  1E7P A;  4H4Y A;  3FBS A;  3V3O A;  1K4Q A;  2GH5 A;  4K2X A;  4OPI A;  4UDR A;  2WU2 A;  2BXS A;  3GD4 A;  4K7Z A;  3DH9 A;  5U63 A;  1W4X A;  5EB5 A;  3NRN A;  2BAC A;  2E5V A;  3NK0 X;  4K5S A;  4Z2R A;  3CGB A;  1SEZ A;  2WPE A;  5CQF A;  3VRD B;  3F8R A;  4YSZ A;  2YLR A;  3URH A;  1V59 A;  4I59 A;  1PJ5 A;  3PS9 A;  1FL2 A;  3UOZ A;  3K7Q X;  4H4V A;  3UKQ A;  5BVA A;  5ER0 A;  1GRG A;  3M12 A;  5IQ1 A;  3UTF A;  4MJW A;  2XVJ A;  1NAA A;  4OPT A;  3V3N A;  2XVF A;  1H81 A;  1X31 B;  1JNR A;  2WDQ A;  3EF6 A;  4U8I A;  1YQ3 A;  2V60 A;  4USQ A;  4A65 A;  5IQ4 A;  4K8D A;  2GQW A;  4H4U A;  5FMH A;  1CJC A;  2X8H A;  3RP6 A;  1DJQ A;  4B1B A;  3RNM A;  2FJD A;  1ZKQ A;  3ALL A;  3BHF A;  3NHO X;  1N4W A;  3D8X A;  2Z5Y A;  4KPR A;  2F5Z A;  4U8M A;  3AEE A;  2X50 A;  2X3N A;  4NEW A;  3RP7 A;  4Z44 A;  2E4G A;  3UOX A;  3ZDN A;  4J56 A;  3IF9 A;  1GRH A;  1GES A;  3OZ2 A;  2WHD A;  4EMW A;  4WCT A;  2ARD A;  5DBJ A;  1Y0P A;  4U8K A;  1N4U A;  1PDH A;  4LII A;  5TR3 A;  2YG6 A;  1PJ6 A;  3H8L A;  3QSE A;  1E1K A;  2ZBW A;  5JCI A;  3GSI A;  2Q0K A;  5EOW A;  2VQB A;  4ZN0 A;  2YR5 A;  4IV9 A;  4FK1 C;  3NH3 X;  1ZY8 A;  3LB8 A;  4C74 A;  1YQ4 A;  2TPR A;  4NZH A;  3EAO A;  2PYX A;  4AP3 A;  3NGC X;  5KWF A;  1GRA A;  2XVE A;  3B6D A;  4JDR A;  3DJE A;  4J34 A;  1FEB A;  1D4C A;  4EQR A;  2YLX A;  3D1C A;  3AXB A;  4CY6 A;  1LTX R;  2E1M A;  2OAL A;  4BUR A;  1GET A;  3AYI A;  4BV6 A;  1Q9I A;  2IVE A;  4U2S A;  4EMI A;  1NEK A;  2GR1 A;  3ADA B;  2XVH A;  4EQX A;  3GWD A;  3DGH A;  3EPT A;  1Y56 B;  3KU9 A;  3DJD A;  4C3X A;  1CC2 A;  1CF3 A;  1PXA A;  4U2L A;  1H86 A;  2YM1 A;  3BI2 A;  5BUL A;  2CDU A;  4TM0 A;  4Y4L A;  2VRL A;  1N1P A;  2WDR A;  4FDC B;  1CJ3 A;  1RP0 A;  2BK5 A;  2EQ6 A;  1JRX A;  3AYJ A;  2BA9 A;  1JEH A;  4NTC A;  4B69 A;  3CNP A;  3ICR A;  1ONF A;  4Z43 A;  2GMH A;  4TLX A;  2RGO A;  3C4N A;  2C76 A;  2PHH A;  1ZP0 A;  1K0L A;  3K7M X;  1P2H A;  2A8X A;  2YLZ A;  4GR1 A;  4ADW A;  2QA2 A;  3QFB A;  5HHF A;  2VVL A;  4J36 A;  4OPD A;  1KF6 A;  3RHA A;  3AE4 A;  4LU6 A;  4BK3 A;  1IUT A;  1JOA A;  3G5Q A;  2AR8 A;  4H4P A;  3ZYX A;  2WES A;  5EB4 A;  1IUX A;  4E0V A;  1MOK A;  1DJN A;  3GD3 A;  4PAB A;  4YSY A;  2GR3 A;  1GER A;  5BUK A;  2AAQ A;  4A6N A;  2ZZC A;  1NPX A;  3GDP A;  1F8R A;  4TM3 A;  5FS6 A;  4YKF A;  1BWC A;  3AEC A;  1PBC A;  3P4Q A;  1DOD A;  4H4R A;  3UP4 A;  1JRZ A;  3I6D A;  3KD9 A;  5JCL A;  1PXB A;  2LFC A;  3GQH A;  3L1R A;  1L9C A;  3Q6J A;  2B9Y A;  5FS8 A;  4APN A;  4XXG A;  1S2Q A;  2XDO A;  1AOG A;  4YTP A;  3UP5 A;  1LQT A;  3AE1 A;  5JCN A;  4Z26 A;  1B4V A; 
#chains in the Genus database with same CATH topology
 1CHU A;  4IDO A;  3KFW X;  3L8R A;  5GON E;  1PJ7 A;  2YVJ A;  2K5B B;  5JTG A;  1SA0 E;  1U4Q A;  2YR4 A;  1TYT A;  3NK1 X;  3VRB A;  3S5W A;  3AE8 A;  2BC1 A;  2C65 A;  2EQ7 A;  4GK5 E;  2EHO B;  3F8D A;  2BG9 C;  5IUX A;  5KMS A;  3JAF A;  4IL9 A;  3CGC A;  2YG7 A;  4WYV A;  2HN2 A;  3DJG X;  2A72 A;  4GDP A;  3I0Q A;  3FIM B;  4BK2 A;  5LXT E;  4TWD A;  1UX4 A;  3HZL A;  1OJC A;  2JMK A;  1P2E A;  5FY0 A;  4YHH T;  4EM4 A;  2PZS A;  2FBW A;  4QXB B;  3V76 A;  3IBP A;  4JV5 T;  2X5I D;  2PYJ A;  2H89 A;  3FMW A;  3LZW A;  3C4W A;  1HCI A;  2QVA A;  2QA7 A;  1H84 A;  1HS7 A;  3QJ4 A;  2OA1 A;  2Y6R A;  4X64 T;  4L5G A;  4G74 A;  5FNV E;  2VK9 A;  4AOS A;  4GAP A;  5HXE A;  4U8J A;  1RVF 4;  1MIY A;  5HCM A;  1AR6 4;  3P4P A;  4XWZ A;  4M52 A;  2BKP A;  2CWY A;  4GF7 A;  4YSH A;  2D0U A;  2CHO A;  3BHK A;  4Y4M A;  4LFA T;  4H4T A;  3GDN A;  3AEG A;  3ALM A;  1AL2 4;  3CMM A;  3SM8 A;  4H4W A;  5KDM C;  3A7M A;  3ZKR A;  5L4H A;  1YY5 A;  5ABF A;  2V61 A;  3IHR A;  2XFP A;  4LFB T;  3B57 A;  1MXT A;  3LZX A;  3FZK B;  4H9P C;  3SRZ A;  3UQ4 A;  3UKP A;  3PUA A;  3T37 A;  4ILC A;  3D0T A;  5KVI A;  2J1D G;  2UXD T;  2X66 A;  2GQF A;  4CCQ A;  3FG2 P;  1RSG A;  1HF8 A;  4H63 H;  3ZT5 A;  3OYZ A;  4EZH A;  3C96 A;  3CPI G;  1RUF 4;  1XPQ A;  3UKA A;  3CK6 A;  4PDW D;  2A87 A;  4I50 E;  2DL1 A;  1IUV A;  2X9Y A;  4IIJ E;  4GOU A;  4XAX B;  3LBX A;  1QJD A;  5CA0 E;  2C72 A;  4H9N C;  2X8G A;  1GTE A;  2NOX A;  3NTA A;  4H4X A;  3C4Z A;  4ERR A;  4U72 A;  1FEA A;  5FP3 A;  4DND A;  1RUG 4;  4IDP A;  4IHJ E;  5FYM A;  5F5W A;  5EBK A;  2KXP B;  2VQE T;  5M10 A;  2LKG A;  1WYC A;  2XAF B;  1IUW A;  3LXD A;  2XFQ A;  3PJA J;  3W15 B;  5LNK A;  1DOB A;  2J4G A;  3Q5D A;  4BK1 A;  4QH5 A;  2XLP A;  2XQ3 A;  2E8I A;  2B76 A;  3ABV A;  2IIU A;  5AQK B;  3TKL B;  4UP3 A;  2APG A;  1NAF A;  4A99 A;  1I94 T;  3ICT A;  3ETU A;  4K22 A;  2VWA A;  2UXN B;  1IBL T;  5J2U E;  3T14 A;  2VRM A;  2OAM A;  5HEH A;  1EL5 A;  4G6H A;  2XLT A;  2XVI A;  3ZYM A;  1CC6 A;  4Z2U A;  3FXE B;  1HG2 A;  2W67 A;  2GK9 A;  3I1A A;  1K0J A;  4OPL A;  3C50 A;  5FVL A;  3NNE A;  3UTH A;  2ZZ0 A;  5JDG A;  2BG9 A;  3KBU A;  4A7A A;  4JQ9 A;  3LFM A;  2C7G A;  4HFB A;  2D2S A;  1M7K A;  3N9P A;  3PV0 F;  1EL8 A;  5J7X A;  4DVD A;  2HWB 4;  4TM1 A;  3TLS A;  3KA7 A;  1HYU A;  1IBK T;  2V6X A;  1D4E A;  2B9X A;  1OED C;  2RP4 A;  2BS4 A;  4X9N A;  3L8K A;  3NRY A;  1CJ4 A;  3VKH A;  4YT0 A;  1RUD 4;  4DR3 T;  1WR0 A;  1IJH A;  3AEF A;  1KK7 A;  2CRB A;  1AR7 4;  2CE7 A;  3QUJ A;  4OYJ A;  4A6N B;  2C3C A;  1XHC A;  2Q9Q A;  4U31 A;  4O8S A;  3KPK A;  3QFA A;  1NG3 A;  2CLY C;  2JPF A;  2WU5 A;  3AE2 A;  4PW8 A;  3TLV A;  2R07 4;  4CRT A;  4Q4Y 4;  2XLU A;  4JI7 T;  1F8W A;  4A9W A;  4H4Z A;  3RH3 A;  1GTH A;  5FVK A;  4C77 A;  5JR9 B;  2E9X D;  5DJQ C;  5LCY A;  5AQV B;  4YY3 T;  1VBB 4;  5JRC B;  3AEA A;  4JNQ A;  2D5U A;  3MKD A;  2WB5 A;  4K5R A;  2V7M A;  2R6G F;  2MYS A;  5JDM A;  3ONX A;  4TN7 B;  5HY5 A;  3NYE A;  4BJM A;  2I0Z A;  1H83 A;  3HI2 A;  5JCK A;  3CN8 A;  1Z7S 4;  3GQK A;  3V5S A;  1EL7 A;  1F8S A;  3RGL A;  2BZB A;  2WPC A;  3S61 A;  3NN0 X;  2LKH A;  3M13 A;  1BR1 A;  4NTE A;  2WBA A;  4KBM B;  2DLR A;  4IRE A;  4GKJ T;  5F3J A;  1V9D A;  4BAY B;  1Z6L A;  5J2T E;  4JLE A;  3NT6 A;  3P8C D;  5HXH A;  5C2T A;  2LSJ A;  2WCA A;  4CCR A;  4IT4 A;  3UOY A;  4DMV A;  4HGA A;  2BK4 A;  1BEV 4;  3KVB A;  2BKN A;  3R84 B;  3UOV A;  5AQI B;  5EZY E;  4CY8 A;  2JQK A;  4NWZ A;  4B63 A;  3BQK A;  3EAB A;  1HG5 A;  3ZT6 A;  1HRI 4;  5LYJ E;  1OJ9 A;  3AA7 B;  4B64 A;  3SZ0 A;  3AYL A;  1BR2 A;  4CBQ A;  1E1M A;  3AD9 B;  4HFC A;  1UCU A;  1FMV A;  4PFP A;  5TAO A;  4LF4 T;  1GND A;  4GUV A;  3K8P C;  4ZOL E;  1VBA 4;  3ITJ A;  1E7P A;  4H4Y A;  3FBS A;  3V3O A;  2GH5 A;  3DH9 A;  5U63 A;  1YKE B;  2NWB A;  2BRY A;  2V5D A;  3AA6 B;  3CGB A;  4LMJ A;  3F8R A;  4I59 A;  3PS9 A;  2XHE B;  2VKD A;  5ER0 A;  4NPP A;  3M12 A;  3V3N A;  2E9X C;  2XVJ A;  1NAA A;  4UIG A;  2XQA A;  4YLH A;  2XQY A;  1JNR A;  3EF6 A;  4CQI A;  3MJX A;  2W4X A;  2LEH A;  3CQX C;  2YIN A;  2WZH A;  1VRB A;  1ZKQ A;  1R09 4;  4ZS2 A;  2WY2 A;  3D8X A;  2Z5Y A;  2RR1 4;  4U8M A;  3AEE A;  2PBI A;  4MFR A;  1N32 T;  3F31 A;  3J9X 1;  1OED A;  3PUG A;  3ZDN A;  4J56 A;  3T31 A;  2WWV A;  3AA0 B;  2WHD A;  4WCT A;  3ZN0 B;  1Y0P A;  1N4U A;  1PDH A;  5TR3 A;  3QSE A;  3H8L A;  4PK5 A;  2V6Y B;  4Q4V 4;  3SZF A;  3GSI A;  4U2Z A;  5KNL A;  2Q0K A;  1AR8 4;  4IV9 A;  3VHL A;  4ZI3 D;  4FK1 C;  4AKL A;  4BA9 A;  4C74 A;  4TWF A;  1HX1 B;  4GB3 4;  4P0A A;  2TPR A;  4NZH A;  3NGC X;  3R6N A;  3RYF E;  3N9M A;  3NVO A;  4JDR A;  4J34 A;  3RKG A;  1LTX R;  2E1M A;  4HWD A;  1Q9I A;  2IVE A;  4U2S A;  5JRE A;  2IML A;  4AQF C;  3UU8 A;  2N9D A;  3E08 A;  3DGH A;  4U2L A;  3RIF A;  2RS1 4;  4N78 D;  2WM9 A;  4IE6 A;  2YM1 A;  4WBO A;  4TM0 A;  1N1P A;  4CI1 B;  2BA9 A;  1JEH A;  1U5P A;  3O4X E;  3AVS A;  4TLX A;  3K7M X;  1P2H A;  2IDO B;  2YLZ A;  5HHF A;  3PUQ A;  3AE4 A;  3M3Z B;  5EB4 A;  4DUZ T;  4X62 T;  4IE4 A;  2J62 A;  1W09 A;  4PAB A;  5L3E B;  4YSY A;  1XDO A;  4TM3 A;  1BWC A;  3K3Q C;  1PBC A;  3UUX B;  4X5T A;  4Z8X A;  2MBG A;  5HEG A;  3L1R A;  2XJ7 A;  2B9Y A;  3UU4 A;  2LSI A;  2IUB A;  4CN6 A;  3U3I A;  3ESL A;  3UP5 A;  3NRX A;  3NBX X;  5JCN A;  5AQQ B;  1D7L A;  3AWI A;  1COY A;  2PW9 A;  3RPU A;  2C66 A;  4IE5 A;  2NW9 A;  1IAP A;  4OPG A;  5HWY A;  1TDN A;  4QH4 A;  2NP9 A;  5GSN A;  3H4K A;  3CND A;  3IC9 A;  4U3C A;  4O5U A;  3LSV A;  2DKH A;  4ZI3 C;  3GYX A;  2BAB A;  1OWA A;  3SX6 A;  3ZMT B;  1S35 A;  2G0U A;  2BXR A;  1VRQ B;  2YEV C;  1PN0 A;  2VAS A;  5LV9 A;  4DV6 T;  4IVO B;  1GSN A;  1R8I A;  4OVI A;  4WX1 A;  2RS5 4;  2OLO A;  2E9X A;  1O94 A;  5ADX L;  1K0I A;  4OPU A;  3LK3 B;  2VOU A;  3UQ7 A;  3Q5E A;  4WW0 A;  1B5Q A;  3E1T A;  3NZQ A;  1LJ1 A;  3U78 A;  4O2B E;  3I9W A;  3AXJ A;  1TDO A;  2IW5 B;  3ZT7 A;  1HNW T;  5BRT A;  2Y6Q A;  2GRT A;  5BMV E;  4NXM T;  4NEV A;  3N9L A;  2FJE A;  5JDH A;  4EZ4 A;  2JJ9 A;  2H88 A;  4A98 A;  1M62 A;  1QLB A;  1XNQ T;  3A8Y C;  1KDG A;  3FBL A;  1RYI A;  3IEE A;  2OV9 A;  4M1P A;  3TLU A;  2EX3 A;  2WQY A;  3HKD E;  1MND A;  2PY5 A;  2QGS A;  5LG4 A;  4EQW A;  4FK1 A;  2TMD A;  4OFZ A;  4Z90 A;  2CUL A;  3QSS A;  4X4J A;  5CGM A;  2Y48 B;  1Y01 A;  5CA1 E;  2BKO A;  2Q9Q D;  2WPF A;  5LP6 E;  4DV5 T;  2CXF A;  3ATQ A;  3BK9 A;  2WP9 A;  1VBC 4;  3AB3 B;  3P1W A;  2CWO A;  2GVC A;  4AT0 A;  4AQF A;  1HXS 4;  2BS3 A;  1XMQ T;  4UVA B;  3AE5 A;  5C3J A;  3O0H A;  2XCG A;  3GWF A;  2V3A A;  2PTF A;  2JBV A;  5HEO A;  5L2L A;  3G5R A;  3QNU A;  4NIQ A;  1B8S A;  3MK7 C;  3IWA A;  3HL6 A;  4C3Y A;  4QH1 A;  4RG3 A;  4ZCC A;  1BGN A;  3SWH A;  2YAU A;  1VOM A;  1E2A A;  4DV3 T;  1CJ2 A;  2NVK X;  2QCU A;  2BBH A;  4LF8 T;  4HB9 A;  4MBQ A;  3DME A;  3JC6 D;  2LHR A;  1I6Z A;  1S2Y A;  1SHZ C;  1MNE A;  4ZS3 A;  3HKC E;  2V6O A;  4IDZ A;  2B7S A;  3LK4 2;  2C3D A;  4FX9 A;  1L0V A;  2V7K A;  4I58 A;  4P0B A;  4RSL A;  5AQJ B;  3QB5 K;  2YG5 A;  2PG8 A;  3EDU A;  4CXX A;  1TDF A;  1XAN A;  3UKH A;  3RIU A;  2GAH B;  1QO8 A;  3T2Z A;  2B9W A;  4KUM B;  4IA6 A;  5FS9 A;  3H3A A;  3AE9 A;  5KMG P;  4G73 A;  2C67 A;  4DR5 T;  3C64 A;  3KV4 A;  3QVR A;  1TYP A;  3AEB A;  3G5S A;  2ODU A;  4ZI2 C;  3I3L A;  3GA8 A;  2V26 A;  3OVU A;  1ZDL A;  2UU9 T;  5J60 A;  5HXI A;  3ISH A;  1PS9 A;  3AED A;  4U8N A;  3UKK A;  3SZW A;  2Q9Q C;  2R4E A;  3ALJ A;  3QVP A;  4IDQ A;  3KV9 A;  4U8P A;  2X8C A;  1DOC A;  4A79 A;  1PVC 4;  5CFB A;  4PK6 A;  1HNZ T;  4H9R C;  3UKF A;  2JKC A;  2WBL A;  3F8P A;  5FKY A;  2ZM2 A;  4N9X A;  2CXL A;  2JB1 A;  3I9Y A;  3VKG A;  3PU8 A;  2EQ9 A;  4YXD A;  2VUR A;  4UEM A;  1H6V A;  1ZKE A;  4PJM A;  1IUU A;  3DK9 A;  2VVS A;  4YSX A;  4EIP A;  2V7I A;  4H50 A;  3JC6 C;  5KVH A;  2GR2 A;  3PDY A;  3P7I A;  5J0Z A;  2KLQ A;  2XFU A;  4WBN E;  1H7C A;  1W9R A;  5E0O A;  3VU7 H;  1GAL A;  3Q9T A;  4Z25 A;  4IVM B;  1POV 0;  1BR4 A;  3JSK A;  3ZC1 A;  2Q0L A;  5ETW A;  3P9U A;  2XAH B;  2KND A;  3RED A;  4PNI A;  3GMB A;  1E6E A;  2CBI A;  1VG9 A;  4YKG A;  2DNX A;  4TNV A;  4DV0 T;  3BI5 A;  1W0A A;  5HXS A;  1XHX A;  5IHY A;  4OPC A;  4DBQ A;  2BK3 A;  4DV2 T;  4OHF A;  4AQG A;  1KSU A;  5FS7 A;  1E39 A;  3ZJ2 A;  4YWO A;  2C5I T;  1H8T D;  4H9S E;  4HN9 A;  1PO2 4;  3F2E A;  4HTE A;  4JI0 T;  2YN6 A;  1UUS A;  5HCJ A;  4B68 A;  5EK2 A;  4OX9 T;  3Q2M A;  1LV0 A;  3PTR B;  5H6Q B;  2XAG B;  2LOS A;  1B7T A;  2QA1 A;  5FXX A;  2E5L T;  4TM4 A;  2VVL G;  4EIQ A;  1QUU A;  4DBR A;  2YLT A;  2YLS A;  1ZOV A;  1O5W A;  2NTY A;  2RM2 4;  4HFE A;  1MIW A;  2K3W A;  2N2N A;  4YTM A;  4EYU A;  2Q6U A;  5U25 A;  5HYM A;  1LVL A;  2XLR A;  3TLW A;  1GEU A;  1JU2 A;  2KMF A;  2WZI A;  2W61 A;  4J57 A;  1PBF A;  1IUS A;  2NW8 A;  3FB2 A;  5JR9 A;  2RGJ A;  1UGO A;  4OPI A;  5AQT B;  5LHG B;  4UDR A;  2WU2 A;  2BXS A;  3GD4 A;  1D4M 4;  4K7Z A;  2IHR 1;  4HKA A;  1W4X A;  2HHH T;  3NRN A;  2E5V A;  3NK0 X;  4Z2R A;  2YLR A;  3URH A;  1PJ5 A;  2F4V T;  4B3R T;  3C98 B;  4U2Y A;  1GRG A;  5LMU T;  4F6R C;  5IQ1 A;  2PLV 4;  2XVF A;  3KDS E;  3CKD A;  3LDQ B;  4I4T E;  3CML A;  3HYW A;  5ABH A;  3LBX B;  4B6X A;  5IQ4 A;  1CJC A;  2X8H A;  3RP6 A;  1MMN A;  4B1B A;  3GN5 B;  1G8X A;  3NHO X;  4KPR A;  3EUH A;  2F5Z A;  4F8H A;  5JDF A;  2X3N A;  5ABE A;  3UOX A;  1MMA A;  1GRH A;  3OZ2 A;  4EMW A;  2ARD A;  4JBW F;  4U8K A;  2LRK A;  4MHC A;  1E1K A;  1EV1 4;  1VRH 4;  5EOW A;  2YR5 A;  1GQE A;  4EEB A;  2KIN B;  3A5X A;  4OK0 A;  4ZI7 E;  3ANW A;  1FIO A;  2MOZ A;  3GMI A;  5EK4 A;  5LBM A;  1LRZ A;  2PYX A;  4DR4 T;  5FL1 A;  2I6H A;  3AAA B;  1AR9 4;  4UV9 B;  2C5J A;  1GRA A;  2V7J A;  4TV8 E;  2P9B A;  3AXB A;  1R08 4;  3B5M A;  2OAL A;  4JI2 T;  2JMH A;  4ZHQ E;  1GET A;  4BV6 A;  4BUR A;  3P50 A;  4GKK T;  1NEK A;  3PUZ F;  2GR1 A;  3ADA B;  1ASJ 4;  3J8F 4;  2M6B A;  3Q5X A;  1Y56 B;  4FI5 A;  4QKN A;  3UU6 A;  3CVR A;  1CC2 A;  4UXN B;  1PXA A;  2VB6 A;  2BG9 B;  2VRL A;  2QRX A;  3RLF F;  3FI7 A;  1CJ3 A;  2EQ6 A;  1JRX A;  5LJN A;  4NTC A;  3ZMZ B;  1ONF A;  4QX7 B;  2XAQ B;  2PHH A;  4GR1 A;  4ADW A;  3QFB A;  3RHA A;  2XZE A;  3JAE A;  2M67 A;  5H6R B;  4LU6 A;  4Q25 A;  4BK3 A;  1IUT A;  2VL0 A;  1J5E T;  3MZK B;  2AR8 A;  2EHO D;  5C8Y E;  4UV8 B;  2WES A;  4CZZ B;  1IUX A;  2Y8D A;  2ES0 A;  4ILB A;  1MOK A;  2B1E A;  1DJN A;  3GD3 A;  2GR3 A;  1GER A;  4YFS A;  2AAQ A;  5FS6 A;  3RC3 A;  1DOD A;  1PXB A;  4TZ4 C;  3PUX F;  3EVY A;  5JQG E;  4YTP A;  4H9O C;  1B4V A;  2NTX A;  1VQW A;  1TDK A;  4ZCD A;  4CNK A;  1XMO T;  5KMP A;  3CPZ A;  4ZZB A;  3CTY A;  2ZM6 T;  5LHH B;  3OC4 A;  1IJ6 A;  3EAM A;  1GRE A;  1OJD A;  1XNR T;  1TDE A;  5DQW A;  3NIX A;  3ONJ A;  2MTQ A;  1F6M A;  1NDA A;  3O1J A;  2WET A;  1RUE 4;  1D1A A;  1J1J A;  2A2F X;  3UTE A;  4B66 A;  4GYR A;  2RGH A;  5CKU A;  4WZX A;  1X9B A;  4JY3 A;  2WDV A;  1DXL A;  4P1N A;  2CPT A;  2RPA A;  3K3O A;  5L4E A;  5FY1 A;  1NEN A;  1WR6 A;  2CMR A;  3OBV E;  2D0T A;  4ECH A;  3S4U A;  4V1A v;  4PJL A;  2VVM A;  4UVB B;  1DNC A;  3EDV A;  2C73 A;  2BC0 A;  1O3X A;  4P09 A;  2ZZB A;  1D0Y A;  2PYL A;  3NKZ A;  1L9D A;  4I55 E;  3B3R A;  4LFC T;  1NHS A;  5KX5 E;  5KXJ A;  3AD8 B;  4A5L A;  3GYJ A;  3WAJ A;  2ODV A;  5FXW A;  4L0R A;  2FJA A;  1PBE A;  2JQH A;  1HNX T;  2A9U A;  1LQU A;  3NN6 X;  1UUR A;  1W0B A;  1RUI 4;  2EHO C;  4RG4 A;  3DP7 A;  1H82 A;  3L3P A;  4KP3 C;  2H7V C;  3ZEF B;  3SOL A;  3AE7 A;  4B3T T;  3ONL C;  4UF0 A;  3LJP A;  1N34 T;  1M64 A;  1REO A;  1Z0P A;  3GYI A;  4YJ2 E;  3ICS A;  1HR0 T;  4JY2 A;  4NTD A;  5DAB A;  5AQN B;  2CA5 A;  2V1D B;  1ZK7 A;  2CM0 A;  4PK4 A;  3LOV A;  5LA6 E;  3NTD A;  5LMN T;  4LML A;  2JK6 A;  2BCG G;  2WAU A;  1LPF A;  3OPC A;  3T2K A;  1VCT A;  4AOX A;  1KNZ A;  4JN9 A;  2FUP A;  3ZJ1 A;  2ZMA A;  5L3B B;  2C75 A;  2NPX A;  4DGK A;  3UUN A;  2XFN A;  2GMJ A;  5LG3 A;  1HX8 A;  4EGW A;  2LLY A;  3M0O A;  4AT2 A;  2ACZ A;  1E1N A;  3PE0 A;  3WAK A;  1FJG T;  3COX A;  4U8L A;  2V7L A;  1OED B;  2DWK A;  3RIU C;  1EBD A;  2XUE A;  4KHP T;  3BI4 A;  4GAV A;  3O9X A;  3ZLI A;  3GRS A;  3R9U A;  1BKW A;  3NK2 X;  2D9D A;  4DMW A;  1FOH A;  1GPE A;  1S3B A;  1ZOY A;  4MAL A;  4QXC B;  2K9A A;  2YKS A;  1BF3 A;  4CN4 A;  3O1I A;  1NA1 D;  3K7T A;  4CN1 A;  3O1H A;  3PUW F;  2H7O A;  5LJM A;  1FEC A;  4ISS A;  5AQG B;  1Q1W A;  1S3E A;  2R4J A;  2GEW A;  3CQG B;  4JYA T;  1IBM T;  1KNR A;  2YWL A;  2R7F A;  2CLY B;  2JRK A;  1NHP A;  3NKS A;  3OTO T;  3KPF A;  4HE8 A;  4JUY A;  2JAE A;  1FCD A;  2KZ7 B;  5A1L A;  2JQ9 A;  5L3G B;  3RX6 A;  1D4D A;  2VQ7 A;  1D1B A;  2XM1 A;  3EAN A;  4KMC A;  3HA4 A;  1ELI A;  4EB6 E;  2BS2 A;  4AKG A;  1EL9 A;  2CHN A;  4O4H E;  4O2A E;  4JI4 T;  4H2N A;  3ZN1 B;  4EED A;  2HWC 4;  3NWI A;  4GIW A;  3AVR A;  2V5Z A;  2UXX B;  2C4C A;  4AKI A;  3UFE A;  4B3S T;  4U33 A;  2BYB A;  2XSA A;  3OYX A;  1N36 T;  4D04 A;  4GCM A;  1RUJ 4;  3M65 A;  2B7R A;  3SUC A;  1VG0 A;  4GDE A;  2XPK A;  3FXD B;  1H7W A;  2RAB A;  2GV8 A;  2IID A;  4UDQ A;  5M4Y A;  2YG4 A;  4U2T A;  4C91 A;  3K3N A;  4TLZ A;  4Z24 A;  4LF6 T;  2Z6E A;  3CPJ G;  2RMU 4;  2EHO A;  3JAD A;  2VKO A;  4HA6 A;  2MPK A;  3KBT A;  2V3B A;  4JNA A;  4DR2 T;  1D5T A;  2Z5X A;  1NG4 A;  3FHN A;  4J31 A;  4U74 A;  1HRV 4;  3NLC A;  1Z8U A;  3DA1 A;  3T8O A;  5U1O A;  3L09 A;  3OKQ A;  3AD7 B;  4AP1 A;  3NYC A;  3CNJ A;  4TV9 E;  3II4 A;  5L3C B;  4XWR A;  4GRT A;  3ATR A;  2W62 A;  4HWH A;  5IWA T;  2O9Z A;  2W63 A;  4QHO A;  5AFU L;  2R0C A;  4ZXL A;  4H2Q A;  4TX5 A;  2AQJ A;  2GF3 A;  2WOV A;  2YG3 A;  3P4R A;  1YKJ A;  2E9X B;  4HEA A;  2UUB T;  3RHW A;  3ZCJ A;  3AA1 B;  2A89 A;  4BJN A;  3NYF A;  3AXJ B;  4P9S A;  3P4W A;  1UX5 A;  2J3N A;  4HFV A;  2R0P A;  4NUU A;  2R0G A;  1KSS A;  2CFY A;  5CJ5 A;  2X9W A;  3SFD A;  1BZL A;  3CIR A;  5JR9 C;  3RP8 A;  3RI5 A;  4H4Q A;  1PXC A;  4JEU B;  5IYZ E;  5DQV A;  1WFD A;  4KI0 F;  2CBJ A;  2NW7 A;  1SE7 A;  4QXH B;  1GXF A;  4HFI A;  4JI1 T;  4DV1 T;  2OA5 A;  4XBF B;  4DR6 T;  5EB5 A;  2ACX A;  2BAC A;  2KSR A;  3ZC0 A;  2WPE A;  2BG9 E;  4YSZ A;  2K24 A;  5AQL B;  1FL2 A;  3K7Q X;  4DR7 T;  4H4V A;  3UKQ A;  2AXD S;  4X1I E;  3T1H T;  1H81 A;  1D0X A;  2I0M A;  3N9O A;  2WDQ A;  3ZMV B;  4A97 A;  3KV5 A;  4K8D A;  4H4U A;  4YHJ A;  5FMH A;  1IZN B;  2XQ5 A;  1DJQ A;  3RNM A;  2FJD A;  5AQM B;  4WNK A;  4COF A;  1N4W A;  2PFV A;  5LBQ B;  2N1G A;  2C0S A;  3HYV A;  2VL8 A;  2X0L B;  4NEW A;  2LE8 A;  4DID B;  1GES A;  5DBJ A;  5AQH B;  2HN1 A;  4LII A;  2YG6 A;  3N2G E;  4IGU A;  2W0G A;  2VQB A;  3ZST A;  1VBD 4;  2JQQ A;  3NH3 X;  3T0K A;  3LB8 A;  3X1D A;  1ZEE A;  1YQ4 A;  2YDR A;  4LF9 T;  3ETV A;  4UEL A;  4G6G A;  3UUM A;  3MAC A;  2DHR A;  2HH7 A;  3CWZ B;  2XVE A;  2YK0 A;  2BRA A;  1FEB A;  4C90 A;  1D4C A;  3D1C A;  4CY6 A;  4EQR A;  4AKH A;  1ZV4 X;  4TWH A;  5JDL A;  3IF8 B;  4CXW A;  4NUV A;  3MA9 A;  2LJL A;  4EQX A;  1EZ3 A;  3EPT A;  4II3 A;  3DJD A;  4HWC A;  4II2 A;  5LB7 B;  2W66 A;  3BI2 A;  5BUL A;  2CDU A;  1XI1 A;  2VKJ A;  2WDR A;  1RP0 A;  5J1G A;  4B69 A;  3CNP A;  3ICR A;  4O4L E;  5JVD E;  2LRL A;  2GMH A;  4DV4 T;  2C76 A;  1ZP0 A;  4J36 A;  4OPD A;  1KF6 A;  3Q5W A;  3G5Q A;  5AQS B;  1D0Z A;  4LF5 T;  3ZYX A;  4E0V A;  4IE7 A;  1CUN A;  3GN5 A;  2RA1 A;  2YOE A;  4TNW A;  4Q4W 4;  2BVL A;  5CB4 E;  3TLT A;  4A6N A;  1G73 A;  3GDP A;  1XHZ A;  3UT5 E;  4YKF A;  3AEC A;  1JRZ A;  2WMO A;  4G9K A;  3RQU A;  3RQW A;  3DTO A;  4ADZ A;  2LFC A;  3RC8 A;  3GQH A;  2DI4 A;  5HAX A;  4UVC B;  1S2Q A;  2XDO A;  1AOG A;  2XY8 B;  1LQT A;  4TUY E;  3AE1 A;  4Z26 A;  3N2K E;  2ZLY A;  5ABF B;  3ZPO A;  2XLS A;  4EAH A;  5L3F B;  5JRC A;  4J33 A;  3VQR A;  3E0Z A;  2XQ8 A;  4YTN A;  2C70 A;  2R04 4;  2XFO A;  4X66 T;  1LKX A;  5BR8 T;  3CGD A;  3SGL A;  2CVJ A;  5LHI B;  2LOP A;  5JDQ A;  1E1H B;  4HWF A;  1GOS A;  5AQF B;  5IPY A;  1KEY A;  1SUM B;  4ZZC A;  1Y56 A;  4EMJ A;  2XAJ B;  4PAG A;  3UUB A;  1B37 A;  4LA1 A;  4U8O A;  2QYW A;  4AKR B;  1KNP A;  3C51 A;  4J2C A;  4A5X A;  1RUH 4;  3T2Y A;  2DKI A;  3AE3 A;  4DUY T;  5HEU A;  3CGE A;  2YU1 A;  2V5C A;  2WOW A;  1BGJ A;  2YM2 A;  3FZF B;  1OJA A;  4AXP A;  4OCG A;  2PJQ A;  3QK6 A;  3KVA A;  4RHV 4;  1LVF A;  4JI5 T;  2JB2 A;  1VCS A;  4CI2 B;  2LHN A;  3PJA A;  1PO1 4;  1OED E;  2X99 A;  2XQ7 A;  5JDN A;  4KX6 A;  2W00 A;  3RRC A;  3ZSS A;  2XYO A;  3QB5 A;  3V5U A;  4O5Q A;  3QC9 A;  3RYC E;  4AQY T;  4NXN T;  1HFA A;  4DSH A;  4EIW A;  5AQO B;  1RMU 4;  1GV4 A;  3IHG A;  2KT9 A;  2JIW A;  4DR1 T;  2UXB T;  3DK4 A;  3DK8 A;  5HYA A;  2YR6 A;  3UKL A;  4LMK A;  4O4I E;  3RYI E;  1PBB A;  3KVE A;  4DSG A;  5AQR B;  5M0Z A;  1JNZ A;  2IVD A;  3H8I A;  1RUC 4;  4E7Z A;  2X51 A;  2AE9 A;  3NG7 X;  1CL0 A;  2UXC T;  4AI6 A;  1GRB A;  2GB0 A;  2SPC A;  4UR9 A;  4DV7 T;  4H2R A;  5KOX A;  2GAG B;  3AE6 A;  2I59 A;  5EK3 A;  4USR A;  1T98 A;  1UKV G;  3UTK A;  2YQU A;  2DCF A;  4MLK A;  1F3P A;  3CPH G;  3KLJ A;  5ABG A;  5KMQ A;  2NR4 A;  2YVG A;  2XM2 A;  2VKH A;  1XZY A;  5KRQ A;  2XQ9 A;  4D03 A;  1J5W A;  1FMW A;  4JI6 T;  4C5O A;  2FJB A;  2UUC T;  3VR9 A;  2X68 A;  3SQP A;  3EI0 A;  1Y64 B;  4CI3 B;  1XDI A;  3GMC A;  4Z91 A;  2WMN A;  3LAD A;  3WE0 A;  3AAI A;  3PUR A;  4G63 A;  3N2O A;  2W0H A;  3PO7 A;  2BDE A;  2Q9Q B;  2UZZ A;  2HPL A;  2J47 A;  4HFD A;  3VR8 A;  2C64 A;  2V6Y A;  4GK0 E;  2BCP A;  1JRY A;  3RYH E;  5F8P A;  4X1Y E;  4KHZ F;  2XQ6 A;  1ZMC A;  2JB3 A;  3KV6 A;  2W2U A;  3RF1 A;  1DU2 A;  1M6I A;  3FPZ A;  4CXY A;  1GRT A;  2LT3 A;  4K0U A;  3ANW B;  2IC9 A;  4PJJ A;  5LGU B;  1E1L A;  1GRF A;  2QAE A;  3IHM A;  3F57 A;  4REK A;  5HWX A;  3JCF A;  1AJ3 A;  4H63 V;  3UU5 A;  1L9E A;  2CCQ A;  3CNT A;  3KKJ A;  1WYB A;  1TRB A;  2WEU A;  2VZ2 A;  3CX6 B;  2X9H A;  3AB1 A;  2Y6X A;  4EYY R;  4O4J E;  1GT8 A;  2LSG A;  5FY7 A;  4U7Y A;  1YD8 G;  1OOP D;  2V8S V;  1X79 A;  3OJA A;  1H7X A;  2XSB A;  3C4X A;  4EV6 A;  4I0U A;  4QX8 B;  1WCR A;  3DGZ A;  4B65 A;  1D1C A;  3BNU A;  3P4S A;  1DOE A;  2X0Y A;  3H37 A;  3K30 A;  4J2W A;  4PFO A;  4H9Q C;  2KWH A;  3PUV F;  1VBE 4;  2R9Z A;  3DJJ A;  3GRT A;  1ZMD A;  1COV 4;  2LM2 A;  1OJT A;  2WOI A;  2L9Q A;  2R46 A;  2WP5 A;  3CX7 B;  2LSY A;  4X9M A;  3B13 A;  3N9Q A;  3ZMU B;  2KWI B;  1PHH A;  4PJN A;  3E22 E;  1ZX9 A;  3N5L A;  1Q1R A;  4G2A A;  3PVC A;  2YDQ A;  4LF7 T;  5L47 A;  4GYS A;  4Y4N A;  4CNJ A;  3RRW A;  3SY4 A;  4U7I A;  1PBD A;  1QSD A;  5KOW A;  5FMN A;  4EOZ B;  3SFE A;  2L3L A;  1WRD A;  3CX8 B;  2X9X A;  1N33 T;  2EQ8 A;  5AQU B;  1LVK A;  4IL4 A;  4UDP A;  3EHZ A;  3PUY F;  2L8K A;  3GWH A;  3HYX A;  4H2P A;  3L39 A;  2GR0 A;  1UK5 A;  2WP6 A;  4EQS A;  3SYI A;  3UUL A;  3VRA A;  4BJY A;  4IDN A;  4NNJ A;  1NHR A;  2XTL A;  2LM9 A;  2H3R A;  1KFY A;  1D7Y A;  4EM3 A;  2UUA T;  2Q7V A;  3HKB E;  3CNS A;  3LJC A;  4ASK A;  3LG7 A;  3ZCI A;  4PAA A;  2XQ4 A;  4DNA A;  1NWM X;  4X20 E;  3BNM A;  2HQM A;  2YLW A;  1CBO A;  4FJO A;  4ICY A;  5L46 A;  4B67 A;  2WS3 A;  1NHQ A;  4H7U A;  4IA5 A;  1WLX A;  4YJ3 E;  4H4S A;  3PUS A;  3UTG A;  1CC4 A;  5KMR A;  4Z2T A;  1MO9 A;  3FZH B;  5JH7 E;  3H3M A;  3WI3 A;  2RS3 4;  2VVN A;  1NCQ D;  1YXR A;  3MXZ A;  3C4A A;  1O95 A;  1T7S A;  2HPJ A;  2M6I A;  4AIS A;  1YQZ A;  4ILU A;  2VQF T;  5GRT A;  5JCM A;  4ANJ A;  3I0O A;  3RIA A;  2OLN A;  4BJZ A;  1VDC A;  4JI3 T;  3UCL A;  2YVF A;  1N4V A;  2A3D A;  3QSM A;  4UF0 B;  3T1Y T;  3IA3 A;  4AIU A;  2R45 A;  1MQT D;  2ZM8 A;  1K4Q A;  4K2X A;  4IE0 A;  4A56 A;  4K5S A;  1SEZ A;  5CQF A;  3VRD B;  2ZM0 A;  5AQP B;  1V59 A;  1T72 A;  1K5M D;  3UOZ A;  5BVA A;  3NZP A;  3UTF A;  2C5K T;  3ZYL A;  4MJW A;  4OPT A;  5HXR A;  3LK2 B;  3G06 A;  1X31 B;  4U8I A;  1YQ3 A;  2V60 A;  3ZYK A;  4USQ A;  3SZC A;  2WSS V;  2BVM A;  4A65 A;  3SXI A;  2GQW A;  2E2A A;  1T8B A;  2IAK A;  3ALL A;  3BHF A;  2XAS B;  2X50 A;  1PIV 4;  4HWI B;  3DJB A;  3AAE B;  3UU3 A;  3RP7 A;  4Z44 A;  2E4G A;  1YW0 A;  3IF9 A;  4K0K T;  2MAW A;  4IST A;  2OLT A;  4X65 T;  2YU2 A;  1PJ6 A;  2ZBW A;  2BBJ A;  5JCI A;  1MMG A;  3Q9D A;  2CEA A;  3N9N A;  4ZN0 A;  1RHI 4;  5LGN B;  1ZY8 A;  1IJ5 A;  2K48 A;  2LSK A;  1S94 A;  1HTJ F;  1XDP A;  4DO0 A;  4ZI2 D;  3KIN B;  3BQI A;  5L3D B;  3EAO A;  4AP3 A;  5KWF A;  1OXZ A;  3B6D A;  3DJE A;  2YLX A;  2CXD A;  1MIV A;  3AYI A;  4X1K E;  4EMI A;  2DWG A;  2XVH A;  2X67 A;  5FXV A;  4Q4X 4;  3GWD A;  3HKE E;  3ZMS B;  3K1S A;  3KU9 A;  4C3X A;  1CF3 A;  3QOF A;  1H86 A;  3JD7 4;  4Y4L A;  4FDC B;  2BK5 A;  3AYJ A;  3BQL A;  5HXC A;  4Z43 A;  3PU3 A;  4EXT A;  2RGO A;  3C4N A;  3FBZ A;  1K0L A;  2IC6 A;  3RKO A;  2A8X A;  4JI8 T;  2QA2 A;  2VVL A;  5LOV E;  5FXZ A;  1XWM A;  4B3M T;  5FL0 A;  1JOA A;  2R06 4;  4H4P A;  1BR0 A;  1MMD A;  4L9I A;  1ZHC A;  4JEH B;  4HFH A;  1US7 B;  5HEJ A;  2X0H A;  2WWU A;  3UFG A;  1EAH 4;  3CQC B;  4E7S A;  5BUK A;  4OYK A;  2ZZC A;  4ILA A;  1NPX A;  4XZC A;  3FZM B;  1F8R A;  3HR0 A;  3UP4 A;  3P4Q A;  3J7Y q;  4H4R A;  1FEW A;  3I6D A;  3KD9 A;  5JCL A;  4QWN B;  3SS1 A;  3Q6J A;  4ZEY A;  1L9C A;  1YKH B;  2YDS A;  4APN A;  4I43 B;  5LGT B;  4XXG A;  3JBG 4;  3FZL B;  5FS8 A; 
#chains in the Genus database with same CATH homology
 4ZCD A;  4CNK A;  1CHU A;  1TDK A;  1D7L A;  5KMP A;  3AWI A;  2YVJ A;  1COY A;  1PJ7 A;  3CTY A;  2XLS A;  2C66 A;  2YR4 A;  4J33 A;  1TYT A;  4YTN A;  4OPG A;  3VQR A;  3NK1 X;  2C70 A;  3VRB A;  3S5W A;  3AE8 A;  1TDN A;  3OC4 A;  2BC1 A;  2C65 A;  2EQ7 A;  2XFO A;  1GRE A;  5GSN A;  3F8D A;  3H4K A;  1OJD A;  5KMS A;  3CGD A;  3CND A;  3CGC A;  3SGL A;  2YG7 A;  1TDE A;  2CVJ A;  3IC9 A;  3NIX A;  4O5U A;  2DKH A;  3DJG X;  3GYX A;  1F6M A;  4GDP A;  1GOS A;  3FIM B;  4BK2 A;  1NDA A;  2WET A;  5IPY A;  1Y56 A;  2BAB A;  3UTE A;  4B66 A;  3HZL A;  1OJC A;  4EMJ A;  3SX6 A;  2RGH A;  1P2E A;  4EM4 A;  1B37 A;  5CKU A;  4LA1 A;  2FBW A;  4U8O A;  3V76 A;  4JY3 A;  2BXR A;  1KNP A;  2WDV A;  1DXL A;  1VRQ B;  2H89 A;  1PN0 A;  3FMW A;  3T2Y A;  2DKI A;  1NEN A;  3LZW A;  5LV9 A;  3AE3 A;  4IVO B;  3CGE A;  4ECH A;  1GSN A;  2WOW A;  1BGJ A;  4OVI A;  2YM2 A;  4WX1 A;  1H84 A;  1OJA A;  3QJ4 A;  2OA1 A;  2OLO A;  4OCG A;  1O94 A;  1K0I A;  4OPU A;  2VOU A;  2Y6R A;  2VVM A;  1DNC A;  1B5Q A;  2JB2 A;  3E1T A;  4G74 A;  1LJ1 A;  2C73 A;  4AOS A;  1TDO A;  2BC0 A;  2X99 A;  4GAP A;  4U8J A;  2ZZB A;  2Y6Q A;  5BRT A;  2GRT A;  4KX6 A;  4NEV A;  1L9D A;  3P4P A;  4XWZ A;  3B3R A;  4O5Q A;  2FJE A;  2XYO A;  4M52 A;  1NHS A;  5KXJ A;  3AD8 B;  4A5L A;  3GYJ A;  4GF7 A;  4YSH A;  4DSH A;  2H88 A;  2FJA A;  1QLB A;  1GV4 A;  1PBE A;  3BHK A;  3IHG A;  1KDG A;  4Y4M A;  1LQU A;  1RYI A;  3NN6 X;  3DK4 A;  4H4T A;  4RG4 A;  3GDN A;  3AEG A;  2WQY A;  1H82 A;  3ALM A;  3DK8 A;  3CMM A;  3SM8 A;  2YR6 A;  4H4W A;  3UKL A;  3AE7 A;  1PBB A;  1YY5 A;  3LJP A;  3KVE A;  2V61 A;  4EQW A;  4DSG A;  2XFP A;  4FK1 A;  5M0Z A;  1JNZ A;  1M64 A;  1REO A;  1VQW A;  2TMD A;  3GYI A;  2IVD A;  3H8I A;  2CUL A;  1MXT A;  3ICS A;  3LZX A;  3QSS A;  4JY2 A;  4X4J A;  3UKP A;  3T37 A;  3NG7 X;  5KVI A;  2WPF A;  4NTD A;  1CL0 A;  1GRB A;  3ATQ A;  2GQF A;  4CCQ A;  1ZK7 A;  3FG2 P;  2GB0 A;  1RSG A;  3LOV A;  4H2R A;  2WP9 A;  3NTD A;  5KOX A;  3P1W A;  2GAG B;  2GVC A;  2JK6 A;  2BCG G;  4AT0 A;  3AE6 A;  3C96 A;  3CPI G;  4USR A;  1UKV G;  1XPQ A;  3UKA A;  2YQU A;  2BS3 A;  1LPF A;  3AE5 A;  5C3J A;  2A87 A;  3O0H A;  1F3P A;  3CPH G;  1IUV A;  2XCG A;  3GWF A;  3KLJ A;  3T2K A;  2C72 A;  1QJD A;  2V3A A;  5KMQ A;  2YVG A;  2JBV A;  4AOX A;  2X8G A;  3G5R A;  1GTE A;  5KRQ A;  4D03 A;  3NTA A;  4H4X A;  4JN9 A;  1B8S A;  2NPX A;  2C75 A;  3IWA A;  4DGK A;  4C5O A;  2FJB A;  3VR9 A;  1FEA A;  2XFN A;  4C3Y A;  4RG3 A;  4ZCC A;  3SQP A;  1BGN A;  2GMJ A;  2YAU A;  1XDI A;  3GMC A;  3M0O A;  1CJ2 A;  2NVK X;  2QCU A;  5EBK A;  4AT2 A;  2ACZ A;  5M10 A;  3LAD A;  3WE0 A;  1E1N A;  4U8L A;  3COX A;  4HB9 A;  2W0H A;  1IUW A;  3LXD A;  3PO7 A;  3DME A;  2XFQ A;  2UZZ A;  3VR8 A;  1EBD A;  1S2Y A;  2C64 A;  3BI4 A;  4GAV A;  2V6O A;  2BCP A;  1JRY A;  1DOB A;  3GRS A;  2B7S A;  3R9U A;  1BKW A;  3NK2 X;  2C3D A;  4FX9 A;  1L0V A;  4BK1 A;  4I58 A;  1FOH A;  4RSL A;  2XLP A;  1ZMC A;  2B76 A;  3ABV A;  2JB3 A;  1GPE A;  2YG5 A;  1S3B A;  1ZOY A;  1M6I A;  3FPZ A;  1BF3 A;  1TDF A;  4UP3 A;  1XAN A;  2APG A;  1GRT A;  3K7T A;  4A99 A;  3ICT A;  4K22 A;  3UKH A;  1E1L A;  1FEC A;  1GRF A;  1Q1W A;  1S3E A;  2QAE A;  2GAH B;  2R4J A;  1QO8 A;  2GEW A;  3IHM A;  2B9W A;  4REK A;  3T14 A;  3T2Z A;  1KNR A;  2VRM A;  2OAM A;  4IA6 A;  1EL5 A;  1L9E A;  2YWL A;  4G6H A;  2XLT A;  2XVI A;  5FS9 A;  3CNT A;  3KKJ A;  1TRB A;  1NHP A;  1CC6 A;  3AE9 A;  2WEU A;  3NKS A;  4Z2U A;  3KPF A;  2VZ2 A;  4G73 A;  3AB1 A;  2C67 A;  2JAE A;  1FCD A;  3QVR A;  1K0J A;  1TYP A;  4OPL A;  3AEB A;  1GT8 A;  3G5S A;  1D4D A;  3NNE A;  3UTH A;  3I3L A;  2ZZ0 A;  2VQ7 A;  1ZDL A;  1H7X A;  4A7A A;  4JQ9 A;  5J60 A;  3EAN A;  2C7G A;  3ISH A;  5HXI A;  1PS9 A;  3AED A;  1ELI A;  2BS2 A;  1EL8 A;  1EL9 A;  5J7X A;  3DGZ A;  4B65 A;  4TM1 A;  3BNU A;  3P4S A;  1DOE A;  4U8N A;  3UKK A;  4H2N A;  3KA7 A;  3K30 A;  4J2W A;  1HYU A;  1D4E A;  3SZW A;  2B9X A;  2R4E A;  2BS4 A;  2R9Z A;  3ALJ A;  1CJ4 A;  3L8K A;  2V5Z A;  3QVP A;  4X9N A;  2C4C A;  4YT0 A;  3DJJ A;  3GRT A;  1ZMD A;  2BYB A;  1OJT A;  2WOI A;  1IJH A;  2R46 A;  3AEF A;  2WP5 A;  4U8P A;  2X8C A;  1DOC A;  4X9M A;  4A79 A;  4D04 A;  4GCM A;  3UKF A;  1PHH A;  2B7R A;  2JKC A;  3F8P A;  4A6N B;  1VG0 A;  1ZX9 A;  3SUC A;  1Q1R A;  2C3C A;  1XHC A;  4GDE A;  4N9X A;  2JB1 A;  3PVC A;  4Y4N A;  4CNJ A;  3KPK A;  1H7W A;  4YXD A;  2EQ9 A;  2RAB A;  2GV8 A;  2IID A;  3SY4 A;  4UDQ A;  1PBD A;  3QFA A;  1NG3 A;  2YG4 A;  2WU5 A;  1H6V A;  3AE2 A;  5KOW A;  1IUU A;  4CRT A;  3SFE A;  2XLU A;  4U2T A;  3DK9 A;  1F8W A;  4YSX A;  4A9W A;  4TLZ A;  4EIP A;  4Z24 A;  4H4Z A;  1GTH A;  2EQ8 A;  3CPJ G;  4C77 A;  4H50 A;  4UDP A;  5KVH A;  3AEA A;  4JNQ A;  2GR2 A;  2XFU A;  4HA6 A;  3HYX A;  2V3B A;  4H2P A;  4K5R A;  4JNA A;  1GAL A;  1D5T A;  3Q9T A;  4Z25 A;  4IVM B;  2Z5X A;  1NG4 A;  3JSK A;  2GR0 A;  4J31 A;  4EQS A;  2WP6 A;  5HY5 A;  2Q0L A;  3NYE A;  3SYI A;  3NLC A;  3VRA A;  2I0Z A;  1H83 A;  3P9U A;  4BJY A;  3DA1 A;  5U1O A;  4NNJ A;  1NHR A;  3CN8 A;  3RED A;  5JCK A;  3GMB A;  3GQK A;  1E6E A;  1EL7 A;  1VG9 A;  3AD7 B;  1F8S A;  4AP1 A;  1KFY A;  3CNJ A;  1D7Y A;  3II4 A;  3NYC A;  4YKG A;  4XWR A;  2WPC A;  4EM3 A;  4GRT A;  3ATR A;  3BI5 A;  3S61 A;  2Q7V A;  2O9Z A;  4OPC A;  3CNS A;  2BK3 A;  2R0C A;  4H2Q A;  3NN0 X;  2AQJ A;  2GF3 A;  2WOV A;  1KSU A;  3M13 A;  5FS7 A;  4NTE A;  1E39 A;  2WBA A;  3P4R A;  2YG3 A;  1YKJ A;  4PAA A;  1Z6L A;  4YWO A;  4DNA A;  3NT6 A;  3BNM A;  2HQM A;  5C2T A;  2YLW A;  4B68 A;  4CCR A;  1CBO A;  2A89 A;  1LV0 A;  3UOY A;  4ICY A;  3NYF A;  4P9S A;  5L46 A;  4B67 A;  2J3N A;  2WS3 A;  2QA1 A;  1NHQ A;  2BK4 A;  2R0P A;  4H7U A;  4IA5 A;  3UOV A;  4H4S A;  2R0G A;  1KSS A;  2CFY A;  3UTG A;  1CC4 A;  4TM4 A;  5KMR A;  4Z2T A;  1MO9 A;  3SFD A;  1BZL A;  2VVL G;  4CY8 A;  3CIR A;  4EIQ A;  4NWZ A;  2YLT A;  3C4A A;  3RP8 A;  4B63 A;  2YLS A;  1ZOV A;  4H4Q A;  1O95 A;  1O5W A;  1PXC A;  1YQZ A;  4YTM A;  2Q6U A;  5U25 A;  5GRT A;  5JCM A;  5HYM A;  1OJ9 A;  1LVL A;  2XLR A;  4B64 A;  2OLN A;  3SZ0 A;  4BJZ A;  1GEU A;  1VDC A;  1JU2 A;  3UCL A;  2YVF A;  3AYL A;  4CBQ A;  1E1M A;  1N4V A;  3AD9 B;  3QSM A;  4J57 A;  1GND A;  1IUS A;  1PBF A;  4GUV A;  2RGJ A;  2R45 A;  1GXF A;  3ITJ A;  1E7P A;  4H4Y A;  3FBS A;  3V3O A;  1K4Q A;  2GH5 A;  4K2X A;  4OPI A;  4UDR A;  2WU2 A;  2BXS A;  3GD4 A;  4K7Z A;  3DH9 A;  5U63 A;  1W4X A;  5EB5 A;  3NRN A;  2BRY A;  2BAC A;  2E5V A;  3NK0 X;  4K5S A;  4Z2R A;  3CGB A;  1SEZ A;  2WPE A;  5CQF A;  3VRD B;  3F8R A;  4YSZ A;  2YLR A;  3URH A;  1V59 A;  4I59 A;  1PJ5 A;  3PS9 A;  1FL2 A;  3UOZ A;  3K7Q X;  4H4V A;  3UKQ A;  5BVA A;  5ER0 A;  1GRG A;  3M12 A;  5IQ1 A;  3UTF A;  4MJW A;  2XVJ A;  1NAA A;  4OPT A;  3V3N A;  2XVF A;  1H81 A;  1X31 B;  1JNR A;  2WDQ A;  3EF6 A;  3HYW A;  4U8I A;  1YQ3 A;  2V60 A;  4USQ A;  3SZC A;  4A65 A;  5IQ4 A;  3SXI A;  4K8D A;  2GQW A;  4H4U A;  5FMH A;  1CJC A;  2X8H A;  3RP6 A;  1DJQ A;  4B1B A;  3RNM A;  2FJD A;  1ZKQ A;  3ALL A;  3BHF A;  3NHO X;  1N4W A;  3D8X A;  2Z5Y A;  4KPR A;  2F5Z A;  4U8M A;  3AEE A;  2X50 A;  3HYV A;  2X3N A;  4NEW A;  3RP7 A;  4Z44 A;  2E4G A;  3UOX A;  3ZDN A;  4J56 A;  3IF9 A;  1GRH A;  1GES A;  3T31 A;  3OZ2 A;  2WHD A;  4EMW A;  4WCT A;  2ARD A;  5DBJ A;  1Y0P A;  4U8K A;  1N4U A;  1PDH A;  4LII A;  5TR3 A;  2YG6 A;  1PJ6 A;  3H8L A;  3QSE A;  1E1K A;  2ZBW A;  3SZF A;  3GSI A;  5JCI A;  5KNL A;  2Q0K A;  5EOW A;  2VQB A;  4ZN0 A;  2YR5 A;  4IV9 A;  4FK1 C;  3NH3 X;  3T0K A;  1ZY8 A;  3LB8 A;  4C74 A;  1YQ4 A;  2TPR A;  4NZH A;  3EAO A;  2PYX A;  4G6G A;  4AP3 A;  3NGC X;  5KWF A;  1GRA A;  2XVE A;  3B6D A;  4JDR A;  3DJE A;  2BRA A;  4J34 A;  1FEB A;  1D4C A;  4EQR A;  2YLX A;  3D1C A;  3AXB A;  4CY6 A;  1LTX R;  2E1M A;  2OAL A;  4BUR A;  1GET A;  3AYI A;  4BV6 A;  1Q9I A;  2IVE A;  4U2S A;  4EMI A;  1NEK A;  2GR1 A;  3ADA B;  2XVH A;  4EQX A;  3GWD A;  3DGH A;  3EPT A;  4II3 A;  1Y56 B;  3KU9 A;  3DJD A;  4C3X A;  1CC2 A;  1CF3 A;  1PXA A;  4U2L A;  4II2 A;  1H86 A;  2YM1 A;  3BI2 A;  5BUL A;  2CDU A;  4TM0 A;  4Y4L A;  2VRL A;  1N1P A;  2WDR A;  4FDC B;  1CJ3 A;  1RP0 A;  2BK5 A;  2EQ6 A;  1JRX A;  3AYJ A;  2BA9 A;  1JEH A;  4NTC A;  4B69 A;  3CNP A;  3ICR A;  1ONF A;  4Z43 A;  2GMH A;  4TLX A;  2RGO A;  3C4N A;  2C76 A;  2PHH A;  1ZP0 A;  1K0L A;  3K7M X;  1P2H A;  2A8X A;  2YLZ A;  4GR1 A;  4ADW A;  2QA2 A;  3QFB A;  5HHF A;  2VVL A;  4J36 A;  4OPD A;  1KF6 A;  3RHA A;  3AE4 A;  4LU6 A;  4BK3 A;  1IUT A;  1JOA A;  3G5Q A;  2AR8 A;  4H4P A;  3ZYX A;  2WES A;  5EB4 A;  1IUX A;  4E0V A;  1MOK A;  1DJN A;  3GD3 A;  4PAB A;  4YSY A;  2GR3 A;  1GER A;  5BUK A;  2AAQ A;  4A6N A;  2ZZC A;  1NPX A;  3GDP A;  1F8R A;  4TM3 A;  5FS6 A;  4YKF A;  1BWC A;  3AEC A;  1PBC A;  3P4Q A;  1DOD A;  4H4R A;  3UP4 A;  1JRZ A;  3I6D A;  4G9K A;  3KD9 A;  5JCL A;  1PXB A;  2LFC A;  3GQH A;  3L1R A;  1L9C A;  3Q6J A;  2B9Y A;  5FS8 A;  4APN A;  4XXG A;  1S2Q A;  2XDO A;  1AOG A;  4YTP A;  3UP5 A;  1LQT A;  3AE1 A;  5JCN A;  4Z26 A;  1B4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...