3VR9A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 199
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr9A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr9A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr9A04
3UKLA 4YTPA 3GD4A 3AEAA 2VRMA 2C66A 5GRTA 3UOZA 3NKSA 4NEWA 1O95A 1PBCA 1FEAA 4CRTA 4EQWA 3GDPA 2VQBA 1ZOVA 2BCGG 3DK9A 4YSXA 1GTHA 3UOVA 4A65A 4KX6A 4B63A 1L0VA 1FECA 1S3EA 1GESA 3CNSA 1PJ5A 1OJ9A 4U2TA 5U25A 3RP7A 4IVOB 4H4RA 3V3NA 2OA1A 3AE6A 1DOEA 3GQKA 3RP6A 4TM0A 3UCLA 4B66A 3DK4A 4Z24A 1TYTA 1D5TA 1E1KA 2CDUA 4B64A 3IF9A 3DA1A 5BULA 3VRAA 3IHMA 2Z5XA 2NPXA 3AEDA 4MJWA 1Y56B 3K30A 3GMCA 3ATRA 2PHHA 4JN9A 2YG6A 2YG4A 5FS6A 4B65A 2ACZA 4J31A 1K0IA 4I58A 5KWFA 4BV6A 2EQ8A 3G5RA 4PAAA 3URHA 1B37A 4C74A 4DNAA 1XANA 1KNRA 5KVIA 4JY3A 1B5QA 3NN0X 2LFCA 3UKHA 4NTCA 2YVFA 4OPUA 2IIDA 3GYJA 1TDNA 1L9EA 2WOIA 4IV9A 4IA6A 2JBVA 3EPTA 2GR2A 1ZP0A 3SFEA 3NRNA 2WS3A 1PBEA 2YM1A 3GRSA 2BABA 1F8WA 3QSMA 4ZCDA 4B1BA 2WQYA 3BI5A 5J60A 4I59A 2J3NA 3AXBA 2GF3A 4GCMA 1KFYA 2WPCA 4C3XA 3M12A 4PABA 3VRBA 5IQ4A 3AE5A 3AEEA 2R4EA 3B6DA 3GD3A 3UKQA 3QVRA 4H4ZA 1CL0A 2XFQA 1B4VA 1H82A 3AYLA 4A6NA 2YLRA 3ABVA 1GNDA 3UKAA 5KOXA 2R0GA 1P2EA 2IVEA 2YR5A 1N4WA 1D4DA 4H4XA 2E1MA 4Z26A 4U8NA 3V3OA 1BZLA 1D7LA 3ICRA 3UTHA 1RP0A 1S3BA 2YLSA 3I6DA 4O5QA 2GB0A 2XVEA 3CNDA 1OJDA 4CCQA 3ICSA 3KLJA 2YVJA 4RG4A 3ZDNA 1GEUA 5ER0A 3E1TA 4TLZA 5KRQA 1GRBA 2QA2A 1N4VA 4EQXA 2BC0A 4YTNA 3NYEA 4X9MA 2GR0A 2R46A 4EM4A 4H50A 1K4QA 2BC1A 5JCIA 3CNPA 4JY2A 3LJPA 2XFPA 1XHCA 4YKGA 2FJDA 4YTMA 1S2QA 5M0ZA 4AT2A 4N9XA 5J7XA 4J33A 1ZDLA 2XLSA 4LA1A 3UKFA 4ZN0A 3BI4A 3KA7A 4WCTA 2XFUA 2X50A 2GQWA 4UDQA 4C5OA 1NG4A 1IUTA 3AEGA 4ECHA 4OPLA 1D4CA 4ICYA 2WEUA 1V59A 2X3NA 2ZZ0A 4J36A 5FS9A 4H4WA 2Y6QA 4U8MA 4UDPA 4FDCB 4B67A 4BJYA 1VRQB 4OPCA 3ALMA 2VZ2A 1TRBA 1GETA 2YLXA 2GR1A 3UP5A 1O94A 4H2PA 3NGCX 4U8PA 2CULA 4J34A 1F8RA 4K2XA 2GH5A 2JAEA 2BCPA 2OALA 3ATQA 1CJ4A 3G5QA 2GMJA 2YAUA 4TM1A 2C64A 1PXBA 3FPZA 1EL7A 3D1CA 5L46A 3M0OA 2R9ZA 4CY6A 2B7SA 2B76A 4H4VA 1GXFA 1NAAA 1VG0A 1HYUA 2BS3A 2V6OA 3AD8B 2WPFA 3VR9A 1CC2A 3QSEA 3QFAA 5EOWA 1CBOA 3G5SA 3AE3A 1Q1WA 1FCDA 4USRA 1ZK7A 3GWFA 5FMHA 4KPRA 5CQFA 2JKCA 2C70A 2X99A 5CKUA 3H8LA 2BACA 4EIQA 3P4SA 2AAQA 4U2LA 3KPFA 4EM3A 1CJ2A 3BNMA 4A99A 4TLXA 1XDIA 1FOHA 4YXDA 3L1RA 3NHOX 3UKKA 4EMIA 3IC9A 3NYCA 2XYOA 3AD7B 3AYIA 4GR1A 4U8OA 4EIPA 5JCMA 2XLPA 3FG2P 5FS7A 2BA9A 2BS2A 1S2YA 1CHUA 2WU5A 2WOWA 4P9SA 3NK0X 4DSGA 1EBDA 4FK1C 4RG3A 3Q9TA 2QCUA 3B3RA 4NEVA 3OZ2A 3QJ4A 3SUCA 3C96A 1E1MA 4EMWA 2QAEA 2WBAA 3P9UA 4H4UA 4YKFA 1CJCA 3K7MX 2V3AA 1CC6A 5EB5A 1W4XA 3COXA 1H86A 2OLNA 3AE9A 3F8DA 5KOWA 4A7AA 4AT0A 3NG7X 4YSHA 3AE7A 2E4GA 2W0HA 2O9ZA 5M10A 2Q0KA 2GRTA 2GV8A 3K7TA 3KD9A 4H4TA 3LADA 3GSIA 1PBFA 1PDHA 3QFBA 2APGA 3RNMA 1UKVG 1GRAA 3JSKA 1KF6A 3F8RA 1ELIA 2B9WA 3DGHA 1ZMDA 2H89A 3VQRA 4Y4LA 2A87A 4Z2RA 1LJ1A 1NEKA 1QJDA 4WX1A 2VQ7A 3BI2A 1RSGA 2C7GA 2GMHA 3BHKA 5C2TA 4D03A 1F8SA 3AEFA 3OC4A 4APNA 3NK2X 5JCKA 3P4RA 1TDOA 3LB8A 1KDGA 1TDEA 4XWRA 2CVJA 2BK3A 2BS4A 1Y56A 1XPQA 1CJ3A 2ZBWA 4YSZA 3CPHG 4AOXA 3BHFA 3DMEA 4EQSA 1QLBA 1PJ7A 4BK1A 3EANA 4UDRA 1OJAA 3AECA 4B68A 4ADWA 3GYXA 4CNKA 4YWOA 1GPEA 1DODA 1X31B 2YR6A 3S61A 1IJHA 3QSSA 4Z43A 1OJCA 4FK1A 5GSNA 1PN0A 2CFYA 4K7ZA 5BRTA 3EF6A 2C72A 2WDQA 1DJNA 2EQ6A 2GR3A 2XFOA 3ALJA 1YQZA 5KXJA 1L9CA 2R4JA 4HB9A 1N4UA 3ISHA 3LOVA 1PHHA 2BXSA 2UZZA 3KKJA 1AOGA 4H2QA 1PS9A 1LV0A 1GTEA 2B7RA 3SFDA 4REKA 3DH9A 2OAMA 1ZY8A 3AB1A 2RGJA 1PJ6A 4USQA 2XLUA 4BK2A 4EQRA 3UKPA 1E39A 2JB1A 3HZLA 3ZYXA 2FJBA 4AOSA 4CY8A 1VG9A 2XFNA 1KSUA 2JB2A 3NN6X 1ZOYA 1YY5A 4U8LA 4GDPA 5KVHA 4Z25A 1CC4A 2YG3A 3GRTA 2E5VA 4U8JA 2ZZCA 4OPIA 4GUVA 4CBQA 1BKWA 3ALLA 4OPTA 1JNZA 2I0ZA 2H88A 1FEBA 2VOUA 3DGZA 1IUXA 4JNAA 3DJJA 1ZKQA 2RGHA 2YLZA 4LIIA 1PBBA 1LQUA 4Z44A 5HXIA 4AP3A 4DSHA 5LV9A 2Q0LA 4H4YA 2GVCA 1GRHA 2WESA 2WDRA 3NH3X 4H4PA 4J57A 2DKHA 3UOXA 1H81A 3CPIG 1ZX9A 1NDAA 3P4QA 3NLCA 4FX9A 1GRFA 4GDEA 1GSNA 2C65A 2NVKX 3NYFA 1NHQA 1LQTA 1YKJA 3CGEA 3AE2A 4JDRA 1IUWA 3NTAA 3CGDA 2VRLA 4K5RA 4ZCCA 1LVLA 1OJTA 3LZWA 1TDKA 2YWLA 4CNJA 1JOAA 3GMBA 1Q9IA 2Q6UA 3CGCA 1RYIA 2XVJA 1PBDA 3KU9A 3I3LA 1H7WA 1H7XA 3IHGA 4TM4A 3C4NA 2EQ7A 4IA5A 1GERA 1D4EA 2YR4A 3CTYA 2XDOA 3CGBA 5U63A 1GV4A 2FBWA 2ARDA 2WDVA 1NG3A 2C3DA 3V76A 3GQHA 3VRDB 3NT6A 1JU2A 1O5WA 4YT0A 1D7YA 1GALA 5U1OA 5BUKA 3H4KA 1E1LA 1EL5A 1FL2A 3DJEA 3DK8A 4HA6A 2FJAA 4A9WA 2BK4A 3PS9A 3M13A 3NNEA 2R0PA 3FIMB 2V3BA 4O5UA 3L8KA 3WE0A 3CIRA 1F6MA 2GEWA 3UOYA 3REDA 1F3PA 2Y6RA 2C73A 4XXGA 4H7UA 3QVPA 1E7PA 5TR3A 1N1PA 1NHRA 2DKIA 2XVIA 4B69A 1E1NA 4U8IA 2YG7A 2GAHB 1MO9A 4DGKA 4D04A 1DOBA 4OPGA 4Y4MA 3SQPA 3DJGX 1BGNA 1IUVA 2AQJA 4A6NB 3AD9B 2YG5A 1L9DA 2A89A 2C75A 3NTDA 1JRZA 4BJZA 1TDFA 3AE1A 1PXCA 2WP6A 3PO7A 1BWCA 3UTEA 4XWZA 4JQ9A 2YQUA 1GOSA 2R0CA 2GAGB 3H8IA 1KSSA 4A79A 4H4SA 3RHAA 1MOKA 3II4A 4U8KA 1P2HA 4CCRA 1ONFA 3SM8A 3LXDA 1IUUA 3ITJA 5FS8A 4AP1A 4RSLA 1K0LA 3GWDA 1IUSA 1NPXA 4OCGA 4OPDA 4Z2UA 1QO8A 2JB3A 1KNPA 2Q7VA 4NZHA 4C77A 3P4PA 4Z2TA 2YM2A 5JCLA 1BGJA 1H6VA 3K7QX 1B8SA 2BYBA 3NK1X 3AE8A 1LPFA 3O0HA 2A8XA 2VVMA 4H2RA 1SEZA 2EQ9A 2WOVA 2X8CA 4J56A 3KVEA 4TM3A 1REOA 3BNUA 2R45A 1CF3A 4GRTA 5HYMA 5HY5A 2X8GA 3FBSA 2IVDA 3R9UA 3GDNA 1DJQA 4A5LA 5IPYA 3AYJA 3UTGA 1DXLA 1NENA 5C3JA 1MXTA 1YQ4A 4EMJA 3EAOA 4C3YA 3LZXA 1YQ3A 2WU2A 1GT8A 4NTDA 2FJEA 3CPJG 2YLWA 1DOCA 1GREA 1E6EA 1M6IA 2B9XA 2WPEA 1EL8A 2TPRA 2XLTA 2YLTA 2BK5A 1JEHA 1JRYA 3ADAB 2VVLG 2V60A 3CNTA 2PYXA 3SGLA 2GQFA 2HQMA 1JRXA 2TMDA 2ZZBA 1VDCA 3C4AA 3UTFA 1ZMCA 1LTXR 3NIXA 3D8XA 2B9YA 3T37A 1BF3A 4E0VA 4Y4NA 4UP3A 4IVMB 5EB4A 3P1WA 1NHSA 3AE4A 1H83A 1Y0PA 2Z5YA 3Q6JA 2BXRA 3IWAA 5BVAA 3S5WA 1GRGA 3PVCA 2AR8A 1PXAA 1K0JA 5DBJA 4YSYA 5EBKA 5JCNA 5HHFA 4H4QA 2QA1A 4K5SA 4J2WA 3RP8A 1NHPA 3F8PA 2F5ZA 4OVIA 1DNCA 2YVGA 2V61A 4JNQA 2OLOA 2WP5A 1Z6LA 3CN8A 4H2NA 4K22A 4X9NA 1VQWA 2C3CA 2C67A 3VR8A 2JK6A 3DJDA 2WHDA 3ICTA 1M64A 5IQ1A 4X4JA 3FMWA 1Q1RA 2WETA 4U2SA 1GRTA 4NTEA 4BURA 2XVFA 2XCGA 2WP9A 1TYPA 3UP4A 3AEBA 1EL9A 4K8DA 2VVLA 4GF7A 3CNJA 2V5ZA 1COYA 2RGOA 1JNRA 2XLRA 2XVHA 4LU6A 2RABA 2C76A 2X8HA 3AWIA 4BK3A 4M52A 1H84A 3GYIA
chains in the Genus database with same CATH superfamily
3UKLA 4YTPA 4QXHB 2KWHA 2VRMA 3I0OA 3UFEA 3UOZA 3DP7A 4NEWA 1PBCA 3ONLC 5HEUA 3NBXX 1ZOVA 3DK9A 3UOVA 4KX6A 1VCSA 1GESA 3CNSA 5U25A 1IBKT 1E1HB 3RP6A 4NIQA 4DVDA 4TWDA 4Z24A 2UXXB 2VKJA 3IBPA 2CDUA 4EYUA 3VRAA 2HHHT 2UUAT 1MMAA 5HYAA 2UUCT 1WR6A 5FXXA 2PHHA 4JN9A 2LOPA 2YG4A 5FS6A 3LK42 3AVSA 3PUVF 1PIV4 4PAAA 3N5LA 1OEDC 4C74A 4DNAA 2E8IA 1KNRA 2WSSV 5KVIA 2BG9A 4P0AA 1Z8UA 4LF4T 4NTCA 4HWDA 3LDQB 2JBVA 5LP6E 1ZP0A 3SFEA 4LF7T 1UX5A 3BI5A 5J60A 4C90A 3ANWA 3K1SA 3K3OA 1KFYA 2WPCA 2R7FA 3AEEA 3UKQA 2C0SA 1CL0A 1T98A 2K5BB 4NPPA 4HWHA 4NXMT 1B4VA 5IHYA 1OOPD 5LHHB 3Q5WA 2YLRA 1GNDA 1YXRA 4L0RA 5H6QB 3NWIA 5JH7E 1D4DA 3OYXA 4Z26A 3V3OA 1D7LA 5AQKB 3ICRA 3UTHA 1S3BA 2YLSA 5AQLB 2XVEA 3CNDA 2L3LA 3ZDNA 5FKYA 5KRQA 2YEVC 4PJJA 3PUSA 2X9WA 2BC0A 1OEDA 1UURA 3O1HA 4JBWF 4H50A 3RKGA 3CNPA 2K3WA 3LJPA 3ZEFB 4COFA 5FXVA 2XFPA 4YTMA 4AQFC 3AA1B 3DTOA 1XNQT 5L3DB 2XFUA 5TAOA 3FZFB 1MQTD 3HA4A 2CBIA 3KDSE 4JI5T 4UDQA 1VBC4 1IUTA 4ECHA 2WEUA 1V59A 5LA6E 2X3NA 5FS9A 4I55E 2KZ7B 1ZV4X 4B67A 4DNDA 1TRBA 2GR1A 4H2PA 4K2XA 2JAEA 2Q9QB 2OALA 3JC6C 3ATQA 2DHRA 2GMJA 2DNXA 2YAUA 2C64A 1G8XA 3PU8A 3KFWX 1EL7A 4CY6A 2B76A 3GN5B 5FVLA 1IAPA 1HYUA 3AD8B 2UXCT 2XQAA 2WPFA 5EOWA 4QH4A 4IDNA 2NOXA 4USRA 3N2OA 5AQTB 5LGTB 3JC6D 1ZK7A 4IDPA 3SY4A 3H8LA 4TZ4C 4EIQA 2AAQA 1XDIA 4DMVA 4YXDA 2J1DG 1XMOT 3UKKA 3NYCA 4G9KA 1S2YA 3L39A 2WOWA 2XSAA 4QH1A 2Y8DA 3N2KE 1X9BA 2VQET 5GONE 3QJ4A 5IUXA 4X62T 2WBAA 4G6GA 3EDUA 4YKFA 2V7IA 2DLRA 1CC6A 3H37A 4AT0A 3NG7X 3AE7A 2O9ZA 2Q0KA 3KD9A 3T2YA 2PFVA 2APGA 5CB4E 3RNMA 1UKVG 4JI2T 4K0UA 4JV5T 1ELIA 3VQRA 2XZEA 2LOSA 3N2GE 3VU7H 3CX7B 4X1KE 4G6HA 2VQ7A 3BI2A 2V6YA 5JTGA 1RSGA 2C7GA 1F8SA 4APNA 3QNUA 5LHGB 4ZHQE 1KDGA 2LSIA 4XWRA 4UF0B 2BS4A 1Y56A 2WBLA 1US7B 2D9DA 3T2KA 3AA7B 4EQSA 4U7IA 4IE7A 5L3BB 3CPZA 3OJAA 4B68A 3GYXA 4IIJE 4YWOA 3QSSA 4EYYR 4BAYB 4HTEA 2GR3A 3F31A 3UU6A 2WZIA 5F5WA 2BXSA 3HR0A 1AOGA 4Q4X4 1XDOA 3WI3A 2LJLA 3U3IA 4REKA 3ZYMA 3GMIA 4DV3T 2XLUA 1OWAA 3HKBE 1LVKA 2IW5B 4AOSA 5KMPA 2JB2A 1ZOYA 1VBA4 5KVHA 2E2AA 3PUZF 5ABFA 2E5VA 3A7MA 2V1DB 3ALLA 4IDQA 3P7IA 3LBXB 2RS54 1PBBA 5HXIA 5JDQA 4DSHA 4O2AE 5HEJA 4ZS2A 2Q0LA 2GVCA 3U78A 2DKHA 3UOXA 1H81A 1ZX9A 5LBMA 3P4QA 1NHQA 3CGEA 3NTAA 1R8IA 2XJ7A 5LB7B 4ZCCA 3S4UA 4H63H 3UQ4A 1JOAA 3CGCA 2Q6UA 2EHOB 4KHPT 1PBDA 3KU9A 4UR9A 2EQ7A 1D4EA 3C98B 2C3DA 4GKJT 4AKHA 1JU2A 2ZM8A 5AQUB 1RUI4 3M3ZB 3RH3A 3PS9A 4U31A 3M13A 3NNEA 3FIMB 4Q25A 4O5UA 3CIRA 5HCMA 4TNVA 2WWVA 1F3PA 1MIWA 4XXGA 3Q5XA 4PAGA 1AL24 3QVPA 2KSRA 2RPAA 5DJQC 5AQFB 2C5JA 4B69A 2K48A 2JMHA 1AJ3A 2LRLA 3SQPA 3DJGX 1IUVA 1ZHCA 4ISSA 4A6NB 4DR3T 2E9XB 2BKOA 3PO7A 1BWCA 1HRI4 2R0CA 3K3QC 3H8IA 4H4SA 1MOKA 4EV6A 4U8KA 3E22E 4FI5A 1P2HA 3EUHA 4CCRA 3LXDA 3AAAB 1U5PA 3ITJA 4O4IE 4Z2UA 1IUSA 2LKHA 1QO8A 3RRWA 4C77A 4Z2TA 2X51A 2YM2A 1MMDA 3H3AA 1BGJA 3K7QX 3UU3A 3AXJA 2BYBA 4EZHA 3O0HA 3AAIA 2X8CA 2WOVA 4YJ3E 3KVEA 3BNUA 5HYMA 1CF3A 3FBSA 2IVDA 1DJQA 4A5LA 3AYJA 4HFDA 4CZZB 1LKXA 3F2EA 5JQGE 4PJNA 2CA5A 4C3YA 4DV2T 2Y48B 4HWFA 2EX3A 4DBRA 4HE8A 5LJMA 2XQ4A 2FJEA 4UEMA 4NTDA 2YLWA 5CFBA 1DOCA 1GREA 2W4XA 2BBJA 1KEYA 2WPEA 2XLTA 3NRXA 4G73A 1JRYA 2I59A 3SGLA 5LHIB 4O4HE 4AKIA 4EZ4A 2LRKA 1JRXA 4TV9E 5IYZE 3C4AA 4X66T 4PK4A 3EHZA 5JRCA 3FXEB 3T37A 2X67A 4JI4T 3BQKA 3CQXC 3AE4A 1Y0PA 2BRAA 2BXRA 3R6NA 1RUG4 1GRGA 4ILBA 1K0JA 4F8HA 4K5SA 3RP8A 1AR74 4HWIB 2YINA 1COV4 4GOUA 4NWZA 2YVGA 2V61A 4DBQA 4H2NA 4X9NA 2C67A 3KV9A 2WHDA 3ESLA 2XQYA 4H9OC 4GIWA 3C51A 2CXFA 2WP9A 1TYPA 1EZ3A 4GAVA 3ZSSA 3WAJA 1JNRA 2QA7A 3TLVA 1I94T 4LU6A 3KV5A 2RABA 5JDGA 4BK3A 4M52A 5LGUB 1XHXA 3GD4A 1IZNB 2C66A 3ZPOA 3NKSA 1FEAA 1HG5A 4EQWA 5AQNB 4G63A 4ZI7E 1GTHA 4A65A 4B63A 1FIOA 1S3EA 4DV0T 3PU3A 2YU2A 4H4RA 4IVOB 2OA1A 3AE6A 3O4XE 1HNWT 4B66A 2BVMA 3HKCE 3AA0B 1OEDE 1TYTA 4ZXLA 1D5TA 3IF9A 3HYWA 3IHMA 2B1EA 2Z5XA 2NPXA 2R074 3RC8A 2VKDA 4LFCT 4IL4A 4OK0A 5JVDE 2CXDA 1K0IA 4I58A 4BV6A 2EQ8A 4BJNA 3URHA 4EXTA 2BKNA 3SZFA 1XANA 3EVYA 3M65A 4JY3A 3NN0X 2NP9A 2YVFA 4OPUA 1RHI4 3GYJA 1TDNA 4IV9A 4IA6A 3EPTA 1GQEA 2A2FX 2GR2A 4B3TT 1PBEA 1SE7A 2BDEA 2LLYA 4P1NA 4YHHT 3VKGA 1IBLT 5AQJB 3NRYA 4I59A 2GF3A 4GCMA 1W0BA 2XQ8A 4C3XA 1AR64 4H9SE 1UGOA 1HF8A 1ASJ4 3CWZB 5JDHA 2XFQA 1Z7S4 1MIYA 2L9QA 3UKAA 1Y64B 3P4WA 2IVEA 3H3MA 4JI1T 4H4XA 4WBOA 1RP0A 1HX8A 2JPFA 4PK5A 5AQSB 4IE0A 1GEUA 4ZOLE 2QA2A 4YTNA 4X9MA 2XQ6A 2PYLA 2CLYC 3PUYF 1K4QA 2BC1A 4ADZA 4JY2A 2RP4A 2R6GF 4YKGA 1XHCA 4N9XA 2A72A 4LA1A 1NAFA 2JQHA 3K8PC 2X50A 2ACXA 3Q9DA 5H6RB 2C5KT 4UV9B 2ZZ0A 4J36A 4II2A 2C4CA 2DCFA 4H4WA 5AQGB 2Y6QA 4H9RC 5LMNT 5JR9C 1VRQB 3CQGB 4OPCA 2IUBA 3ETVA 3NGCX 4U8PA 2QGSA 4J34A 2VB6A 2BCPA 4ERRA 1M62A 3FPZA 2K24A 4QWNB 4U3CA 2HN2A 3EABA 5LBQB 1NAAA 2BS3A 3QSEA 1H8TD 1CBOA 3G5SA 1EAH4 4Z90A 3FB2A 4V1Av 1HR0T 4HFCA 2JKCA 3KBTA 2BG9B 2KWIB 4EM3A 2ODUA 4TLXA 2GK9A 1FOHA 2Y6XA 4GR1A 3AD7B 5JCMA 2XY8B 2J47A 1FMVA 2R064 2BA9A 2BS2A 1CHUA 2WU5A 5KNLA 4FK1C 2PZSA 2QCUA 3B3RA 3C96A 2HPJA 5JR9A 4H4UA 2R044 2P9BA 1CJCA 3K7MX 4NUVA 4EEBA 3COXA 3F8DA 2CMRA 3BQIA 5KOWA 1XNRT 2HPLA 3NZQA 2E4GA 3K7TA 4ILUA 3T2ZA 3AA6B 1KF6A 2I6HA 2B9WA 2H89A 3T1HT 1QJDA 5C2TA 4HFIA 2X0YA 3ZCJA 2PJQA 2D0UA 1NCQD 1HNZT 4Q4V4 1TDOA 2HWC4 2CVJA 2BK3A 4EB6E 4LMKA 2I0MA 4BK1A 3ZJ2A 4O4JE 4ADWA 3PV0F 4CNKA 2W00A 1GPEA 3S61A 1IJHA 5ABEA 4FK1A 1PN0A 2CFYA 3O1JA 1N36T 5BRTA 2LM2A 2C72A 5CA0E 2XFOA 3SS1A 1N4UA 4IE5A 1BR1A 2CM0A 2J4GA 4O8SA 2JRKA 1PS9A 1LV0A 3NZPA 2C5IT 3UTKA 3DH9A 5KMGP 3AB1A 1D4M4 4EQRA 1VG9A 1KSUA 3NN6X 2VKHA 2M6BA 4GDPA 2Q9QC 2CXLA 5L47A 2YG3A 3FZKB 2X68A 3MACA 2E5LT 2V5CA 2ODVA 4N78D 3DGZA 5JDLA 1IUXA 3QOFA 1ZKQA 3B57A 2YLZA 3KV4A 4LIIA 1LQUA 3BQLA 4Z44A 4UV8B 5FMNA 4AP3A 2IDOB 4K0KT 1WLXA 2WESA 3NH3X 1MNDA 4U33A 2XM2A 2CBJA 3CPIG 4QX8B 1NDAA 4FX9A 3V5SA 4GDEA 3NYFA 2NVKX 2VRLA 3PTRB 4YHJA 4CNJA 4LFBT 1IJ6A 2IC6A 3PURA 2AXDS 3I3LA 3ONJA 1H7WA 3IHGA 2V8SV 1GERA 4UELA 4AQFA 3PUWF 5ABGA 5FL1A 4KHZF 2FBWA 4H9NC 2WDVA 3V76A 3GQHA 5HCJA 1ZEEA 2QVAA 1G73A 3VRDB 3P50A 2AE9A 4HKAA 1PVC4 1O5WA 2NW9A 3H4KA 1E1LA 3JAFA 3PUAA 1UK5A 1FL2A 3DJEA 3DK8A 1H7CA 4KP3C 2X9HA 3JAEA 3A8YC 2GEWA 2Y6RA 1BR4A 2C73A 2Q9QA 2X0HA 3N9PA 3CMMA 5J2UE 1XHZA 4DGKA 4H63V 4AIUA 1AR84 1DOBA 3GN5A 1BGNA 1N33T 4CI1B 2A89A 1TDFA 2RM24 3AE1A 3J7Yq 1FEWA 3C64A 3UTEA 4JQ9A 2YQUA 4UVBB 1KSSA 3RHAA 4CI3B 3SZCA 4PW8A 1IUUA 5FS8A 4MLKA 4OCGA 1J5ET 5JCLA 4G74A 5LNKA 1XMQT 3NK1X 3Q5DA 3D0TA 2A8XA 2VVMA 4H2RA 3QC9A 4KUMB 3VKHA 4TM3A 2R45A 2X8GA 2W62A 4I43B 3HI2A 5LMUT 4GKKT 4TN7B 1NENA 4O4LE 5JDMA 2LEHA 3RGLA 1U4QA 3EAOA 5J0ZA 1YQ3A 4B3ST 5L3FB 3ZYKA 5ABFB 4P0BA 2YLTA 5L3GB 3W15B 2VVLG 5HXHA 2RMU4 1WYBA 3E08A 3N9NA 2TMDA 1VDCA 3UTFA 1XZYA 2IC9A 1BR0A 3NIXA 2B9YA 4UP3A 2HWB4 4GYSA 5EB4A 3RPUA 3P1WA 1NHSA 3MJXA 2W66A 2MBGA 3Q6JA 5BVAA 2NTYA 4HWCA 4XBFB 1PXAA 5DBJA 4ZEYA 4H4QA 2QA1A 2XPKA 4AI6A 5F8PA 3I1AA 3UQ7A 4OVIA 3WAKA 4JNQA 2ZLYA 3CN8A 5LG4A 1VQWA 4X5TA 2C3CA 3VR8A 2JK6A 2V7LA 2JJ9A 1M64A 2CRBA 2N1GA 3KVBA 3P8CD 2EHOC 3ZYLA 1D0YA 4BURA 2WCAA 4X64T 1EL9A 4PK6A 5AQRB 3PDYA 4P09A 3CNJA 4NNJA 2X9YA 2ZMAA 2XLRA 4CI2B 2X8HA 3SWHA 3JADA 5DQVA 3FZMB 3TLTA 3GYIA 4AQYT 5L2LA 2EHOD 3AEAA 5GRTA 4EGWA 4TUYE 3ZCIA 4C91A 3GDPA 1RUD4 2BCGG 4YSXA 5BR8T 2Z6EA 1L0VA 1FECA 4U2TA 1PJ5A 2H7VC 3N9OA 2M6IA 1DOEA 3LBXA 3GQKA 2JQ9A 2E9XC 3E0ZA 4H9PC 1E1KA 4B64A 3DA1A 4LFAT 4IE4A 3AEDA 1T7SA 3K30A 3ZT5A 4B65A 2ACZA 5AQIB 4OYKA 4TNWA 2EHOA 1B37A 3OYZA 5AQHB 2VL8A 4DUZT 2LFCA 1XI1A 3UKHA 3CX6B 5FVKA 2IIDA 1L9EA 4IE6A 3MZKB 4YLHA 2WS3A 2BABA 3FHNA 1F8WA 3QSMA 4PFPA 4ZCDA 4B1BA 4LMLA 3T14A 1HG2A 2J3NA 3JBG4 2CWOA 1D1AA 1K5MD 3M12A 4PABA 4KI0F 3AE5A 5FP3A 3B6DA 3GD3A 3QVRA 2VKOA 2KLQA 3O9XA 4H4ZA 1DU2A 3FI7A 3PJAA 5JRCB 5HEOA 4ILCA 4Q4Y4 2MTQA 3ZC1A 3C4ZA 2CHOA 3AYLA 4A6NA 3ABVA 4AXPA 2E9XA 2IHR1 4LF8T 3N9QA 2XTLA 2KXPB 5FXZA 3RYFE 2E1MA 4U8NA 1BZLA 5ADXL 5HEHA 3TKLB 5EK4A 2GB0A 4CCQA 3KLJA 5ER0A 4TLZA 1GRBA 1N4VA 4J2CA 2BRYA 4EQXA 5AQMB 4DV6T 3Q2MA 3GWHA 5L3CB 2R46A 4EM4A 4QHOA 3SX6A 2FJDA 4AT2A 5J7XA 1MMNA 4J33A 4ZN0A 3BI4A 3KA7A 2XQ9A 5CGMA 4DR2T 2GQWA 4C5OA 1NG4A 3AEGA 2PTFA 4ICYA 4IT4A 4YY3T 1N32T 3SXIA 1MIVA 4UXNB 3ZMZB 4U8MA 4UDPA 4FDCB 4FJOA 1GETA 2YLXA 3UP5A 3RLFF 3IA3A 2LSGA 4A98A 4ZI3C 1F8RA 3IHRA 2DI4A 3G5QA 3GA8A 4TM1A 1POV0 3ZC0A 3D1CA 2X0LB 5L46A 1XDPA 2B7SA 4H4VA 1GXFA 4NUUA 2V6OA 2KMFA 1CUNA 3VR9A 1HNXT 1CC2A 4ZI3D 3AE3A 1Q1WA 5HWXA 4I50E 1FCDA 5FMHA 5AQPB 4A5XA 2C70A 2X99A 1R094 3ZKRA 2BACA 4L5GA 3TLWA 3RYCE 5BULA 3NHOX 4EMIA 2JQKA 3AYIA 5FNVE 1HCIA 1QUUA 4P9SA 1XWMA 2CE7A 4JI7T 1HRV4 4RG3A 3X1DA 2XHEB 2KT9A 3SUCA 4NEVA 5EZYE 3OZ2A 2IMLA 3T1YT 1KK7A 5L3EB 2L8KA 3LJCA 2QAEA 5ABHA 4AQGA 2V3AA 2HN1A 1YD8G 1H86A 4A7AA 4HFEA 5ETWA 2W0HA 5M10A 2GRTA 2GV8A 4H4TA 1SA0E 1WCRA 1GRAA 5HXCA 3HYVA 3JSKA 4ZI2C 1HFAA 4GYRA 3F8RA 3DGHA 1ZMDA 4Y4LA 2A87A 5BMVE 1NEKA 4WX1A 1T72A 4Z91A 4XAXB 3BHKA 4D03A 3AEFA 3OC4A 4PNIA 3P4RA 5FYMA 4OFZA 2DL1A 1TDEA 2G0UA 4ZI2D 3G06A 1CJ3A 2ZBWA 3CPHG 3BHFA 2CHNA 3DMEA 1PJ7A 3LFMA 4E7SA 3OBVE 4UDRA 2PLV4 3ZN1B 4I0UA 1VRBA 4PJLA 1X31B 4Z43A 5GSNA 4K7ZA 2DWKA 2WDQA 2NW7A 1DJNA 3HYXA 3AAEB 2KINB 3EDVA 2EQ6A 5AQQB 5J1GA 3ALJA 1YQZA 4HB9A 4WBNE 1PHHA 3PUGA 2W2UA 4A56A 2XAGB 2NWBA 2OV9A 2B7RA 4DV7T 3SOLA 1ZY8A 3FBLA 2RGJA 4CXWA 4USQA 4BK2A 2BBHA 3J9X1 1E39A 4JUYA 2JB1A 3HZLA 3RF1A 1SUMB 3QUJA 4CY8A 1LVFA 2JQQA 2ES0A 4U8LA 1CC4A 1W09A 2BZBA 3Q5EA 3GRTA 2NW8A 2ZZCA 3IF8B 3RX6A 4JNAA 3C50A 5LV9A 4H4YA 1GRHA 2WDRA 4MHCA 4H4PA 2XUEA 3RHWA 1D0XA 2VASA 3PUXF 1GRFA 2X5ID 4WZXA 1GSNA 2C65A 3RIAA 3RC3A 1LQTA 1YKJA 3AE2A 3PE0A 1IUWA 2VURA 1OJTA 1TDKA 1MMGA 3ZLIA 1Q9IA 3GMBA 2XVJA 2V7KA 4GAPA 5KMRA 4IA5A 2MAWA 3UFGA 3C4WA 3CTYA 2XDOA 5U63A 1GV4A 1NG3A 4OX9T 2WMOA 3N9LA 2WMNA 2UXDT 3NT6A 5U1OA 4JEUB 2LSYA 5BUKA 4CN1A 4JI6T 4HA6A 4A9WA 2YU1A 1E2AA 4WNKA 2V3BA 4B3RT 3ANWB 5DABA 3UOYA 2NTXA 2RS14 4GB34 2DWGA 4AISA 4H7UA 2PG8A 1E7PA 5TR3A 4U8IA 3MXZA 2YG7A 2QRXA 4D04A 4OPGA 1I6ZA 5J2TE 4GK5E 2AQJA 2HH7A 3A5XA 2A9UA 3NTDA 4XWZA 1Y01A 2YN6A 2GAGB 3SRZA 3UU4A 4A79A 5KDMC 2LSKA 1ONFA 4DR4T 3HKDE 1J1JA 4AP1A 1K0LA 3GWDA 1S94A 1NPXA 4OPDA 2JB3A 1KNPA 1OEDB 3B5MA 5A1LA 1NA1D 1H6VA 2H3RA 1B8SA 2YOEA 2XAQB 3R84B 3AE8A 1LPFA 3UUNA 3NVOA 5L4HA 2LT3A 3SYIA 1SEZA 2EQ9A 4GRTA 4QH5A 3R9UA 3UU5A 5HY5A 3GDNA 5E0OA 5IPYA 3UTGA 5C3JA 3JD74 1IJ5A 5L4EA 2UU9T 1YQ4A 4EMJA 1VBE4 3LZXA 5LYJE 3LK2B 2XAFB 1GT8A 1UX4A 1E6EA 3N9MA 1M6IA 5LJNA 2PW9A 3AB3B 4B6XA 2WZHA 2CEAA 1JEHA 1OXZA 3CNTA 2D0TA 3UT5E 2PYXA 1W9RA 3UUBA 5CJ5A 2GQFA 2HQMA 3T8OA 1N34T 1YKEB 3CX8B 3RI5A 3D8XA 4E0VA 2MYSA 4IVMB 5KX5E 2Z5YA 4QKNA 3SZWA 3S5WA 3PVCA 2AR8A 3KBUA 5EBKA 5HHFA 2MOZA 1NHPA 3F8PA 1RUH4 2PY5A 2F5ZA 1DNCA 3L3PA 2ZM2A 1Z6LA 2WP5A 3CMLA 4K22A 2VWAA 3DJDA 2Q9QD 4JYAT 3ICTA 2YDQA 1EV14 4X4JA 5FL0A 4U2SA 4IHJE 1GRTA 3RYHE 5JREA 1VBD4 2XCGA 5KMQA 4HGAA 2F4VT 5JDNA 1IBMT 1COYA 4ZZCA 2RGOA 4PDWD 2N2NA 3AWIA 1H84A 2V7JA 1O95A 4ZZBA 4CRTA 3ZT7A 2LHNA 4DR1T 2VQBA 3RRCA 4M1PA 4TV8E 3ZMTB 4X1IE 1OJ9A 3RP7A 3V3NA 2M67A 5HWYA 4TM0A 3UCLA 2V6YB 2UXBT 2ZM0A 3DK4A 4ILAA 3B13A 3L8RA 3F57A 3FZLB 4JI8T 4MJWA 1BEV4 1Y56B 3GMCA 4OYJA 3ATRA 3FBZA 2YG6A 2BKPA 2N9DA 1BR2A 4JEHB 4J31A 3CKDA 5KWFA 1QSDA 3G5RA 4RHV4 1V9DA 1B5QA 3LG7A 3RIFA 3I9YA 1S35A 1HTJF 2VVNA 2WOIA 5HXSA 4ANJA 1T8BA 1FMWA 3NRNA 2YM1A 3GRSA 5EK3A 5LG3A 2WQYA 3AXBA 1YW0A 4PFOA 3OVUA 1AR94 2V6XA 3VRBA 5IQ4A 2R4EA 2BVLA 4II3A 1UCUA 1H82A 4DR7T 5KOXA 2R0GA 1P2EA 2YR5A 1KNZA 3HKEE 1N4WA 2W63A 3I6DA 4O5QA 2W61A 4HFHA 1OJDA 2IAKA 3ICSA 2VL0A 2YVJA 4RG4A 3ZN0B 5EK2A 3E1TA 4QXBB 3CVRA 3NYEA 2GR0A 5JCIA 4UF0A 4U74A 1D1BA 4LF6T 3OTOT 5M0ZA 1S2QA 5FY1A 3UUXB 3JCFA 1ZDLA 2XLSA 3UKFA 2XASB 4WCTA 4TWHA 3K3NA 1HX1B 4MBQA 2YK0A 4OPLA 1D4CA 4X20E 5FXWA 3T0KA 2WWUA 5F3JA 3KINB 4XZCA 4BJYA 3ALMA 2VZ2A 3ZJ1A 3NKZA 4LF5T 1O94A 2LM9A 2YKSA 4DR5T 2K9AA 2CULA 3KV6A 2GH5A 1CJ4A 2CCQA 4DV4T 1PXBA 2W67A 5AQVB 1O3XA 2FUPA 3M0OA 2R9ZA 5CA1E 2LKGA 2A3DA 1VG0A 5LCYA 4EOZB 3UU8A 4U2ZA 3QFAA 4DV1T 3RKOA 5LOVE 5LXTE 3GWFA 4KPRA 1R084 5CQFA 2WY2A 2OLTA 1RVF4 5CKUA 2VQFT 1HS7A 3P4SA 4U2LA 1B7TA 3LSVA 3KPFA 1CJ2A 1VOMA 2D2SA 3BNMA 3L1RA 3UULA 4A99A 2XAJB 3IC9A 2XYOA 4EIPA 4U8OA 4MFRA 2XLPA 3FG2P 3J8F4 5FS7A 4HFVA 1PO14 3AXJB 4NXNT 4HFBA 3NK0X 4DSGA 1EBDA 1RUJ4 3Q9TA 3RQUA 3RIUC 2E9XD 2LHRA 1E1MA 2RS34 2D5UA 4EMWA 3P9UA 4DR6T 3IEEA 3ZMVB 5EB5A 1W4XA 2OLNA 3AE9A 4WW0A 3VHLA 3KPKA 3AVRA 4H9QC 5AQOB 2KNDA 4YSHA 2XAHB 1VCTA 4KMCA 4F6RC 4HEAA 3LADA 3GSIA 1PBFA 4AKLA 4G2AA 4MALA 3V5UA 5AFUL 1PDHA 3QFBA 4IGUA 4OHFA 4GK0E 4AKRB 2X9XA 5HXEA 4Z2RA 1LJ1A 4O2BE 4X65T 4DV5T 3ONXA 2GMHA 2XQ7A 2YDSA 4U7YA 4CQIA 4IL9A 3NK2X 5JCKA 3HL6A 4CXYA 3LB8A 2OA5A 3QB5K 4ASKA 1XPQA 4YSZA 4AOXA 1RUF4 3UUMA 1QLBA 3EANA 5HAXA 2IIUA 2J62A 3AECA 4IREA 1OJAA 1DODA 2YR6A 1OJCA 3RIUA 1ZKEA 5FY7A 1HXS4 3CQCB 3O1IA 3EF6A 3RYIE 4EAHA 1Z0PA 5IWAT 3L09A 5KXJA 1L9CA 2R4JA 3ISHA 3LOVA 3I9WA 2UZZA 4CN6A 4YJ2E 3KKJA 4H2QA 3QB5A 1GTEA 1WFDA 3SFDA 3TLSA 2OAMA 1W0AA 1PJ6A 3UKPA 3ZYXA 2FJBA 4ZS3A 1J5WA 3PJAJ 2XFNA 4YFSA 3ZT6A 1YY5A 4Z25A 3DJBA 4U8JA 4OPIA 4CBQA 4GUVA 1BKWA 4KBMB 3LK3B 4OPTA 1JNZA 2I0ZA 2H88A 1FEBA 2VOUA 3DJJA 2RGHA 2BG9E 4UIGA 5DQWA 3BK9A 4TX5A 2PBIA 4J57A 4WYVA 5FY0A 1NWMX 3NLCA 3RQWA 2PYJA 4Z8XA 2W0GA 4JDRA 3CGDA 2CPTA 4K5RA 1LVLA 3LZWA 2YWLA 1RYIA 2XQ5A 4TM4A 4B3MT 1H7XA 2UXNB 3C4NA 5JDFA 4UVAB 2YR4A 3CGBA 4EEDA 2ARDA 2XSBA 4YT0A 1D7YA 1GALA 1EL5A 2V7MA 2FJAA 2BK4A 2WB5A 4U2YA 2R0PA 3T31A 3PUQA 5HEGA 3WE0A 3L8KA 1F6MA 3REDA 5HXRA 1N1PA 1NHRA 1SHZC 2DKIA 2XVIA 1E1NA 2NR4A 2GAHB 1MO9A 4JLEA 3ZSTA 2H7OA 4Y4MA 2XM1A 3SZ0A 2VVSA 3AD9B 2YG5A 1L9DA 2C75A 1JRZA 4BJZA 2JIWA 4U72A 1FJGT 1PXCA 2WP6A 4EIWA 1GOSA 1X79A 4DIDB 3ZMSB 5M4YA 3II4A 4QXCB 3SM8A 3I0QA 4RSLA 3QK6A 4IDOA 2Q7VA 4L9IA 4NZHA 3P4PA 3OKQA 2UUBT 2CWYA 4A97A 3EI0A 3OPCA 4JI0T 2SPCA 1D0ZA 1WYCA 4IDZA 1RMU4 3MKDA 4J56A 2XQ3A 2LE8A 1REOA 3FZHB 3CK6A 3KVAA 2ZM6T 1VRH4 1DXLA 4LMJA 1MXTA 4HN9A 4I4TE 1YKHB 1LRZA 2WU2A 1RUE4 2WM9A 3CPJG 4DO0A 1VBB4 4UVCB 1WR0A 4DMWA 4X1YE 2B9XA 1EL8A 2TPRA 4LF9T 4BA9A 2BK5A 2QYWA 3ADAB 3TLUA 2V60A 4JI3T 5KMSA 2RR14 2ZZBA 1PO24 3MK7C 1ZMCA 1LTXR 1BF3A 4Y4NA 1RUC4 1MNEA 1M7KA 2LSJA 1H83A 3IWAA 2MPKA 3EAMA 4YSYA 5JCNA 4J2WA 4QX7B 2CLYB 4BJMA 4TWFA 4Q4W4 4DUYT 2OLOA 5LGNB 5C8YE 1UUSA 4CXXA 4PJMA 1D1CA 5IQ1A 2V5DA 3FMWA 4E7ZA 4CN4A 3ZMUB 1Q1RA 2V26A 2WETA 4ISTA 2X66A 4NTEA 2XVFA 3C4XA 2WAUA 3UP4A 2RA1A 3AEBA 3MA9A 2BG9C 3ETUA 1WRDA 2VVLA 4GF7A 4AKGA 4K8DA 2V5ZA 2VK9A 3FXDB 2XVHA 2C76A 5JR9B 2YDRA 2JMKA
chains in the Genus database with same CATH topology
3UKLA 4YTPA 3GD4A 3AEAA 2VRMA 2C66A 5GRTA 3UOZA 3NKSA 4NEWA 1O95A 1PBCA 1FEAA 4CRTA 4EQWA 3GDPA 2VQBA 1ZOVA 2BCGG 3DK9A 4YSXA 1GTHA 3UOVA 4A65A 4KX6A 4B63A 1L0VA 1FECA 1S3EA 1GESA 3CNSA 1PJ5A 1OJ9A 4U2TA 5U25A 3RP7A 4IVOB 4H4RA 3V3NA 2OA1A 3AE6A 1DOEA 3GQKA 3RP6A 4TM0A 3UCLA 4B66A 3DK4A 4Z24A 1TYTA 1D5TA 1E1KA 2CDUA 4B64A 3IF9A 3DA1A 3HYWA 5BULA 3VRAA 3IHMA 2Z5XA 2NPXA 3AEDA 4MJWA 1Y56B 3K30A 3GMCA 3ATRA 2PHHA 4JN9A 2YG6A 2YG4A 5FS6A 4B65A 2ACZA 4J31A 1K0IA 4I58A 5KWFA 4BV6A 2EQ8A 3G5RA 4PAAA 3URHA 1B37A 3SZFA 4C74A 1XANA 4DNAA 1KNRA 5KVIA 4JY3A 1B5QA 3NN0X 2LFCA 3UKHA 4NTCA 2YVFA 4OPUA 2IIDA 3GYJA 1TDNA 1L9EA 2WOIA 4IV9A 4IA6A 2JBVA 3EPTA 2GR2A 1ZP0A 3SFEA 3NRNA 2WS3A 1PBEA 2YM1A 3GRSA 2BABA 1F8WA 3QSMA 4ZCDA 4B1BA 2WQYA 3BI5A 5J60A 4I59A 3T14A 2J3NA 3AXBA 2GF3A 4GCMA 1KFYA 2WPCA 4C3XA 3M12A 4PABA 3VRBA 5IQ4A 3AE5A 3AEEA 2R4EA 3B6DA 3GD3A 3UKQA 3QVRA 4H4ZA 1CL0A 2XFQA 4II3A 1B4VA 1H82A 3AYLA 4A6NA 2YLRA 3ABVA 1GNDA 3UKAA 5KOXA 2R0GA 1P2EA 2IVEA 2YR5A 1N4WA 1D4DA 4H4XA 2E1MA 4Z26A 4U8NA 3V3OA 1BZLA 1D7LA 3ICRA 3UTHA 1RP0A 1S3BA 2YLSA 3I6DA 4O5QA 2GB0A 2XVEA 3CNDA 1OJDA 4CCQA 3ICSA 3KLJA 2YVJA 4RG4A 3ZDNA 1GEUA 5ER0A 3E1TA 4TLZA 5KRQA 1GRBA 2QA2A 1N4VA 2BRYA 4EQXA 2BC0A 4YTNA 3NYEA 4X9MA 2GR0A 2R46A 4EM4A 4H50A 1K4QA 2BC1A 5JCIA 3CNPA 4JY2A 3LJPA 3SX6A 2XFPA 1XHCA 4YKGA 2FJDA 4YTMA 1S2QA 5M0ZA 4AT2A 4N9XA 5J7XA 4J33A 1ZDLA 2XLSA 4LA1A 3UKFA 4ZN0A 3BI4A 3KA7A 4WCTA 2XFUA 2X50A 2GQWA 4UDQA 4C5OA 1NG4A 1IUTA 3AEGA 4ECHA 4OPLA 1D4CA 4ICYA 2WEUA 1V59A 3T0KA 2X3NA 2ZZ0A 4J36A 4II2A 5FS9A 3SXIA 2C4CA 4H4WA 2Y6QA 4U8MA 4UDPA 4FDCB 4B67A 4BJYA 1VRQB 4OPCA 3ALMA 2VZ2A 1TRBA 1GETA 2YLXA 2GR1A 3UP5A 1O94A 4H2PA 3NGCX 4U8PA 2CULA 4J34A 1F8RA 4K2XA 2GH5A 2JAEA 2BCPA 2OALA 3ATQA 1CJ4A 3G5QA 2GMJA 2YAUA 4TM1A 2C64A 1PXBA 3FPZA 1EL7A 3D1CA 5L46A 3M0OA 2R9ZA 4CY6A 2B7SA 2B76A 4H4VA 1GXFA 1NAAA 1VG0A 1HYUA 2BS3A 2V6OA 3AD8B 2WPFA 3VR9A 1CC2A 3QSEA 3QFAA 5EOWA 1CBOA 3G5SA 3AE3A 1Q1WA 1FCDA 4USRA 1ZK7A 3GWFA 5FMHA 4KPRA 5CQFA 2JKCA 3SY4A 2C70A 2X99A 5CKUA 3H8LA 2BACA 4EIQA 3P4SA 2AAQA 4U2LA 3KPFA 4EM3A 1CJ2A 3BNMA 4A99A 4TLXA 1XDIA 1FOHA 4YXDA 3L1RA 3NHOX 3UKKA 4EMIA 3IC9A 3NYCA 2XYOA 3AD7B 3AYIA 4GR1A 4U8OA 4EIPA 5JCMA 2XLPA 3FG2P 4G9KA 5FS7A 2BA9A 2BS2A 1S2YA 1CHUA 2WU5A 2WOWA 5KNLA 4P9SA 3NK0X 4DSGA 1EBDA 4FK1C 4RG3A 3Q9TA 2QCUA 3B3RA 4NEVA 3OZ2A 3QJ4A 3SUCA 3C96A 1E1MA 4EMWA 4G6GA 2QAEA 2WBAA 3P9UA 4H4UA 4YKFA 1CJCA 3K7MX 2V3AA 1CC6A 5EB5A 1W4XA 3COXA 1H86A 2OLNA 3AE9A 3F8DA 3KPKA 5KOWA 4A7AA 4AT0A 3NG7X 4YSHA 3AE7A 2E4GA 2W0HA 2O9ZA 5M10A 2Q0KA 2GRTA 2GV8A 3K7TA 3KD9A 3T2ZA 4H4TA 3LADA 3GSIA 1PBFA 1PDHA 3T2YA 3QFBA 2APGA 3RNMA 1UKVG 1GRAA 3HYVA 3JSKA 1KF6A 3F8RA 1ELIA 2B9WA 3DGHA 1ZMDA 2H89A 3VQRA 4Y4LA 2A87A 4Z2RA 1LJ1A 1NEKA 1QJDA 4WX1A 4G6HA 2VQ7A 3BI2A 1RSGA 2C7GA 2GMHA 3BHKA 5C2TA 4D03A 1F8SA 3AEFA 3OC4A 4APNA 3NK2X 5JCKA 3P4RA 1TDOA 3LB8A 1KDGA 1TDEA 4XWRA 2CVJA 2BK3A 2BS4A 1Y56A 1XPQA 1CJ3A 2ZBWA 4YSZA 3CPHG 4AOXA 3BHFA 3T2KA 3DMEA 4EQSA 1QLBA 1PJ7A 4BK1A 3EANA 4UDRA 1OJAA 3AECA 4B68A 4ADWA 3GYXA 4CNKA 4YWOA 1GPEA 1DODA 1X31B 2YR6A 3S61A 1IJHA 3QSSA 4Z43A 1OJCA 4FK1A 5GSNA 1PN0A 2CFYA 4K7ZA 5BRTA 3EF6A 2C72A 2WDQA 1DJNA 3HYXA 2EQ6A 2GR3A 2XFOA 3ALJA 1YQZA 5KXJA 1L9CA 2R4JA 4HB9A 1N4UA 3ISHA 3LOVA 1PHHA 2BXSA 2UZZA 3KKJA 1AOGA 4H2QA 1PS9A 1LV0A 1GTEA 2B7RA 3SFDA 4REKA 3DH9A 2OAMA 1ZY8A 3AB1A 2RGJA 1PJ6A 4USQA 2XLUA 4BK2A 4EQRA 3UKPA 1E39A 2JB1A 3HZLA 3ZYXA 2FJBA 4AOSA 4CY8A 1VG9A 2XFNA 5KMPA 1KSUA 2JB2A 3NN6X 1ZOYA 1YY5A 4U8LA 4GDPA 5KVHA 4Z25A 1CC4A 2YG3A 3GRTA 2E5VA 4U8JA 2ZZCA 4OPIA 4GUVA 4CBQA 1BKWA 3ALLA 4OPTA 1JNZA 2I0ZA 2H88A 1FEBA 2VOUA 3DGZA 1IUXA 4JNAA 3DJJA 1ZKQA 2RGHA 2YLZA 4LIIA 1PBBA 1LQUA 4Z44A 5HXIA 4AP3A 4DSHA 5LV9A 2Q0LA 4H4YA 2GVCA 1GRHA 2WESA 2WDRA 3NH3X 4H4PA 4J57A 2DKHA 3UOXA 1H81A 3CPIG 1ZX9A 1NDAA 3P4QA 3NLCA 4FX9A 1GRFA 4GDEA 1GSNA 2C65A 2NVKX 3NYFA 1NHQA 1LQTA 1YKJA 3CGEA 3AE2A 4JDRA 1IUWA 3NTAA 3CGDA 2VRLA 4K5RA 4ZCCA 1LVLA 1OJTA 3LZWA 1TDKA 2YWLA 4CNJA 1JOAA 3GMBA 1Q9IA 2Q6UA 3CGCA 1RYIA 2XVJA 1PBDA 3KU9A 3I3LA 1H7WA 1H7XA 3IHGA 4GAPA 3C4NA 2EQ7A 4IA5A 4TM4A 5KMRA 1GERA 1D4EA 2YR4A 3CTYA 2XDOA 3CGBA 5U63A 1GV4A 2FBWA 2ARDA 2WDVA 1NG3A 2C3DA 3V76A 3GQHA 3VRDB 3NT6A 1JU2A 1O5WA 4YT0A 1D7YA 1GALA 5U1OA 5BUKA 3H4KA 1E1LA 1EL5A 1FL2A 3DJEA 3DK8A 4HA6A 2FJAA 4A9WA 2BK4A 3PS9A 3M13A 3NNEA 2R0PA 3FIMB 3T31A 2V3BA 4O5UA 3L8KA 3WE0A 3CIRA 1F6MA 2GEWA 3UOYA 3REDA 1F3PA 2Y6RA 2C73A 4XXGA 4H7UA 3QVPA 1E7PA 5TR3A 1N1PA 1NHRA 3CMMA 2DKIA 2XVIA 4B69A 1E1NA 4U8IA 2YG7A 2GAHB 1MO9A 4DGKA 4D04A 1DOBA 4OPGA 4Y4MA 3SQPA 3DJGX 1BGNA 1IUVA 3SZ0A 2AQJA 4A6NB 3AD9B 2YG5A 1L9DA 2A89A 2C75A 3NTDA 1JRZA 4BJZA 1TDFA 3AE1A 1PXCA 2WP6A 3PO7A 1BWCA 3UTEA 4XWZA 4JQ9A 2YQUA 1GOSA 2R0CA 2GAGB 3H8IA 1KSSA 4A79A 4H4SA 3RHAA 1MOKA 3II4A 4U8KA 3SZCA 1P2HA 4CCRA 1ONFA 3SM8A 3LXDA 1IUUA 3ITJA 5FS8A 4AP1A 4RSLA 1K0LA 3GWDA 1IUSA 1NPXA 4OCGA 4OPDA 4Z2UA 1QO8A 2JB3A 1KNPA 2Q7VA 4NZHA 4C77A 3P4PA 4Z2TA 2YM2A 5JCLA 4G74A 1BGJA 1H6VA 3K7QX 1B8SA 2BYBA 3NK1X 3AE8A 1LPFA 3O0HA 2A8XA 2VVMA 4H2RA 3SYIA 1SEZA 2EQ9A 2WOVA 2X8CA 4J56A 3KVEA 4TM3A 1REOA 3BNUA 2R45A 1CF3A 4GRTA 5HYMA 5HY5A 2X8GA 3FBSA 2IVDA 3R9UA 3GDNA 1DJQA 4A5LA 5IPYA 3AYJA 3UTGA 1DXLA 1NENA 5C3JA 1MXTA 1YQ4A 4EMJA 3EAOA 4C3YA 3LZXA 1YQ3A 2WU2A 1GT8A 4NTDA 2FJEA 3CPJG 2YLWA 1DOCA 1GREA 1E6EA 1M6IA 2B9XA 2WPEA 1EL8A 2TPRA 2XLTA 2YLTA 2BK5A 4G73A 1JEHA 1JRYA 3ADAB 2VVLG 2V60A 3CNTA 2PYXA 3SGLA 2GQFA 2HQMA 5KMSA 1JRXA 2TMDA 2ZZBA 1VDCA 3C4AA 3UTFA 1ZMCA 1LTXR 3NIXA 3D8XA 2B9YA 3T37A 1BF3A 4E0VA 4Y4NA 4UP3A 4IVMB 5EB4A 3P1WA 1NHSA 3AE4A 1H83A 1Y0PA 2BRAA 2Z5YA 2BXRA 3IWAA 3Q6JA 3S5WA 3SZWA 5BVAA 1GRGA 3PVCA 2AR8A 1PXAA 1K0JA 5DBJA 4YSYA 5EBKA 5JCNA 5HHFA 4H4QA 2QA1A 4K5SA 4J2WA 3RP8A 1NHPA 3F8PA 2F5ZA 4OVIA 1DNCA 2YVGA 4NWZA 2V61A 4JNQA 2OLOA 2WP5A 1Z6LA 3CN8A 4H2NA 4K22A 4X9NA 1VQWA 2C3CA 2C67A 3VR8A 2JK6A 3DJDA 2WHDA 3ICTA 1M64A 5IQ1A 4X4JA 3FMWA 1Q1RA 2WETA 4U2SA 1GRTA 4NTEA 4BURA 2XVFA 2XCGA 5KMQA 2WP9A 1TYPA 3UP4A 3AEBA 1EL9A 4K8DA 2VVLA 4GAVA 4GF7A 4NNJA 3CNJA 2V5ZA 1COYA 2RGOA 1JNRA 2XLRA 2XVHA 4LU6A 2RABA 2C76A 2X8HA 3AWIA 4BK3A 4M52A 1H84A 3GYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKL A;  4YTP A;  3GD4 A;  3AEA A;  2VRM A;  2C66 A;  5GRT A;  3UOZ A;  3NKS A;  4NEW A;  1O95 A;  1PBC A;  1FEA A;  4CRT A;  4EQW A;  3GDP A;  2VQB A;  1ZOV A;  2BCG G;  3DK9 A;  4YSX A;  1GTH A;  3UOV A;  4A65 A;  4KX6 A;  4B63 A;  1L0V A;  1FEC A;  1S3E A;  1GES A;  3CNS A;  1PJ5 A;  1OJ9 A;  4U2T A;  5U25 A;  3RP7 A;  4IVO B;  4H4R A;  3V3N A;  2OA1 A;  3AE6 A;  1DOE A;  3GQK A;  3RP6 A;  4TM0 A;  3UCL A;  4B66 A;  3DK4 A;  4Z24 A;  1TYT A;  1D5T A;  1E1K A;  2CDU A;  4B64 A;  3IF9 A;  3DA1 A;  5BUL A;  3VRA A;  3IHM A;  2Z5X A;  2NPX A;  3AED A;  4MJW A;  1Y56 B;  3K30 A;  3GMC A;  3ATR A;  2PHH A;  4JN9 A;  2YG6 A;  2YG4 A;  5FS6 A;  4B65 A;  2ACZ A;  4J31 A;  1K0I A;  4I58 A;  5KWF A;  4BV6 A;  2EQ8 A;  3G5R A;  4PAA A;  3URH A;  1B37 A;  4C74 A;  4DNA A;  1XAN A;  1KNR A;  5KVI A;  4JY3 A;  1B5Q A;  3NN0 X;  2LFC A;  3UKH A;  4NTC A;  2YVF A;  4OPU A;  2IID A;  3GYJ A;  1TDN A;  1L9E A;  2WOI A;  4IV9 A;  4IA6 A;  2JBV A;  3EPT A;  2GR2 A;  1ZP0 A;  3SFE A;  3NRN A;  2WS3 A;  1PBE A;  2YM1 A;  3GRS A;  2BAB A;  1F8W A;  3QSM A;  4ZCD A;  4B1B A;  2WQY A;  3BI5 A;  5J60 A;  4I59 A;  2J3N A;  3AXB A;  2GF3 A;  4GCM A;  1KFY A;  2WPC A;  4C3X A;  3M12 A;  4PAB A;  3VRB A;  5IQ4 A;  3AE5 A;  3AEE A;  2R4E A;  3B6D A;  3GD3 A;  3UKQ A;  3QVR A;  4H4Z A;  1CL0 A;  2XFQ A;  1B4V A;  1H82 A;  3AYL A;  4A6N A;  2YLR A;  3ABV A;  1GND A;  3UKA A;  5KOX A;  2R0G A;  1P2E A;  2IVE A;  2YR5 A;  1N4W A;  1D4D A;  4H4X A;  2E1M A;  4Z26 A;  4U8N A;  3V3O A;  1BZL A;  1D7L A;  3ICR A;  3UTH A;  1RP0 A;  1S3B A;  2YLS A;  3I6D A;  4O5Q A;  2GB0 A;  2XVE A;  3CND A;  1OJD A;  4CCQ A;  3ICS A;  3KLJ A;  2YVJ A;  4RG4 A;  3ZDN A;  1GEU A;  5ER0 A;  3E1T A;  4TLZ A;  5KRQ A;  1GRB A;  2QA2 A;  1N4V A;  4EQX A;  2BC0 A;  4YTN A;  3NYE A;  4X9M A;  2GR0 A;  2R46 A;  4EM4 A;  4H50 A;  1K4Q A;  2BC1 A;  5JCI A;  3CNP A;  4JY2 A;  3LJP A;  2XFP A;  1XHC A;  4YKG A;  2FJD A;  4YTM A;  1S2Q A;  5M0Z A;  4AT2 A;  4N9X A;  5J7X A;  4J33 A;  1ZDL A;  2XLS A;  4LA1 A;  3UKF A;  4ZN0 A;  3BI4 A;  3KA7 A;  4WCT A;  2XFU A;  2X50 A;  2GQW A;  4UDQ A;  4C5O A;  1NG4 A;  1IUT A;  3AEG A;  4ECH A;  4OPL A;  1D4C A;  4ICY A;  2WEU A;  1V59 A;  2X3N A;  2ZZ0 A;  4J36 A;  5FS9 A;  4H4W A;  2Y6Q A;  4U8M A;  4UDP A;  4FDC B;  4B67 A;  4BJY A;  1VRQ B;  4OPC A;  3ALM A;  2VZ2 A;  1TRB A;  1GET A;  2YLX A;  2GR1 A;  3UP5 A;  1O94 A;  4H2P A;  3NGC X;  4U8P A;  2CUL A;  4J34 A;  1F8R A;  4K2X A;  2GH5 A;  2JAE A;  2BCP A;  2OAL A;  3ATQ A;  1CJ4 A;  3G5Q A;  2GMJ A;  2YAU A;  4TM1 A;  2C64 A;  1PXB A;  3FPZ A;  1EL7 A;  3D1C A;  5L46 A;  3M0O A;  2R9Z A;  4CY6 A;  2B7S A;  2B76 A;  4H4V A;  1GXF A;  1NAA A;  1VG0 A;  1HYU A;  2BS3 A;  2V6O A;  3AD8 B;  2WPF A;  3VR9 A;  1CC2 A;  3QSE A;  3QFA A;  5EOW A;  1CBO A;  3G5S A;  3AE3 A;  1Q1W A;  1FCD A;  4USR A;  1ZK7 A;  3GWF A;  5FMH A;  4KPR A;  5CQF A;  2JKC A;  2C70 A;  2X99 A;  5CKU A;  3H8L A;  2BAC A;  4EIQ A;  3P4S A;  2AAQ A;  4U2L A;  3KPF A;  4EM3 A;  1CJ2 A;  3BNM A;  4A99 A;  4TLX A;  1XDI A;  1FOH A;  4YXD A;  3L1R A;  3NHO X;  3UKK A;  4EMI A;  3IC9 A;  3NYC A;  2XYO A;  3AD7 B;  3AYI A;  4GR1 A;  4U8O A;  4EIP A;  5JCM A;  2XLP A;  3FG2 P;  5FS7 A;  2BA9 A;  2BS2 A;  1S2Y A;  1CHU A;  2WU5 A;  2WOW A;  4P9S A;  3NK0 X;  4DSG A;  1EBD A;  4FK1 C;  4RG3 A;  3Q9T A;  2QCU A;  3B3R A;  4NEV A;  3OZ2 A;  3QJ4 A;  3SUC A;  3C96 A;  1E1M A;  4EMW A;  2QAE A;  2WBA A;  3P9U A;  4H4U A;  4YKF A;  1CJC A;  3K7M X;  2V3A A;  1CC6 A;  5EB5 A;  1W4X A;  3COX A;  1H86 A;  2OLN A;  3AE9 A;  3F8D A;  5KOW A;  4A7A A;  4AT0 A;  3NG7 X;  4YSH A;  3AE7 A;  2E4G A;  2W0H A;  2O9Z A;  5M10 A;  2Q0K A;  2GRT A;  2GV8 A;  3K7T A;  3KD9 A;  4H4T A;  3LAD A;  3GSI A;  1PBF A;  1PDH A;  3QFB A;  2APG A;  3RNM A;  1UKV G;  1GRA A;  3JSK A;  1KF6 A;  3F8R A;  1ELI A;  2B9W A;  3DGH A;  1ZMD A;  2H89 A;  3VQR A;  4Y4L A;  2A87 A;  4Z2R A;  1LJ1 A;  1NEK A;  1QJD A;  4WX1 A;  2VQ7 A;  3BI2 A;  1RSG A;  2C7G A;  2GMH A;  3BHK A;  5C2T A;  4D03 A;  1F8S A;  3AEF A;  3OC4 A;  4APN A;  3NK2 X;  5JCK A;  3P4R A;  1TDO A;  3LB8 A;  1KDG A;  1TDE A;  4XWR A;  2CVJ A;  2BK3 A;  2BS4 A;  1Y56 A;  1XPQ A;  1CJ3 A;  2ZBW A;  4YSZ A;  3CPH G;  4AOX A;  3BHF A;  3DME A;  4EQS A;  1QLB A;  1PJ7 A;  4BK1 A;  3EAN A;  4UDR A;  1OJA A;  3AEC A;  4B68 A;  4ADW A;  3GYX A;  4CNK A;  4YWO A;  1GPE A;  1DOD A;  1X31 B;  2YR6 A;  3S61 A;  1IJH A;  3QSS A;  4Z43 A;  1OJC A;  4FK1 A;  5GSN A;  1PN0 A;  2CFY A;  4K7Z A;  5BRT A;  3EF6 A;  2C72 A;  2WDQ A;  1DJN A;  2EQ6 A;  2GR3 A;  2XFO A;  3ALJ A;  1YQZ A;  5KXJ A;  1L9C A;  2R4J A;  4HB9 A;  1N4U A;  3ISH A;  3LOV A;  1PHH A;  2BXS A;  2UZZ A;  3KKJ A;  1AOG A;  4H2Q A;  1PS9 A;  1LV0 A;  1GTE A;  2B7R A;  3SFD A;  4REK A;  3DH9 A;  2OAM A;  1ZY8 A;  3AB1 A;  2RGJ A;  1PJ6 A;  4USQ A;  2XLU A;  4BK2 A;  4EQR A;  3UKP A;  1E39 A;  2JB1 A;  3HZL A;  3ZYX A;  2FJB A;  4AOS A;  4CY8 A;  1VG9 A;  2XFN A;  1KSU A;  2JB2 A;  3NN6 X;  1ZOY A;  1YY5 A;  4U8L A;  4GDP A;  5KVH A;  4Z25 A;  1CC4 A;  2YG3 A;  3GRT A;  2E5V A;  4U8J A;  2ZZC A;  4OPI A;  4GUV A;  4CBQ A;  1BKW A;  3ALL A;  4OPT A;  1JNZ A;  2I0Z A;  2H88 A;  1FEB A;  2VOU A;  3DGZ A;  1IUX A;  4JNA A;  3DJJ A;  1ZKQ A;  2RGH A;  2YLZ A;  4LII A;  1PBB A;  1LQU A;  4Z44 A;  5HXI A;  4AP3 A;  4DSH A;  5LV9 A;  2Q0L A;  4H4Y A;  2GVC A;  1GRH A;  2WES A;  2WDR A;  3NH3 X;  4H4P A;  4J57 A;  2DKH A;  3UOX A;  1H81 A;  3CPI G;  1ZX9 A;  1NDA A;  3P4Q A;  3NLC A;  4FX9 A;  1GRF A;  4GDE A;  1GSN A;  2C65 A;  2NVK X;  3NYF A;  1NHQ A;  1LQT A;  1YKJ A;  3CGE A;  3AE2 A;  4JDR A;  1IUW A;  3NTA A;  3CGD A;  2VRL A;  4K5R A;  4ZCC A;  1LVL A;  1OJT A;  3LZW A;  1TDK A;  2YWL A;  4CNJ A;  1JOA A;  3GMB A;  1Q9I A;  2Q6U A;  3CGC A;  1RYI A;  2XVJ A;  1PBD A;  3KU9 A;  3I3L A;  1H7W A;  1H7X A;  3IHG A;  4TM4 A;  3C4N A;  2EQ7 A;  4IA5 A;  1GER A;  1D4E A;  2YR4 A;  3CTY A;  2XDO A;  3CGB A;  5U63 A;  1GV4 A;  2FBW A;  2ARD A;  2WDV A;  1NG3 A;  2C3D A;  3V76 A;  3GQH A;  3VRD B;  3NT6 A;  1JU2 A;  1O5W A;  4YT0 A;  1D7Y A;  1GAL A;  5U1O A;  5BUK A;  3H4K A;  1E1L A;  1EL5 A;  1FL2 A;  3DJE A;  3DK8 A;  4HA6 A;  2FJA A;  4A9W A;  2BK4 A;  3PS9 A;  3M13 A;  3NNE A;  2R0P A;  3FIM B;  2V3B A;  4O5U A;  3L8K A;  3WE0 A;  3CIR A;  1F6M A;  2GEW A;  3UOY A;  3RED A;  1F3P A;  2Y6R A;  2C73 A;  4XXG A;  4H7U A;  3QVP A;  1E7P A;  5TR3 A;  1N1P A;  1NHR A;  2DKI A;  2XVI A;  4B69 A;  1E1N A;  4U8I A;  2YG7 A;  2GAH B;  1MO9 A;  4DGK A;  4D04 A;  1DOB A;  4OPG A;  4Y4M A;  3SQP A;  3DJG X;  1BGN A;  1IUV A;  2AQJ A;  4A6N B;  3AD9 B;  2YG5 A;  1L9D A;  2A89 A;  2C75 A;  3NTD A;  1JRZ A;  4BJZ A;  1TDF A;  3AE1 A;  1PXC A;  2WP6 A;  3PO7 A;  1BWC A;  3UTE A;  4XWZ A;  4JQ9 A;  2YQU A;  1GOS A;  2R0C A;  2GAG B;  3H8I A;  1KSS A;  4A79 A;  4H4S A;  3RHA A;  1MOK A;  3II4 A;  4U8K A;  1P2H A;  4CCR A;  1ONF A;  3SM8 A;  3LXD A;  1IUU A;  3ITJ A;  5FS8 A;  4AP1 A;  4RSL A;  1K0L A;  3GWD A;  1IUS A;  1NPX A;  4OCG A;  4OPD A;  4Z2U A;  1QO8 A;  2JB3 A;  1KNP A;  2Q7V A;  4NZH A;  4C77 A;  3P4P A;  4Z2T A;  2YM2 A;  5JCL A;  1BGJ A;  1H6V A;  3K7Q X;  1B8S A;  2BYB A;  3NK1 X;  3AE8 A;  1LPF A;  3O0H A;  2A8X A;  2VVM A;  4H2R A;  1SEZ A;  2EQ9 A;  2WOV A;  2X8C A;  4J56 A;  3KVE A;  4TM3 A;  1REO A;  3BNU A;  2R45 A;  1CF3 A;  4GRT A;  5HYM A;  5HY5 A;  2X8G A;  3FBS A;  2IVD A;  3R9U A;  3GDN A;  1DJQ A;  4A5L A;  5IPY A;  3AYJ A;  3UTG A;  1DXL A;  1NEN A;  5C3J A;  1MXT A;  1YQ4 A;  4EMJ A;  3EAO A;  4C3Y A;  3LZX A;  1YQ3 A;  2WU2 A;  1GT8 A;  4NTD A;  2FJE A;  3CPJ G;  2YLW A;  1DOC A;  1GRE A;  1E6E A;  1M6I A;  2B9X A;  2WPE A;  1EL8 A;  2TPR A;  2XLT A;  2YLT A;  2BK5 A;  1JEH A;  1JRY A;  3ADA B;  2VVL G;  2V60 A;  3CNT A;  2PYX A;  3SGL A;  2GQF A;  2HQM A;  1JRX A;  2TMD A;  2ZZB A;  1VDC A;  3C4A A;  3UTF A;  1ZMC A;  1LTX R;  3NIX A;  3D8X A;  2B9Y A;  3T37 A;  1BF3 A;  4E0V A;  4Y4N A;  4UP3 A;  4IVM B;  5EB4 A;  3P1W A;  1NHS A;  3AE4 A;  1H83 A;  1Y0P A;  2Z5Y A;  3Q6J A;  2BXR A;  3IWA A;  5BVA A;  3S5W A;  1GRG A;  3PVC A;  2AR8 A;  1PXA A;  1K0J A;  5DBJ A;  4YSY A;  5EBK A;  5JCN A;  5HHF A;  4H4Q A;  2QA1 A;  4K5S A;  4J2W A;  3RP8 A;  1NHP A;  3F8P A;  2F5Z A;  4OVI A;  1DNC A;  2YVG A;  2V61 A;  4JNQ A;  2OLO A;  2WP5 A;  1Z6L A;  3CN8 A;  4H2N A;  4K22 A;  4X9N A;  1VQW A;  2C3C A;  2C67 A;  3VR8 A;  2JK6 A;  3DJD A;  2WHD A;  3ICT A;  1M64 A;  5IQ1 A;  4X4J A;  3FMW A;  1Q1R A;  2WET A;  4U2S A;  1GRT A;  4NTE A;  4BUR A;  2XVF A;  2XCG A;  2WP9 A;  1TYP A;  3UP4 A;  3AEB A;  1EL9 A;  4K8D A;  2VVL A;  4GF7 A;  3CNJ A;  2V5Z A;  1COY A;  2RGO A;  1JNR A;  2XLR A;  2XVH A;  4LU6 A;  2RAB A;  2C76 A;  2X8H A;  3AWI A;  4BK3 A;  4M52 A;  1H84 A;  3GYI A; 
#chains in the Genus database with same CATH topology
 3UKL A;  4YTP A;  4QXH B;  2KWH A;  2VRM A;  3I0O A;  3UFE A;  3UOZ A;  3DP7 A;  4NEW A;  1PBC A;  3ONL C;  5HEU A;  3NBX X;  1ZOV A;  3DK9 A;  3UOV A;  4KX6 A;  1VCS A;  1GES A;  3CNS A;  5U25 A;  1IBK T;  1E1H B;  3RP6 A;  4NIQ A;  4DVD A;  4TWD A;  4Z24 A;  2UXX B;  2VKJ A;  3IBP A;  2CDU A;  4EYU A;  3VRA A;  2HHH T;  2UUA T;  1MMA A;  5HYA A;  2UUC T;  1WR6 A;  5FXX A;  2PHH A;  4JN9 A;  2LOP A;  2YG4 A;  5FS6 A;  3LK4 2;  3AVS A;  3PUV F;  1PIV 4;  4PAA A;  3N5L A;  1OED C;  4C74 A;  4DNA A;  2E8I A;  1KNR A;  2WSS V;  5KVI A;  2BG9 A;  4P0A A;  1Z8U A;  4LF4 T;  4NTC A;  4HWD A;  3LDQ B;  2JBV A;  5LP6 E;  1ZP0 A;  3SFE A;  4LF7 T;  1UX5 A;  3BI5 A;  5J60 A;  4C90 A;  3ANW A;  3K1S A;  3K3O A;  1KFY A;  2WPC A;  2R7F A;  3AEE A;  3UKQ A;  2C0S A;  1CL0 A;  1T98 A;  2K5B B;  4NPP A;  4HWH A;  4NXM T;  1B4V A;  5IHY A;  1OOP D;  5LHH B;  3Q5W A;  2YLR A;  1GND A;  1YXR A;  4L0R A;  5H6Q B;  3NWI A;  5JH7 E;  1D4D A;  3OYX A;  4Z26 A;  3V3O A;  1D7L A;  5AQK B;  3ICR A;  3UTH A;  1S3B A;  2YLS A;  5AQL B;  2XVE A;  3CND A;  2L3L A;  3ZDN A;  5FKY A;  5KRQ A;  2YEV C;  4PJJ A;  3PUS A;  2X9W A;  2BC0 A;  1OED A;  1UUR A;  3O1H A;  4JBW F;  4H50 A;  3RKG A;  3CNP A;  2K3W A;  3LJP A;  3ZEF B;  4COF A;  5FXV A;  2XFP A;  4YTM A;  4AQF C;  3AA1 B;  3DTO A;  1XNQ T;  5L3D B;  2XFU A;  5TAO A;  3FZF B;  1MQT D;  3HA4 A;  2CBI A;  3KDS E;  4JI5 T;  4UDQ A;  1VBC 4;  1IUT A;  4ECH A;  2WEU A;  1V59 A;  5LA6 E;  2X3N A;  5FS9 A;  4I55 E;  2KZ7 B;  1ZV4 X;  4B67 A;  4DND A;  1TRB A;  2GR1 A;  4H2P A;  4K2X A;  2JAE A;  2Q9Q B;  2OAL A;  3JC6 C;  3ATQ A;  2DHR A;  2GMJ A;  2DNX A;  2YAU A;  2C64 A;  1G8X A;  3PU8 A;  3KFW X;  1EL7 A;  4CY6 A;  2B76 A;  3GN5 B;  5FVL A;  1IAP A;  1HYU A;  3AD8 B;  2UXC T;  2XQA A;  2WPF A;  5EOW A;  4QH4 A;  4IDN A;  2NOX A;  4USR A;  3N2O A;  5AQT B;  5LGT B;  3JC6 D;  1ZK7 A;  4IDP A;  3SY4 A;  3H8L A;  4TZ4 C;  4EIQ A;  2AAQ A;  1XDI A;  4DMV A;  4YXD A;  2J1D G;  1XMO T;  3UKK A;  3NYC A;  4G9K A;  1S2Y A;  3L39 A;  2WOW A;  2XSA A;  4QH1 A;  2Y8D A;  3N2K E;  1X9B A;  2VQE T;  5GON E;  3QJ4 A;  5IUX A;  4X62 T;  2WBA A;  4G6G A;  3EDU A;  4YKF A;  2V7I A;  2DLR A;  1CC6 A;  3H37 A;  4AT0 A;  3NG7 X;  3AE7 A;  2O9Z A;  2Q0K A;  3KD9 A;  3T2Y A;  2PFV A;  2APG A;  5CB4 E;  3RNM A;  1UKV G;  4JI2 T;  4K0U A;  4JV5 T;  1ELI A;  3VQR A;  2XZE A;  2LOS A;  3N2G E;  3VU7 H;  3CX7 B;  4X1K E;  4G6H A;  2VQ7 A;  3BI2 A;  2V6Y A;  5JTG A;  1RSG A;  2C7G A;  1F8S A;  4APN A;  3QNU A;  5LHG B;  4ZHQ E;  1KDG A;  2LSI A;  4XWR A;  4UF0 B;  2BS4 A;  1Y56 A;  2WBL A;  1US7 B;  2D9D A;  3T2K A;  3AA7 B;  4EQS A;  4U7I A;  4IE7 A;  5L3B B;  3CPZ A;  3OJA A;  4B68 A;  3GYX A;  4IIJ E;  4YWO A;  3QSS A;  4EYY R;  4BAY B;  4HTE A;  2GR3 A;  3F31 A;  3UU6 A;  2WZI A;  5F5W A;  2BXS A;  3HR0 A;  1AOG A;  4Q4X 4;  1XDO A;  3WI3 A;  2LJL A;  3U3I A;  4REK A;  3ZYM A;  3GMI A;  4DV3 T;  2XLU A;  1OWA A;  3HKB E;  1LVK A;  2IW5 B;  4AOS A;  5KMP A;  2JB2 A;  1ZOY A;  1VBA 4;  5KVH A;  2E2A A;  3PUZ F;  5ABF A;  2E5V A;  3A7M A;  2V1D B;  3ALL A;  4IDQ A;  3P7I A;  3LBX B;  2RS5 4;  1PBB A;  5HXI A;  5JDQ A;  4DSH A;  4O2A E;  5HEJ A;  4ZS2 A;  2Q0L A;  2GVC A;  3U78 A;  2DKH A;  3UOX A;  1H81 A;  1ZX9 A;  5LBM A;  3P4Q A;  1NHQ A;  3CGE A;  3NTA A;  1R8I A;  2XJ7 A;  5LB7 B;  4ZCC A;  3S4U A;  4H63 H;  3UQ4 A;  1JOA A;  3CGC A;  2Q6U A;  2EHO B;  4KHP T;  1PBD A;  3KU9 A;  4UR9 A;  2EQ7 A;  1D4E A;  3C98 B;  2C3D A;  4GKJ T;  4AKH A;  1JU2 A;  2ZM8 A;  5AQU B;  1RUI 4;  3M3Z B;  3RH3 A;  3PS9 A;  4U31 A;  3M13 A;  3NNE A;  3FIM B;  4Q25 A;  4O5U A;  3CIR A;  5HCM A;  4TNV A;  2WWV A;  1F3P A;  1MIW A;  4XXG A;  3Q5X A;  4PAG A;  1AL2 4;  3QVP A;  2KSR A;  2RPA A;  5DJQ C;  5AQF B;  2C5J A;  4B69 A;  2K48 A;  2JMH A;  1AJ3 A;  2LRL A;  3SQP A;  3DJG X;  1IUV A;  1ZHC A;  4ISS A;  4A6N B;  4DR3 T;  2E9X B;  2BKO A;  3PO7 A;  1BWC A;  1HRI 4;  2R0C A;  3K3Q C;  3H8I A;  4H4S A;  1MOK A;  4EV6 A;  4U8K A;  3E22 E;  4FI5 A;  1P2H A;  3EUH A;  4CCR A;  3LXD A;  3AAA B;  1U5P A;  3ITJ A;  4O4I E;  4Z2U A;  1IUS A;  2LKH A;  1QO8 A;  3RRW A;  4C77 A;  4Z2T A;  2X51 A;  2YM2 A;  1MMD A;  3H3A A;  1BGJ A;  3K7Q X;  3UU3 A;  3AXJ A;  2BYB A;  4EZH A;  3O0H A;  3AAI A;  2X8C A;  2WOV A;  4YJ3 E;  3KVE A;  3BNU A;  5HYM A;  1CF3 A;  3FBS A;  2IVD A;  1DJQ A;  4A5L A;  3AYJ A;  4HFD A;  4CZZ B;  1LKX A;  3F2E A;  5JQG E;  4PJN A;  2CA5 A;  4C3Y A;  4DV2 T;  2Y48 B;  4HWF A;  2EX3 A;  4DBR A;  4HE8 A;  5LJM A;  2XQ4 A;  2FJE A;  4UEM A;  4NTD A;  2YLW A;  5CFB A;  1DOC A;  1GRE A;  2W4X A;  2BBJ A;  1KEY A;  2WPE A;  2XLT A;  3NRX A;  4G73 A;  1JRY A;  2I59 A;  3SGL A;  5LHI B;  4O4H E;  4AKI A;  4EZ4 A;  2LRK A;  1JRX A;  4TV9 E;  5IYZ E;  3C4A A;  4X66 T;  4PK4 A;  3EHZ A;  5JRC A;  3FXE B;  3T37 A;  2X67 A;  4JI4 T;  3BQK A;  3CQX C;  3AE4 A;  1Y0P A;  2BRA A;  2BXR A;  3R6N A;  1RUG 4;  1GRG A;  4ILB A;  1K0J A;  4F8H A;  4K5S A;  3RP8 A;  1AR7 4;  4HWI B;  2YIN A;  1COV 4;  4GOU A;  4NWZ A;  2YVG A;  2V61 A;  4DBQ A;  4H2N A;  4X9N A;  2C67 A;  3KV9 A;  2WHD A;  3ESL A;  2XQY A;  4H9O C;  4GIW A;  3C51 A;  2CXF A;  2WP9 A;  1TYP A;  1EZ3 A;  4GAV A;  3ZSS A;  3WAJ A;  1JNR A;  2QA7 A;  3TLV A;  1I94 T;  4LU6 A;  3KV5 A;  2RAB A;  5JDG A;  4BK3 A;  4M52 A;  5LGU B;  1XHX A;  3GD4 A;  1IZN B;  2C66 A;  3ZPO A;  3NKS A;  1FEA A;  1HG5 A;  4EQW A;  5AQN B;  4G63 A;  4ZI7 E;  1GTH A;  4A65 A;  4B63 A;  1FIO A;  1S3E A;  4DV0 T;  3PU3 A;  2YU2 A;  4H4R A;  4IVO B;  2OA1 A;  3AE6 A;  3O4X E;  1HNW T;  4B66 A;  2BVM A;  3HKC E;  3AA0 B;  1OED E;  1TYT A;  4ZXL A;  1D5T A;  3IF9 A;  3HYW A;  3IHM A;  2B1E A;  2Z5X A;  2NPX A;  2R07 4;  3RC8 A;  2VKD A;  4LFC T;  4IL4 A;  4OK0 A;  5JVD E;  2CXD A;  1K0I A;  4I58 A;  4BV6 A;  2EQ8 A;  4BJN A;  3URH A;  4EXT A;  2BKN A;  3SZF A;  1XAN A;  3EVY A;  3M65 A;  4JY3 A;  3NN0 X;  2NP9 A;  2YVF A;  4OPU A;  1RHI 4;  3GYJ A;  1TDN A;  4IV9 A;  4IA6 A;  3EPT A;  1GQE A;  2A2F X;  2GR2 A;  4B3T T;  1PBE A;  1SE7 A;  2BDE A;  2LLY A;  4P1N A;  4YHH T;  3VKG A;  1IBL T;  5AQJ B;  3NRY A;  4I59 A;  2GF3 A;  4GCM A;  1W0B A;  2XQ8 A;  4C3X A;  1AR6 4;  4H9S E;  1UGO A;  1HF8 A;  1ASJ 4;  3CWZ B;  5JDH A;  2XFQ A;  1Z7S 4;  1MIY A;  2L9Q A;  3UKA A;  1Y64 B;  3P4W A;  2IVE A;  3H3M A;  4JI1 T;  4H4X A;  4WBO A;  1RP0 A;  1HX8 A;  2JPF A;  4PK5 A;  5AQS B;  4IE0 A;  1GEU A;  4ZOL E;  2QA2 A;  4YTN A;  4X9M A;  2XQ6 A;  2PYL A;  2CLY C;  3PUY F;  1K4Q A;  2BC1 A;  4ADZ A;  4JY2 A;  2RP4 A;  2R6G F;  4YKG A;  1XHC A;  4N9X A;  2A72 A;  4LA1 A;  1NAF A;  2JQH A;  3K8P C;  2X50 A;  2ACX A;  3Q9D A;  5H6R B;  2C5K T;  4UV9 B;  2ZZ0 A;  4J36 A;  4II2 A;  2C4C A;  2DCF A;  4H4W A;  5AQG B;  2Y6Q A;  4H9R C;  5LMN T;  5JR9 C;  1VRQ B;  3CQG B;  4OPC A;  2IUB A;  3ETV A;  3NGC X;  4U8P A;  2QGS A;  4J34 A;  2VB6 A;  2BCP A;  4ERR A;  1M62 A;  3FPZ A;  2K24 A;  4QWN B;  4U3C A;  2HN2 A;  3EAB A;  5LBQ B;  1NAA A;  2BS3 A;  3QSE A;  1H8T D;  1CBO A;  3G5S A;  1EAH 4;  4Z90 A;  3FB2 A;  4V1A v;  1HR0 T;  4HFC A;  2JKC A;  3KBT A;  2BG9 B;  2KWI B;  4EM3 A;  2ODU A;  4TLX A;  2GK9 A;  1FOH A;  2Y6X A;  4GR1 A;  3AD7 B;  5JCM A;  2XY8 B;  2J47 A;  1FMV A;  2R06 4;  2BA9 A;  2BS2 A;  1CHU A;  2WU5 A;  5KNL A;  4FK1 C;  2PZS A;  2QCU A;  3B3R A;  3C96 A;  2HPJ A;  5JR9 A;  4H4U A;  2R04 4;  2P9B A;  1CJC A;  3K7M X;  4NUV A;  4EEB A;  3COX A;  3F8D A;  2CMR A;  3BQI A;  5KOW A;  1XNR T;  2HPL A;  3NZQ A;  2E4G A;  3K7T A;  4ILU A;  3T2Z A;  3AA6 B;  1KF6 A;  2I6H A;  2B9W A;  2H89 A;  3T1H T;  1QJD A;  5C2T A;  4HFI A;  2X0Y A;  3ZCJ A;  2PJQ A;  2D0U A;  1NCQ D;  1HNZ T;  4Q4V 4;  1TDO A;  2HWC 4;  2CVJ A;  2BK3 A;  4EB6 E;  4LMK A;  2I0M A;  4BK1 A;  3ZJ2 A;  4O4J E;  4ADW A;  3PV0 F;  4CNK A;  2W00 A;  1GPE A;  3S61 A;  1IJH A;  5ABE A;  4FK1 A;  1PN0 A;  2CFY A;  3O1J A;  1N36 T;  5BRT A;  2LM2 A;  2C72 A;  5CA0 E;  2XFO A;  3SS1 A;  1N4U A;  4IE5 A;  1BR1 A;  2CM0 A;  2J4G A;  4O8S A;  2JRK A;  1PS9 A;  1LV0 A;  3NZP A;  2C5I T;  3UTK A;  3DH9 A;  5KMG P;  3AB1 A;  1D4M 4;  4EQR A;  1VG9 A;  1KSU A;  3NN6 X;  2VKH A;  2M6B A;  4GDP A;  2Q9Q C;  2CXL A;  5L47 A;  2YG3 A;  3FZK B;  2X68 A;  3MAC A;  2E5L T;  2V5C A;  2ODV A;  4N78 D;  3DGZ A;  5JDL A;  1IUX A;  3QOF A;  1ZKQ A;  3B57 A;  2YLZ A;  3KV4 A;  4LII A;  1LQU A;  3BQL A;  4Z44 A;  4UV8 B;  5FMN A;  4AP3 A;  2IDO B;  4K0K T;  1WLX A;  2WES A;  3NH3 X;  1MND A;  4U33 A;  2XM2 A;  2CBJ A;  3CPI G;  4QX8 B;  1NDA A;  4FX9 A;  3V5S A;  4GDE A;  3NYF A;  2NVK X;  2VRL A;  3PTR B;  4YHJ A;  4CNJ A;  4LFB T;  1IJ6 A;  2IC6 A;  3PUR A;  2AXD S;  3I3L A;  3ONJ A;  1H7W A;  3IHG A;  2V8S V;  1GER A;  4UEL A;  4AQF A;  3PUW F;  5ABG A;  5FL1 A;  4KHZ F;  2FBW A;  4H9N C;  2WDV A;  3V76 A;  3GQH A;  5HCJ A;  1ZEE A;  2QVA A;  1G73 A;  3VRD B;  3P50 A;  2AE9 A;  4HKA A;  1PVC 4;  1O5W A;  2NW9 A;  3H4K A;  1E1L A;  3JAF A;  3PUA A;  1UK5 A;  1FL2 A;  3DJE A;  3DK8 A;  1H7C A;  4KP3 C;  2X9H A;  3JAE A;  3A8Y C;  2GEW A;  2Y6R A;  1BR4 A;  2C73 A;  2Q9Q A;  2X0H A;  3N9P A;  3CMM A;  5J2U E;  1XHZ A;  4DGK A;  4H63 V;  4AIU A;  1AR8 4;  1DOB A;  3GN5 A;  1BGN A;  1N33 T;  4CI1 B;  2A89 A;  1TDF A;  2RM2 4;  3AE1 A;  3J7Y q;  1FEW A;  3C64 A;  3UTE A;  4JQ9 A;  2YQU A;  4UVB B;  1KSS A;  3RHA A;  4CI3 B;  3SZC A;  4PW8 A;  1IUU A;  5FS8 A;  4MLK A;  4OCG A;  1J5E T;  5JCL A;  4G74 A;  5LNK A;  1XMQ T;  3NK1 X;  3Q5D A;  3D0T A;  2A8X A;  2VVM A;  4H2R A;  3QC9 A;  4KUM B;  3VKH A;  4TM3 A;  2R45 A;  2X8G A;  2W62 A;  4I43 B;  3HI2 A;  5LMU T;  4GKK T;  4TN7 B;  1NEN A;  4O4L E;  5JDM A;  2LEH A;  3RGL A;  1U4Q A;  3EAO A;  5J0Z A;  1YQ3 A;  4B3S T;  5L3F B;  3ZYK A;  5ABF B;  4P0B A;  2YLT A;  5L3G B;  3W15 B;  2VVL G;  5HXH A;  2RMU 4;  1WYB A;  3E08 A;  3N9N A;  2TMD A;  1VDC A;  3UTF A;  1XZY A;  2IC9 A;  1BR0 A;  3NIX A;  2B9Y A;  4UP3 A;  2HWB 4;  4GYS A;  5EB4 A;  3RPU A;  3P1W A;  1NHS A;  3MJX A;  2W66 A;  2MBG A;  3Q6J A;  5BVA A;  2NTY A;  4HWC A;  4XBF B;  1PXA A;  5DBJ A;  4ZEY A;  4H4Q A;  2QA1 A;  2XPK A;  4AI6 A;  5F8P A;  3I1A A;  3UQ7 A;  4OVI A;  3WAK A;  4JNQ A;  2ZLY A;  3CN8 A;  5LG4 A;  1VQW A;  4X5T A;  2C3C A;  3VR8 A;  2JK6 A;  2V7L A;  2JJ9 A;  1M64 A;  2CRB A;  2N1G A;  3KVB A;  3P8C D;  2EHO C;  3ZYL A;  1D0Y A;  4BUR A;  2WCA A;  4X64 T;  1EL9 A;  4PK6 A;  5AQR B;  3PDY A;  4P09 A;  3CNJ A;  4NNJ A;  2X9Y A;  2ZMA A;  2XLR A;  4CI2 B;  2X8H A;  3SWH A;  3JAD A;  5DQV A;  3FZM B;  3TLT A;  3GYI A;  4AQY T;  5L2L A;  2EHO D;  3AEA A;  5GRT A;  4EGW A;  4TUY E;  3ZCI A;  4C91 A;  3GDP A;  1RUD 4;  2BCG G;  4YSX A;  5BR8 T;  2Z6E A;  1L0V A;  1FEC A;  4U2T A;  1PJ5 A;  2H7V C;  3N9O A;  2M6I A;  1DOE A;  3LBX A;  3GQK A;  2JQ9 A;  2E9X C;  3E0Z A;  4H9P C;  1E1K A;  4B64 A;  3DA1 A;  4LFA T;  4IE4 A;  3AED A;  1T7S A;  3K30 A;  3ZT5 A;  4B65 A;  2ACZ A;  5AQI B;  4OYK A;  4TNW A;  2EHO A;  1B37 A;  3OYZ A;  5AQH B;  2VL8 A;  4DUZ T;  2LFC A;  1XI1 A;  3UKH A;  3CX6 B;  5FVK A;  2IID A;  1L9E A;  4IE6 A;  3MZK B;  4YLH A;  2WS3 A;  2BAB A;  3FHN A;  1F8W A;  3QSM A;  4PFP A;  4ZCD A;  4B1B A;  4LML A;  3T14 A;  1HG2 A;  2J3N A;  3JBG 4;  2CWO A;  1D1A A;  1K5M D;  3M12 A;  4PAB A;  4KI0 F;  3AE5 A;  5FP3 A;  3B6D A;  3GD3 A;  3QVR A;  2VKO A;  2KLQ A;  3O9X A;  4H4Z A;  1DU2 A;  3FI7 A;  3PJA A;  5JRC B;  5HEO A;  4ILC A;  4Q4Y 4;  2MTQ A;  3ZC1 A;  3C4Z A;  2CHO A;  3AYL A;  4A6N A;  3ABV A;  4AXP A;  2E9X A;  2IHR 1;  4LF8 T;  3N9Q A;  2XTL A;  2KXP B;  5FXZ A;  3RYF E;  2E1M A;  4U8N A;  1BZL A;  5ADX L;  5HEH A;  3TKL B;  5EK4 A;  2GB0 A;  4CCQ A;  3KLJ A;  5ER0 A;  4TLZ A;  1GRB A;  1N4V A;  4J2C A;  2BRY A;  4EQX A;  5AQM B;  4DV6 T;  3Q2M A;  3GWH A;  5L3C B;  2R46 A;  4EM4 A;  4QHO A;  3SX6 A;  2FJD A;  4AT2 A;  5J7X A;  1MMN A;  4J33 A;  4ZN0 A;  3BI4 A;  3KA7 A;  2XQ9 A;  5CGM A;  4DR2 T;  2GQW A;  4C5O A;  1NG4 A;  3AEG A;  2PTF A;  4ICY A;  4IT4 A;  4YY3 T;  1N32 T;  3SXI A;  1MIV A;  4UXN B;  3ZMZ B;  4U8M A;  4UDP A;  4FDC B;  4FJO A;  1GET A;  2YLX A;  3UP5 A;  3RLF F;  3IA3 A;  2LSG A;  4A98 A;  4ZI3 C;  1F8R A;  3IHR A;  2DI4 A;  3G5Q A;  3GA8 A;  4TM1 A;  1POV 0;  3ZC0 A;  3D1C A;  2X0L B;  5L46 A;  1XDP A;  2B7S A;  4H4V A;  1GXF A;  4NUU A;  2V6O A;  2KMF A;  1CUN A;  3VR9 A;  1HNX T;  1CC2 A;  4ZI3 D;  3AE3 A;  1Q1W A;  5HWX A;  4I50 E;  1FCD A;  5FMH A;  5AQP B;  4A5X A;  2C70 A;  2X99 A;  1R09 4;  3ZKR A;  2BAC A;  4L5G A;  3TLW A;  3RYC E;  5BUL A;  3NHO X;  4EMI A;  2JQK A;  3AYI A;  5FNV E;  1HCI A;  1QUU A;  4P9S A;  1XWM A;  2CE7 A;  4JI7 T;  1HRV 4;  4RG3 A;  3X1D A;  2XHE B;  2KT9 A;  3SUC A;  4NEV A;  5EZY E;  3OZ2 A;  2IML A;  3T1Y T;  1KK7 A;  5L3E B;  2L8K A;  3LJC A;  2QAE A;  5ABH A;  4AQG A;  2V3A A;  2HN1 A;  1YD8 G;  1H86 A;  4A7A A;  4HFE A;  5ETW A;  2W0H A;  5M10 A;  2GRT A;  2GV8 A;  4H4T A;  1SA0 E;  1WCR A;  1GRA A;  5HXC A;  3HYV A;  3JSK A;  4ZI2 C;  1HFA A;  4GYR A;  3F8R A;  3DGH A;  1ZMD A;  4Y4L A;  2A87 A;  5BMV E;  1NEK A;  4WX1 A;  1T72 A;  4Z91 A;  4XAX B;  3BHK A;  4D03 A;  3AEF A;  3OC4 A;  4PNI A;  3P4R A;  5FYM A;  4OFZ A;  2DL1 A;  1TDE A;  2G0U A;  4ZI2 D;  3G06 A;  1CJ3 A;  2ZBW A;  3CPH G;  3BHF A;  2CHN A;  3DME A;  1PJ7 A;  3LFM A;  4E7S A;  3OBV E;  4UDR A;  2PLV 4;  3ZN1 B;  4I0U A;  1VRB A;  4PJL A;  1X31 B;  4Z43 A;  5GSN A;  4K7Z A;  2DWK A;  2WDQ A;  2NW7 A;  1DJN A;  3HYX A;  3AAE B;  2KIN B;  3EDV A;  2EQ6 A;  5AQQ B;  5J1G A;  3ALJ A;  1YQZ A;  4HB9 A;  4WBN E;  1PHH A;  3PUG A;  2W2U A;  4A56 A;  2XAG B;  2NWB A;  2OV9 A;  2B7R A;  4DV7 T;  3SOL A;  1ZY8 A;  3FBL A;  2RGJ A;  4CXW A;  4USQ A;  4BK2 A;  2BBH A;  3J9X 1;  1E39 A;  4JUY A;  2JB1 A;  3HZL A;  3RF1 A;  1SUM B;  3QUJ A;  4CY8 A;  1LVF A;  2JQQ A;  2ES0 A;  4U8L A;  1CC4 A;  1W09 A;  2BZB A;  3Q5E A;  3GRT A;  2NW8 A;  2ZZC A;  3IF8 B;  3RX6 A;  4JNA A;  3C50 A;  5LV9 A;  4H4Y A;  1GRH A;  2WDR A;  4MHC A;  4H4P A;  2XUE A;  3RHW A;  1D0X A;  2VAS A;  3PUX F;  1GRF A;  2X5I D;  4WZX A;  1GSN A;  2C65 A;  3RIA A;  3RC3 A;  1LQT A;  1YKJ A;  3AE2 A;  3PE0 A;  1IUW A;  2VUR A;  1OJT A;  1TDK A;  1MMG A;  3ZLI A;  1Q9I A;  3GMB A;  2XVJ A;  2V7K A;  4GAP A;  5KMR A;  4IA5 A;  2MAW A;  3UFG A;  3C4W A;  3CTY A;  2XDO A;  5U63 A;  1GV4 A;  1NG3 A;  4OX9 T;  2WMO A;  3N9L A;  2WMN A;  2UXD T;  3NT6 A;  5U1O A;  4JEU B;  2LSY A;  5BUK A;  4CN1 A;  4JI6 T;  4HA6 A;  4A9W A;  2YU1 A;  1E2A A;  4WNK A;  2V3B A;  4B3R T;  3ANW B;  5DAB A;  3UOY A;  2NTX A;  2RS1 4;  4GB3 4;  2DWG A;  4AIS A;  4H7U A;  2PG8 A;  1E7P A;  5TR3 A;  4U8I A;  3MXZ A;  2YG7 A;  2QRX A;  4D04 A;  4OPG A;  1I6Z A;  5J2T E;  4GK5 E;  2AQJ A;  2HH7 A;  3A5X A;  2A9U A;  3NTD A;  4XWZ A;  1Y01 A;  2YN6 A;  2GAG B;  3SRZ A;  3UU4 A;  4A79 A;  5KDM C;  2LSK A;  1ONF A;  4DR4 T;  3HKD E;  1J1J A;  4AP1 A;  1K0L A;  3GWD A;  1S94 A;  1NPX A;  4OPD A;  2JB3 A;  1KNP A;  1OED B;  3B5M A;  5A1L A;  1NA1 D;  1H6V A;  2H3R A;  1B8S A;  2YOE A;  2XAQ B;  3R84 B;  3AE8 A;  1LPF A;  3UUN A;  3NVO A;  5L4H A;  2LT3 A;  3SYI A;  1SEZ A;  2EQ9 A;  4GRT A;  4QH5 A;  3R9U A;  3UU5 A;  5HY5 A;  3GDN A;  5E0O A;  5IPY A;  3UTG A;  5C3J A;  3JD7 4;  1IJ5 A;  5L4E A;  2UU9 T;  1YQ4 A;  4EMJ A;  1VBE 4;  3LZX A;  5LYJ E;  3LK2 B;  2XAF B;  1GT8 A;  1UX4 A;  1E6E A;  3N9M A;  1M6I A;  5LJN A;  2PW9 A;  3AB3 B;  4B6X A;  2WZH A;  2CEA A;  1JEH A;  1OXZ A;  3CNT A;  2D0T A;  3UT5 E;  2PYX A;  1W9R A;  3UUB A;  5CJ5 A;  2GQF A;  2HQM A;  3T8O A;  1N34 T;  1YKE B;  3CX8 B;  3RI5 A;  3D8X A;  4E0V A;  2MYS A;  4IVM B;  5KX5 E;  2Z5Y A;  4QKN A;  3SZW A;  3S5W A;  3PVC A;  2AR8 A;  3KBU A;  5EBK A;  5HHF A;  2MOZ A;  1NHP A;  3F8P A;  1RUH 4;  2PY5 A;  2F5Z A;  1DNC A;  3L3P A;  2ZM2 A;  1Z6L A;  2WP5 A;  3CML A;  4K22 A;  2VWA A;  3DJD A;  2Q9Q D;  4JYA T;  3ICT A;  2YDQ A;  1EV1 4;  4X4J A;  5FL0 A;  4U2S A;  4IHJ E;  1GRT A;  3RYH E;  5JRE A;  1VBD 4;  2XCG A;  5KMQ A;  4HGA A;  2F4V T;  5JDN A;  1IBM T;  1COY A;  4ZZC A;  2RGO A;  4PDW D;  2N2N A;  3AWI A;  1H84 A;  2V7J A;  1O95 A;  4ZZB A;  4CRT A;  3ZT7 A;  2LHN A;  4DR1 T;  2VQB A;  3RRC A;  4M1P A;  4TV8 E;  3ZMT B;  4X1I E;  1OJ9 A;  3RP7 A;  3V3N A;  2M67 A;  5HWY A;  4TM0 A;  3UCL A;  2V6Y B;  2UXB T;  2ZM0 A;  3DK4 A;  4ILA A;  3B13 A;  3L8R A;  3F57 A;  3FZL B;  4JI8 T;  4MJW A;  1BEV 4;  1Y56 B;  3GMC A;  4OYJ A;  3ATR A;  3FBZ A;  2YG6 A;  2BKP A;  2N9D A;  1BR2 A;  4JEH B;  4J31 A;  3CKD A;  5KWF A;  1QSD A;  3G5R A;  4RHV 4;  1V9D A;  1B5Q A;  3LG7 A;  3RIF A;  3I9Y A;  1S35 A;  1HTJ F;  2VVN A;  2WOI A;  5HXS A;  4ANJ A;  1T8B A;  1FMW A;  3NRN A;  2YM1 A;  3GRS A;  5EK3 A;  5LG3 A;  2WQY A;  3AXB A;  1YW0 A;  4PFO A;  3OVU A;  1AR9 4;  2V6X A;  3VRB A;  5IQ4 A;  2R4E A;  2BVL A;  4II3 A;  1UCU A;  1H82 A;  4DR7 T;  5KOX A;  2R0G A;  1P2E A;  2YR5 A;  1KNZ A;  3HKE E;  1N4W A;  2W63 A;  3I6D A;  4O5Q A;  2W61 A;  4HFH A;  1OJD A;  2IAK A;  3ICS A;  2VL0 A;  2YVJ A;  4RG4 A;  3ZN0 B;  5EK2 A;  3E1T A;  4QXB B;  3CVR A;  3NYE A;  2GR0 A;  5JCI A;  4UF0 A;  4U74 A;  1D1B A;  4LF6 T;  3OTO T;  5M0Z A;  1S2Q A;  5FY1 A;  3UUX B;  3JCF A;  1ZDL A;  2XLS A;  3UKF A;  2XAS B;  4WCT A;  4TWH A;  3K3N A;  1HX1 B;  4MBQ A;  2YK0 A;  4OPL A;  1D4C A;  4X20 E;  5FXW A;  3T0K A;  2WWU A;  5F3J A;  3KIN B;  4XZC A;  4BJY A;  3ALM A;  2VZ2 A;  3ZJ1 A;  3NKZ A;  4LF5 T;  1O94 A;  2LM9 A;  2YKS A;  4DR5 T;  2K9A A;  2CUL A;  3KV6 A;  2GH5 A;  1CJ4 A;  2CCQ A;  4DV4 T;  1PXB A;  2W67 A;  5AQV B;  1O3X A;  2FUP A;  3M0O A;  2R9Z A;  5CA1 E;  2LKG A;  2A3D A;  1VG0 A;  5LCY A;  4EOZ B;  3UU8 A;  4U2Z A;  3QFA A;  4DV1 T;  3RKO A;  5LOV E;  5LXT E;  3GWF A;  4KPR A;  1R08 4;  5CQF A;  2WY2 A;  2OLT A;  1RVF 4;  5CKU A;  2VQF T;  1HS7 A;  3P4S A;  4U2L A;  1B7T A;  3LSV A;  3KPF A;  1CJ2 A;  1VOM A;  2D2S A;  3BNM A;  3L1R A;  3UUL A;  4A99 A;  2XAJ B;  3IC9 A;  2XYO A;  4EIP A;  4U8O A;  4MFR A;  2XLP A;  3FG2 P;  3J8F 4;  5FS7 A;  4HFV A;  1PO1 4;  3AXJ B;  4NXN T;  4HFB A;  3NK0 X;  4DSG A;  1EBD A;  1RUJ 4;  3Q9T A;  3RQU A;  3RIU C;  2E9X D;  2LHR A;  1E1M A;  2RS3 4;  2D5U A;  4EMW A;  3P9U A;  4DR6 T;  3IEE A;  3ZMV B;  5EB5 A;  1W4X A;  2OLN A;  3AE9 A;  4WW0 A;  3VHL A;  3KPK A;  3AVR A;  4H9Q C;  5AQO B;  2KND A;  4YSH A;  2XAH B;  1VCT A;  4KMC A;  4F6R C;  4HEA A;  3LAD A;  3GSI A;  1PBF A;  4AKL A;  4G2A A;  4MAL A;  3V5U A;  5AFU L;  1PDH A;  3QFB A;  4IGU A;  4OHF A;  4GK0 E;  4AKR B;  2X9X A;  5HXE A;  4Z2R A;  1LJ1 A;  4O2B E;  4X65 T;  4DV5 T;  3ONX A;  2GMH A;  2XQ7 A;  2YDS A;  4U7Y A;  4CQI A;  4IL9 A;  3NK2 X;  5JCK A;  3HL6 A;  4CXY A;  3LB8 A;  2OA5 A;  3QB5 K;  4ASK A;  1XPQ A;  4YSZ A;  4AOX A;  1RUF 4;  3UUM A;  1QLB A;  3EAN A;  5HAX A;  2IIU A;  2J62 A;  3AEC A;  4IRE A;  1OJA A;  1DOD A;  2YR6 A;  1OJC A;  3RIU A;  1ZKE A;  5FY7 A;  1HXS 4;  3CQC B;  3O1I A;  3EF6 A;  3RYI E;  4EAH A;  1Z0P A;  5IWA T;  3L09 A;  5KXJ A;  1L9C A;  2R4J A;  3ISH A;  3LOV A;  3I9W A;  2UZZ A;  4CN6 A;  4YJ2 E;  3KKJ A;  4H2Q A;  3QB5 A;  1GTE A;  1WFD A;  3SFD A;  3TLS A;  2OAM A;  1W0A A;  1PJ6 A;  3UKP A;  3ZYX A;  2FJB A;  4ZS3 A;  1J5W A;  3PJA J;  2XFN A;  4YFS A;  3ZT6 A;  1YY5 A;  4Z25 A;  3DJB A;  4U8J A;  4OPI A;  4CBQ A;  4GUV A;  1BKW A;  4KBM B;  3LK3 B;  4OPT A;  1JNZ A;  2I0Z A;  2H88 A;  1FEB A;  2VOU A;  3DJJ A;  2RGH A;  2BG9 E;  4UIG A;  5DQW A;  3BK9 A;  4TX5 A;  2PBI A;  4J57 A;  4WYV A;  5FY0 A;  1NWM X;  3NLC A;  3RQW A;  2PYJ A;  4Z8X A;  2W0G A;  4JDR A;  3CGD A;  2CPT A;  4K5R A;  1LVL A;  3LZW A;  2YWL A;  1RYI A;  2XQ5 A;  4TM4 A;  4B3M T;  1H7X A;  2UXN B;  3C4N A;  5JDF A;  4UVA B;  2YR4 A;  3CGB A;  4EED A;  2ARD A;  2XSB A;  4YT0 A;  1D7Y A;  1GAL A;  1EL5 A;  2V7M A;  2FJA A;  2BK4 A;  2WB5 A;  4U2Y A;  2R0P A;  3T31 A;  3PUQ A;  5HEG A;  3WE0 A;  3L8K A;  1F6M A;  3RED A;  5HXR A;  1N1P A;  1NHR A;  1SHZ C;  2DKI A;  2XVI A;  1E1N A;  2NR4 A;  2GAH B;  1MO9 A;  4JLE A;  3ZST A;  2H7O A;  4Y4M A;  2XM1 A;  3SZ0 A;  2VVS A;  3AD9 B;  2YG5 A;  1L9D A;  2C75 A;  1JRZ A;  4BJZ A;  2JIW A;  4U72 A;  1FJG T;  1PXC A;  2WP6 A;  4EIW A;  1GOS A;  1X79 A;  4DID B;  3ZMS B;  5M4Y A;  3II4 A;  4QXC B;  3SM8 A;  3I0Q A;  4RSL A;  3QK6 A;  4IDO A;  2Q7V A;  4L9I A;  4NZH A;  3P4P A;  3OKQ A;  2UUB T;  2CWY A;  4A97 A;  3EI0 A;  3OPC A;  4JI0 T;  2SPC A;  1D0Z A;  1WYC A;  4IDZ A;  1RMU 4;  3MKD A;  4J56 A;  2XQ3 A;  2LE8 A;  1REO A;  3FZH B;  3CK6 A;  3KVA A;  2ZM6 T;  1VRH 4;  1DXL A;  4LMJ A;  1MXT A;  4HN9 A;  4I4T E;  1YKH B;  1LRZ A;  2WU2 A;  1RUE 4;  2WM9 A;  3CPJ G;  4DO0 A;  1VBB 4;  4UVC B;  1WR0 A;  4DMW A;  4X1Y E;  2B9X A;  1EL8 A;  2TPR A;  4LF9 T;  4BA9 A;  2BK5 A;  2QYW A;  3ADA B;  3TLU A;  2V60 A;  4JI3 T;  5KMS A;  2RR1 4;  2ZZB A;  1PO2 4;  3MK7 C;  1ZMC A;  1LTX R;  1BF3 A;  4Y4N A;  1RUC 4;  1MNE A;  1M7K A;  2LSJ A;  1H83 A;  3IWA A;  2MPK A;  3EAM A;  4YSY A;  5JCN A;  4J2W A;  4QX7 B;  2CLY B;  4BJM A;  4TWF A;  4Q4W 4;  4DUY T;  2OLO A;  5LGN B;  5C8Y E;  1UUS A;  4CXX A;  4PJM A;  1D1C A;  5IQ1 A;  2V5D A;  3FMW A;  4E7Z A;  4CN4 A;  3ZMU B;  1Q1R A;  2V26 A;  2WET A;  4IST A;  2X66 A;  4NTE A;  2XVF A;  3C4X A;  2WAU A;  3UP4 A;  2RA1 A;  3AEB A;  3MA9 A;  2BG9 C;  3ETU A;  1WRD A;  2VVL A;  4GF7 A;  4AKG A;  4K8D A;  2V5Z A;  2VK9 A;  3FXD B;  2XVH A;  2C76 A;  5JR9 B;  2YDR A;  2JMK A; 
#chains in the Genus database with same CATH homology
 3UKL A;  4YTP A;  3GD4 A;  3AEA A;  2VRM A;  2C66 A;  5GRT A;  3UOZ A;  3NKS A;  4NEW A;  1O95 A;  1PBC A;  1FEA A;  4CRT A;  4EQW A;  3GDP A;  2VQB A;  1ZOV A;  2BCG G;  3DK9 A;  4YSX A;  1GTH A;  3UOV A;  4A65 A;  4KX6 A;  4B63 A;  1L0V A;  1FEC A;  1S3E A;  1GES A;  3CNS A;  1PJ5 A;  1OJ9 A;  4U2T A;  5U25 A;  3RP7 A;  4IVO B;  4H4R A;  3V3N A;  2OA1 A;  3AE6 A;  1DOE A;  3GQK A;  3RP6 A;  4TM0 A;  3UCL A;  4B66 A;  3DK4 A;  4Z24 A;  1TYT A;  1D5T A;  1E1K A;  2CDU A;  4B64 A;  3IF9 A;  3DA1 A;  3HYW A;  5BUL A;  3VRA A;  3IHM A;  2Z5X A;  2NPX A;  3AED A;  4MJW A;  1Y56 B;  3K30 A;  3GMC A;  3ATR A;  2PHH A;  4JN9 A;  2YG6 A;  2YG4 A;  5FS6 A;  4B65 A;  2ACZ A;  4J31 A;  1K0I A;  4I58 A;  5KWF A;  4BV6 A;  2EQ8 A;  3G5R A;  4PAA A;  3URH A;  1B37 A;  3SZF A;  4C74 A;  1XAN A;  4DNA A;  1KNR A;  5KVI A;  4JY3 A;  1B5Q A;  3NN0 X;  2LFC A;  3UKH A;  4NTC A;  2YVF A;  4OPU A;  2IID A;  3GYJ A;  1TDN A;  1L9E A;  2WOI A;  4IV9 A;  4IA6 A;  2JBV A;  3EPT A;  2GR2 A;  1ZP0 A;  3SFE A;  3NRN A;  2WS3 A;  1PBE A;  2YM1 A;  3GRS A;  2BAB A;  1F8W A;  3QSM A;  4ZCD A;  4B1B A;  2WQY A;  3BI5 A;  5J60 A;  4I59 A;  3T14 A;  2J3N A;  3AXB A;  2GF3 A;  4GCM A;  1KFY A;  2WPC A;  4C3X A;  3M12 A;  4PAB A;  3VRB A;  5IQ4 A;  3AE5 A;  3AEE A;  2R4E A;  3B6D A;  3GD3 A;  3UKQ A;  3QVR A;  4H4Z A;  1CL0 A;  2XFQ A;  4II3 A;  1B4V A;  1H82 A;  3AYL A;  4A6N A;  2YLR A;  3ABV A;  1GND A;  3UKA A;  5KOX A;  2R0G A;  1P2E A;  2IVE A;  2YR5 A;  1N4W A;  1D4D A;  4H4X A;  2E1M A;  4Z26 A;  4U8N A;  3V3O A;  1BZL A;  1D7L A;  3ICR A;  3UTH A;  1RP0 A;  1S3B A;  2YLS A;  3I6D A;  4O5Q A;  2GB0 A;  2XVE A;  3CND A;  1OJD A;  4CCQ A;  3ICS A;  3KLJ A;  2YVJ A;  4RG4 A;  3ZDN A;  1GEU A;  5ER0 A;  3E1T A;  4TLZ A;  5KRQ A;  1GRB A;  2QA2 A;  1N4V A;  2BRY A;  4EQX A;  2BC0 A;  4YTN A;  3NYE A;  4X9M A;  2GR0 A;  2R46 A;  4EM4 A;  4H50 A;  1K4Q A;  2BC1 A;  5JCI A;  3CNP A;  4JY2 A;  3LJP A;  3SX6 A;  2XFP A;  1XHC A;  4YKG A;  2FJD A;  4YTM A;  1S2Q A;  5M0Z A;  4AT2 A;  4N9X A;  5J7X A;  4J33 A;  1ZDL A;  2XLS A;  4LA1 A;  3UKF A;  4ZN0 A;  3BI4 A;  3KA7 A;  4WCT A;  2XFU A;  2X50 A;  2GQW A;  4UDQ A;  4C5O A;  1NG4 A;  1IUT A;  3AEG A;  4ECH A;  4OPL A;  1D4C A;  4ICY A;  2WEU A;  1V59 A;  3T0K A;  2X3N A;  2ZZ0 A;  4J36 A;  4II2 A;  5FS9 A;  3SXI A;  2C4C A;  4H4W A;  2Y6Q A;  4U8M A;  4UDP A;  4FDC B;  4B67 A;  4BJY A;  1VRQ B;  4OPC A;  3ALM A;  2VZ2 A;  1TRB A;  1GET A;  2YLX A;  2GR1 A;  3UP5 A;  1O94 A;  4H2P A;  3NGC X;  4U8P A;  2CUL A;  4J34 A;  1F8R A;  4K2X A;  2GH5 A;  2JAE A;  2BCP A;  2OAL A;  3ATQ A;  1CJ4 A;  3G5Q A;  2GMJ A;  2YAU A;  4TM1 A;  2C64 A;  1PXB A;  3FPZ A;  1EL7 A;  3D1C A;  5L46 A;  3M0O A;  2R9Z A;  4CY6 A;  2B7S A;  2B76 A;  4H4V A;  1GXF A;  1NAA A;  1VG0 A;  1HYU A;  2BS3 A;  2V6O A;  3AD8 B;  2WPF A;  3VR9 A;  1CC2 A;  3QSE A;  3QFA A;  5EOW A;  1CBO A;  3G5S A;  3AE3 A;  1Q1W A;  1FCD A;  4USR A;  1ZK7 A;  3GWF A;  5FMH A;  4KPR A;  5CQF A;  2JKC A;  3SY4 A;  2C70 A;  2X99 A;  5CKU A;  3H8L A;  2BAC A;  4EIQ A;  3P4S A;  2AAQ A;  4U2L A;  3KPF A;  4EM3 A;  1CJ2 A;  3BNM A;  4A99 A;  4TLX A;  1XDI A;  1FOH A;  4YXD A;  3L1R A;  3NHO X;  3UKK A;  4EMI A;  3IC9 A;  3NYC A;  2XYO A;  3AD7 B;  3AYI A;  4GR1 A;  4U8O A;  4EIP A;  5JCM A;  2XLP A;  3FG2 P;  4G9K A;  5FS7 A;  2BA9 A;  2BS2 A;  1S2Y A;  1CHU A;  2WU5 A;  2WOW A;  5KNL A;  4P9S A;  3NK0 X;  4DSG A;  1EBD A;  4FK1 C;  4RG3 A;  3Q9T A;  2QCU A;  3B3R A;  4NEV A;  3OZ2 A;  3QJ4 A;  3SUC A;  3C96 A;  1E1M A;  4EMW A;  4G6G A;  2QAE A;  2WBA A;  3P9U A;  4H4U A;  4YKF A;  1CJC A;  3K7M X;  2V3A A;  1CC6 A;  5EB5 A;  1W4X A;  3COX A;  1H86 A;  2OLN A;  3AE9 A;  3F8D A;  3KPK A;  5KOW A;  4A7A A;  4AT0 A;  3NG7 X;  4YSH A;  3AE7 A;  2E4G A;  2W0H A;  2O9Z A;  5M10 A;  2Q0K A;  2GRT A;  2GV8 A;  3K7T A;  3KD9 A;  3T2Z A;  4H4T A;  3LAD A;  3GSI A;  1PBF A;  1PDH A;  3T2Y A;  3QFB A;  2APG A;  3RNM A;  1UKV G;  1GRA A;  3HYV A;  3JSK A;  1KF6 A;  3F8R A;  1ELI A;  2B9W A;  3DGH A;  1ZMD A;  2H89 A;  3VQR A;  4Y4L A;  2A87 A;  4Z2R A;  1LJ1 A;  1NEK A;  1QJD A;  4WX1 A;  4G6H A;  2VQ7 A;  3BI2 A;  1RSG A;  2C7G A;  2GMH A;  3BHK A;  5C2T A;  4D03 A;  1F8S A;  3AEF A;  3OC4 A;  4APN A;  3NK2 X;  5JCK A;  3P4R A;  1TDO A;  3LB8 A;  1KDG A;  1TDE A;  4XWR A;  2CVJ A;  2BK3 A;  2BS4 A;  1Y56 A;  1XPQ A;  1CJ3 A;  2ZBW A;  4YSZ A;  3CPH G;  4AOX A;  3BHF A;  3T2K A;  3DME A;  4EQS A;  1QLB A;  1PJ7 A;  4BK1 A;  3EAN A;  4UDR A;  1OJA A;  3AEC A;  4B68 A;  4ADW A;  3GYX A;  4CNK A;  4YWO A;  1GPE A;  1DOD A;  1X31 B;  2YR6 A;  3S61 A;  1IJH A;  3QSS A;  4Z43 A;  1OJC A;  4FK1 A;  5GSN A;  1PN0 A;  2CFY A;  4K7Z A;  5BRT A;  3EF6 A;  2C72 A;  2WDQ A;  1DJN A;  3HYX A;  2EQ6 A;  2GR3 A;  2XFO A;  3ALJ A;  1YQZ A;  5KXJ A;  1L9C A;  2R4J A;  4HB9 A;  1N4U A;  3ISH A;  3LOV A;  1PHH A;  2BXS A;  2UZZ A;  3KKJ A;  1AOG A;  4H2Q A;  1PS9 A;  1LV0 A;  1GTE A;  2B7R A;  3SFD A;  4REK A;  3DH9 A;  2OAM A;  1ZY8 A;  3AB1 A;  2RGJ A;  1PJ6 A;  4USQ A;  2XLU A;  4BK2 A;  4EQR A;  3UKP A;  1E39 A;  2JB1 A;  3HZL A;  3ZYX A;  2FJB A;  4AOS A;  4CY8 A;  1VG9 A;  2XFN A;  5KMP A;  1KSU A;  2JB2 A;  3NN6 X;  1ZOY A;  1YY5 A;  4U8L A;  4GDP A;  5KVH A;  4Z25 A;  1CC4 A;  2YG3 A;  3GRT A;  2E5V A;  4U8J A;  2ZZC A;  4OPI A;  4GUV A;  4CBQ A;  1BKW A;  3ALL A;  4OPT A;  1JNZ A;  2I0Z A;  2H88 A;  1FEB A;  2VOU A;  3DGZ A;  1IUX A;  4JNA A;  3DJJ A;  1ZKQ A;  2RGH A;  2YLZ A;  4LII A;  1PBB A;  1LQU A;  4Z44 A;  5HXI A;  4AP3 A;  4DSH A;  5LV9 A;  2Q0L A;  4H4Y A;  2GVC A;  1GRH A;  2WES A;  2WDR A;  3NH3 X;  4H4P A;  4J57 A;  2DKH A;  3UOX A;  1H81 A;  3CPI G;  1ZX9 A;  1NDA A;  3P4Q A;  3NLC A;  4FX9 A;  1GRF A;  4GDE A;  1GSN A;  2C65 A;  2NVK X;  3NYF A;  1NHQ A;  1LQT A;  1YKJ A;  3CGE A;  3AE2 A;  4JDR A;  1IUW A;  3NTA A;  3CGD A;  2VRL A;  4K5R A;  4ZCC A;  1LVL A;  1OJT A;  3LZW A;  1TDK A;  2YWL A;  4CNJ A;  1JOA A;  3GMB A;  1Q9I A;  2Q6U A;  3CGC A;  1RYI A;  2XVJ A;  1PBD A;  3KU9 A;  3I3L A;  1H7W A;  1H7X A;  3IHG A;  4GAP A;  3C4N A;  2EQ7 A;  4IA5 A;  4TM4 A;  5KMR A;  1GER A;  1D4E A;  2YR4 A;  3CTY A;  2XDO A;  3CGB A;  5U63 A;  1GV4 A;  2FBW A;  2ARD A;  2WDV A;  1NG3 A;  2C3D A;  3V76 A;  3GQH A;  3VRD B;  3NT6 A;  1JU2 A;  1O5W A;  4YT0 A;  1D7Y A;  1GAL A;  5U1O A;  5BUK A;  3H4K A;  1E1L A;  1EL5 A;  1FL2 A;  3DJE A;  3DK8 A;  4HA6 A;  2FJA A;  4A9W A;  2BK4 A;  3PS9 A;  3M13 A;  3NNE A;  2R0P A;  3FIM B;  3T31 A;  2V3B A;  4O5U A;  3L8K A;  3WE0 A;  3CIR A;  1F6M A;  2GEW A;  3UOY A;  3RED A;  1F3P A;  2Y6R A;  2C73 A;  4XXG A;  4H7U A;  3QVP A;  1E7P A;  5TR3 A;  1N1P A;  1NHR A;  3CMM A;  2DKI A;  2XVI A;  4B69 A;  1E1N A;  4U8I A;  2YG7 A;  2GAH B;  1MO9 A;  4DGK A;  4D04 A;  1DOB A;  4OPG A;  4Y4M A;  3SQP A;  3DJG X;  1BGN A;  1IUV A;  3SZ0 A;  2AQJ A;  4A6N B;  3AD9 B;  2YG5 A;  1L9D A;  2A89 A;  2C75 A;  3NTD A;  1JRZ A;  4BJZ A;  1TDF A;  3AE1 A;  1PXC A;  2WP6 A;  3PO7 A;  1BWC A;  3UTE A;  4XWZ A;  4JQ9 A;  2YQU A;  1GOS A;  2R0C A;  2GAG B;  3H8I A;  1KSS A;  4A79 A;  4H4S A;  3RHA A;  1MOK A;  3II4 A;  4U8K A;  3SZC A;  1P2H A;  4CCR A;  1ONF A;  3SM8 A;  3LXD A;  1IUU A;  3ITJ A;  5FS8 A;  4AP1 A;  4RSL A;  1K0L A;  3GWD A;  1IUS A;  1NPX A;  4OCG A;  4OPD A;  4Z2U A;  1QO8 A;  2JB3 A;  1KNP A;  2Q7V A;  4NZH A;  4C77 A;  3P4P A;  4Z2T A;  2YM2 A;  5JCL A;  4G74 A;  1BGJ A;  1H6V A;  3K7Q X;  1B8S A;  2BYB A;  3NK1 X;  3AE8 A;  1LPF A;  3O0H A;  2A8X A;  2VVM A;  4H2R A;  3SYI A;  1SEZ A;  2EQ9 A;  2WOV A;  2X8C A;  4J56 A;  3KVE A;  4TM3 A;  1REO A;  3BNU A;  2R45 A;  1CF3 A;  4GRT A;  5HYM A;  5HY5 A;  2X8G A;  3FBS A;  2IVD A;  3R9U A;  3GDN A;  1DJQ A;  4A5L A;  5IPY A;  3AYJ A;  3UTG A;  1DXL A;  1NEN A;  5C3J A;  1MXT A;  1YQ4 A;  4EMJ A;  3EAO A;  4C3Y A;  3LZX A;  1YQ3 A;  2WU2 A;  1GT8 A;  4NTD A;  2FJE A;  3CPJ G;  2YLW A;  1DOC A;  1GRE A;  1E6E A;  1M6I A;  2B9X A;  2WPE A;  1EL8 A;  2TPR A;  2XLT A;  2YLT A;  2BK5 A;  4G73 A;  1JEH A;  1JRY A;  3ADA B;  2VVL G;  2V60 A;  3CNT A;  2PYX A;  3SGL A;  2GQF A;  2HQM A;  5KMS A;  1JRX A;  2TMD A;  2ZZB A;  1VDC A;  3C4A A;  3UTF A;  1ZMC A;  1LTX R;  3NIX A;  3D8X A;  2B9Y A;  3T37 A;  1BF3 A;  4E0V A;  4Y4N A;  4UP3 A;  4IVM B;  5EB4 A;  3P1W A;  1NHS A;  3AE4 A;  1H83 A;  1Y0P A;  2BRA A;  2Z5Y A;  2BXR A;  3IWA A;  3Q6J A;  3S5W A;  3SZW A;  5BVA A;  1GRG A;  3PVC A;  2AR8 A;  1PXA A;  1K0J A;  5DBJ A;  4YSY A;  5EBK A;  5JCN A;  5HHF A;  4H4Q A;  2QA1 A;  4K5S A;  4J2W A;  3RP8 A;  1NHP A;  3F8P A;  2F5Z A;  4OVI A;  1DNC A;  2YVG A;  4NWZ A;  2V61 A;  4JNQ A;  2OLO A;  2WP5 A;  1Z6L A;  3CN8 A;  4H2N A;  4K22 A;  4X9N A;  1VQW A;  2C3C A;  2C67 A;  3VR8 A;  2JK6 A;  3DJD A;  2WHD A;  3ICT A;  1M64 A;  5IQ1 A;  4X4J A;  3FMW A;  1Q1R A;  2WET A;  4U2S A;  1GRT A;  4NTE A;  4BUR A;  2XVF A;  2XCG A;  5KMQ A;  2WP9 A;  1TYP A;  3UP4 A;  3AEB A;  1EL9 A;  4K8D A;  2VVL A;  4GAV A;  4GF7 A;  4NNJ A;  3CNJ A;  2V5Z A;  1COY A;  2RGO A;  1JNR A;  2XLR A;  2XVH A;  4LU6 A;  2RAB A;  2C76 A;  2X8H A;  3AWI A;  4BK3 A;  4M52 A;  1H84 A;  3GYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...