3VR9A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
total genus 199
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr9A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr9A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr9A04
2FJDA 1JOAA 2X8CA 4DGKA 4I59A 2GB0A 1K0JA 1Q1WA 2BK5A 4C3YA 2XFPA 3FG2P 2FBWA 1L9DA 1ZKQA 2C64A 1ZOYA 2QCUA 5KRQA 2VQ7A 3L8KA 5TR3A 2ZBWA 5KOWA 1JEHA 2WP6A 3QJ4A 5M0ZA 2B9XA 3V3NA 5EOWA 1H83A 2YM1A 1S2QA 4MJWA 4CCQA 2WBAA 2YM2A 2H89A 3DK8A 4HB9A 3SM8A 2OLNA 4P9SA 4TM3A 1RYIA 2Q6UA 4H4WA 4XWRA 1PXBA 2GH5A 2YG6A 5KVIA 3DK4A 2YLZA 1B4VA 1YY5A 3EPTA 2BXSA 2GMHA 4ICYA 5KVHA 1GRAA 1IUTA 2BYBA 1IUWA 2WPFA 2TPRA 3M0OA 2BC0A 3CNTA 1FCDA 1PXAA 3VR9A 2PYXA 4U8NA 3E1TA 1NHQA 3IHGA 3NYCA 4A6NB 3K7TA 3NYFA 1F8SA 1W4XA 2JB1A 1CC2A 1XPQA 2VOUA 2WEUA 3HZLA 1TDFA 2CDUA 2GR1A 3FPZA 3V3OA 1IUSA 1GESA 3NRNA 4EIQA 3QSSA 1JRZA 4REKA 1K4QA 1TDKA 3DJEA 5HXIA 1ZX9A 2CFYA 3VQRA 2BS4A 1GT8A 4NEWA 5U63A 3CNDA 3ICTA 3KU9A 1FECA 4ECHA 5EBKA 1PBFA 1PBBA 2E5VA 2GEWA 4OPIA 3AD8B 1MOKA 1PHHA 1H7WA 5IQ1A 4DNAA 2WHDA 1F3PA 1N4VA 3QFAA 4EM4A 4Z2RA 2XFNA 2WPCA 4EMJA 5C3JA 4U2SA 4JY3A 4KPRA 3EANA 1LPFA 1ZDLA 3GRTA 4YKFA 1DODA 4FX9A 1NHSA 5L46A 2C72A 1TYTA 2BA9A 2YG5A 3NNEA 4YXDA 4ZCDA 3ZDNA 4AP1A 2YG7A 3P4QA 3AYIA 3BNUA 4A5LA 2YVFA 3QVPA 3NKSA 1O5WA 2X8HA 3NK2X 2H88A 2BXRA 1EL8A 2Q0KA 3O0HA 4JQ9A 2YR5A 3OZ2A 2GAGB 4XXGA 1NEKA 3UCLA 4CCRA 2R46A 4I58A 4J33A 3V76A 1E1MA 4APNA 4OCGA 3AD7B 1ZK7A 2GV8A 1PJ7A 3CGEA 4JY2A 1NENA 2OLOA 3K7MX 1JRXA 2X99A 1KSSA 1VG0A 3CTYA 3R9UA 1Q1RA 4A6NA 4TM1A 4IVOB 4J34A 4YSZA 4Z26A 1QJDA 3D8XA 4AT2A 1KSUA 1LJ1A 1PDHA 4B66A 2V3AA 4U2LA 4LU6A 4YSYA 4A9WA 1P2HA 1JRYA 2XVJA 1B5QA 4FK1C 3ICSA 4H2PA 4CY8A 1JNRA 4YTNA 1E1KA 1F8WA 2FJEA 3WE0A 3IHMA 1H81A 4K5RA 4YSHA 2WQYA 4H4ZA 3GYXA 1FEAA 1GRHA 3ISHA 3AYJA 4U8MA 3NT6A 1S2YA 4DSHA 4C5OA 3P9UA 4WX1A 3T37A 3FBSA 3NH3X 3BNMA 2YQUA 2WOVA 2BK4A 2YLRA 4U2TA 2YAUA 5HYMA 2QAEA 2YVGA 1VRQB 3AYLA 1D4CA 1FEBA 1PJ5A 2B7RA 2R0GA 2XLSA 3KD9A 2VRMA 3K30A 4BK1A 1ZY8A 1K0LA 1CC6A 1CBOA 1CJ3A 1Y56B 1N4WA 5DBJA 3AE8A 2AR8A 2O9ZA 2JBVA 2JAEA 4FK1A 4OPGA 4GRTA 1D4DA 3G5QA 1NG3A 5CQFA 3LADA 4NZHA 1NHPA 1ZOVA 2WESA 1JU2A 1VQWA 2IVEA 4Y4MA 3RP8A 1FOHA 2Z5YA 4D04A 2JB2A 2ACZA 2V5ZA 4DSGA 4Z44A 4H2NA 3DH9A 1O95A 2LFCA 3AEDA 3S61A 4H2QA 2NVKX 2E1MA 1TYPA 1VDCA 1REOA 3BHFA 1CHUA 2C73A 4B63A 4ADWA 5KWFA 1S3EA 3K7QX 3UOXA 1OJAA 4EQXA 2OALA 2ZZ0A 3DK9A 3LJPA 4H4VA 3B6DA 4CBQA 2V6OA 2EQ8A 4IA6A 3ATRA 3AE2A 3KKJA 3NTDA 2B9YA 1PXCA 4Z43A 5J7XA 3LXDA 4UDPA 3CPIG 3S5WA 3DJJA 4H4XA 1DNCA 2IVDA 4YSXA 1YQ3A 3GDPA 4H7UA 4BK3A 2A89A 1CJCA 4AP3A 4B67A 1YQ4A 2WDVA 2ARDA 3C4AA 2BACA 3II4A 4KX6A 1H86A 3OC4A 1IJHA 4OPTA 3AE5A 1EL9A 1BGNA 3NIXA 2JKCA 2ZZCA 4GF7A 1E39A 1ZP0A 2VVLG 3JSKA 4CNKA 1PBEA 1Y56A 4RG3A 1EL5A 2NPXA 2OA1A 4K8DA 3GQKA 5GRTA 3NK1X 1Y0PA 3PVCA 5FMHA 3NN6X 4Z24A 1IUXA 3L1RA 2E4GA 4EQSA 3H4KA 5KOXA 4HA6A 1BWCA 3VRBA 4J56A 4TM4A 1GV4A 2R4EA 4BURA 2RGHA 1E7PA 2CULA 4YTMA 1Q9IA 2EQ9A 3QSEA 4A65A 1LTXR 2R0PA 5JCMA 2WDQA 4EQRA 4X9MA 4E0VA 4X4JA 3SFDA 2EQ6A 2F5ZA 1GXFA 1GPEA 3QSMA 4JDRA 1DXLA 3NLCA 2GF3A 3GMCA 3CGCA 1PBDA 3NYEA 5FS9A 4J2WA 3IC9A 4H2RA 4A79A 2AQJA 3ICRA 3IF9A 3P1WA 4B68A 5BULA 5BUKA 2HQMA 1NHRA 1M64A 3P4PA 3GWDA 4TLXA 3GWFA 4Y4NA 4H4YA 3AWIA 3UKPA 2W0HA 2XLPA 4BK2A 4IV9A 4FDCB 4CRTA 3CNPA 4YTPA 3LZXA 3UP5A 2Q7VA 1GSNA 3IWAA 2RGOA 3NN0X 1HYUA 3GD3A 1AOGA 2XLTA 4H4RA 1PN0A 1F6MA 4IVMB 3ITJA 2WOIA 1D7LA 3UKFA 5IPYA 2C67A 4BJZA 2BCGG 4PAAA 3RHAA 3CGDA 4YWOA 3UKLA 3CNJA 3D1CA 1L0VA 1IUUA 1CC4A 3QFBA 4H4SA 4H50A 4AOSA 4J31A 1CF3A 1DJNA 4H4QA 2WU5A 1B8SA 1CL0A 2XVFA 3G5RA 1V59A 1GRBA 4GDEA 3UKAA 3KLJA 1GOSA 3GMBA 3EF6A 3NHOX 3LOVA 3QVRA 1Z6LA 3CIRA 1MXTA 2R4JA 1NG4A 2RABA 4K22A 4U8IA 2I0ZA 3GSIA 3KVEA 4Z2UA 5GSNA 3BI4A 4A7AA 5KXJA 3DJDA 3I3LA 3AE6A 2XFQA 3M13A 3AEEA 4PABA 1KNPA 2YVJA 2XVIA 3BI5A 2CVJA 1LQTA 1PS9A 2XDOA 1BZLA 3CPJG 3NTAA 4EM3A 2BK3A 2XLUA 3SQPA 1D5TA 3SGLA 3GRSA 1M6IA 2YG4A 4NTCA 4NTEA 1GALA 4JNAA 4AT0A 1GERA 3LB8A 2V60A 2VVMA 3DGZA 5BRTA 1GRFA 1DOBA 4A99A 2XCGA 4B65A 1BGJA 1ONFA 4C77A 2YR4A 1KNRA 2YR6A 1LQUA 1TDOA 2FJBA 1NAAA 1OJTA 1X31B 3C96A 5FS6A 2ZZBA 3UTHA 1PBCA 1E6EA 2JB3A 2XFOA 3AE7A 1LVLA 1CJ4A 3URHA 2B76A 3PO7A 5BVAA 3SUCA 4BV6A 2C65A 5FS7A 2C76A 3DJGX 3H8IA 2WETA 2YWLA 5ER0A 1K0IA 2R9ZA 3Q9TA 1NPXA 4NTDA 5HHFA 1DJQA 2UZZA 2X3NA 3RP7A 2BS3A 2V3BA 4K5SA 2PHHA 3FIMB 4ZN0A 4JN9A 4OPDA 2GR0A 3AECA 1H6VA 2WOWA 1VG9A 4U8OA 2WPEA 2TMDA 1ZMCA 4LIIA 4Z25A 2WU2A 1TRBA 2R0CA 2C3CA 5LV9A 3FMWA 4D03A 2C75A 3GQHA 4J57A 4RG4A 2DKHA 2Q0LA 3VRAA 2IIDA 4J36A 2Y6QA 3GYJA 1XANA 3ABVA 3CPHG 2WP5A 3UTGA 4Z2TA 5JCKA 4H4UA 2AAQA 5EB5A 1TDNA 1F8RA 3GDNA 5EB4A 1XHCA 3NGCX 4LA1A 1O94A 2A8XA 3LZWA 1YQZA 3CN8A 1L9CA 4ZCCA 2WDRA 2C70A 3UOVA 3GYIA 2BS2A 1GEUA 3AD9B 4X9NA 3AE4A 4H4PA 4Y4LA 2GVCA 2VRLA 4B69A 1SEZA 4GR1A 1D4EA 4GUVA 3VRDB 1NDAA 2C7GA 4N9XA 2OAMA 1OJCA 3VR8A 1H82A 4GCMA 3GD4A 4B64A 1H7XA 1YKJA 2WP9A 1UKVG 5J60A 4USQA 2C66A 4H4TA 4O5QA 5JCLA 4OPCA 4U8PA 4JNQA 3COXA 4TLZA 1GRGA 4RSLA 4UDRA 2QA2A 4B1BA 3AE9A 2GR3A 4OVIA 2BABA 3F8DA 3NG7X 1ZMDA 1RSGA 2A87A 2X8GA 3P4SA 3KPFA 3M12A 5JCIA 3CGBA 3Q6JA 2WS3A 4OPLA 2YG3A 3DGHA 2DKIA 2EQ7A 3BHKA 1DOCA 1QLBA 3UTEA 4GDPA 1EL7A 1H84A 1GTEA 2GQWA 2VZ2A 3B3RA 3UOZA 4EMIA 4UP3A 2YLWA 1GRTA 2BC1A 3AXBA 1QO8A 3NK0X 2YLSA 4NEVA 5U25A 4EMWA 1XDIA 3RP6A 3ALJA 3F8PA 3UKQA 4K7ZA 3ADAB 3F8RA 1KFYA 1ELIA 1PJ6A 5U1OA 4AOXA 3AE3A 3AEAA 1BF3A 1CJ2A 1LV0A 2GMJA 1TDEA 2JK6A 2R45A 4CY6A 1GNDA 2VVLA 3H8LA 5FS8A 3ZYXA 1KDGA 2XLRA 4U8JA 3CNSA 4C74A 2GQFA 1D7YA 1EBDA 1OJDA 3ALMA 2YLXA 4O5UA 5M10A 3P4RA 2YLTA 3DA1A 3AEBA 3BI2A 5C2TA 1DOEA 1B37A 2GAHB 4UDQA 2GRTA 4WCTA 1GREA 3I6DA 4TM0A 4U8KA 2XVHA 4BJYA 2C3DA 2XFUA 3UKKA 4YT0A 2B7SA 3ALLA 1KF6A 5HY5A 1S3BA 2FJAA 2XYOA 2VQBA 1OJ9A 3KA7A 3G5SA 3PS9A 2XVEA 3AEFA 2BCPA 1L9EA 3AEGA 3AE1A 2B9WA 4USRA 3RNMA 3ATQA 2QA1A 3UKHA 2APGA 1MO9A 4EIPA 4YKGA 2X50A 1E1NA 2RGJA 3EAOA 1GETA 4IA5A 4M52A 4OPUA 1GTHA 3DMEA 3REDA 2V61A 4U8LA 1BKWA 4C3XA 4CNJA 2J3NA 1N4UA 1COYA 3C4NA 4XWZA 1JNZA 4EQWA 2GR2A 3AB1A 2Y6RA 3UTFA 1E1LA 1RP0A 3UOYA 5IQ4A 5CKUA 2Z5XA 1N1PA 1P2EA 3UP4A 5JCNA 1FL2A 4K2XA 1IUVA 3SFEA
chains in the Genus database with same CATH superfamily
2PBIA 2X8CA 4DGKA 5E0OA 4I59A 3AXJB 4MLKA 4A5XA 1ZOYA 5TR3A 2ZBWA 4UELA 5KOWA 4EV6A 3QJ4A 2B9XA 2SPCA 4M1PA 5EOWA 1WFDA 2YM1A 1S94A 4XBFB 2WBAA 4II3A 1BEV4 4HB9A 4BA9A 3PE0A 4U33A 5KVIA 1M62A 2YLZA 4GIWA 2C4CA 1B4VA 1VRH4 5KMPA 4NNJA 4UV8B 1YY5A 4IIJE 3LDQB 5HEHA 3CNTA 3QK6A 2PYXA 4E7SA 4U8NA 1NHQA 3IHGA 3Q5WA 3HYVA 4I50E 3NYFA 1CC2A 1XPQA 5KMGP 3KBUA 5LMUT 3P7IA 1GESA 4EZ4A 5L3CB 2DLRA 3JC6D 1H7CA 1XHZA 1K4QA 2IW5B 3CKDA 3FHNA 3K3QC 4TN7B 5HXHA 4NEWA 3RKGA 1BR2A 1OWAA 3N9PA 1XZYA 3U78A 5EBKA 1PBBA 4TX5A 4O4HE 3LG7A 3PUQA 1ZEEA 3K3OA 3MKDA 5IQ1A 4HFDA 1N4VA 4EMJA 4U2SA 4KPRA 3ZLIA 4YKFA 1DU2A 5L46A 2BA9A 2YG5A 4YXDA 4AP1A 2YG7A 3VKHA 5LGUB 1OXZA 2OV9A 3P4WA 4OFZA 3QVPA 4DV5T 1O5WA 1HS7A 2YR5A 2VK9A 4XXGA 2W0GA 3UCLA 4CCRA 4I58A 4J33A 3V76A 5AFUL 4ZI7E 4OCGA 4JI8T 3AD7B 3IEEA 3CGEA 1NENA 2UXNB 2BG9A 2X99A 4GKKT 4IVOB 1E2AA 4YSZA 3D8XA 4AT2A 1LJ1A 1PDHA 2PLV4 4II2A 4YSYA 2XVJA 4DBRA 3I1AA 3ICSA 4CY8A 2HWB4 1VCSA 2IDOB 3N9QA 1H81A 4H4ZA 1XDPA 4WZXA 3FBSA 3PJAJ 5FXWA 2WOVA 2YAUA 3BQKA 3BK9A 2R044 2C5KT 4HFEA 1PJ5A 3HYWA 4IE7A 2JAEA 2EHOB 4F8HA 1D4DA 4DV7T 2CWOA 3LADA 1MIVA 1BR0A 5CA1E 3ZC1A 4H9OC 4D04A 2ACZA 1HNWT 3DH9A 2LFCA 3S61A 4DVDA 5LB7B 1TYPA 3C51A 2C73A 3ZSTA 5KWFA 3K7QX 3ZN1B 3NRXA 4O4IE 2LJLA 4H4VA 4G6GA 5DQVA 3NTDA 5J7XA 3LXDA 2J47A 4UDPA 2V7KA 4H4XA 1T98A 2IVDA 3GDPA 4BK3A 4LFBT 2A89A 3LK3B 1VBA4 2WDVA 5FL1A 3II4A 4ISSA 3OC4A 1UGOA 4OPTA 3AE5A 4GAVA 2M6BA 1BGNA 4U72A 2KMFA 5JRCB 3NIXA 2ZZCA 2VVLG 4A97A 2VKOA 1RUI4 4LMLA 4K8DA 4DR4T 3K8PC 3RPUA 4Z24A 5DJQC 1GQEA 4O2AE 2YDSA 3CVRA 1GV4A 2XPKA 2CULA 3M65A 3KBTA 4H9NC 1O3XA 2BZBA 3SRZA 4AKLA 4E0VA 1N36T 4X4JA 1WR6A 3C4XA 3DP7A 2PY5A 2ZLYA 4A79A 2MAWA 4B68A 3ZKRA 4HWHA 3FBZA 1M7KA 1NHRA 5HXRA 5L2LA 3AWIA 4DUZT 2N9DA 3FB2A 3Q5EA 3ETVA 4B3ST 1GSNA 2RGOA 3NN0X 2VB6A 2XLTA 3RIUC 1D7LA 3UKFA 4AQYT 2JRKA 3FZHB 3CGDA 3UKLA 3CNJA 1AR94 2WWUA 4H4SA 4BJNA 1CF3A 1DJNA 3ZCJA 1HTJF 3KINB 4K0KT 3O9XA 2E2AA 3KLJA 1GOSA 3SZWA 3EF6A 2C0SA 3EDVA 3CIRA 2R4JA 5HXSA 1NG4A 3N9NA 5GSNA 3BI4A 4A7AA 5KXJA 3I3LA 3AEEA 2EHOD 5LMNT 1RUE4 1J5ET 3NTAA 5AQKB 2KSRA 2V8SV 2BK3A 2YDQA 1PIV4 1GALA 1GERA 3DGZA 3N9MA 2WWVA 1GRFA 2VL0A 2XCGA 1KNRA 2FJBA 4DV6T 4GK5E 1OJTA 2Y8DA 4ASKA 4CQIA 5FS6A 3F2EA 3ZT6A 2C65A 4LF4T 2WETA 2R064 4LF8T 4DV3T 4LF7T 4UVBB 1VBB4 5HHFA 3OYZA 2LOSA 2E9XA 2A9UA 4K5SA 4H63V 2YEVC 2EHOC 4OPDA 2GR0A 4P0BA 1H6VA 1X9BA 4KHZF 2KWIB 4LIIA 2LKHA 2C75A 2X0LB 4WW0A 4J57A 3QB5K 4RG4A 2QVAA 2IIDA 2R6GF 1XANA 1YD8G 3MACA 3CPHG 4U7IA 3UTGA 4Z2TA 5JCKA 4PK6A 1HNZT 3MA9A 4AKHA 1TDNA 3SS1A 2CA5A 1XHCA 3NRYA 2DNXA 2D2SA 1XWMA 2UXBT 1GEUA 3AD9B 4EYUA 2GVCA 4B69A 4GKJT 2C7GA 2W62A 1W09A 4JLEA 5LYJE 2V6YB 3FZKB 4U8PA 3N9OA 2DWGA 1EV14 4TLZA 4RSLA 4UDRA 4QXCB 2GR3A 4OVIA 3FZMB 3RKOA 1ZMDA 1RSGA 5AQOB 5JCIA 5JREA 4LMJA 3I9WA 2DKIA 2M67A 3BHKA 2XM2A 3R6NA 3UTEA 1V9DA 3KV9A 1RMU4 1EL7A 3ZMUB 4ZZBA 2XQ9A 5EK3A 1YKHB 3MJXA 4UP3A 2BC1A 3AXBA 3O1HA 3NK0X 2HHHT 1XDIA 2EX3A 1RUJ4 1KFYA 2ES0A 4AOXA 3AE3A 4CN4A 2GMJA 2W2UA 2JK6A 2R45A 2WB5A 5FS8A 5JDFA 1KDGA 2XLRA 4U8JA 3CNSA 5FYMA 4IL4A 1EBDA 1OJDA 2WY2A 5L3BB 3L09A 2YLTA 4TWHA 2A72A 3BI2A 3ZJ1A 2GRTA 1IAPA 3I6DA 2VVNA 4BJYA 5HEJA 2X0YA 3UKKA 4YT0A 3ALLA 2WMNA 4B3MT 1OJ9A 3KA7A 2XVEA 3AE1A 4EIPA 3UKHA 3ATQA 2GK9A 1HNXT 2X50A 2MTQA 2X66A 5DABA 3EHZA 2UUCT 1XMOT 3J8F4 4GYSA 4U8LA 2XQ4A 3FXDB 2J3NA 3C4NA 4UEMA 4HWFA 4ZEYA 4X1KE 3UTFA 1E1LA 5IQ4A 5CKUA 1N1PA 3K1SA 3LBXA 3TLWA 4AISA 2V6XA 3GD3A 2FJDA 1JOAA 3UQ4A 5J2UE 1K0JA 1Q1WA 4CXWA 1ZKQA 5JDMA 2C64A 2R074 5FVLA 3V3NA 2CPTA 2VKDA 4QH1A 2BRAA 2OLTA 4DV0T 5AQFB 4L0RA 3A7MA 4JUYA 1SHZC 3SM8A 5EK4A 2DWKA 2Q6UA 2YG6A 2VVSA 3DK4A 3C4WA 3SY4A 4ICYA 3U3IA 3EPTA 5ABHA 1GRAA 1IUTA 4IE6A 2BYBA 2XQ6A 2XSBA 5HXEA 2UXCT 3UT5E 4PDWD 3B57A 3E1TA 2XZEA 3O1IA 1F8SA 2JB1A 2WEUA 3HZLA 5HEUA 2K48A 1TDFA 4JI0T 2GR1A 4KMCA 2RS14 3AA6B 1IUSA 2JJ9A 1JRZA 1OEDA 3AVSA 1TDKA 1N33T 5HXIA 1ZX9A 4ZI3C 2BS4A 5U63A 5LHIB 1KEYA 5AQGB 3RYCE 3CNDA 2LRLA 2D9DA 3UFEA 4OPIA 1MOKA 1PHHA 2WHDA 1F3PA 4Z2RA 3ZT5A 5C3JA 4JY3A 3EANA 1LPFA 3GRTA 5LXTE 1NHSA 3HKDE 2XAFB 3P4QA 4EB6E 1NAFA 1D1AA 2MBGA 3TLTA 3O0HA 1I6ZA 1T72A 5ABEA 3RHWA 1NEKA 4NIQA 1HRV4 2R46A 3ZMTB 1E1MA 4APNA 3E22E 3UUMA 4JI5T 5HAXA 2OLOA 1JRXA 3K7MX 4YFSA 1KSSA 3EABA 2NW7A 4A6NA 2KINB 2XQAA 5FXXA 4J34A 4Z26A 4YJ3E 4JI4T 3RQWA 2IIUA 5JDGA 1JRYA 5A1LA 1D4M4 5AQTB 1JNRA 4YTNA 2FJEA 3NZQA 1Y64B 2WQYA 3GYXA 4HFBA 1GRHA 3AYJA 4KUMB 4C5OA 1N32T 3B5MA 3ZSSA 3OTOT 2YQUA 3HA4A 1D4CA 2VRMA 1KK7A 1Y56B 1CJ3A 1N4WA 4FK1A 2M6IA 3ETUA 4OHFA 2YDRA 1FJGT 4A98A 3KFWX 5CQFA 4NZHA 2Q9QB 4G2AA 1NHPA 1ZOVA 2WESA 3SOLA 2IVEA 2LSJA 1FOHA 4GYRA 2JB2A 2V5ZA 4Z44A 1O95A 3AEDA 2C5JA 3GWHA 4CN6A 2ZM0A 4HFHA 1U4QA 1S3EA 1J5WA 3X1DA 5BMVE 3J9X1 4U2ZA 1OJAA 2YKSA 3OJAA 2ZZ0A 3DK9A 2V6OA 5GONE 2EQ8A 1ZHCA 4Z43A 1PXCA 2WAUA 4MALA 5KDMC 3CPIG 4Q4W4 1IBMT 4N78D 3RH3A 1YW0A 1CJCA 4AP3A 4B67A 1D0YA 5LJMA 2ARDA 2XM1A 2BACA 4KX6A 1IJHA 5AQQB 2X9HA 1EL9A 3CMLA 3ANWB 5AQVB 4F6RC 2X9WA 4CI2B 2NPXA 2OA1A 1ZKEA 2K3WA 3NK1X 2VASA 5ABFA 1IUXA 3HKCE 3Q9DA 4UXNB 1LKXA 3DJBA 4ZI2C 2VKHA 2E4GA 3JBG4 1NWMX 4EQSA 5KOXA 5ETWA 4HA6A 2CXLA 3VRBA 1BWCA 4BURA 2RGHA 3QSEA 3PU3A 1LTXR 2R0PA 5JCMA 2WDQA 5EZYE 3CPZA 4EQRA 3M3ZB 4P09A 2EQ6A 4LFCT 3QSMA 2PYLA 3NLCA 3CGCA 2IC9A 4TWDA 5FVKA 1PBDA 5FS9A 3IC9A 3H37A 3ICRA 2A2FX 4UVAB 5FNVE 3ZCIA 3QC9A 5ADXL 4Y4NA 2YK0A 4BK2A 4IV9A 4CRTA 3CNPA 4YTPA 5L3FB 3LZXA 3UP5A 3IWAA 3ZEFB 3P50A 2RS54 3TLSA 4H4RA 3A8YC 1F6MA 4IVMB 2WOIA 4Z91A 5BR8T 4H9QC 4ILUA 4BJZA 2BCGG 3LBXB 4YWOA 3ONJA 1FEWA 1IUUA 1CC4A 3QFBA 4Z90A 4H4QA 4DV1T 1GRBA 2DI4A 3UKAA 1WR0A 1Z6LA 5FY0A 2NR4A 3KVEA 2RMU4 2V26A 3DJDA 2XFQA 3NVOA 4PABA 3CK6A 2YVJA 2XVIA 2Q9QD 2XDOA 2L3LA 3SQPA 3SGLA 1M6IA 2YG4A 4NTCA 4NTEA 1HG2A 2XQ7A 2RP4A 2VVMA 5BRTA 1AJ3A 4TZ4C 1DOBA 4I0UA 1BGJA 4C77A 3ONXA 3UQ7A 3RYIE 4U31A 2WBLA 3VU7H 1MMAA 2CWYA 3IF8B 3RIAA 1NAAA 1X31B 4UR9A 4I55E 1PBCA 3N9LA 3AE7A 4AXPA 1EAH4 3SUCA 2WZHA 3SZFA 4KI0F 5AQUB 2C76A 2Y48B 3RGLA 4KHPT 2YWLA 5ER0A 1Z0PA 2YN6A 3PUYF 2UZZA 4QWNB 2AE9A 2X3NA 5EK2A 4I43B 3RP7A 3GMIA 4ILBA 1BR1A 4UF0A 5F3JA 2WOWA 2Q9QC 5KMQA 2TMDA 4DR1T 4Z25A 2LSYA 2WU2A 4PK5A 1TRBA 5LV9A 3FMWA 4D03A 4X20E 3H3AA 3S4UA 2RA1A 1MMDA 4J36A 2X68A 3PUWF 4Q4V4 4JBWF 4H4UA 5JDHA 3N2GE 2BKOA 5EB5A 4TV9E 1E1HB 4IHJE 4LA1A 1XI1A 2L8KA 3G06A 1L9CA 1HRI4 2WCAA 1FMWA 2WDRA 4JI1T 2C70A 3UOVA 3GYIA 4X9NA 3T8OA 4H4PA 4Y4LA 4LF6T 3F57A 5C8YE 3VR8A 4B64A 1H7XA 2WP9A 1UKVG 2V7JA 4TWFA 5J60A 3N2OA 4AQFA 2C66A 4G73A 5JCLA 4YY3T 5F8PA 2ACXA 5HEGA 3UU3A 4BJMA 4JEUB 3UUNA 2BABA 2WM9A 3JCFA 2X8GA 3KPFA 3L8RA 3UTKA 4COFA 3CGBA 3Q6JA 3ZC0A 4L9IA 4H9RC 2YG3A 1VRBA 1QLBA 3T31A 4P0AA 2VZ2A 3B3RA 4EMIA 1I94T 4IDOA 4WBOA 4NEVA 3OPCA 5U25A 1MMNA 3RP6A 4K7ZA 3F8RA 1ELIA 4OX9T 1BF3A 3AEAA 4WNKA 2XHEB 1IJ6A 1TDEA 3ZYXA 4C91A 3PUGA 2XAJB 5FXZA 1W0BA 2GQFA 3P4RA 3DA1A 4CXXA 1LVFA 4QHOA 3KVBA 5FY7A 5C2TA 5JDNA 4UDQA 2PW9A 4AQGA 1XMQT 1Z7S4 2B7SA 2PFVA 2LLYA 1KF6A 3VHLA 5HY5A 2XYOA 2UXXB 5HWXA 5TAOA 3AEGA 2B9WA 4USRA 2QA1A 4ANJA 1MO9A 3I0QA 4YKGA 3NZPA 3AAIA 4PK4A 5HXCA 4J2CA 2I6HA 2RGJA 4KP3C 2J62A 4M52A 1GTHA 3DMEA 2V61A 4PW8A 1J1JA 4I4TE 4QKNA 1N4UA 1COYA 2KLQA 3IA3A 4IREA 1D1CA 2Y6RA 3ZJ2A 4G6HA 4B6XA 1RP0A 2NW8A 2Z5XA 1FL2A 2CBIA 4USQA 5AQIB 4C3YA 2BK5A 3FG2P 1SA0E 2VL8A 1L9DA 5KRQA 2VQ7A 3HKBE 4JI3T 1JEHA 5M0ZA 1D1BA 3WI3A 2V7MA 3DK8A 2D0UA 2V1DB 3PV0F 2OLNA 1RYIA 4H4WA 4FJOA 1OEDC 1W9RA 2HN2A 4U74A 3V5UA 2BXSA 2GMHA 3UULA 4H63H 1KNZA 3PU8A 3M0OA 4ADZA 2NWBA 4HTEA 3VR9A 5HYAA 2BG9B 4GAPA 1W4XA 2VOUA 1CUNA 1FIOA 4DR5T 3W15B 2CDUA 4G63A 3FPZA 3V3OA 4TV8E 3NRNA 3ZMZB 4EIQA 3QSSA 4REKA 2Y6XA 3DJEA 3VQRA 3KV4A 2CFYA 5M4YA 4ZHQE 3T2KA 3JADA 3UU5A 5JVDE 2F4VT 3ICTA 3KU9A 4NPPA 2H7OA 3AXJA 5IHYA 3UU6A 4EYYR 1FECA 4ECHA 3ZPOA 3ESLA 2BKPA 2E5VA 5HCJA 2GEWA 3AD8B 1D0XA 2JQQA 1FMVA 2AXDS 2XFNA 2WPCA 3RX6A 3T2ZA 4X1IE 5AQPB 2XY8B 1IBLT 1TYTA 2C72A 3NNEA 1WLXA 3BNUA 3ONLC 2N2NA 4JI6T 3NKSA 5L4HA 2X8HA 2Q0KA 3Q5XA 4JQ9A 3SX6A 3OZ2A 2GAGB 3QUJA 4Q4Y4 3EI0A 3FBLA 1ZK7A 2QYWA 4PJLA 2X0HA 3GA8A 4FI5A 2YINA 2J4GA 4X1YE 4QX8B 1QJDA 5FMNA 1KSUA 2V3AA 1WYCA 4QH4A 2JQ9A 3RRWA 1P2HA 4FK1C 4H2PA 2CCQA 5LGTB 1E1KA 4UF0B 1F8WA 3MK7C 2FUPA 4OK0A 1FEAA 2CM0A 1VBC4 5H6QB 3ISHA 2YU1A 4U8MA 4DSHA 4WX1A 3T37A 3AAAB 4ILAA 3BNMA 4TUYE 2BK4A 2YLRA 4U2TA 1W0AA 5HYMA 2E5LT 3EUHA 2QAEA 2YVGA 2HH7A 1VRQB 2NW9A 3AYLA 2B7RA 3KD9A 4CXYA 4BK1A 1CBOA 2I59A 1US7B 5DBJA 3AE8A 2AR8A 2O9ZA 4OPGA 1VOMA 3PUZF 5F5WA 1NG3A 1OEDE 3ZT7A 3FZFB 3NWIA 1JU2A 1X79A 2D5UA 1VQWA 5JR9A 3SWHA 3RP8A 4ZI3D 3T1YT 4DSGA 5L47A 5FL0A 4H2NA 4H2QA 4X64T 2NVKX 2E1MA 1VDCA 4O8SA 3KDSE 3BHFA 2XQ3A 1CHUA 2XQ8A 5HEOA 5LOVE 3H3MA 3UOXA 4O4JE 4EQXA 2OALA 4XZCA 2P9BA 3QB5A 5FKYA 3RYFE 1SUMB 4IA6A 3AE2A 3KKJA 2B9YA 1ZV4X 1WCRA 3Q5DA 3DJJA 3PUXF 4K0UA 4YSXA 4ZZCA 4H7UA 1RUF4 3FI7A 2MYSA 3CX8B 3C4AA 1VCTA 1SE7A 5ABGA 2ZM6T 2BVLA 3HKEE 4AI6A 1K5MD 4CNKA 2MPKA 1ZP0A 1E39A 3RC8A 1PBEA 4RG3A 3KVAA 5GRTA 2C5IT 2LHNA 3PVCA 5FMHA 3NN6X 5HWYA 2CHOA 2EHOA 3HL6A 1YXRA 2V7LA 3L1RA 1NCQD 4HKAA 2LHRA 4J56A 4TM4A 3AA7B 2R4EA 3R84B 2EQ9A 3SZ0A 2NOXA 2BG9C 4X9MA 1RUH4 2VQFT 3SFDA 2F5ZA 4NWZA 4JDRA 3GMCA 2XSAA 3NBXX 4YLHA 2ODVA 4HWCA 3IF9A 2LSIA 3P1WA 5BULA 1ASJ4 1HXS4 3GWDA 1YKEB 3P4PA 4TLXA 5LBQB 2WZIA 4PJMA 3GWFA 1S35A 4UVCB 2W0HA 2XLPA 2CBJA 5J0ZA 1PVC4 1D0ZA 1HYUA 1AOGA 1PN0A 5KMRA 3ITJA 2KZ7B 5LHGB 2NTYA 4PAAA 3RHAA 2W00A 4AOSA 2E9XB 2WU5A 3RQUA 2L9QA 1B8SA 3G5RA 2XVFA 4PFOA 3NHOX 4CN1A 2HN1A 3JAEA 4X65T 3QVRA 2VWAA 2RABA 4K22A 4U8IA 4DR3T 2I0ZA 2X67A 3GSIA 2PZSA 3PJAA 5CFBA 1KNPA 3BI5A 2LOPA 4NXMT 1LQTA 1BZLA 3CPJG 3T0KA 1COV4 4JV5T 4JNAA 4AT0A 5J2TE 1AR84 4HEAA 4B65A 2YR4A 4DV4T 4LF5T 2YR6A 4U2YA 5KX5E 3JD74 2N1GA 2B1EA 3C96A 3UTHA 2ZZBA 4ZXLA 1E6EA 5CGMA 1LVLA 3URHA 4ZI2D 2CLYB 4BV6A 4CI1B 5FS7A 1T8BA 3DJGX 4ZOLE 4DNDA 4Q4X4 5LGNB 1K0IA 2R9ZA 2JMHA 3HI2A 3Q9TA 4NTDA 4G9KA 2V3BA 2PHHA 3KPKA 3FIMB 4ZN0A 4JN9A 4ZS3A 1VG9A 4U8OA 5LCYA 3CX6B 2R0CA 2C3CA 1AR64 3B13A 3Q2MA 3VRAA 2W66A 2X5ID 2Y6QA 4JI7T 4AQFC 1MIWA 2G0UA 3QNUA 2BG9E 2AAQA 3GDNA 2PYJA 5EB4A 5AQLB 1HFAA 1O94A 3LZWA 4DR6T 4AIUA 3CN8A 4ZCCA 2YOEA 2NTXA 2IHR1 2LT3A 4GR1A 4GUVA 2QGSA 2UU9T 3VRDB 2HWC4 4EAHA 5JDQA 2OAMA 1B7TA 1OJCA 3GD4A 1YKJA 3FZLB 3E0ZA 1HF8A 1WYBA 3EAMA 4O5QA 4OPCA 3ZYLA 4JNQA 2V5DA 1Z8UA 4IGUA 4HFVA 3BQIA 4EGWA 4EXTA 3NG7X 3P4SA 1OOPD 1N34T 1MNDA 4OPLA 4HE8A 1QUUA 2E9XD 4U7YA 2EQ7A 2RPAA 4O4LE 3TLUA 3N5LA 2JQKA 1QO8A 2KT9A 3ALJA 3RIFA 2E8IA 4DR2T 1PJ6A 2HPJA 1CJ2A 1LV0A 5JR9B 4CY6A 4DMVA 2VURA 3JC6C 3ALMA 1MIYA 2YLXA 4O5UA 3OKQA 2JMKA 4X62T 4EIWA 3ZMVB 3AEBA 4LFAT 4WCTA 2V6YA 3IBPA 2XAHB 4U3CA 4TM0A 4U8KA 2XVHA 2C3DA 2XFUA 3UU8A 4UV9B 4UIGA 2ZM8A 2UXDT 3PS9A 2E9XC 4RHV4 3G5SA 1QSDA 2ZM2A 4B3RT 1E1NA 4OPUA 3D0TA 1BKWA 4CNJA 1JNZA 2X9XA 1OEDB 1POV0 3UOYA 1XNRT 1P2EA 5JCNA 4ZS2A 4IDNA 4HN9A 4K2XA 3C98B 3PTRB 2H7VC 1VBE4 2GB0A 2XFPA 2FBWA 3T1HT 2XJ7A 2QCUA 3L8KA 2K5BB 4NUUA 2YU2A 5L4EA 2RS34 3AA1B 3WAKA 2WP6A 3PUAA 3OYXA 1H83A 1S2QA 4MJWA 4IDZA 4DUYT 4CCQA 2YM2A 3L3PA 2H89A 3LJCA 3QOFA 5LJNA 2JPFA 3LFMA 4P9SA 4TM3A 2H3RA 4XWRA 1PXBA 2LM9A 2CLYC 2GH5A 2UUAT 5LP6E 5KVHA 2CEAA 1IUWA 2WPFA 1AR74 2CHNA 2TPRA 3FXEB 2BC0A 2Z6EA 1FCDA 1PXAA 4CI3B 2JIWA 2LSGA 3NYCA 4A6NB 3K7TA 3V5SA 4MBQA 5AQNB 2XASB 2QA7A 3TLVA 1MMGA 4ERRA 4OYJA 3E08A 2K24A 3LK42 3RLFF 1GT8A 3MXZA 2VKJA 3CQXC 3ZYKA 2CRBA 1UX4A 1PBFA 4EOZB 1H7WA 4DNAA 4EM4A 3QFAA 3SYIA 4EEBA 1ZDLA 1DODA 4FX9A 4ZCDA 4WYVA 4X66T 3SXIA 3ZDNA 3AVRA 2BRYA 3AYIA 1NA1D 4A5LA 2YVFA 4IDQA 3NK2X 2H88A 2HPLA 1EL8A 2BXRA 4DMWA 4H9PC 5AQSB 4HGAA 3AA0B 2GV8A 1PJ7A 4JY2A 3RYHE 3PDYA 1VG0A 5AQHB 4X5TA 3CTYA 3R9UA 1Q1RA 1HG5A 4TM1A 1H8TD 2LM2A 4B66A 3O1JA 4U2LA 3ZYMA 4LU6A 4A9WA 2DL1A 1B5QA 3VKGA 1IJ5A 3OBVE 3EDUA 3WE0A 3GN5A 3IHMA 1RVF4 4K5RA 5H6RB 4YSHA 4YHHT 3NT6A 5L3GB 1S2YA 3P9UA 5JR9C 1XHXA 3NH3X 3N2KE 1HR0T 5CA0E 3SZCA 4JYAT 2DHRA 3HR0A 1R094 2IUBA 1FEBA 2R0GA 2XLSA 5KMSA 3RI5A 3K30A 3HYXA 2UUBT 1XNQT 1K0LA 1CC6A 1ZY8A 2XAQB 3OVUA 4DIDB 2JBVA 5ABFB 4GRTA 2W67A 2X51A 1AL24 3RC3A 3G5QA 2CMRA 4PJJA 4Y4MA 2QRXA 3AB3B 4V1Av 2ZMAA 2Z5YA 3T14A 3KV5A 2D0TA 2BBJA 2LE8A 4O2BE 3T2YA 1HX8A 2A3DA 2W4XA 1REOA 5KNLA 4IE4A 4B63A 2KWHA 3C4ZA 4ADWA 4JEHB 2XQ5A 3J7Yq 4IE5A 3LJPA 1U5PA 5CJ5A 3B6DA 2PTFA 4CBQA 1UX5A 1UUSA 3UU4A 4TNVA 3ATRA 4IL9A 4PNIA 3S5WA 1DNCA 1YQ3A 4TNWA 4AKIA 3RRCA 1BR4A 1RUG4 1YQ4A 4QXHB 2MOZA 1H86A 4DO0A 4NXNT 3I9YA 5AQJB 4LF9T 2JKCA 4GF7A 3IHRA 5J1GA 5FY1A 3UUBA 3JSKA 1PO14 1Y56A 1EL5A 3GQKA 2XAGB 1R084 4YHJA 1Y0PA 2BVMA 4GK0E 2LKGA 2CE7A 2Q9QA 3H4KA 4QX7B 1E7PA 1T7SA 4YTMA 4BAYB 1Q9IA 4A65A 3ZMSB 1RHI4 4WBNE 1GXFA 1GPEA 1DXLA 2GF3A 4Q25A 2WSSV 3NYEA 4J2WA 4H2RA 2AQJA 3PUSA 4HWIB 5FP3A 5BUKA 2HQMA 1M64A 3CMMA 4H4YA 2XUEA 3UKPA 4FDCB 4XAXB 3K3NA 2Q7VA 3AAEB 4C90A 5IPYA 1PO24 2C67A 2RR14 1VBD4 2RM24 1G73A 1L0VA 4EZHA 3D1CA 3MZKB 1MNEA 4H50A 3I0OA 4LMKA 2W63A 4J31A 3ANWA 5JTGA 3C64A 2BKNA 1CL0A 1V59A 4HFIA 1WRDA 4QXBB 4GDEA 3LSVA 3P8CD 3GMBA 3LOVA 4DV2T 1MXTA 1MQTD 3CQCB 1RUD4 4Z2UA 2V5CA 3RIUA 3AE6A 3M13A 5JDLA 2CVJA 1PS9A 4EM3A 2BDEA 2XLUA 1D5TA 3GRSA 3L39A 3NKZA 4QH5A 4B3TT 3PURA 3LB8A 2V60A 1UK5A 2ODUA 4Z8XA 4A99A 1ONFA 4MHCA 4L5GA 2XTLA 1LQUA 1TDOA 3TKLB 4GB34 1IZNB 3UFGA 2XFOA 2JB3A 3PUVF 1CJ4A 2B76A 3PO7A 5BVAA 3BQLA 2XQYA 3H8IA 5LA6E 5LG4A 5JH7E 1RUC4 1NPXA 3ZN0B 4E7ZA 1DJQA 2V7IA 5AQRB 2BS3A 2LSKA 2IC6A 3AECA 4HWDA 3RF1A 2J1DG 4GOUA 2PJQA 2WPEA 1ZMCA 5JQGE 1IBKT 4IT4A 3GQHA 2DKHA 2Q0LA 5HCMA 2X9YA 1XDOA 3GYJA 1G8XA 4H9SE 3ABVA 4DR7T 5DQWA 2WP5A 1F8RA 3NGCX 2A8XA 3EVYA 1YQZA 3F31A 2DCFA 3O4XE 1HX1B 2BS2A 3AE4A 2BBHA 2VRLA 4PAGA 4A56A 3WAJA 1UURA 1D4EA 1NDAA 1SEZA 4N9XA 2PG8A 1H82A 4GCMA 5FXVA 4HFCA 3A5XA 2IAKA 4H4TA 2I0MA 3GN5B 3COXA 1GRGA 4B1BA 2VQET 2QA2A 3AE9A 3CWZB 3F8DA 2IMLA 2A87A 4MFRA 3M12A 2WS3A 4IDPA 4EEDA 2R7FA 3DGHA 5L3EB 5CB4E 1DOCA 4GDPA 1EZ3A 1H84A 1GTEA 4NUVA 2GQWA 3UOZA 2LRKA 4P1NA 2NP9A 1GRTA 2YLWA 5AQMB 2YLSA 4EMWA 4G74A 5JRCA 3F8PA 3UKQA 4JI2T 3CQGB 4ISTA 3ADAB 3DTOA 4DBQA 5U1OA 1R8IA 1GNDA 3KV6A 2VVLA 3H8LA 3LK2B 4AKGA 5LHHB 4C74A 2LEHA 3C50A 1D7YA 3UUXB 4PJNA 5M10A 2W61A 2KNDA 1DOEA 1B37A 1LRZA 2GAHB 1GREA 5LNKA 4YJ2E 2K9AA 5L3DB 2JQHA 1HCIA 2FJAA 1S3BA 2VQBA 3AEFA 2BCPA 1L9EA 5IWAT 3RNMA 5LG3A 2OA5A 2APGA 4ILCA 5LBMA 4PFPA 2KXPB 1UCUA 2CXFA 3JAFA 5IYZE 1GETA 3EAOA 4IA5A 4CZZB 3REDA 4C3XA 3CX7B 4XWZA 4AKRB 4EQWA 2GR2A 3AB1A 2WMOA 4KBMB 5IUXA 3UP4A 4OYKA 4IE0A 1LVKA 2CXDA 1Y01A 1IUVA 3SFEA
chains in the Genus database with same CATH topology
2FJDA 1JOAA 2X8CA 4DGKA 4I59A 2GB0A 1K0JA 1Q1WA 2BK5A 4C3YA 2XFPA 3FG2P 2FBWA 1L9DA 1ZKQA 2C64A 1ZOYA 2QCUA 5KRQA 2VQ7A 3L8KA 5TR3A 2ZBWA 5KOWA 1JEHA 2WP6A 3QJ4A 5M0ZA 2B9XA 3V3NA 5EOWA 1H83A 2BRAA 2YM1A 1S2QA 4MJWA 4CCQA 2WBAA 2YM2A 4II3A 2H89A 3DK8A 4HB9A 3SM8A 2OLNA 4P9SA 4TM3A 1RYIA 2Q6UA 4H4WA 4XWRA 1PXBA 2GH5A 2YG6A 5KVIA 3DK4A 2YLZA 2C4CA 1B4VA 5KMPA 4NNJA 3SY4A 1YY5A 3EPTA 2BXSA 2GMHA 4ICYA 5KVHA 1GRAA 1IUTA 2BYBA 1IUWA 2WPFA 2TPRA 3M0OA 2BC0A 3CNTA 1FCDA 1PXAA 3VR9A 2PYXA 4U8NA 3E1TA 1NHQA 3IHGA 3HYVA 4GAPA 3NYCA 4A6NB 3K7TA 3NYFA 1F8SA 1W4XA 2JB1A 1CC2A 1XPQA 2VOUA 2WEUA 3HZLA 1TDFA 2CDUA 2GR1A 3FPZA 3V3OA 1IUSA 1GESA 3NRNA 4EIQA 3QSSA 1JRZA 4REKA 1K4QA 1TDKA 3DJEA 5HXIA 1ZX9A 2CFYA 3VQRA 2BS4A 1GT8A 3T2KA 4NEWA 5U63A 3CNDA 3ICTA 3KU9A 1FECA 4ECHA 5EBKA 1PBFA 1PBBA 2E5VA 2GEWA 4OPIA 3AD8B 1MOKA 1PHHA 1H7WA 5IQ1A 4DNAA 2WHDA 1F3PA 1N4VA 3QFAA 4EM4A 4Z2RA 2XFNA 3SYIA 2WPCA 4EMJA 5C3JA 4U2SA 4JY3A 4KPRA 3T2ZA 3EANA 1LPFA 1ZDLA 3GRTA 4YKFA 1DODA 4FX9A 1NHSA 5L46A 2C72A 1TYTA 2BA9A 2YG5A 3NNEA 4YXDA 4ZCDA 3SXIA 3ZDNA 2YG7A 4AP1A 3P4QA 2BRYA 3AYIA 3BNUA 4A5LA 2YVFA 3QVPA 3NKSA 1O5WA 2X8HA 3NK2X 2H88A 2BXRA 1EL8A 2Q0KA 3O0HA 4JQ9A 3SX6A 2YR5A 3OZ2A 2GAGB 4XXGA 1NEKA 3UCLA 4CCRA 2R46A 4I58A 4J33A 3V76A 1E1MA 4APNA 4OCGA 3AD7B 1ZK7A 2GV8A 1PJ7A 3CGEA 4JY2A 1NENA 2OLOA 3K7MX 1JRXA 2X99A 1KSSA 1VG0A 3CTYA 3R9UA 1Q1RA 4A6NA 4TM1A 4IVOB 4J34A 4YSZA 4Z26A 1QJDA 3D8XA 4AT2A 1KSUA 1LJ1A 1PDHA 4B66A 2V3AA 4U2LA 4II2A 4LU6A 4YSYA 4A9WA 1P2HA 1JRYA 2XVJA 1B5QA 4FK1C 3ICSA 4H2PA 4CY8A 1JNRA 4YTNA 1E1KA 1F8WA 2FJEA 3WE0A 3IHMA 1H81A 4K5RA 4YSHA 2WQYA 4H4ZA 3GYXA 1FEAA 1GRHA 3ISHA 3AYJA 4U8MA 3NT6A 1S2YA 4DSHA 4C5OA 3P9UA 4WX1A 3T37A 3FBSA 3NH3X 3BNMA 2YQUA 2WOVA 2BK4A 2YLRA 4U2TA 2YAUA 5HYMA 3SZCA 2QAEA 2YVGA 1VRQB 3AYLA 1D4CA 1FEBA 1PJ5A 2B7RA 2R0GA 2XLSA 3KD9A 5KMSA 2VRMA 3K30A 4BK1A 3HYXA 1ZY8A 1K0LA 1CC6A 1CBOA 1CJ3A 1Y56B 3HYWA 1N4WA 5DBJA 3AE8A 2AR8A 2O9ZA 2JBVA 2JAEA 4FK1A 4OPGA 4GRTA 1D4DA 3G5QA 1NG3A 5CQFA 3LADA 4NZHA 1NHPA 1ZOVA 2WESA 1JU2A 1VQWA 2IVEA 4Y4MA 3RP8A 1FOHA 2Z5YA 3T14A 4D04A 2JB2A 2ACZA 2V5ZA 4DSGA 4Z44A 3T2YA 4H2NA 3DH9A 1O95A 2LFCA 3AEDA 3S61A 4H2QA 2NVKX 2E1MA 1TYPA 1VDCA 1REOA 3BHFA 5KNLA 1CHUA 2C73A 4B63A 4ADWA 5KWFA 1S3EA 3K7QX 3UOXA 1OJAA 4EQXA 2OALA 2ZZ0A 3DK9A 3LJPA 4H4VA 3B6DA 4CBQA 2V6OA 4G6GA 2EQ8A 4IA6A 3ATRA 3AE2A 3KKJA 3NTDA 2B9YA 1PXCA 4Z43A 5J7XA 3LXDA 4UDPA 3CPIG 3S5WA 3DJJA 4H4XA 1DNCA 2IVDA 4YSXA 1YQ3A 3GDPA 4H7UA 4BK3A 2A89A 1CJCA 4AP3A 4B67A 1YQ4A 2WDVA 2ARDA 3C4AA 2BACA 3II4A 4KX6A 1H86A 3OC4A 1IJHA 4OPTA 3AE5A 4GAVA 1EL9A 1BGNA 3NIXA 2JKCA 2ZZCA 4GF7A 1E39A 1ZP0A 2VVLG 3JSKA 4CNKA 1PBEA 1Y56A 4RG3A 1EL5A 2NPXA 2OA1A 4K8DA 3GQKA 5GRTA 3NK1X 1Y0PA 3PVCA 5FMHA 3NN6X 4Z24A 1IUXA 3L1RA 2E4GA 4EQSA 3H4KA 5KOXA 4HA6A 1BWCA 3VRBA 4J56A 4TM4A 1GV4A 2R4EA 4BURA 2RGHA 1E7PA 2CULA 4YTMA 1Q9IA 2EQ9A 3QSEA 4A65A 1LTXR 2R0PA 3SZ0A 5JCMA 2WDQA 4EQRA 4X9MA 4E0VA 4X4JA 3SFDA 2EQ6A 2F5ZA 1GXFA 1GPEA 4NWZA 3QSMA 4JDRA 1DXLA 3NLCA 2GF3A 3GMCA 3CGCA 1PBDA 3NYEA 5FS9A 4J2WA 3IC9A 4H2RA 4A79A 2AQJA 3ICRA 3IF9A 3P1WA 4B68A 5BULA 5BUKA 2HQMA 1NHRA 1M64A 3P4PA 3CMMA 3GWDA 4TLXA 3GWFA 4Y4NA 4H4YA 3AWIA 3UKPA 2W0HA 2XLPA 4BK2A 4IV9A 4FDCB 4CRTA 3CNPA 4YTPA 3LZXA 3UP5A 2Q7VA 1GSNA 3IWAA 2RGOA 3NN0X 1HYUA 3GD3A 1AOGA 2XLTA 4H4RA 1PN0A 1F6MA 4IVMB 3ITJA 2WOIA 5KMRA 1D7LA 3UKFA 5IPYA 2C67A 4BJZA 2BCGG 4PAAA 3RHAA 3CGDA 4YWOA 3UKLA 3CNJA 3D1CA 1L0VA 1IUUA 1CC4A 3QFBA 4H4SA 4H50A 4AOSA 4J31A 1CF3A 1DJNA 4H4QA 2WU5A 1B8SA 1CL0A 2XVFA 3G5RA 1V59A 1GRBA 4GDEA 3UKAA 3KLJA 1GOSA 3GMBA 3EF6A 3NHOX 3LOVA 3SZWA 3QVRA 1Z6LA 3CIRA 1MXTA 2R4JA 1NG4A 2RABA 4K22A 4U8IA 2I0ZA 3GSIA 3KVEA 4Z2UA 5GSNA 3BI4A 4A7AA 5KXJA 3DJDA 3I3LA 3AE6A 2XFQA 3M13A 3AEEA 4PABA 1KNPA 2YVJA 2XVIA 3BI5A 2CVJA 1LQTA 1PS9A 2XDOA 1BZLA 3CPJG 3NTAA 4EM3A 2BK3A 2XLUA 3SQPA 1D5TA 3SGLA 3GRSA 1M6IA 2YG4A 4NTCA 4NTEA 3T0KA 1GALA 4JNAA 4AT0A 1GERA 3LB8A 2V60A 2VVMA 3DGZA 5BRTA 1GRFA 1DOBA 4A99A 2XCGA 4B65A 1BGJA 1ONFA 4C77A 2YR4A 1KNRA 2YR6A 1LQUA 1TDOA 2FJBA 1NAAA 1OJTA 1X31B 3C96A 5FS6A 2ZZBA 3UTHA 1PBCA 1E6EA 2JB3A 2XFOA 3AE7A 1LVLA 1CJ4A 3URHA 2B76A 3PO7A 5BVAA 3SUCA 3SZFA 4BV6A 2C65A 5FS7A 2C76A 3DJGX 3H8IA 2WETA 2YWLA 5ER0A 1K0IA 2R9ZA 3Q9TA 1NPXA 4NTDA 5HHFA 1DJQA 2UZZA 2X3NA 4G9KA 3RP7A 2BS3A 2V3BA 4K5SA 2PHHA 3KPKA 3FIMB 4ZN0A 4JN9A 4OPDA 2GR0A 3AECA 1H6VA 2WOWA 1VG9A 4U8OA 2WPEA 5KMQA 2TMDA 1ZMCA 4LIIA 4Z25A 2WU2A 1TRBA 2R0CA 2C3CA 5LV9A 3FMWA 4D03A 2C75A 3GQHA 4J57A 4RG4A 2DKHA 2Q0LA 3VRAA 2IIDA 4J36A 2Y6QA 3GYJA 1XANA 3ABVA 3CPHG 2WP5A 3UTGA 4Z2TA 5JCKA 4H4UA 2AAQA 5EB5A 1TDNA 1F8RA 3GDNA 5EB4A 1XHCA 3NGCX 4LA1A 1O94A 2A8XA 3LZWA 1YQZA 3CN8A 1L9CA 4ZCCA 2WDRA 2C70A 3UOVA 3GYIA 2BS2A 1GEUA 3AD9B 4X9NA 3AE4A 4H4PA 4Y4LA 2GVCA 2VRLA 4B69A 1SEZA 4GR1A 1D4EA 4GUVA 3VRDB 1NDAA 2C7GA 4N9XA 2OAMA 1OJCA 3VR8A 1H82A 4GCMA 3GD4A 4B64A 1H7XA 1YKJA 2WP9A 1UKVG 5J60A 4USQA 2C66A 4H4TA 4G73A 4O5QA 5JCLA 4OPCA 4U8PA 4JNQA 3COXA 4TLZA 1GRGA 4RSLA 4UDRA 2QA2A 4B1BA 3AE9A 2GR3A 4OVIA 2BABA 3F8DA 3NG7X 1ZMDA 1RSGA 2A87A 2X8GA 3P4SA 3KPFA 3M12A 5JCIA 3CGBA 3Q6JA 2WS3A 4OPLA 2YG3A 3DGHA 2DKIA 2EQ7A 3BHKA 1DOCA 1QLBA 3UTEA 3T31A 4GDPA 1EL7A 1H84A 1GTEA 2GQWA 2VZ2A 3B3RA 3UOZA 4EMIA 4UP3A 2YLWA 1GRTA 2BC1A 3AXBA 1QO8A 3NK0X 2YLSA 4NEVA 5U25A 4EMWA 1XDIA 4G74A 3RP6A 3ALJA 3F8PA 3UKQA 4K7ZA 3ADAB 3F8RA 1KFYA 1ELIA 1PJ6A 5U1OA 4AOXA 3AE3A 3AEAA 1BF3A 1CJ2A 1LV0A 2GMJA 1TDEA 2JK6A 2R45A 4CY6A 1GNDA 2VVLA 3H8LA 5FS8A 3ZYXA 1KDGA 2XLRA 4U8JA 3CNSA 4C74A 2GQFA 1D7YA 1EBDA 1OJDA 3ALMA 2YLXA 4O5UA 5M10A 3P4RA 2YLTA 3DA1A 3AEBA 3BI2A 5C2TA 1DOEA 1B37A 2GAHB 4UDQA 2GRTA 4WCTA 1GREA 3I6DA 4TM0A 4U8KA 2XVHA 4BJYA 2C3DA 2XFUA 3UKKA 4YT0A 2B7SA 3ALLA 1KF6A 5HY5A 1S3BA 2FJAA 2XYOA 2VQBA 1OJ9A 3KA7A 3G5SA 3PS9A 2XVEA 3AEFA 2BCPA 1L9EA 3AEGA 3AE1A 2B9WA 4USRA 3RNMA 3ATQA 2QA1A 3UKHA 2APGA 1MO9A 4EIPA 4YKGA 2X50A 1E1NA 2RGJA 3EAOA 1GETA 4IA5A 4M52A 4OPUA 1GTHA 3DMEA 3REDA 2V61A 4U8LA 1BKWA 4C3XA 4CNJA 2J3NA 1N4UA 1COYA 3C4NA 4XWZA 1JNZA 4EQWA 2GR2A 3AB1A 2Y6RA 3UTFA 4G6HA 1E1LA 1RP0A 3UOYA 5IQ4A 5CKUA 2Z5XA 1N1PA 1P2EA 3UP4A 5JCNA 1FL2A 4K2XA 1IUVA 3SFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJD A;  1JOA A;  2X8C A;  4DGK A;  4I59 A;  2GB0 A;  1K0J A;  1Q1W A;  2BK5 A;  4C3Y A;  2XFP A;  3FG2 P;  2FBW A;  1L9D A;  1ZKQ A;  2C64 A;  1ZOY A;  2QCU A;  5KRQ A;  2VQ7 A;  3L8K A;  5TR3 A;  2ZBW A;  5KOW A;  1JEH A;  2WP6 A;  3QJ4 A;  5M0Z A;  2B9X A;  3V3N A;  5EOW A;  1H83 A;  2YM1 A;  1S2Q A;  4MJW A;  4CCQ A;  2WBA A;  2YM2 A;  2H89 A;  3DK8 A;  4HB9 A;  3SM8 A;  2OLN A;  4P9S A;  4TM3 A;  1RYI A;  2Q6U A;  4H4W A;  4XWR A;  1PXB A;  2GH5 A;  2YG6 A;  5KVI A;  3DK4 A;  2YLZ A;  1B4V A;  1YY5 A;  3EPT A;  2BXS A;  2GMH A;  4ICY A;  5KVH A;  1GRA A;  1IUT A;  2BYB A;  1IUW A;  2WPF A;  2TPR A;  3M0O A;  2BC0 A;  3CNT A;  1FCD A;  1PXA A;  3VR9 A;  2PYX A;  4U8N A;  3E1T A;  1NHQ A;  3IHG A;  3NYC A;  4A6N B;  3K7T A;  3NYF A;  1F8S A;  1W4X A;  2JB1 A;  1CC2 A;  1XPQ A;  2VOU A;  2WEU A;  3HZL A;  1TDF A;  2CDU A;  2GR1 A;  3FPZ A;  3V3O A;  1IUS A;  1GES A;  3NRN A;  4EIQ A;  3QSS A;  1JRZ A;  4REK A;  1K4Q A;  1TDK A;  3DJE A;  5HXI A;  1ZX9 A;  2CFY A;  3VQR A;  2BS4 A;  1GT8 A;  4NEW A;  5U63 A;  3CND A;  3ICT A;  3KU9 A;  1FEC A;  4ECH A;  5EBK A;  1PBF A;  1PBB A;  2E5V A;  2GEW A;  4OPI A;  3AD8 B;  1MOK A;  1PHH A;  1H7W A;  5IQ1 A;  4DNA A;  2WHD A;  1F3P A;  1N4V A;  3QFA A;  4EM4 A;  4Z2R A;  2XFN A;  2WPC A;  4EMJ A;  5C3J A;  4U2S A;  4JY3 A;  4KPR A;  3EAN A;  1LPF A;  1ZDL A;  3GRT A;  4YKF A;  1DOD A;  4FX9 A;  1NHS A;  5L46 A;  2C72 A;  1TYT A;  2BA9 A;  2YG5 A;  3NNE A;  4YXD A;  4ZCD A;  3ZDN A;  4AP1 A;  2YG7 A;  3P4Q A;  3AYI A;  3BNU A;  4A5L A;  2YVF A;  3QVP A;  3NKS A;  1O5W A;  2X8H A;  3NK2 X;  2H88 A;  2BXR A;  1EL8 A;  2Q0K A;  3O0H A;  4JQ9 A;  2YR5 A;  3OZ2 A;  2GAG B;  4XXG A;  1NEK A;  3UCL A;  4CCR A;  2R46 A;  4I58 A;  4J33 A;  3V76 A;  1E1M A;  4APN A;  4OCG A;  3AD7 B;  1ZK7 A;  2GV8 A;  1PJ7 A;  3CGE A;  4JY2 A;  1NEN A;  2OLO A;  3K7M X;  1JRX A;  2X99 A;  1KSS A;  1VG0 A;  3CTY A;  3R9U A;  1Q1R A;  4A6N A;  4TM1 A;  4IVO B;  4J34 A;  4YSZ A;  4Z26 A;  1QJD A;  3D8X A;  4AT2 A;  1KSU A;  1LJ1 A;  1PDH A;  4B66 A;  2V3A A;  4U2L A;  4LU6 A;  4YSY A;  4A9W A;  1P2H A;  1JRY A;  2XVJ A;  1B5Q A;  4FK1 C;  3ICS A;  4H2P A;  4CY8 A;  1JNR A;  4YTN A;  1E1K A;  1F8W A;  2FJE A;  3WE0 A;  3IHM A;  1H81 A;  4K5R A;  4YSH A;  2WQY A;  4H4Z A;  3GYX A;  1FEA A;  1GRH A;  3ISH A;  3AYJ A;  4U8M A;  3NT6 A;  1S2Y A;  4DSH A;  4C5O A;  3P9U A;  4WX1 A;  3T37 A;  3FBS A;  3NH3 X;  3BNM A;  2YQU A;  2WOV A;  2BK4 A;  2YLR A;  4U2T A;  2YAU A;  5HYM A;  2QAE A;  2YVG A;  1VRQ B;  3AYL A;  1D4C A;  1FEB A;  1PJ5 A;  2B7R A;  2R0G A;  2XLS A;  3KD9 A;  2VRM A;  3K30 A;  4BK1 A;  1ZY8 A;  1K0L A;  1CC6 A;  1CBO A;  1CJ3 A;  1Y56 B;  1N4W A;  5DBJ A;  3AE8 A;  2AR8 A;  2O9Z A;  2JBV A;  2JAE A;  4FK1 A;  4OPG A;  4GRT A;  1D4D A;  3G5Q A;  1NG3 A;  5CQF A;  3LAD A;  4NZH A;  1NHP A;  1ZOV A;  2WES A;  1JU2 A;  1VQW A;  2IVE A;  4Y4M A;  3RP8 A;  1FOH A;  2Z5Y A;  4D04 A;  2JB2 A;  2ACZ A;  2V5Z A;  4DSG A;  4Z44 A;  4H2N A;  3DH9 A;  1O95 A;  2LFC A;  3AED A;  3S61 A;  4H2Q A;  2NVK X;  2E1M A;  1TYP A;  1VDC A;  1REO A;  3BHF A;  1CHU A;  2C73 A;  4B63 A;  4ADW A;  5KWF A;  1S3E A;  3K7Q X;  3UOX A;  1OJA A;  4EQX A;  2OAL A;  2ZZ0 A;  3DK9 A;  3LJP A;  4H4V A;  3B6D A;  4CBQ A;  2V6O A;  2EQ8 A;  4IA6 A;  3ATR A;  3AE2 A;  3KKJ A;  3NTD A;  2B9Y A;  1PXC A;  4Z43 A;  5J7X A;  3LXD A;  4UDP A;  3CPI G;  3S5W A;  3DJJ A;  4H4X A;  1DNC A;  2IVD A;  4YSX A;  1YQ3 A;  3GDP A;  4H7U A;  4BK3 A;  2A89 A;  1CJC A;  4AP3 A;  4B67 A;  1YQ4 A;  2WDV A;  2ARD A;  3C4A A;  2BAC A;  3II4 A;  4KX6 A;  1H86 A;  3OC4 A;  1IJH A;  4OPT A;  3AE5 A;  1EL9 A;  1BGN A;  3NIX A;  2JKC A;  2ZZC A;  4GF7 A;  1E39 A;  1ZP0 A;  2VVL G;  3JSK A;  4CNK A;  1PBE A;  1Y56 A;  4RG3 A;  1EL5 A;  2NPX A;  2OA1 A;  4K8D A;  3GQK A;  5GRT A;  3NK1 X;  1Y0P A;  3PVC A;  5FMH A;  3NN6 X;  4Z24 A;  1IUX A;  3L1R A;  2E4G A;  4EQS A;  3H4K A;  5KOX A;  4HA6 A;  1BWC A;  3VRB A;  4J56 A;  4TM4 A;  1GV4 A;  2R4E A;  4BUR A;  2RGH A;  1E7P A;  2CUL A;  4YTM A;  1Q9I A;  2EQ9 A;  3QSE A;  4A65 A;  1LTX R;  2R0P A;  5JCM A;  2WDQ A;  4EQR A;  4X9M A;  4E0V A;  4X4J A;  3SFD A;  2EQ6 A;  2F5Z A;  1GXF A;  1GPE A;  3QSM A;  4JDR A;  1DXL A;  3NLC A;  2GF3 A;  3GMC A;  3CGC A;  1PBD A;  3NYE A;  5FS9 A;  4J2W A;  3IC9 A;  4H2R A;  4A79 A;  2AQJ A;  3ICR A;  3IF9 A;  3P1W A;  4B68 A;  5BUL A;  5BUK A;  2HQM A;  1NHR A;  1M64 A;  3P4P A;  3GWD A;  4TLX A;  3GWF A;  4Y4N A;  4H4Y A;  3AWI A;  3UKP A;  2W0H A;  2XLP A;  4BK2 A;  4IV9 A;  4FDC B;  4CRT A;  3CNP A;  4YTP A;  3LZX A;  3UP5 A;  2Q7V A;  1GSN A;  3IWA A;  2RGO A;  3NN0 X;  1HYU A;  3GD3 A;  1AOG A;  2XLT A;  4H4R A;  1PN0 A;  1F6M A;  4IVM B;  3ITJ A;  2WOI A;  1D7L A;  3UKF A;  5IPY A;  2C67 A;  4BJZ A;  2BCG G;  4PAA A;  3RHA A;  3CGD A;  4YWO A;  3UKL A;  3CNJ A;  3D1C A;  1L0V A;  1IUU A;  1CC4 A;  3QFB A;  4H4S A;  4H50 A;  4AOS A;  4J31 A;  1CF3 A;  1DJN A;  4H4Q A;  2WU5 A;  1B8S A;  1CL0 A;  2XVF A;  3G5R A;  1V59 A;  1GRB A;  4GDE A;  3UKA A;  3KLJ A;  1GOS A;  3GMB A;  3EF6 A;  3NHO X;  3LOV A;  3QVR A;  1Z6L A;  3CIR A;  1MXT A;  2R4J A;  1NG4 A;  2RAB A;  4K22 A;  4U8I A;  2I0Z A;  3GSI A;  3KVE A;  4Z2U A;  5GSN A;  3BI4 A;  4A7A A;  5KXJ A;  3DJD A;  3I3L A;  3AE6 A;  2XFQ A;  3M13 A;  3AEE A;  4PAB A;  1KNP A;  2YVJ A;  2XVI A;  3BI5 A;  2CVJ A;  1LQT A;  1PS9 A;  2XDO A;  1BZL A;  3CPJ G;  3NTA A;  4EM3 A;  2BK3 A;  2XLU A;  3SQP A;  1D5T A;  3SGL A;  3GRS A;  1M6I A;  2YG4 A;  4NTC A;  4NTE A;  1GAL A;  4JNA A;  4AT0 A;  1GER A;  3LB8 A;  2V60 A;  2VVM A;  3DGZ A;  5BRT A;  1GRF A;  1DOB A;  4A99 A;  2XCG A;  4B65 A;  1BGJ A;  1ONF A;  4C77 A;  2YR4 A;  1KNR A;  2YR6 A;  1LQU A;  1TDO A;  2FJB A;  1NAA A;  1OJT A;  1X31 B;  3C96 A;  5FS6 A;  2ZZB A;  3UTH A;  1PBC A;  1E6E A;  2JB3 A;  2XFO A;  3AE7 A;  1LVL A;  1CJ4 A;  3URH A;  2B76 A;  3PO7 A;  5BVA A;  3SUC A;  4BV6 A;  2C65 A;  5FS7 A;  2C76 A;  3DJG X;  3H8I A;  2WET A;  2YWL A;  5ER0 A;  1K0I A;  2R9Z A;  3Q9T A;  1NPX A;  4NTD A;  5HHF A;  1DJQ A;  2UZZ A;  2X3N A;  3RP7 A;  2BS3 A;  2V3B A;  4K5S A;  2PHH A;  3FIM B;  4ZN0 A;  4JN9 A;  4OPD A;  2GR0 A;  3AEC A;  1H6V A;  2WOW A;  1VG9 A;  4U8O A;  2WPE A;  2TMD A;  1ZMC A;  4LII A;  4Z25 A;  2WU2 A;  1TRB A;  2R0C A;  2C3C A;  5LV9 A;  3FMW A;  4D03 A;  2C75 A;  3GQH A;  4J57 A;  4RG4 A;  2DKH A;  2Q0L A;  3VRA A;  2IID A;  4J36 A;  2Y6Q A;  3GYJ A;  1XAN A;  3ABV A;  3CPH G;  2WP5 A;  3UTG A;  4Z2T A;  5JCK A;  4H4U A;  2AAQ A;  5EB5 A;  1TDN A;  1F8R A;  3GDN A;  5EB4 A;  1XHC A;  3NGC X;  4LA1 A;  1O94 A;  2A8X A;  3LZW A;  1YQZ A;  3CN8 A;  1L9C A;  4ZCC A;  2WDR A;  2C70 A;  3UOV A;  3GYI A;  2BS2 A;  1GEU A;  3AD9 B;  4X9N A;  3AE4 A;  4H4P A;  4Y4L A;  2GVC A;  2VRL A;  4B69 A;  1SEZ A;  4GR1 A;  1D4E A;  4GUV A;  3VRD B;  1NDA A;  2C7G A;  4N9X A;  2OAM A;  1OJC A;  3VR8 A;  1H82 A;  4GCM A;  3GD4 A;  4B64 A;  1H7X A;  1YKJ A;  2WP9 A;  1UKV G;  5J60 A;  4USQ A;  2C66 A;  4H4T A;  4O5Q A;  5JCL A;  4OPC A;  4U8P A;  4JNQ A;  3COX A;  4TLZ A;  1GRG A;  4RSL A;  4UDR A;  2QA2 A;  4B1B A;  3AE9 A;  2GR3 A;  4OVI A;  2BAB A;  3F8D A;  3NG7 X;  1ZMD A;  1RSG A;  2A87 A;  2X8G A;  3P4S A;  3KPF A;  3M12 A;  5JCI A;  3CGB A;  3Q6J A;  2WS3 A;  4OPL A;  2YG3 A;  3DGH A;  2DKI A;  2EQ7 A;  3BHK A;  1DOC A;  1QLB A;  3UTE A;  4GDP A;  1EL7 A;  1H84 A;  1GTE A;  2GQW A;  2VZ2 A;  3B3R A;  3UOZ A;  4EMI A;  4UP3 A;  2YLW A;  1GRT A;  2BC1 A;  3AXB A;  1QO8 A;  3NK0 X;  2YLS A;  4NEV A;  5U25 A;  4EMW A;  1XDI A;  3RP6 A;  3ALJ A;  3F8P A;  3UKQ A;  4K7Z A;  3ADA B;  3F8R A;  1KFY A;  1ELI A;  1PJ6 A;  5U1O A;  4AOX A;  3AE3 A;  3AEA A;  1BF3 A;  1CJ2 A;  1LV0 A;  2GMJ A;  1TDE A;  2JK6 A;  2R45 A;  4CY6 A;  1GND A;  2VVL A;  3H8L A;  5FS8 A;  3ZYX A;  1KDG A;  2XLR A;  4U8J A;  3CNS A;  4C74 A;  2GQF A;  1D7Y A;  1EBD A;  1OJD A;  3ALM A;  2YLX A;  4O5U A;  5M10 A;  3P4R A;  2YLT A;  3DA1 A;  3AEB A;  3BI2 A;  5C2T A;  1DOE A;  1B37 A;  2GAH B;  4UDQ A;  2GRT A;  4WCT A;  1GRE A;  3I6D A;  4TM0 A;  4U8K A;  2XVH A;  4BJY A;  2C3D A;  2XFU A;  3UKK A;  4YT0 A;  2B7S A;  3ALL A;  1KF6 A;  5HY5 A;  1S3B A;  2FJA A;  2XYO A;  2VQB A;  1OJ9 A;  3KA7 A;  3G5S A;  3PS9 A;  2XVE A;  3AEF A;  2BCP A;  1L9E A;  3AEG A;  3AE1 A;  2B9W A;  4USR A;  3RNM A;  3ATQ A;  2QA1 A;  3UKH A;  2APG A;  1MO9 A;  4EIP A;  4YKG A;  2X50 A;  1E1N A;  2RGJ A;  3EAO A;  1GET A;  4IA5 A;  4M52 A;  4OPU A;  1GTH A;  3DME A;  3RED A;  2V61 A;  4U8L A;  1BKW A;  4C3X A;  4CNJ A;  2J3N A;  1N4U A;  1COY A;  3C4N A;  4XWZ A;  1JNZ A;  4EQW A;  2GR2 A;  3AB1 A;  2Y6R A;  3UTF A;  1E1L A;  1RP0 A;  3UOY A;  5IQ4 A;  5CKU A;  2Z5X A;  1N1P A;  1P2E A;  3UP4 A;  5JCN A;  1FL2 A;  4K2X A;  1IUV A;  3SFE A; 
#chains in the Genus database with same CATH topology
 2PBI A;  2X8C A;  4DGK A;  5E0O A;  4I59 A;  3AXJ B;  4MLK A;  4A5X A;  1ZOY A;  5TR3 A;  2ZBW A;  4UEL A;  5KOW A;  4EV6 A;  3QJ4 A;  2B9X A;  2SPC A;  4M1P A;  5EOW A;  1WFD A;  2YM1 A;  1S94 A;  4XBF B;  2WBA A;  4II3 A;  1BEV 4;  4HB9 A;  4BA9 A;  3PE0 A;  4U33 A;  5KVI A;  1M62 A;  2YLZ A;  4GIW A;  2C4C A;  1B4V A;  1VRH 4;  5KMP A;  4NNJ A;  4UV8 B;  1YY5 A;  4IIJ E;  3LDQ B;  5HEH A;  3CNT A;  3QK6 A;  2PYX A;  4E7S A;  4U8N A;  1NHQ A;  3IHG A;  3Q5W A;  3HYV A;  4I50 E;  3NYF A;  1CC2 A;  1XPQ A;  5KMG P;  3KBU A;  5LMU T;  3P7I A;  1GES A;  4EZ4 A;  5L3C B;  2DLR A;  3JC6 D;  1H7C A;  1XHZ A;  1K4Q A;  2IW5 B;  3CKD A;  3FHN A;  3K3Q C;  4TN7 B;  5HXH A;  4NEW A;  3RKG A;  1BR2 A;  1OWA A;  3N9P A;  1XZY A;  3U78 A;  5EBK A;  1PBB A;  4TX5 A;  4O4H E;  3LG7 A;  3PUQ A;  1ZEE A;  3K3O A;  3MKD A;  5IQ1 A;  4HFD A;  1N4V A;  4EMJ A;  4U2S A;  4KPR A;  3ZLI A;  4YKF A;  1DU2 A;  5L46 A;  2BA9 A;  2YG5 A;  4YXD A;  4AP1 A;  2YG7 A;  3VKH A;  5LGU B;  1OXZ A;  2OV9 A;  3P4W A;  4OFZ A;  3QVP A;  4DV5 T;  1O5W A;  1HS7 A;  2YR5 A;  2VK9 A;  4XXG A;  2W0G A;  3UCL A;  4CCR A;  4I58 A;  4J33 A;  3V76 A;  5AFU L;  4ZI7 E;  4OCG A;  4JI8 T;  3AD7 B;  3IEE A;  3CGE A;  1NEN A;  2UXN B;  2BG9 A;  2X99 A;  4GKK T;  4IVO B;  1E2A A;  4YSZ A;  3D8X A;  4AT2 A;  1LJ1 A;  1PDH A;  2PLV 4;  4II2 A;  4YSY A;  2XVJ A;  4DBR A;  3I1A A;  3ICS A;  4CY8 A;  2HWB 4;  1VCS A;  2IDO B;  3N9Q A;  1H81 A;  4H4Z A;  1XDP A;  4WZX A;  3FBS A;  3PJA J;  5FXW A;  2WOV A;  2YAU A;  3BQK A;  3BK9 A;  2R04 4;  2C5K T;  4HFE A;  1PJ5 A;  3HYW A;  4IE7 A;  2JAE A;  2EHO B;  4F8H A;  1D4D A;  4DV7 T;  2CWO A;  3LAD A;  1MIV A;  1BR0 A;  5CA1 E;  3ZC1 A;  4H9O C;  4D04 A;  2ACZ A;  1HNW T;  3DH9 A;  2LFC A;  3S61 A;  4DVD A;  5LB7 B;  1TYP A;  3C51 A;  2C73 A;  3ZST A;  5KWF A;  3K7Q X;  3ZN1 B;  3NRX A;  4O4I E;  2LJL A;  4H4V A;  4G6G A;  5DQV A;  3NTD A;  5J7X A;  3LXD A;  2J47 A;  4UDP A;  2V7K A;  4H4X A;  1T98 A;  2IVD A;  3GDP A;  4BK3 A;  4LFB T;  2A89 A;  3LK3 B;  1VBA 4;  2WDV A;  5FL1 A;  3II4 A;  4ISS A;  3OC4 A;  1UGO A;  4OPT A;  3AE5 A;  4GAV A;  2M6B A;  1BGN A;  4U72 A;  2KMF A;  5JRC B;  3NIX A;  2ZZC A;  2VVL G;  4A97 A;  2VKO A;  1RUI 4;  4LML A;  4K8D A;  4DR4 T;  3K8P C;  3RPU A;  4Z24 A;  5DJQ C;  1GQE A;  4O2A E;  2YDS A;  3CVR A;  1GV4 A;  2XPK A;  2CUL A;  3M65 A;  3KBT A;  4H9N C;  1O3X A;  2BZB A;  3SRZ A;  4AKL A;  4E0V A;  1N36 T;  4X4J A;  1WR6 A;  3C4X A;  3DP7 A;  2PY5 A;  2ZLY A;  4A79 A;  2MAW A;  4B68 A;  3ZKR A;  4HWH A;  3FBZ A;  1M7K A;  1NHR A;  5HXR A;  5L2L A;  3AWI A;  4DUZ T;  2N9D A;  3FB2 A;  3Q5E A;  3ETV A;  4B3S T;  1GSN A;  2RGO A;  3NN0 X;  2VB6 A;  2XLT A;  3RIU C;  1D7L A;  3UKF A;  4AQY T;  2JRK A;  3FZH B;  3CGD A;  3UKL A;  3CNJ A;  1AR9 4;  2WWU A;  4H4S A;  4BJN A;  1CF3 A;  1DJN A;  3ZCJ A;  1HTJ F;  3KIN B;  4K0K T;  3O9X A;  2E2A A;  3KLJ A;  1GOS A;  3SZW A;  3EF6 A;  2C0S A;  3EDV A;  3CIR A;  2R4J A;  5HXS A;  1NG4 A;  3N9N A;  5GSN A;  3BI4 A;  4A7A A;  5KXJ A;  3I3L A;  3AEE A;  2EHO D;  5LMN T;  1RUE 4;  1J5E T;  3NTA A;  5AQK B;  2KSR A;  2V8S V;  2BK3 A;  2YDQ A;  1PIV 4;  1GAL A;  1GER A;  3DGZ A;  3N9M A;  2WWV A;  1GRF A;  2VL0 A;  2XCG A;  1KNR A;  2FJB A;  4DV6 T;  4GK5 E;  1OJT A;  2Y8D A;  4ASK A;  4CQI A;  5FS6 A;  3F2E A;  3ZT6 A;  2C65 A;  4LF4 T;  2WET A;  2R06 4;  4LF8 T;  4DV3 T;  4LF7 T;  4UVB B;  1VBB 4;  5HHF A;  3OYZ A;  2LOS A;  2E9X A;  2A9U A;  4K5S A;  4H63 V;  2YEV C;  2EHO C;  4OPD A;  2GR0 A;  4P0B A;  1H6V A;  1X9B A;  4KHZ F;  2KWI B;  4LII A;  2LKH A;  2C75 A;  2X0L B;  4WW0 A;  4J57 A;  3QB5 K;  4RG4 A;  2QVA A;  2IID A;  2R6G F;  1XAN A;  1YD8 G;  3MAC A;  3CPH G;  4U7I A;  3UTG A;  4Z2T A;  5JCK A;  4PK6 A;  1HNZ T;  3MA9 A;  4AKH A;  1TDN A;  3SS1 A;  2CA5 A;  1XHC A;  3NRY A;  2DNX A;  2D2S A;  1XWM A;  2UXB T;  1GEU A;  3AD9 B;  4EYU A;  2GVC A;  4B69 A;  4GKJ T;  2C7G A;  2W62 A;  1W09 A;  4JLE A;  5LYJ E;  2V6Y B;  3FZK B;  4U8P A;  3N9O A;  2DWG A;  1EV1 4;  4TLZ A;  4RSL A;  4UDR A;  4QXC B;  2GR3 A;  4OVI A;  3FZM B;  3RKO A;  1ZMD A;  1RSG A;  5AQO B;  5JCI A;  5JRE A;  4LMJ A;  3I9W A;  2DKI A;  2M67 A;  3BHK A;  2XM2 A;  3R6N A;  3UTE A;  1V9D A;  3KV9 A;  1RMU 4;  1EL7 A;  3ZMU B;  4ZZB A;  2XQ9 A;  5EK3 A;  1YKH B;  3MJX A;  4UP3 A;  2BC1 A;  3AXB A;  3O1H A;  3NK0 X;  2HHH T;  1XDI A;  2EX3 A;  1RUJ 4;  1KFY A;  2ES0 A;  4AOX A;  3AE3 A;  4CN4 A;  2GMJ A;  2W2U A;  2JK6 A;  2R45 A;  2WB5 A;  5FS8 A;  5JDF A;  1KDG A;  2XLR A;  4U8J A;  3CNS A;  5FYM A;  4IL4 A;  1EBD A;  1OJD A;  2WY2 A;  5L3B B;  3L09 A;  2YLT A;  4TWH A;  2A72 A;  3BI2 A;  3ZJ1 A;  2GRT A;  1IAP A;  3I6D A;  2VVN A;  4BJY A;  5HEJ A;  2X0Y A;  3UKK A;  4YT0 A;  3ALL A;  2WMN A;  4B3M T;  1OJ9 A;  3KA7 A;  2XVE A;  3AE1 A;  4EIP A;  3UKH A;  3ATQ A;  2GK9 A;  1HNX T;  2X50 A;  2MTQ A;  2X66 A;  5DAB A;  3EHZ A;  2UUC T;  1XMO T;  3J8F 4;  4GYS A;  4U8L A;  2XQ4 A;  3FXD B;  2J3N A;  3C4N A;  4UEM A;  4HWF A;  4ZEY A;  4X1K E;  3UTF A;  1E1L A;  5IQ4 A;  5CKU A;  1N1P A;  3K1S A;  3LBX A;  3TLW A;  4AIS A;  2V6X A;  3GD3 A;  2FJD A;  1JOA A;  3UQ4 A;  5J2U E;  1K0J A;  1Q1W A;  4CXW A;  1ZKQ A;  5JDM A;  2C64 A;  2R07 4;  5FVL A;  3V3N A;  2CPT A;  2VKD A;  4QH1 A;  2BRA A;  2OLT A;  4DV0 T;  5AQF B;  4L0R A;  3A7M A;  4JUY A;  1SHZ C;  3SM8 A;  5EK4 A;  2DWK A;  2Q6U A;  2YG6 A;  2VVS A;  3DK4 A;  3C4W A;  3SY4 A;  4ICY A;  3U3I A;  3EPT A;  5ABH A;  1GRA A;  1IUT A;  4IE6 A;  2BYB A;  2XQ6 A;  2XSB A;  5HXE A;  2UXC T;  3UT5 E;  4PDW D;  3B57 A;  3E1T A;  2XZE A;  3O1I A;  1F8S A;  2JB1 A;  2WEU A;  3HZL A;  5HEU A;  2K48 A;  1TDF A;  4JI0 T;  2GR1 A;  4KMC A;  2RS1 4;  3AA6 B;  1IUS A;  2JJ9 A;  1JRZ A;  1OED A;  3AVS A;  1TDK A;  1N33 T;  5HXI A;  1ZX9 A;  4ZI3 C;  2BS4 A;  5U63 A;  5LHI B;  1KEY A;  5AQG B;  3RYC E;  3CND A;  2LRL A;  2D9D A;  3UFE A;  4OPI A;  1MOK A;  1PHH A;  2WHD A;  1F3P A;  4Z2R A;  3ZT5 A;  5C3J A;  4JY3 A;  3EAN A;  1LPF A;  3GRT A;  5LXT E;  1NHS A;  3HKD E;  2XAF B;  3P4Q A;  4EB6 E;  1NAF A;  1D1A A;  2MBG A;  3TLT A;  3O0H A;  1I6Z A;  1T72 A;  5ABE A;  3RHW A;  1NEK A;  4NIQ A;  1HRV 4;  2R46 A;  3ZMT B;  1E1M A;  4APN A;  3E22 E;  3UUM A;  4JI5 T;  5HAX A;  2OLO A;  1JRX A;  3K7M X;  4YFS A;  1KSS A;  3EAB A;  2NW7 A;  4A6N A;  2KIN B;  2XQA A;  5FXX A;  4J34 A;  4Z26 A;  4YJ3 E;  4JI4 T;  3RQW A;  2IIU A;  5JDG A;  1JRY A;  5A1L A;  1D4M 4;  5AQT B;  1JNR A;  4YTN A;  2FJE A;  3NZQ A;  1Y64 B;  2WQY A;  3GYX A;  4HFB A;  1GRH A;  3AYJ A;  4KUM B;  4C5O A;  1N32 T;  3B5M A;  3ZSS A;  3OTO T;  2YQU A;  3HA4 A;  1D4C A;  2VRM A;  1KK7 A;  1Y56 B;  1CJ3 A;  1N4W A;  4FK1 A;  2M6I A;  3ETU A;  4OHF A;  2YDR A;  1FJG T;  4A98 A;  3KFW X;  5CQF A;  4NZH A;  2Q9Q B;  4G2A A;  1NHP A;  1ZOV A;  2WES A;  3SOL A;  2IVE A;  2LSJ A;  1FOH A;  4GYR A;  2JB2 A;  2V5Z A;  4Z44 A;  1O95 A;  3AED A;  2C5J A;  3GWH A;  4CN6 A;  2ZM0 A;  4HFH A;  1U4Q A;  1S3E A;  1J5W A;  3X1D A;  5BMV E;  3J9X 1;  4U2Z A;  1OJA A;  2YKS A;  3OJA A;  2ZZ0 A;  3DK9 A;  2V6O A;  5GON E;  2EQ8 A;  1ZHC A;  4Z43 A;  1PXC A;  2WAU A;  4MAL A;  5KDM C;  3CPI G;  4Q4W 4;  1IBM T;  4N78 D;  3RH3 A;  1YW0 A;  1CJC A;  4AP3 A;  4B67 A;  1D0Y A;  5LJM A;  2ARD A;  2XM1 A;  2BAC A;  4KX6 A;  1IJH A;  5AQQ B;  2X9H A;  1EL9 A;  3CML A;  3ANW B;  5AQV B;  4F6R C;  2X9W A;  4CI2 B;  2NPX A;  2OA1 A;  1ZKE A;  2K3W A;  3NK1 X;  2VAS A;  5ABF A;  1IUX A;  3HKC E;  3Q9D A;  4UXN B;  1LKX A;  3DJB A;  4ZI2 C;  2VKH A;  2E4G A;  3JBG 4;  1NWM X;  4EQS A;  5KOX A;  5ETW A;  4HA6 A;  2CXL A;  3VRB A;  1BWC A;  4BUR A;  2RGH A;  3QSE A;  3PU3 A;  1LTX R;  2R0P A;  5JCM A;  2WDQ A;  5EZY E;  3CPZ A;  4EQR A;  3M3Z B;  4P09 A;  2EQ6 A;  4LFC T;  3QSM A;  2PYL A;  3NLC A;  3CGC A;  2IC9 A;  4TWD A;  5FVK A;  1PBD A;  5FS9 A;  3IC9 A;  3H37 A;  3ICR A;  2A2F X;  4UVA B;  5FNV E;  3ZCI A;  3QC9 A;  5ADX L;  4Y4N A;  2YK0 A;  4BK2 A;  4IV9 A;  4CRT A;  3CNP A;  4YTP A;  5L3F B;  3LZX A;  3UP5 A;  3IWA A;  3ZEF B;  3P50 A;  2RS5 4;  3TLS A;  4H4R A;  3A8Y C;  1F6M A;  4IVM B;  2WOI A;  4Z91 A;  5BR8 T;  4H9Q C;  4ILU A;  4BJZ A;  2BCG G;  3LBX B;  4YWO A;  3ONJ A;  1FEW A;  1IUU A;  1CC4 A;  3QFB A;  4Z90 A;  4H4Q A;  4DV1 T;  1GRB A;  2DI4 A;  3UKA A;  1WR0 A;  1Z6L A;  5FY0 A;  2NR4 A;  3KVE A;  2RMU 4;  2V26 A;  3DJD A;  2XFQ A;  3NVO A;  4PAB A;  3CK6 A;  2YVJ A;  2XVI A;  2Q9Q D;  2XDO A;  2L3L A;  3SQP A;  3SGL A;  1M6I A;  2YG4 A;  4NTC A;  4NTE A;  1HG2 A;  2XQ7 A;  2RP4 A;  2VVM A;  5BRT A;  1AJ3 A;  4TZ4 C;  1DOB A;  4I0U A;  1BGJ A;  4C77 A;  3ONX A;  3UQ7 A;  3RYI E;  4U31 A;  2WBL A;  3VU7 H;  1MMA A;  2CWY A;  3IF8 B;  3RIA A;  1NAA A;  1X31 B;  4UR9 A;  4I55 E;  1PBC A;  3N9L A;  3AE7 A;  4AXP A;  1EAH 4;  3SUC A;  2WZH A;  3SZF A;  4KI0 F;  5AQU B;  2C76 A;  2Y48 B;  3RGL A;  4KHP T;  2YWL A;  5ER0 A;  1Z0P A;  2YN6 A;  3PUY F;  2UZZ A;  4QWN B;  2AE9 A;  2X3N A;  5EK2 A;  4I43 B;  3RP7 A;  3GMI A;  4ILB A;  1BR1 A;  4UF0 A;  5F3J A;  2WOW A;  2Q9Q C;  5KMQ A;  2TMD A;  4DR1 T;  4Z25 A;  2LSY A;  2WU2 A;  4PK5 A;  1TRB A;  5LV9 A;  3FMW A;  4D03 A;  4X20 E;  3H3A A;  3S4U A;  2RA1 A;  1MMD A;  4J36 A;  2X68 A;  3PUW F;  4Q4V 4;  4JBW F;  4H4U A;  5JDH A;  3N2G E;  2BKO A;  5EB5 A;  4TV9 E;  1E1H B;  4IHJ E;  4LA1 A;  1XI1 A;  2L8K A;  3G06 A;  1L9C A;  1HRI 4;  2WCA A;  1FMW A;  2WDR A;  4JI1 T;  2C70 A;  3UOV A;  3GYI A;  4X9N A;  3T8O A;  4H4P A;  4Y4L A;  4LF6 T;  3F57 A;  5C8Y E;  3VR8 A;  4B64 A;  1H7X A;  2WP9 A;  1UKV G;  2V7J A;  4TWF A;  5J60 A;  3N2O A;  4AQF A;  2C66 A;  4G73 A;  5JCL A;  4YY3 T;  5F8P A;  2ACX A;  5HEG A;  3UU3 A;  4BJM A;  4JEU B;  3UUN A;  2BAB A;  2WM9 A;  3JCF A;  2X8G A;  3KPF A;  3L8R A;  3UTK A;  4COF A;  3CGB A;  3Q6J A;  3ZC0 A;  4L9I A;  4H9R C;  2YG3 A;  1VRB A;  1QLB A;  3T31 A;  4P0A A;  2VZ2 A;  3B3R A;  4EMI A;  1I94 T;  4IDO A;  4WBO A;  4NEV A;  3OPC A;  5U25 A;  1MMN A;  3RP6 A;  4K7Z A;  3F8R A;  1ELI A;  4OX9 T;  1BF3 A;  3AEA A;  4WNK A;  2XHE B;  1IJ6 A;  1TDE A;  3ZYX A;  4C91 A;  3PUG A;  2XAJ B;  5FXZ A;  1W0B A;  2GQF A;  3P4R A;  3DA1 A;  4CXX A;  1LVF A;  4QHO A;  3KVB A;  5FY7 A;  5C2T A;  5JDN A;  4UDQ A;  2PW9 A;  4AQG A;  1XMQ T;  1Z7S 4;  2B7S A;  2PFV A;  2LLY A;  1KF6 A;  3VHL A;  5HY5 A;  2XYO A;  2UXX B;  5HWX A;  5TAO A;  3AEG A;  2B9W A;  4USR A;  2QA1 A;  4ANJ A;  1MO9 A;  3I0Q A;  4YKG A;  3NZP A;  3AAI A;  4PK4 A;  5HXC A;  4J2C A;  2I6H A;  2RGJ A;  4KP3 C;  2J62 A;  4M52 A;  1GTH A;  3DME A;  2V61 A;  4PW8 A;  1J1J A;  4I4T E;  4QKN A;  1N4U A;  1COY A;  2KLQ A;  3IA3 A;  4IRE A;  1D1C A;  2Y6R A;  3ZJ2 A;  4G6H A;  4B6X A;  1RP0 A;  2NW8 A;  2Z5X A;  1FL2 A;  2CBI A;  4USQ A;  5AQI B;  4C3Y A;  2BK5 A;  3FG2 P;  1SA0 E;  2VL8 A;  1L9D A;  5KRQ A;  2VQ7 A;  3HKB E;  4JI3 T;  1JEH A;  5M0Z A;  1D1B A;  3WI3 A;  2V7M A;  3DK8 A;  2D0U A;  2V1D B;  3PV0 F;  2OLN A;  1RYI A;  4H4W A;  4FJO A;  1OED C;  1W9R A;  2HN2 A;  4U74 A;  3V5U A;  2BXS A;  2GMH A;  3UUL A;  4H63 H;  1KNZ A;  3PU8 A;  3M0O A;  4ADZ A;  2NWB A;  4HTE A;  3VR9 A;  5HYA A;  2BG9 B;  4GAP A;  1W4X A;  2VOU A;  1CUN A;  1FIO A;  4DR5 T;  3W15 B;  2CDU A;  4G63 A;  3FPZ A;  3V3O A;  4TV8 E;  3NRN A;  3ZMZ B;  4EIQ A;  3QSS A;  4REK A;  2Y6X A;  3DJE A;  3VQR A;  3KV4 A;  2CFY A;  5M4Y A;  4ZHQ E;  3T2K A;  3JAD A;  3UU5 A;  5JVD E;  2F4V T;  3ICT A;  3KU9 A;  4NPP A;  2H7O A;  3AXJ A;  5IHY A;  3UU6 A;  4EYY R;  1FEC A;  4ECH A;  3ZPO A;  3ESL A;  2BKP A;  2E5V A;  5HCJ A;  2GEW A;  3AD8 B;  1D0X A;  2JQQ A;  1FMV A;  2AXD S;  2XFN A;  2WPC A;  3RX6 A;  3T2Z A;  4X1I E;  5AQP B;  2XY8 B;  1IBL T;  1TYT A;  2C72 A;  3NNE A;  1WLX A;  3BNU A;  3ONL C;  2N2N A;  4JI6 T;  3NKS A;  5L4H A;  2X8H A;  2Q0K A;  3Q5X A;  4JQ9 A;  3SX6 A;  3OZ2 A;  2GAG B;  3QUJ A;  4Q4Y 4;  3EI0 A;  3FBL A;  1ZK7 A;  2QYW A;  4PJL A;  2X0H A;  3GA8 A;  4FI5 A;  2YIN A;  2J4G A;  4X1Y E;  4QX8 B;  1QJD A;  5FMN A;  1KSU A;  2V3A A;  1WYC A;  4QH4 A;  2JQ9 A;  3RRW A;  1P2H A;  4FK1 C;  4H2P A;  2CCQ A;  5LGT B;  1E1K A;  4UF0 B;  1F8W A;  3MK7 C;  2FUP A;  4OK0 A;  1FEA A;  2CM0 A;  1VBC 4;  5H6Q B;  3ISH A;  2YU1 A;  4U8M A;  4DSH A;  4WX1 A;  3T37 A;  3AAA B;  4ILA A;  3BNM A;  4TUY E;  2BK4 A;  2YLR A;  4U2T A;  1W0A A;  5HYM A;  2E5L T;  3EUH A;  2QAE A;  2YVG A;  2HH7 A;  1VRQ B;  2NW9 A;  3AYL A;  2B7R A;  3KD9 A;  4CXY A;  4BK1 A;  1CBO A;  2I59 A;  1US7 B;  5DBJ A;  3AE8 A;  2AR8 A;  2O9Z A;  4OPG A;  1VOM A;  3PUZ F;  5F5W A;  1NG3 A;  1OED E;  3ZT7 A;  3FZF B;  3NWI A;  1JU2 A;  1X79 A;  2D5U A;  1VQW A;  5JR9 A;  3SWH A;  3RP8 A;  4ZI3 D;  3T1Y T;  4DSG A;  5L47 A;  5FL0 A;  4H2N A;  4H2Q A;  4X64 T;  2NVK X;  2E1M A;  1VDC A;  4O8S A;  3KDS E;  3BHF A;  2XQ3 A;  1CHU A;  2XQ8 A;  5HEO A;  5LOV E;  3H3M A;  3UOX A;  4O4J E;  4EQX A;  2OAL A;  4XZC A;  2P9B A;  3QB5 A;  5FKY A;  3RYF E;  1SUM B;  4IA6 A;  3AE2 A;  3KKJ A;  2B9Y A;  1ZV4 X;  1WCR A;  3Q5D A;  3DJJ A;  3PUX F;  4K0U A;  4YSX A;  4ZZC A;  4H7U A;  1RUF 4;  3FI7 A;  2MYS A;  3CX8 B;  3C4A A;  1VCT A;  1SE7 A;  5ABG A;  2ZM6 T;  2BVL A;  3HKE E;  4AI6 A;  1K5M D;  4CNK A;  2MPK A;  1ZP0 A;  1E39 A;  3RC8 A;  1PBE A;  4RG3 A;  3KVA A;  5GRT A;  2C5I T;  2LHN A;  3PVC A;  5FMH A;  3NN6 X;  5HWY A;  2CHO A;  2EHO A;  3HL6 A;  1YXR A;  2V7L A;  3L1R A;  1NCQ D;  4HKA A;  2LHR A;  4J56 A;  4TM4 A;  3AA7 B;  2R4E A;  3R84 B;  2EQ9 A;  3SZ0 A;  2NOX A;  2BG9 C;  4X9M A;  1RUH 4;  2VQF T;  3SFD A;  2F5Z A;  4NWZ A;  4JDR A;  3GMC A;  2XSA A;  3NBX X;  4YLH A;  2ODV A;  4HWC A;  3IF9 A;  2LSI A;  3P1W A;  5BUL A;  1ASJ 4;  1HXS 4;  3GWD A;  1YKE B;  3P4P A;  4TLX A;  5LBQ B;  2WZI A;  4PJM A;  3GWF A;  1S35 A;  4UVC B;  2W0H A;  2XLP A;  2CBJ A;  5J0Z A;  1PVC 4;  1D0Z A;  1HYU A;  1AOG A;  1PN0 A;  5KMR A;  3ITJ A;  2KZ7 B;  5LHG B;  2NTY A;  4PAA A;  3RHA A;  2W00 A;  4AOS A;  2E9X B;  2WU5 A;  3RQU A;  2L9Q A;  1B8S A;  3G5R A;  2XVF A;  4PFO A;  3NHO X;  4CN1 A;  2HN1 A;  3JAE A;  4X65 T;  3QVR A;  2VWA A;  2RAB A;  4K22 A;  4U8I A;  4DR3 T;  2I0Z A;  2X67 A;  3GSI A;  2PZS A;  3PJA A;  5CFB A;  1KNP A;  3BI5 A;  2LOP A;  4NXM T;  1LQT A;  1BZL A;  3CPJ G;  3T0K A;  1COV 4;  4JV5 T;  4JNA A;  4AT0 A;  5J2T E;  1AR8 4;  4HEA A;  4B65 A;  2YR4 A;  4DV4 T;  4LF5 T;  2YR6 A;  4U2Y A;  5KX5 E;  3JD7 4;  2N1G A;  2B1E A;  3C96 A;  3UTH A;  2ZZB A;  4ZXL A;  1E6E A;  5CGM A;  1LVL A;  3URH A;  4ZI2 D;  2CLY B;  4BV6 A;  4CI1 B;  5FS7 A;  1T8B A;  3DJG X;  4ZOL E;  4DND A;  4Q4X 4;  5LGN B;  1K0I A;  2R9Z A;  2JMH A;  3HI2 A;  3Q9T A;  4NTD A;  4G9K A;  2V3B A;  2PHH A;  3KPK A;  3FIM B;  4ZN0 A;  4JN9 A;  4ZS3 A;  1VG9 A;  4U8O A;  5LCY A;  3CX6 B;  2R0C A;  2C3C A;  1AR6 4;  3B13 A;  3Q2M A;  3VRA A;  2W66 A;  2X5I D;  2Y6Q A;  4JI7 T;  4AQF C;  1MIW A;  2G0U A;  3QNU A;  2BG9 E;  2AAQ A;  3GDN A;  2PYJ A;  5EB4 A;  5AQL B;  1HFA A;  1O94 A;  3LZW A;  4DR6 T;  4AIU A;  3CN8 A;  4ZCC A;  2YOE A;  2NTX A;  2IHR 1;  2LT3 A;  4GR1 A;  4GUV A;  2QGS A;  2UU9 T;  3VRD B;  2HWC 4;  4EAH A;  5JDQ A;  2OAM A;  1B7T A;  1OJC A;  3GD4 A;  1YKJ A;  3FZL B;  3E0Z A;  1HF8 A;  1WYB A;  3EAM A;  4O5Q A;  4OPC A;  3ZYL A;  4JNQ A;  2V5D A;  1Z8U A;  4IGU A;  4HFV A;  3BQI A;  4EGW A;  4EXT A;  3NG7 X;  3P4S A;  1OOP D;  1N34 T;  1MND A;  4OPL A;  4HE8 A;  1QUU A;  2E9X D;  4U7Y A;  2EQ7 A;  2RPA A;  4O4L E;  3TLU A;  3N5L A;  2JQK A;  1QO8 A;  2KT9 A;  3ALJ A;  3RIF A;  2E8I A;  4DR2 T;  1PJ6 A;  2HPJ A;  1CJ2 A;  1LV0 A;  5JR9 B;  4CY6 A;  4DMV A;  2VUR A;  3JC6 C;  3ALM A;  1MIY A;  2YLX A;  4O5U A;  3OKQ A;  2JMK A;  4X62 T;  4EIW A;  3ZMV B;  3AEB A;  4LFA T;  4WCT A;  2V6Y A;  3IBP A;  2XAH B;  4U3C A;  4TM0 A;  4U8K A;  2XVH A;  2C3D A;  2XFU A;  3UU8 A;  4UV9 B;  4UIG A;  2ZM8 A;  2UXD T;  3PS9 A;  2E9X C;  4RHV 4;  3G5S A;  1QSD A;  2ZM2 A;  4B3R T;  1E1N A;  4OPU A;  3D0T A;  1BKW A;  4CNJ A;  1JNZ A;  2X9X A;  1OED B;  1POV 0;  3UOY A;  1XNR T;  1P2E A;  5JCN A;  4ZS2 A;  4IDN A;  4HN9 A;  4K2X A;  3C98 B;  3PTR B;  2H7V C;  1VBE 4;  2GB0 A;  2XFP A;  2FBW A;  3T1H T;  2XJ7 A;  2QCU A;  3L8K A;  2K5B B;  4NUU A;  2YU2 A;  5L4E A;  2RS3 4;  3AA1 B;  3WAK A;  2WP6 A;  3PUA A;  3OYX A;  1H83 A;  1S2Q A;  4MJW A;  4IDZ A;  4DUY T;  4CCQ A;  2YM2 A;  3L3P A;  2H89 A;  3LJC A;  3QOF A;  5LJN A;  2JPF A;  3LFM A;  4P9S A;  4TM3 A;  2H3R A;  4XWR A;  1PXB A;  2LM9 A;  2CLY C;  2GH5 A;  2UUA T;  5LP6 E;  5KVH A;  2CEA A;  1IUW A;  2WPF A;  1AR7 4;  2CHN A;  2TPR A;  3FXE B;  2BC0 A;  2Z6E A;  1FCD A;  1PXA A;  4CI3 B;  2JIW A;  2LSG A;  3NYC A;  4A6N B;  3K7T A;  3V5S A;  4MBQ A;  5AQN B;  2XAS B;  2QA7 A;  3TLV A;  1MMG A;  4ERR A;  4OYJ A;  3E08 A;  2K24 A;  3LK4 2;  3RLF F;  1GT8 A;  3MXZ A;  2VKJ A;  3CQX C;  3ZYK A;  2CRB A;  1UX4 A;  1PBF A;  4EOZ B;  1H7W A;  4DNA A;  4EM4 A;  3QFA A;  3SYI A;  4EEB A;  1ZDL A;  1DOD A;  4FX9 A;  4ZCD A;  4WYV A;  4X66 T;  3SXI A;  3ZDN A;  3AVR A;  2BRY A;  3AYI A;  1NA1 D;  4A5L A;  2YVF A;  4IDQ A;  3NK2 X;  2H88 A;  2HPL A;  1EL8 A;  2BXR A;  4DMW A;  4H9P C;  5AQS B;  4HGA A;  3AA0 B;  2GV8 A;  1PJ7 A;  4JY2 A;  3RYH E;  3PDY A;  1VG0 A;  5AQH B;  4X5T A;  3CTY A;  3R9U A;  1Q1R A;  1HG5 A;  4TM1 A;  1H8T D;  2LM2 A;  4B66 A;  3O1J A;  4U2L A;  3ZYM A;  4LU6 A;  4A9W A;  2DL1 A;  1B5Q A;  3VKG A;  1IJ5 A;  3OBV E;  3EDU A;  3WE0 A;  3GN5 A;  3IHM A;  1RVF 4;  4K5R A;  5H6R B;  4YSH A;  4YHH T;  3NT6 A;  5L3G B;  1S2Y A;  3P9U A;  5JR9 C;  1XHX A;  3NH3 X;  3N2K E;  1HR0 T;  5CA0 E;  3SZC A;  4JYA T;  2DHR A;  3HR0 A;  1R09 4;  2IUB A;  1FEB A;  2R0G A;  2XLS A;  5KMS A;  3RI5 A;  3K30 A;  3HYX A;  2UUB T;  1XNQ T;  1K0L A;  1CC6 A;  1ZY8 A;  2XAQ B;  3OVU A;  4DID B;  2JBV A;  5ABF B;  4GRT A;  2W67 A;  2X51 A;  1AL2 4;  3RC3 A;  3G5Q A;  2CMR A;  4PJJ A;  4Y4M A;  2QRX A;  3AB3 B;  4V1A v;  2ZMA A;  2Z5Y A;  3T14 A;  3KV5 A;  2D0T A;  2BBJ A;  2LE8 A;  4O2B E;  3T2Y A;  1HX8 A;  2A3D A;  2W4X A;  1REO A;  5KNL A;  4IE4 A;  4B63 A;  2KWH A;  3C4Z A;  4ADW A;  4JEH B;  2XQ5 A;  3J7Y q;  4IE5 A;  3LJP A;  1U5P A;  5CJ5 A;  3B6D A;  2PTF A;  4CBQ A;  1UX5 A;  1UUS A;  3UU4 A;  4TNV A;  3ATR A;  4IL9 A;  4PNI A;  3S5W A;  1DNC A;  1YQ3 A;  4TNW A;  4AKI A;  3RRC A;  1BR4 A;  1RUG 4;  1YQ4 A;  4QXH B;  2MOZ A;  1H86 A;  4DO0 A;  4NXN T;  3I9Y A;  5AQJ B;  4LF9 T;  2JKC A;  4GF7 A;  3IHR A;  5J1G A;  5FY1 A;  3UUB A;  3JSK A;  1PO1 4;  1Y56 A;  1EL5 A;  3GQK A;  2XAG B;  1R08 4;  4YHJ A;  1Y0P A;  2BVM A;  4GK0 E;  2LKG A;  2CE7 A;  2Q9Q A;  3H4K A;  4QX7 B;  1E7P A;  1T7S A;  4YTM A;  4BAY B;  1Q9I A;  4A65 A;  3ZMS B;  1RHI 4;  4WBN E;  1GXF A;  1GPE A;  1DXL A;  2GF3 A;  4Q25 A;  2WSS V;  3NYE A;  4J2W A;  4H2R A;  2AQJ A;  3PUS A;  4HWI B;  5FP3 A;  5BUK A;  2HQM A;  1M64 A;  3CMM A;  4H4Y A;  2XUE A;  3UKP A;  4FDC B;  4XAX B;  3K3N A;  2Q7V A;  3AAE B;  4C90 A;  5IPY A;  1PO2 4;  2C67 A;  2RR1 4;  1VBD 4;  2RM2 4;  1G73 A;  1L0V A;  4EZH A;  3D1C A;  3MZK B;  1MNE A;  4H50 A;  3I0O A;  4LMK A;  2W63 A;  4J31 A;  3ANW A;  5JTG A;  3C64 A;  2BKN A;  1CL0 A;  1V59 A;  4HFI A;  1WRD A;  4QXB B;  4GDE A;  3LSV A;  3P8C D;  3GMB A;  3LOV A;  4DV2 T;  1MXT A;  1MQT D;  3CQC B;  1RUD 4;  4Z2U A;  2V5C A;  3RIU A;  3AE6 A;  3M13 A;  5JDL A;  2CVJ A;  1PS9 A;  4EM3 A;  2BDE A;  2XLU A;  1D5T A;  3GRS A;  3L39 A;  3NKZ A;  4QH5 A;  4B3T T;  3PUR A;  3LB8 A;  2V60 A;  1UK5 A;  2ODU A;  4Z8X A;  4A99 A;  1ONF A;  4MHC A;  4L5G A;  2XTL A;  1LQU A;  1TDO A;  3TKL B;  4GB3 4;  1IZN B;  3UFG A;  2XFO A;  2JB3 A;  3PUV F;  1CJ4 A;  2B76 A;  3PO7 A;  5BVA A;  3BQL A;  2XQY A;  3H8I A;  5LA6 E;  5LG4 A;  5JH7 E;  1RUC 4;  1NPX A;  3ZN0 B;  4E7Z A;  1DJQ A;  2V7I A;  5AQR B;  2BS3 A;  2LSK A;  2IC6 A;  3AEC A;  4HWD A;  3RF1 A;  2J1D G;  4GOU A;  2PJQ A;  2WPE A;  1ZMC A;  5JQG E;  1IBK T;  4IT4 A;  3GQH A;  2DKH A;  2Q0L A;  5HCM A;  2X9Y A;  1XDO A;  3GYJ A;  1G8X A;  4H9S E;  3ABV A;  4DR7 T;  5DQW A;  2WP5 A;  1F8R A;  3NGC X;  2A8X A;  3EVY A;  1YQZ A;  3F31 A;  2DCF A;  3O4X E;  1HX1 B;  2BS2 A;  3AE4 A;  2BBH A;  2VRL A;  4PAG A;  4A56 A;  3WAJ A;  1UUR A;  1D4E A;  1NDA A;  1SEZ A;  4N9X A;  2PG8 A;  1H82 A;  4GCM A;  5FXV A;  4HFC A;  3A5X A;  2IAK A;  4H4T A;  2I0M A;  3GN5 B;  3COX A;  1GRG A;  4B1B A;  2VQE T;  2QA2 A;  3AE9 A;  3CWZ B;  3F8D A;  2IML A;  2A87 A;  4MFR A;  3M12 A;  2WS3 A;  4IDP A;  4EED A;  2R7F A;  3DGH A;  5L3E B;  5CB4 E;  1DOC A;  4GDP A;  1EZ3 A;  1H84 A;  1GTE A;  4NUV A;  2GQW A;  3UOZ A;  2LRK A;  4P1N A;  2NP9 A;  1GRT A;  2YLW A;  5AQM B;  2YLS A;  4EMW A;  4G74 A;  5JRC A;  3F8P A;  3UKQ A;  4JI2 T;  3CQG B;  4IST A;  3ADA B;  3DTO A;  4DBQ A;  5U1O A;  1R8I A;  1GND A;  3KV6 A;  2VVL A;  3H8L A;  3LK2 B;  4AKG A;  5LHH B;  4C74 A;  2LEH A;  3C50 A;  1D7Y A;  3UUX B;  4PJN A;  5M10 A;  2W61 A;  2KND A;  1DOE A;  1B37 A;  1LRZ A;  2GAH B;  1GRE A;  5LNK A;  4YJ2 E;  2K9A A;  5L3D B;  2JQH A;  1HCI A;  2FJA A;  1S3B A;  2VQB A;  3AEF A;  2BCP A;  1L9E A;  5IWA T;  3RNM A;  5LG3 A;  2OA5 A;  2APG A;  4ILC A;  5LBM A;  4PFP A;  2KXP B;  1UCU A;  2CXF A;  3JAF A;  5IYZ E;  1GET A;  3EAO A;  4IA5 A;  4CZZ B;  3RED A;  4C3X A;  3CX7 B;  4XWZ A;  4AKR B;  4EQW A;  2GR2 A;  3AB1 A;  2WMO A;  4KBM B;  5IUX A;  3UP4 A;  4OYK A;  4IE0 A;  1LVK A;  2CXD A;  1Y01 A;  1IUV A;  3SFE A; 
#chains in the Genus database with same CATH homology
 2FJD A;  1JOA A;  2X8C A;  4DGK A;  4I59 A;  2GB0 A;  1K0J A;  1Q1W A;  2BK5 A;  4C3Y A;  2XFP A;  3FG2 P;  2FBW A;  1L9D A;  1ZKQ A;  2C64 A;  1ZOY A;  2QCU A;  5KRQ A;  2VQ7 A;  3L8K A;  5TR3 A;  2ZBW A;  5KOW A;  1JEH A;  2WP6 A;  3QJ4 A;  5M0Z A;  2B9X A;  3V3N A;  5EOW A;  1H83 A;  2BRA A;  2YM1 A;  1S2Q A;  4MJW A;  4CCQ A;  2WBA A;  2YM2 A;  4II3 A;  2H89 A;  3DK8 A;  4HB9 A;  3SM8 A;  2OLN A;  4P9S A;  4TM3 A;  1RYI A;  2Q6U A;  4H4W A;  4XWR A;  1PXB A;  2GH5 A;  2YG6 A;  5KVI A;  3DK4 A;  2YLZ A;  2C4C A;  1B4V A;  5KMP A;  4NNJ A;  3SY4 A;  1YY5 A;  3EPT A;  2BXS A;  2GMH A;  4ICY A;  5KVH A;  1GRA A;  1IUT A;  2BYB A;  1IUW A;  2WPF A;  2TPR A;  3M0O A;  2BC0 A;  3CNT A;  1FCD A;  1PXA A;  3VR9 A;  2PYX A;  4U8N A;  3E1T A;  1NHQ A;  3IHG A;  3HYV A;  4GAP A;  3NYC A;  4A6N B;  3K7T A;  3NYF A;  1F8S A;  1W4X A;  2JB1 A;  1CC2 A;  1XPQ A;  2VOU A;  2WEU A;  3HZL A;  1TDF A;  2CDU A;  2GR1 A;  3FPZ A;  3V3O A;  1IUS A;  1GES A;  3NRN A;  4EIQ A;  3QSS A;  1JRZ A;  4REK A;  1K4Q A;  1TDK A;  3DJE A;  5HXI A;  1ZX9 A;  2CFY A;  3VQR A;  2BS4 A;  1GT8 A;  3T2K A;  4NEW A;  5U63 A;  3CND A;  3ICT A;  3KU9 A;  1FEC A;  4ECH A;  5EBK A;  1PBF A;  1PBB A;  2E5V A;  2GEW A;  4OPI A;  3AD8 B;  1MOK A;  1PHH A;  1H7W A;  5IQ1 A;  4DNA A;  2WHD A;  1F3P A;  1N4V A;  3QFA A;  4EM4 A;  4Z2R A;  2XFN A;  3SYI A;  2WPC A;  4EMJ A;  5C3J A;  4U2S A;  4JY3 A;  4KPR A;  3T2Z A;  3EAN A;  1LPF A;  1ZDL A;  3GRT A;  4YKF A;  1DOD A;  4FX9 A;  1NHS A;  5L46 A;  2C72 A;  1TYT A;  2BA9 A;  2YG5 A;  3NNE A;  4YXD A;  4ZCD A;  3SXI A;  3ZDN A;  2YG7 A;  4AP1 A;  3P4Q A;  2BRY A;  3AYI A;  3BNU A;  4A5L A;  2YVF A;  3QVP A;  3NKS A;  1O5W A;  2X8H A;  3NK2 X;  2H88 A;  2BXR A;  1EL8 A;  2Q0K A;  3O0H A;  4JQ9 A;  3SX6 A;  2YR5 A;  3OZ2 A;  2GAG B;  4XXG A;  1NEK A;  3UCL A;  4CCR A;  2R46 A;  4I58 A;  4J33 A;  3V76 A;  1E1M A;  4APN A;  4OCG A;  3AD7 B;  1ZK7 A;  2GV8 A;  1PJ7 A;  3CGE A;  4JY2 A;  1NEN A;  2OLO A;  3K7M X;  1JRX A;  2X99 A;  1KSS A;  1VG0 A;  3CTY A;  3R9U A;  1Q1R A;  4A6N A;  4TM1 A;  4IVO B;  4J34 A;  4YSZ A;  4Z26 A;  1QJD A;  3D8X A;  4AT2 A;  1KSU A;  1LJ1 A;  1PDH A;  4B66 A;  2V3A A;  4U2L A;  4II2 A;  4LU6 A;  4YSY A;  4A9W A;  1P2H A;  1JRY A;  2XVJ A;  1B5Q A;  4FK1 C;  3ICS A;  4H2P A;  4CY8 A;  1JNR A;  4YTN A;  1E1K A;  1F8W A;  2FJE A;  3WE0 A;  3IHM A;  1H81 A;  4K5R A;  4YSH A;  2WQY A;  4H4Z A;  3GYX A;  1FEA A;  1GRH A;  3ISH A;  3AYJ A;  4U8M A;  3NT6 A;  1S2Y A;  4DSH A;  4C5O A;  3P9U A;  4WX1 A;  3T37 A;  3FBS A;  3NH3 X;  3BNM A;  2YQU A;  2WOV A;  2BK4 A;  2YLR A;  4U2T A;  2YAU A;  5HYM A;  3SZC A;  2QAE A;  2YVG A;  1VRQ B;  3AYL A;  1D4C A;  1FEB A;  1PJ5 A;  2B7R A;  2R0G A;  2XLS A;  3KD9 A;  5KMS A;  2VRM A;  3K30 A;  4BK1 A;  3HYX A;  1ZY8 A;  1K0L A;  1CC6 A;  1CBO A;  1CJ3 A;  1Y56 B;  3HYW A;  1N4W A;  5DBJ A;  3AE8 A;  2AR8 A;  2O9Z A;  2JBV A;  2JAE A;  4FK1 A;  4OPG A;  4GRT A;  1D4D A;  3G5Q A;  1NG3 A;  5CQF A;  3LAD A;  4NZH A;  1NHP A;  1ZOV A;  2WES A;  1JU2 A;  1VQW A;  2IVE A;  4Y4M A;  3RP8 A;  1FOH A;  2Z5Y A;  3T14 A;  4D04 A;  2JB2 A;  2ACZ A;  2V5Z A;  4DSG A;  4Z44 A;  3T2Y A;  4H2N A;  3DH9 A;  1O95 A;  2LFC A;  3AED A;  3S61 A;  4H2Q A;  2NVK X;  2E1M A;  1TYP A;  1VDC A;  1REO A;  3BHF A;  5KNL A;  1CHU A;  2C73 A;  4B63 A;  4ADW A;  5KWF A;  1S3E A;  3K7Q X;  3UOX A;  1OJA A;  4EQX A;  2OAL A;  2ZZ0 A;  3DK9 A;  3LJP A;  4H4V A;  3B6D A;  4CBQ A;  2V6O A;  4G6G A;  2EQ8 A;  4IA6 A;  3ATR A;  3AE2 A;  3KKJ A;  3NTD A;  2B9Y A;  1PXC A;  4Z43 A;  5J7X A;  3LXD A;  4UDP A;  3CPI G;  3S5W A;  3DJJ A;  4H4X A;  1DNC A;  2IVD A;  4YSX A;  1YQ3 A;  3GDP A;  4H7U A;  4BK3 A;  2A89 A;  1CJC A;  4AP3 A;  4B67 A;  1YQ4 A;  2WDV A;  2ARD A;  3C4A A;  2BAC A;  3II4 A;  4KX6 A;  1H86 A;  3OC4 A;  1IJH A;  4OPT A;  3AE5 A;  4GAV A;  1EL9 A;  1BGN A;  3NIX A;  2JKC A;  2ZZC A;  4GF7 A;  1E39 A;  1ZP0 A;  2VVL G;  3JSK A;  4CNK A;  1PBE A;  1Y56 A;  4RG3 A;  1EL5 A;  2NPX A;  2OA1 A;  4K8D A;  3GQK A;  5GRT A;  3NK1 X;  1Y0P A;  3PVC A;  5FMH A;  3NN6 X;  4Z24 A;  1IUX A;  3L1R A;  2E4G A;  4EQS A;  3H4K A;  5KOX A;  4HA6 A;  1BWC A;  3VRB A;  4J56 A;  4TM4 A;  1GV4 A;  2R4E A;  4BUR A;  2RGH A;  1E7P A;  2CUL A;  4YTM A;  1Q9I A;  2EQ9 A;  3QSE A;  4A65 A;  1LTX R;  2R0P A;  3SZ0 A;  5JCM A;  2WDQ A;  4EQR A;  4X9M A;  4E0V A;  4X4J A;  3SFD A;  2EQ6 A;  2F5Z A;  1GXF A;  1GPE A;  4NWZ A;  3QSM A;  4JDR A;  1DXL A;  3NLC A;  2GF3 A;  3GMC A;  3CGC A;  1PBD A;  3NYE A;  5FS9 A;  4J2W A;  3IC9 A;  4H2R A;  4A79 A;  2AQJ A;  3ICR A;  3IF9 A;  3P1W A;  4B68 A;  5BUL A;  5BUK A;  2HQM A;  1NHR A;  1M64 A;  3P4P A;  3CMM A;  3GWD A;  4TLX A;  3GWF A;  4Y4N A;  4H4Y A;  3AWI A;  3UKP A;  2W0H A;  2XLP A;  4BK2 A;  4IV9 A;  4FDC B;  4CRT A;  3CNP A;  4YTP A;  3LZX A;  3UP5 A;  2Q7V A;  1GSN A;  3IWA A;  2RGO A;  3NN0 X;  1HYU A;  3GD3 A;  1AOG A;  2XLT A;  4H4R A;  1PN0 A;  1F6M A;  4IVM B;  3ITJ A;  2WOI A;  5KMR A;  1D7L A;  3UKF A;  5IPY A;  2C67 A;  4BJZ A;  2BCG G;  4PAA A;  3RHA A;  3CGD A;  4YWO A;  3UKL A;  3CNJ A;  3D1C A;  1L0V A;  1IUU A;  1CC4 A;  3QFB A;  4H4S A;  4H50 A;  4AOS A;  4J31 A;  1CF3 A;  1DJN A;  4H4Q A;  2WU5 A;  1B8S A;  1CL0 A;  2XVF A;  3G5R A;  1V59 A;  1GRB A;  4GDE A;  3UKA A;  3KLJ A;  1GOS A;  3GMB A;  3EF6 A;  3NHO X;  3LOV A;  3SZW A;  3QVR A;  1Z6L A;  3CIR A;  1MXT A;  2R4J A;  1NG4 A;  2RAB A;  4K22 A;  4U8I A;  2I0Z A;  3GSI A;  3KVE A;  4Z2U A;  5GSN A;  3BI4 A;  4A7A A;  5KXJ A;  3DJD A;  3I3L A;  3AE6 A;  2XFQ A;  3M13 A;  3AEE A;  4PAB A;  1KNP A;  2YVJ A;  2XVI A;  3BI5 A;  2CVJ A;  1LQT A;  1PS9 A;  2XDO A;  1BZL A;  3CPJ G;  3NTA A;  4EM3 A;  2BK3 A;  2XLU A;  3SQP A;  1D5T A;  3SGL A;  3GRS A;  1M6I A;  2YG4 A;  4NTC A;  4NTE A;  3T0K A;  1GAL A;  4JNA A;  4AT0 A;  1GER A;  3LB8 A;  2V60 A;  2VVM A;  3DGZ A;  5BRT A;  1GRF A;  1DOB A;  4A99 A;  2XCG A;  4B65 A;  1BGJ A;  1ONF A;  4C77 A;  2YR4 A;  1KNR A;  2YR6 A;  1LQU A;  1TDO A;  2FJB A;  1NAA A;  1OJT A;  1X31 B;  3C96 A;  5FS6 A;  2ZZB A;  3UTH A;  1PBC A;  1E6E A;  2JB3 A;  2XFO A;  3AE7 A;  1LVL A;  1CJ4 A;  3URH A;  2B76 A;  3PO7 A;  5BVA A;  3SUC A;  3SZF A;  4BV6 A;  2C65 A;  5FS7 A;  2C76 A;  3DJG X;  3H8I A;  2WET A;  2YWL A;  5ER0 A;  1K0I A;  2R9Z A;  3Q9T A;  1NPX A;  4NTD A;  5HHF A;  1DJQ A;  2UZZ A;  2X3N A;  4G9K A;  3RP7 A;  2BS3 A;  2V3B A;  4K5S A;  2PHH A;  3KPK A;  3FIM B;  4ZN0 A;  4JN9 A;  4OPD A;  2GR0 A;  3AEC A;  1H6V A;  2WOW A;  1VG9 A;  4U8O A;  2WPE A;  5KMQ A;  2TMD A;  1ZMC A;  4LII A;  4Z25 A;  2WU2 A;  1TRB A;  2R0C A;  2C3C A;  5LV9 A;  3FMW A;  4D03 A;  2C75 A;  3GQH A;  4J57 A;  4RG4 A;  2DKH A;  2Q0L A;  3VRA A;  2IID A;  4J36 A;  2Y6Q A;  3GYJ A;  1XAN A;  3ABV A;  3CPH G;  2WP5 A;  3UTG A;  4Z2T A;  5JCK A;  4H4U A;  2AAQ A;  5EB5 A;  1TDN A;  1F8R A;  3GDN A;  5EB4 A;  1XHC A;  3NGC X;  4LA1 A;  1O94 A;  2A8X A;  3LZW A;  1YQZ A;  3CN8 A;  1L9C A;  4ZCC A;  2WDR A;  2C70 A;  3UOV A;  3GYI A;  2BS2 A;  1GEU A;  3AD9 B;  4X9N A;  3AE4 A;  4H4P A;  4Y4L A;  2GVC A;  2VRL A;  4B69 A;  1SEZ A;  4GR1 A;  1D4E A;  4GUV A;  3VRD B;  1NDA A;  2C7G A;  4N9X A;  2OAM A;  1OJC A;  3VR8 A;  1H82 A;  4GCM A;  3GD4 A;  4B64 A;  1H7X A;  1YKJ A;  2WP9 A;  1UKV G;  5J60 A;  4USQ A;  2C66 A;  4H4T A;  4G73 A;  4O5Q A;  5JCL A;  4OPC A;  4U8P A;  4JNQ A;  3COX A;  4TLZ A;  1GRG A;  4RSL A;  4UDR A;  2QA2 A;  4B1B A;  3AE9 A;  2GR3 A;  4OVI A;  2BAB A;  3F8D A;  3NG7 X;  1ZMD A;  1RSG A;  2A87 A;  2X8G A;  3P4S A;  3KPF A;  3M12 A;  5JCI A;  3CGB A;  3Q6J A;  2WS3 A;  4OPL A;  2YG3 A;  3DGH A;  2DKI A;  2EQ7 A;  3BHK A;  1DOC A;  1QLB A;  3UTE A;  3T31 A;  4GDP A;  1EL7 A;  1H84 A;  1GTE A;  2GQW A;  2VZ2 A;  3B3R A;  3UOZ A;  4EMI A;  4UP3 A;  2YLW A;  1GRT A;  2BC1 A;  3AXB A;  1QO8 A;  3NK0 X;  2YLS A;  4NEV A;  5U25 A;  4EMW A;  1XDI A;  4G74 A;  3RP6 A;  3ALJ A;  3F8P A;  3UKQ A;  4K7Z A;  3ADA B;  3F8R A;  1KFY A;  1ELI A;  1PJ6 A;  5U1O A;  4AOX A;  3AE3 A;  3AEA A;  1BF3 A;  1CJ2 A;  1LV0 A;  2GMJ A;  1TDE A;  2JK6 A;  2R45 A;  4CY6 A;  1GND A;  2VVL A;  3H8L A;  5FS8 A;  3ZYX A;  1KDG A;  2XLR A;  4U8J A;  3CNS A;  4C74 A;  2GQF A;  1D7Y A;  1EBD A;  1OJD A;  3ALM A;  2YLX A;  4O5U A;  5M10 A;  3P4R A;  2YLT A;  3DA1 A;  3AEB A;  3BI2 A;  5C2T A;  1DOE A;  1B37 A;  2GAH B;  4UDQ A;  2GRT A;  4WCT A;  1GRE A;  3I6D A;  4TM0 A;  4U8K A;  2XVH A;  4BJY A;  2C3D A;  2XFU A;  3UKK A;  4YT0 A;  2B7S A;  3ALL A;  1KF6 A;  5HY5 A;  1S3B A;  2FJA A;  2XYO A;  2VQB A;  1OJ9 A;  3KA7 A;  3G5S A;  3PS9 A;  2XVE A;  3AEF A;  2BCP A;  1L9E A;  3AEG A;  3AE1 A;  2B9W A;  4USR A;  3RNM A;  3ATQ A;  2QA1 A;  3UKH A;  2APG A;  1MO9 A;  4EIP A;  4YKG A;  2X50 A;  1E1N A;  2RGJ A;  3EAO A;  1GET A;  4IA5 A;  4M52 A;  4OPU A;  1GTH A;  3DME A;  3RED A;  2V61 A;  4U8L A;  1BKW A;  4C3X A;  4CNJ A;  2J3N A;  1N4U A;  1COY A;  3C4N A;  4XWZ A;  1JNZ A;  4EQW A;  2GR2 A;  3AB1 A;  2Y6R A;  3UTF A;  4G6H A;  1E1L A;  1RP0 A;  3UOY A;  5IQ4 A;  5CKU A;  2Z5X A;  1N1P A;  1P2E A;  3UP4 A;  5JCN A;  1FL2 A;  4K2X A;  1IUV A;  3SFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...