3VR9A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
total genus 199
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr9A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr9A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr9A04
3UCLA 4DNAA 4J33A 3UTHA 3I3LA 3CGEA 3GWDA 5U63A 1E1NA 1F3PA 3NYCA 4H7UA 1DJQA 1DNCA 1CJ3A 4H4SA 4H4YA 4YSYA 3G5SA 3UKKA 2C73A 2YG6A 3ICRA 1NENA 1DJNA 2YVGA 4CCQA 2BXRA 3ADAB 1ONFA 4U8NA 2OLNA 2BK3A 1K0LA 4H4VA 3RP7A 1KDGA 1YQ4A 4N9XA 1TYPA 4Z24A 3SM8A 3D1CA 4CY8A 3UKPA 4J57A 2XFPA 3VR9A 4EMWA 1E1LA 5KOWA 4A7AA 1VG0A 2GQWA 2YR4A 2RGOA 3AEDA 1M64A 4OPUA 4ZCCA 3ICTA 2ACZA 2YM1A 3BNUA 3DGZA 3IHGA 4B67A 3DJGX 4USQA 3UOVA 2XVFA 2BS2A 4Y4LA 1L9DA 3NN0X 3ZDNA 2B7RA 3AYLA 1TDKA 2FJEA 5GSNA 3BI5A 1GSNA 2B9XA 3NIXA 4CCRA 1H82A 5C2TA 4CRTA 2NPXA 3F8DA 4U8KA 2XLUA 3UOYA 3RP6A 1CC6A 3AB1A 1CJ4A 5KVIA 3AEGA 2Z5YA 4U8OA 2XVIA 4GF7A 3CPJG 4YT0A 4B66A 2E5VA 1IUUA 3VRDB 3P4SA 2GMJA 2XYOA 3M0OA 4K2XA 5M10A 1V59A 4U2TA 5BUKA 1CC2A 3QVRA 1CHUA 1EL7A 1KF6A 1BWCA 2XFUA 4GDEA 1KSUA 2GR3A 3VR8A 3UP4A 4DGKA 1XPQA 2YVFA 2GQFA 3P4PA 1GTEA 1ZOYA 3I6DA 1RSGA 5BRTA 1XHCA 3QSMA 4NTDA 4C74A 1ZDLA 4YSHA 4LU6A 4BK1A 5KVHA 1BKWA 4C5OA 3C4AA 2WU5A 3AE3A 1BZLA 3OZ2A 4Y4NA 2VVLG 3CN8A 4K5RA 1PXCA 2C3DA 2Y6RA 5EOWA 4OPGA 1ZY8A 2F5ZA 4D03A 4AOSA 2ZZBA 3AE7A 2W0HA 4EMIA 4A9WA 3C4NA 4OPTA 2BS3A 1GEUA 3RP8A 1TDOA 3GQHA 2X8CA 3CNSA 4IVOB 4WCTA 1JU2A 5DBJA 3DK8A 1H81A 4NEVA 1UKVG 1PJ5A 3FBSA 2GEWA 4AT2A 4EMJA 1JRYA 2EQ8A 2H88A 2V3BA 3CTYA 1GERA 3L8KA 4NTCA 1TRBA 3S5WA 3NT6A 2IIDA 3FG2P 5IQ1A 4ECHA 3GDNA 3DH9A 3URHA 4B64A 4UDPA 3VRBA 2X3NA 2WOVA 1JNZA 3F8RA 1GESA 3GD3A 1E1KA 4H2NA 1Q1RA 4GUVA 1GRGA 1ZKQA 1NPXA 2BACA 3Q9TA 4JQ9A 1PBBA 4RG4A 4X9MA 3NTAA 1NAAA 1XANA 1N4WA 2WP9A 3AE8A 4P9SA 3AEEA 1N1PA 1TDFA 4XWZA 3PVCA 3C96A 2YLTA 3GQKA 3AECA 3FMWA 1EL5A 2PHHA 5CKUA 2FJBA 1S2YA 2B9WA 1NHQA 1JOAA 1LQTA 1E7PA 2C65A 4USRA 3AE1A 3NTDA 4TLXA 3NG7X 2C76A 2V3AA 2WDQA 3AE5A 4BURA 3ATQA 4ZN0A 4H2PA 5KRQA 2EQ9A 2WETA 4O5QA 5JCKA 1PJ7A 2JAEA 2NVKX 1E39A 1NHPA 3CNTA 1YQ3A 1VG9A 3PO7A 4Y4MA 5FS6A 4EQXA 1FCDA 4H2RA 2VQ7A 3NH3X 4JY3A 4J2WA 4A99A 2ARDA 2JB3A 2OA1A 2WPCA 4Z26A 3ICSA 4IVMB 4GCMA 3BI4A 1MO9A 2Q0LA 3ALJA 1H7XA 2YLXA 1CJ2A 3M13A 2AQJA 2A8XA 2JK6A 1KFYA 1D7LA 1OJAA 4KPRA 1N4UA 3QJ4A 1B8SA 1P2EA 4U8IA 2WOWA 1K4QA 3NK2X 1FEBA 2X50A 1OJCA 1GRBA 3DJEA 4H50A 3SQPA 2RGHA 2GAHB 2GR0A 1PN0A 4B1BA 1TDNA 1YY5A 2R4EA 2BYBA 3UKFA 1D7YA 2FJAA 1JRXA 1LTXR 3ALLA 2WPEA 3DA1A 3HZLA 1Q1WA 4U8PA 3FIMB 1MOKA 3ISHA 4E0VA 2BK4A 4U2LA 3AEBA 1CBOA 3COXA 3LOVA 1IJHA 4EIQA 2AR8A 2V60A 1FECA 1VQWA 4UDRA 4AP1A 4BJZA 3LXDA 2BK5A 2JB1A 1EL8A 5JCLA 3NGCX 3EANA 1GV4A 2BC0A 1Y0PA 3GYXA 4EQRA 4PABA 2GF3A 5TR3A 3P1WA 2XLSA 4ICYA 2C7GA 3CGCA 2AAQA 3CPHG 3KLJA 3RHAA 3RNMA 4X4JA 1RP0A 4O5UA 1BF3A 1W4XA 1CF3A 2X8GA 2R9ZA 4IA6A 4EM4A 4YKFA 2XVHA 2Q6UA 2GMHA 2WEUA 1Y56A 1NG3A 3BI2A 4BJYA 2WS3A 5IQ4A 3EAOA 1Z6LA 2GH5A 1IUVA 2R0CA 3GWFA 3UP5A 3UOXA 4LIIA 1GRAA 3VRAA 4K8DA 3NN6X 1GALA 4AP3A 4Z43A 1Y56B 2UZZA 2GRTA 3UOZA 2R46A 5HXIA 3K7MX 1ZK7A 4KX6A 1D4CA 2BCGG 1O95A 2X8HA 3P4QA 3WE0A 4YTMA 4ADWA 3DJDA 1F8RA 3V3OA 2QAEA 4FX9A 2BCPA 4NEWA 4TM4A 2WQYA 1L0VA 2ZZ0A 2YM2A 3REDA 4U2SA 4C3YA 1GRFA 2V5ZA 1ZX9A 4TM3A 2VRLA 3ALMA 3GYIA 3KVEA 3QSSA 5EB4A 3UKQA 1ELIA 4I59A 2CULA 1LV0A 4B69A 2CDUA 4GDPA 1B37A 1Q9IA 1VRQB 4YXDA 3H8LA 2IVEA 1OJDA 1AOGA 5CQFA 2DKIA 4YTPA 1PBEA 3AE9A 3GRSA 3CIRA 1YQZA 3P9UA 2J3NA 3GD4A 2YLWA 3AE6A 4K5SA 1JEHA 4JNAA 3D8XA 5KXJA 5KWFA 3AXBA 1IUTA 3DGHA 2WHDA 4REKA 4Z25A 2C70A 3UTGA 1OJTA 4APNA 3SUCA 2WDRA 2YLSA 4RSLA 2V61A 1S3EA 5GRTA 1NHRA 4RG3A 1ZMCA 2IVDA 1PBCA 5U25A 4AT0A 2QA1A 2Q0KA 1VDCA 4BV6A 1YKJA 1GRHA 2R0GA 2CFYA 3GYJA 1QJDA 4HA6A 1KNRA 1E1MA 3AYIA 4EQWA 1IUWA 3GSIA 2LFCA 4H4ZA 1H83A 3EPTA 5HHFA 2FJDA 1D5TA 1H7WA 3AD8B 2JBVA 4K22A 4D04A 1H6VA 2BABA 4FDCB 2C67A 3CGDA 2R0PA 3QVPA 3UKHA 3KU9A 2V6OA 1NDAA 1CL0A 3ITJA 3QSEA 2BC1A 3Q6JA 2OAMA 3DK9A 5JCMA 3NYFA 4YSXA 4I58A 4UDQA 1ZMDA 1PXBA 3QFBA 2B9YA 3T37A 1MXTA 1TDEA 4IA5A 2VVLA 3BHFA 2H89A 2VRMA 3CGBA 4EM3A 2JB2A 1QLBA 1LJ1A 3NK1X 3UTFA 3E1TA 4NZHA 3PS9A 1FOHA 2WP6A 3AEFA 2XVJA 2YVJA 3CNJA 5HY5A 3R9UA 1H86A 1L9CA 2XFOA 1CC4A 1H84A 4A79A 1DODA 4CY6A 4OVIA 2YG4A 4C77A 1S2QA 2XDOA 2WESA 3B3RA 3AD7B 3CPIG 1X31B 1RYIA 4JN9A 3G5RA 2C64A 3AE2A 4LA1A 1FL2A 4YTNA 2TMDA 3IHMA 1K0IA 4YKGA 3QFAA 1O94A 1GETA 4J36A 5U1OA 2YR6A 4B65A 3NHOX 2BXSA 2B76A 2YR5A 3KA7A 4TM0A 5M0ZA 3H8IA 2GR2A 1GTHA 2RGJA 4H4RA 3EF6A 3ZYXA 2XCGA 2XVEA 3KD9A 1ZOVA 2EQ7A 5LV9A 4Z44A 1JNRA 1DOEA 4FK1A 4U8JA 1GXFA 1LQUA 1L9EA 1JRZA 5FS7A 3UKAA 2YLZA 4JDRA 4A65A 1DOBA 1IUXA 1NEKA 2A89A 3CNDA 4J56A 3G5QA 2GAGB 4DSHA 1GOSA 1NG4A 5FS8A 5ER0A 3OC4A 3DJJA 3DMEA 2YG3A 5L46A 4K7ZA 2XLTA 4XWRA 1PDHA 1O5WA 3K7QX 4AOXA 3AE4A 1OJ9A 2X99A 3B6DA 4CNKA 1BGJA 3IWAA 1REOA 1S3BA 1LVLA 2EQ6A 3M12A 4B63A 1PHHA 1PS9A 3K30A 2BA9A 1ZP0A 1CJCA 1GNDA 5JCNA 4X9NA 4CBQA 2WU2A 1NHSA 3GRTA 3V3NA 3KKJA 3AD9B 4ZCDA 5KOXA 2YQUA 4J34A 2O9ZA 2OALA 2WOIA 2VZ2A 2XLRA 5FMHA 2FBWA 1B4VA 4J31A 5C3JA 5IPYA 1B5QA 5EB5A 4Z2RA 2A87A 2ZBWA 2I0ZA 4Z2UA 2WDVA 3KPFA 1DXLA 4M52A 3H4KA 3NKSA 4GR1A 2C66A 2RABA 3NLCA 4OPDA 5EBKA 2WP5A 4TLZA 3DK4A 4H4TA 4OPLA 3LZWA 2ZZCA 4JNQA 3IC9A 3S61A 2QCUA 3NRNA 2C3CA 4YWOA 3AWIA 5HYMA 3SFEA 1QO8A 3LB8A 4OPIA 3F8PA 1GPEA 4H4UA 4CNJA 2XFNA 2YG5A 1F8WA 3BNMA 2JKCA 1IUSA 1KSSA 3BHKA 1D4DA 3K7TA 3NYEA 2R4JA 1PBFA 2BS4A 3AEAA 1F8SA 2APGA 2VOUA 3L1RA 3GMBA 5BVAA 3UTEA 4H4QA 4A6NA 5FS9A 1E6EA 2YG7A 4A5LA 4DSGA 4JY2A 2GB0A 1PJ6A 3NK0X 4B68A 2XFQA 4H4XA 2GVCA 2QA2A 4YSZA 4XXGA 5J7XA 2OLOA 2TPRA 4Z2TA 1HYUA 2C72A 3AYJA 3V76A 2CVJA 1GT8A 2Y6QA 4H2QA 4OPCA 2GR1A 4FK1C 1GRTA 3NNEA 4EQSA 3JSKA 1XDIA 4WX1A 3GMCA 3ATRA 3SGLA 2XLPA 1N4VA 1KNPA 1EL9A 4H4WA 3IF9A 3ABVA 2Z5XA 1PBDA 4HB9A 2VVMA 3P4RA 2VQBA 4H4PA 3FPZA 4NTEA 2WPFA 4IV9A 1FEAA 4C3XA 3SFDA 2HQMA 3LADA 4U8MA 4OCGA 2Q7VA 5BULA 1PXAA 3LJPA 4U8LA 2PYXA 1GREA 1DOCA 2B7SA 2YLRA 4MJWA 5J60A 2YWLA 1P2HA 4PAAA 4UP3A 1M6IA 1SEZA 2DKHA 3O0HA 3VQRA 4EIPA 2E1MA 2YAUA 2C75A 1K0JA 2R45A 1BGNA 3UKLA 4BK3A 3LZXA 3II4A 1D4EA 1LPFA 2WBAA 1F6MA 4GRTA 4TM1A 1EBDA 2GV8A 3CNPA 4A6NB 1COYA 3GDPA 4BK2A 1TYTA 2E4GA 5JCIA
chains in the Genus database with same CATH superfamily
3UCLA 4J33A 3I3LA 5U63A 2LLYA 4B3RT 3RLFF 3ICRA 1NENA 3J8F4 3L09A 2EHOD 4CCQA 4DMVA 3T14A 1N36T 2BXRA 5IUXA 4NNJA 3KVBA 4CY8A 2EX3A 1E1LA 5KOWA 4HWHA 4A7AA 1VG0A 5HAXA 2IW5B 3AEDA 2RGOA 3ZKRA 2YM1A 3DGZA 1IJ6A 3UOVA 2HHHT 2BS2A 2WY2A 3NWIA 3R6NA 2LSGA 2B7RA 4DR5T 3VU7H 4CCRA 1RVF4 3F8DA 4U8KA 3GA8A 1XHZA 4U7IA 2WB5A 1XDPA 5KVIA 2E8IA 3AEGA 5FXVA 2XVIA 2LEHA 4GK0E 3M0OA 5JRCA 1CC2A 2WWVA 3FZLB 1CHUA 1BR1A 5LHGB 1KF6A 3AB3B 1XWMA 1XPQA 2YVFA 3RC8A 2KXPB 1GTEA 5L3GB 3JCFA 4ZS3A 4I43B 1XHCA 3PJAJ 3QSMA 5KVHA 2WU5A 5EOWA 5HEUA 1ZY8A 3C4NA 4YHJA 3RP8A 1TDOA 2XUEA 4HFCA 4DV6T 3ZC0A 2R044 1PJ5A 5LMUT 4C91A 3FBSA 2V3BA 1TRBA 3NT6A 4ZI3C 2XSBA 2LJLA 4B3MT 5IQ1A 2E9XC 3URHA 5L47A 3CWZB 4H9SE 1U5PA 2WMOA 4JQ9A 4J2CA 1N4WA 1W9RA 2WP9A 4IIJE 4P9SA 4XWZA 1HCIA 4N78D 3ANWB 3C96A 2KNDA 1YKHB 4EEBA 2UUBT 4YJ3E 3GQKA 2PHHA 2L3LA 1IJ5A 1MNEA 3K3QC 5CKUA 5ADXL 3RQWA 1NHQA 5JDLA 3JC6C 3NTDA 4TLXA 2V3AA 2WDQA 2NTYA 5AQQB 3ATQA 4KHZF 2XM1A 2EQ9A 3ZT5A 1PJ7A 4FJOA 1VG9A 1FCDA 3UFGA 2CPTA 2VQ7A 4NUVA 1UURA 1MMDA 4A99A 2ARDA 2JB3A 4Z26A 2BG9B 4H63V 2Q0LA 1H7XA 4UF0A 5FY7A 1OJAA 3L39A 2Y48B 1N4UA 1B8SA 4U8IA 2WOWA 3NK2X 2X50A 3RKGA 2WZIA 3RX6A 1WFDA 4OYKA 3MACA 5GONE 1PN0A 3I0QA 4B1BA 4JYAT 2BYBA 3ALLA 2WPEA 2MBGA 1D0ZA 5L3BB 3R84B 4ZZCA 3T1YT 4JEHB 3ZJ2A 3COXA 1Z7S4 2AR8A 2V60A 3RI5A 4O8SA 2OV9A 5JCLA 2H7VC 1Y0PA 4TX5A 2M67A 3ZYLA 2HPJA 3P1WA 4ICYA 1LVFA 3CGCA 2AAQA 1XHXA 3RNMA 3HI2A 1RP0A 4I4TE 4EM4A 1CF3A 3FZMB 3ZT7A 2XVHA 2CLYB 4WW0A 2BDEA 1Z6LA 1W09A 3GWFA 1YD8G 2UZZA 3UOZA 2GRTA 2XQ5A 2V7IA 2R46A 4QX7B 1D4CA 1O95A 2X8HA 3QC9A 5EK4A 2JQHA 4YJ2E 1F8RA 3N5LA 3RYCE 4MFRA 3KVAA 2WQYA 2PG8A 2H3RA 1POV0 2CWYA 4YLHA 4TM3A 4I55E 4HWIB 5HCJA 2K24A 3UKQA 1ELIA 2CA5A 1LV0A 2H7OA 4JI6T 4B69A 1Q9IA 3W15B 4AI6A 2WWUA 2IVEA 2W66A 5BR8T 5CQFA 4YTPA 3AE9A 3SZWA 2LSYA 4M1PA 2UUAT 2J3NA 4MALA 3AE6A 4G63A 2BZBA 4Z25A 2WHDA 5AQJB 1OJTA 3OBVE 2YLSA 4RSLA 4H9RC 1S3EA 4RG3A 1ZMCA 2IVDA 5U25A 4AT0A 5M4YA 4BV6A 2R0GA 3UU4A 4PK5A 3JAFA 3AYIA 1E1MA 2DLRA 4H4ZA 3EHZA 3PU3A 4K22A 1MIWA 2BABA 3PUWF 3ZSSA 4CI1B 5LHIB 1IBMT 4DNDA 4O4JE 4Q4X4 3UKHA 3KU9A 3RF1A 3ITJA 4B3TT 3KPKA 3DK9A 3IEEA 3ETVA 3Q5WA 3ZC1A 1TDEA 4ZOLE 2VVLA 3BHFA 2VRMA 3CGBA 4EM3A 1OEDE 5AQTB 3E1TA 4NZHA 3PS9A 2WP6A 3AEFA 3HKBE 3CNJA 4KHPT 5FY0A 1XNRT 3EI0A 4A79A 4OVIA 2YG4A 2X0YA 1XMOT 3ONJA 1S2QA 2WESA 3SWHA 3LFMA 1RYIA 4JN9A 1FEWA 1VCTA 2NR4A 2DI4A 1OXZA 5E0OA 4PW8A 3WAKA 4YTNA 2IAKA 3HYWA 2YKSA 1O94A 4J36A 2BXSA 2YK0A 4PNIA 2GR2A 2RGJA 1COV4 4DV2T 5LV9A 4Z44A 4Q4V4 5LOVE 1DOEA 3UKAA 2YLZA 2YEVC 1DOBA 4WNKA 2XASB 3UUNA 3MA9A 2V7MA 5LXTE 4DSHA 2E9XB 3OC4A 2D2SA 2AXDS 3DMEA 5L46A 2XLTA 4XWRA 3K7QX 3RRWA 4AOXA 1OJ9A 2PTFA 4UELA 1REOA 4IHJE 5AFUL 1LVLA 4KUMB 2EQ6A 2QYWA 4B63A 1PHHA 1PS9A 3K30A 5FY1A 1CJCA 4X9NA 2WU2A 3KKJA 3RRCA 4JV5T 2LOSA 1LKXA 2JQ9A 2YQUA 4J34A 2VZ2A 1S94A 3H37A 2FBWA 3X1DA 5C3JA 5IPYA 4HE8A 2ZBWA 3QUJA 2I0ZA 4PFPA 3ONLC 5AQUB 5FXXA 1AR74 3RC3A 4OPDA 2WP5A 2BKNA 4Q4Y4 2JPFA 4OPLA 2W63A 3UFEA 1HTJF 3IC9A 4JNQA 3O1HA 2X9YA 4H9PC 4G73A 4GAVA 3F8PA 3PURA 4CNJA 2V7LA 2EHOB 2XFNA 1DU2A 2IMLA 2MTQA 3K7TA 2ZM2A 5HEOA 4IE0A 3CVRA 2KINB 2LHRA 5BVAA 1UGOA 3UU6A 4H4QA 4A6NA 4X1IE 4X5TA 4WYVA 2KT9A 4JY2A 3NK0X 3LBXA 4B68A 5LA6E 2XFQA 4DR2T 4YSZA 2VKHA 4PFOA 3AYJA 3V76A 2L9QA 4O2BE 2CVJA 1GT8A 4OPCA 4ZZBA 5FXWA 5L3CB 1HXS4 4EQSA 1VBC4 4ISTA 3JSKA 2E9XD 4EXTA 3GMCA 1AR64 4B6XA 1N4VA 3RIAA 1PBDA 5JR9A 4HB9A 3P4RA 1N34T 4HTEA 4IV9A 3SFDA 3LADA 2Q7VA 5BULA 2Z6EA 5L4EA 2CBJA 1PVC4 4MJWA 2YWLA 1P2HA 1M6IA 1SEZA 4EIPA 4TNVA 4AXPA 3RIFA 1K0JA 2R45A 3UKLA 2LHNA 2XTLA 3HKCE 2WBAA 1F6MA 2GV8A 4A6NB 5F3JA 1TYTA 2E4GA 3UTHA 2MAWA 3CGEA 1E1NA 5LGUB 2VVSA 1DJQA 1FMWA 5JDQA 2R074 3G5SA 3UKKA 4ANJA 4RHV4 2LOPA 4JI5T 4U8NA 4LF5T 1ONFA 2OLNA 1MNDA 2BK3A 4H4VA 3RP7A 2MOZA 1KDGA 1YQ4A 4N9XA 3LK3B 1HX8A 2XFPA 3VR9A 3C64A 2ODVA 3DTOA 3QOFA 2ACZA 3IHGA 4YFSA 2XVFA 1L9DA 5HYAA 3I9WA 5CGMA 1TDKA 2FJEA 3BI5A 2B9XA 3NIXA 1H82A 5C2TA 1ZHCA 5BMVE 5L3FB 4TWDA 2XLUA 3UOYA 3FI7A 3PU8A 3F31A 1CUNA 3AB1A 4KI0F 2Z5YA 3ZMTB 4U8OA 1IAPA 1RMU4 3GN5B 4GB34 3VRDB 3P4SA 2C0SA 5LG4A 5M10A 1V59A 1AR94 4Z8XA 1VCSA 3AVSA 2BRYA 3KDSE 1EL7A 3GN5A 4V1Av 1BWCA 4G6HA 4GDEA 3VR8A 2XQAA 1OEDB 2VB6A 4DGKA 3ESLA 3N9MA 5LBMA 2W00A 1HX1B 4GYRA 2XAHB 2LKGA 1G8XA 2J47A 2XJ7A 4MBQA 3CMLA 3NZPA 4NTDA 4C74A 4LU6A 4BK1A 4ADZA 5FNVE 3OZ2A 5CFBA 2VVLG 4K5RA 4OPGA 4D03A 3I1AA 4AOSA 2ZZBA 4TUYE 1T72A 4A9WA 4ZS2A 4OPTA 5LG3A 4EOZB 2R6GF 2X8CA 2BBJA 5DBJA 3DK8A 5ABHA 4UF0B 2GEWA 4AT2A 3RIUC 1ZKEA 2V8SV 1JRYA 3CTYA 4G9KA 3G06A 2IIDA 2CXDA 4K0UA 3GDNA 2C5IT 3SZFA 4CN6A 4JEUB 3PUQA 2WOVA 1JNZA 4EYYR 3F8RA 1E1KA 2MYSA 2JRKA 4H2NA 1K5MD 2BBHA 2CMRA 1Z8UA 4O2AE 4WBNE 1NPXA 2BACA 4EYUA 4RG4A 3RYIE 3ZMSB 3N9PA 5AQLB 3ZSTA 4DUZT 1RUD4 3AEEA 1TDFA 5CA0E 4LFBT 3AECA 3FMWA 2RMU4 3PUYF 1S2YA 2B9WA 1UX5A 4ZI3D 2C65A 4H9NC 4ERRA 5L3DB 3NG7X 3AE5A 3Q2MA 3K1SA 3CMMA 1RUI4 1NHPA 5FS6A 1YQ3A 4EQXA 5F8PA 4H2RA 1EZ3A 2FUPA 4UR9A 4GKKT 4GCMA 3BI4A 2WZHA 3ZLIA 3Q9DA 4U2ZA 2YLXA 1RHI4 3JD74 4KPRA 2WAUA 1FEBA 4X1YE 2XAGB 2R064 1OJCA 1GRBA 4MHCA 3C4XA 4QXHB 2R4EA 3DA1A 2FJAA 4U8PA 1MOKA 1HFAA 5LP6E 1CBOA 5CJ5A 3LOVA 2OA5A 4L9IA 1VQWA 4UDRA 2LT3A 2BK5A 1EL8A 3NGCX 2VURA 1GV4A 3EDVA 2VL0A 5TR3A 3O1JA 2LSJA 3SYIA 2XQ3A 3KLJA 4X4JA 1W4XA 4YKFA 2NTXA 1D0XA 1Z0PA 5EZYE 3FZHB 5F5WA 1HNZT 2WEUA 5FVLA 3EABA 1IUVA 5AQSB 3UP5A 2V7KA 4TV9E 4K8DA 3NN6X 1GALA 4Z43A 2XQ4A 1RUF4 3OTOT 2EHOC 2CXLA 1ZK7A 1VBA4 4HN9A 4LMLA 2CLYC 2RPAA 1HG2A 4NEWA 5FKYA 2ZZ0A 3HR0A 5A1LA 2YM2A 3REDA 4U2SA 2V5ZA 1ZX9A 2VRLA 1RUE4 3ALMA 4HWDA 5EB4A 3MKDA 1UCUA 3VKHA 2JQQA 4YXDA 1IBKT 2EHOA 4AQFA 5ABEA 4HFIA 5L4HA 4FI5A 4AIUA 3AXBA 1LRZA 1IUTA 1U4QA 4APNA 3SUCA 1EAH4 2PW9A 1N33T 2MPKA 3EUHA 2OLTA 4IDPA 3AAEB 2XY8B 1YKJA 4CZZB 5JQGE 3GYJA 1QJDA 4JI8T 4DO0A 3NZQA 4UIGA 1H83A 5HHFA 2BG9C 3TLWA 4FDCB 3K3OA 1HNWT 2C67A 4QX8B 4LF9T 3QVPA 2VQET 3P50A 4GAPA 3QSEA 4CXYA 2OAMA 3NYFA 1ZMDA 3QFBA 1NA1D 1MXTA 3E0ZA 3L3PA 4IA5A 2Y8DA 3H3AA 4CN1A 3OJAA 1WYCA 2B1EA 2N9DA 1LJ1A 3NK1X 3KV6A 3R9UA 4CI2B 1H84A 2LSKA 5JRCB 4CY6A 4L0RA 3UT5E 4UEMA 3GWHA 3AE2A 1VRBA 2Q9QD 1FL2A 2TMDA 2BKPA 1K0IA 3UULA 1GETA 4B65A 5ABFB 4ILCA 2E2AA 2B76A 2BVLA 2RP4A 4TM0A 5M0ZA 1GTHA 4IT4A 3EF6A 2EQ7A 1XDOA 4IGUA 4JI1T 1LQUA 4EB6E 1JRZA 4DR1T 5FS7A 4IL9A 4JDRA 1IUXA 5FVKA 4JI7T 1GOSA 2HPLA 1NG4A 5FS8A 5ER0A 4LFAT 2A72A 4UV9B 2VQFT 5LMNT 2YG3A 1N32T 2LKHA 3OYXA 1PDHA 1NCQD 2I6HA 1VOMA 3AE4A 2X99A 3B6DA 1BGJA 3IWAA 2PYJA 1KK7A 2WSSV 2BA9A 1ZP0A 4DBQA 4CBQA 4AKHA 1NHSA 5DQVA 3HA4A 3AD9B 3PUVF 5JDGA 5FMHA 1KEYA 4X62T 4II3A 4G6GA 1B5QA 3O4XE 5EB5A 3NRXA 4LF7T 3KPFA 3TKLB 3H4KA 2RABA 3NLCA 4A98A 1WLXA 3UTKA 3U3IA 3IHRA 4OHFA 3LZWA 2ZZCA 3UU5A 5KNLA 3P7IA 3AWIA 1HRV4 4MLKA 1HS7A 1QO8A 3LB8A 3H3MA 1PO24 4PJLA 4TWHA 1F8WA 3BNMA 1US7B 1QUUA 2R4JA 2VKJA 3T2ZA 4DR4T 2BS4A 3AEAA 2VOUA 3L1RA 5IHYA 1I94T 2ES0A 1E6EA 4DSGA 2GB0A 1PJ6A 5KMPA 4HFVA 3KBUA 4E7SA 2YU2A 5J7XA 2OLOA 2TPRA 4Z2TA 5LB7B 2RS14 4JI2T 4FK1C 3IBPA 4QXBB 5IYZE 4AISA 1XDIA 5IWAT 3RH3A 2LSIA 1EL9A 3IF9A 3C4WA 2SPCA 2VVMA 5EK3A 2BVMA 1AL24 4H4PA 1MQTD 3AA0B 2PY5A 4ILUA 5ETWA 4L5GA 5FP3A 3HYVA 1FEAA 2NP9A 2Q9QB 2PYXA 3N9NA 2B7SA 5J60A 2RS34 4K0KT 1GQEA 3FB2A 2DKHA 3VQRA 2IIUA 4ILBA 4QKNA 5AQOB 2YAUA 2C75A 1WRDA 5CB4E 4DVDA 3LZXA 3II4A 3N2OA 1M62A 2V7JA 4GRTA 4TM1A 4DV1T 1B7TA 5JCIA 3GDPA 1YW0A 2K48A 5AQVB 5JTGA 1F3PA 3JADA 3OVUA 2A2FX 1DNCA 1CJ3A 4H4SA 4H4YA 2XQ9A 4XZCA 2YG6A 4ILAA 3BQIA 4KBMB 2YVGA 4UV8B 4C90A 4DUYT 5AQFB 5HEJA 3ADAB 1K0LA 3F2EA 3CX6B 3P4WA 1TYPA 2ZM0A 3SM8A 3D1CA 4J57A 4IL4A 2X0LB 3SZCA 4EMWA 1ZV4X 2GQWA 1M64A 4OPUA 4OX9T 3LJCA 5TAOA 3DJGX 4A97A 2BKOA 3OYZA 4Y4LA 4YHHT 4HGAA 3CX8B 3ZDNA 3AYLA 2XQ8A 1RUJ4 3P8CD 4DV4T 4EAHA 4CRTA 3MXZA 1X79A 2D5UA 3RP6A 2YINA 4AQGA 1CJ4A 3PUZF 3HKDE 3CPJG 4YT0A 4B66A 2XYOA 3LDQB 4U2TA 5BUKA 3QVRA 4DV7T 1AR84 4LMJA 3B13A 5LJNA 1KSUA 2GR3A 3UP4A 3L8RA 3CQCB 2C4CA 3P4PA 5FL0A 2YDSA 2W61A 1W0AA 1ZDLA 3TLSA 3KBTA 2CCQA 3AE3A 4A56A 4Y4NA 1PXCA 2C3DA 4JI4T 4U74A 4NIQA 3AE7A 2LRLA 3Q5XA 3C50A 4X64T 2IUBA 1MMNA 2D0TA 3GQHA 4WCTA 2L8KA 1JU2A 1H81A 2ZM6T 1UKVG 3JAEA 3N2KE 2EQ8A 3L8KA 4NTCA 3S5WA 2W67A 3KINB 4LFCT 3FZKB 4B64A 3GD3A 1D4M4 3HL6A 2G0UA 4X9MA 1NAAA 1XANA 2PBIA 3ZN1B 2YLTA 3QK6A 5AQPB 5KX5E 1EL5A 2JMHA 4DV5T 5KMRA 2FJBA 3AA7B 1JOAA 4USRA 1WR0A 4PK6A 2PFVA 4BURA 5KRQA 3MK7C 2WETA 2HWC4 4TV8E 1Y01A 4ZI2C 2IHR1 2JAEA 3CNTA 2IC6A 3N9QA 2J62A 3PO7A 4Y4MA 1FIOA 5LCYA 1LVKA 3ZCJA 3DJBA 3ICSA 4IVMB 1OWAA 3EAMA 2I0MA 1MO9A 2E5LT 2XAQB 3C98B 4DR6T 5J2TE 1CJ2A 3M13A 2A8XA 4EGWA 5C8YE 3QJ4A 4QHOA 1P2EA 3ZMUB 4NUUA 3Q5EA 3LK2B 3DJEA 4H50A 3SQPA 5HXEA 2GAHB 4P1NA 2GR0A 1TDNA 4IE5A 3UKFA 1D7YA 3HZLA 1IBLT 2JIWA 1SHZC 3PTRB 4E0VA 2BK4A 1FECA 4BA9A 2JB1A 3E22E 2BC0A 4EQRA 4PABA 2XLSA 2JQKA 2C7GA 3SY4A 1BF3A 2X8GA 2R9ZA 2XSAA 3T2KA 3PUSA 5KMGP 4IDNA 1NG3A 3ZYKA 5JDMA 4P09A 2GH5A 4DR7T 1VBE4 4LIIA 1GRAA 3ZN0B 1FMVA 1Y56B 5HXIA 5AQGB 3K7MX 4ADWA 2BCGG 3WE0A 4YTMA 5JDFA 3V3OA 2QAEA 2BCPA 2J4GA 4TM4A 4O4IE 2Q9QA 5JVDE 2VK9A 5LNKA 2D9DA 2CDUA 4GDPA 1B37A 2E9XA 2DL1A 1XMQT 1VRQB 3ZCIA 2UXBT 3CPZA 1OJDA 1HF8A 2DKIA 4UVBB 4QWNB 2K9AA 1T8BA 2XQ7A 3AXJA 3CIRA 3P9UA 4K5SA 1JEHA 4IDQA 1XZYA 2DWKA 2KZ7B 5KXJA 2C70A 2X51A 2WDRA 3D0TA 4DMWA 1NHRA 5HXSA 3AVRA 1NWMX 5LGNB 2QA1A 3K8PC 2Q0KA 3KV9A 1GRHA 4HA6A 3IF8B 4PJJA 1KNRA 3RYFE 2LFCA 3BQKA 3RYHE 3EPTA 4U2YA 2FJDA 2ACXA 4OK0A 3AD8B 4HWFA 2R0PA 2YOEA 2DCFA 4AKIA 2XQYA 5HEGA 1J5WA 4XAXB 1CL0A 3Q6JA 3PUAA 4CXWA 1PXBA 2B9YA 3T37A 4HFEA 3T31A 1T98A 2H89A 2X9HA 3SZ0A 2JB2A 1QLBA 3ZJ1A 3UTFA 3KV4A 1XI1A 2XVJA 2YVJA 2BG9A 3JC6D 5HWXA 5HY5A 2XFOA 2IDOB 2ZLYA 1WR6A 1DODA 3UU3A 4C77A 3ZEFB 2RS54 4H9QC 4TZ4C 1UUSA 3QB5A 3IA3A 4NXMT 4I50E 3PV0F 2HWB4 1SUMB 3QFAA 4YKGA 4PJNA 3NHOX 2YR5A 3KA7A 2VWAA 1HRI4 2M6IA 2XCGA 2XHEB 2XVEA 3UUBA 5KMQA 2CWOA 4U8JA 3SX6A 1GXFA 4GK5E 1BR4A 2V5CA 2A89A 3G5QA 2NW7A 2GAGB 1MMAA 2PZSA 3ZMZB 5LGTB 4PK4A 4K7ZA 4H9OC 4IDOA 1D1CA 4LMKA 3KFWX 4CNKA 3AXJB 1S3BA 4COFA 5FMNA 4ZHQE 2DWGA 2YU1A 3N2GE 3V5SA 3M12A 4U72A 3UQ7A 1GNDA 5JCNA 1D1BA 4BAYB 3QNUA 4I0UA 3WAJA 5KOXA 5DABA 2O9ZA 2XLRA 3F57A 1B4VA 4J31A 5JREA 4Z2RA 1T7SA 2A87A 3UUMA 2WDVA 2HH7A 1PO14 4GR1A 5EBKA 5JR9C 5DQWA 5JH7E 3FXDB 4H4TA 3RPUA 2M6BA 2QCUA 5AQNB 3NRNA 4YWOA 2CE7A 5HYMA 1E2AA 3SFEA 2X0HA 1GPEA 2V6YA 2YG5A 5HCMA 2JKCA 1IUSA 1KSSA 1OOPD 3NYEA 2V5DA 1PBFA 1D1AA 3NVOA 1F8SA 3GMBA 3WI3A 4CQIA 4F8HA 5FS9A 3N9OA 4A5LA 1Y64B 1HG5A 4U7YA 4H4XA 2QA2A 4XXGA 5AQKB 3ZT6A 2LE8A 1NAFA 2GR1A 4NWZA 3M65A 3ZYMA 1GRTA 3NNEA 2HN1A 2KWHA 3FHNA 4WX1A 4UVCB 3ATRA 3SGLA 1D0YA 3T1HT 1KNPA 1OEDA 4ZEYA 2Z5XA 2VKDA 2VQBA 2UXNB 2CHOA 2HN2A 1J1JA 4NTEA 3U78A 2WPFA 3J7Yq 4C3XA 2HQMA 4U8MA 4LF4T 4DBRA 2XPKA 4F6RC 2KMFA 4EIWA 3LJPA 2X9XA 2W62A 1GREA 2YLRA 4PAAA 3O0HA 3MZKB 2E1MA 3B5MA 3Q5DA 1RUG4 4GIWA 4BK3A 1BGNA 3J9X1 1D4EA 3FBLA 3N9LA 5DJQC 3CNPA 1COYA 4H4RA 2CM0A 2Q9QC 4DNAA 3GWDA 2D0UA 2VASA 3NYCA 4H7UA 4YSYA 4OFZA 4IREA 2C73A 1PIV4 1DJNA 5AQHB 3EDUA 3SXIA 1SE7A 4IE4A 5J1GA 3T0KA 2W4XA 4O4HE 4HEAA 2I59A 4Z24A 5HXCA 5JR9B 3UKPA 2YR4A 4ZCCA 3ICTA 2V6YB 2UXXB 2WCAA 3BNUA 4B67A 4USQA 3SOLA 3NN0X 4YY3T 3NBXX 4AKRB 5GSNA 5HEHA 1X9BA 4BJNA 4AQFC 1GSNA 2NPXA 4P0BA 3VHLA 4HWCA 2W0GA 4HFHA 1CC6A 3OPCA 4QH4A 5HWYA 1HR0T 4GF7A 2V1DB 2E5VA 1IUUA 2N2NA 2GMJA 5L2LA 2V26A 4K2XA 4NPPA 5EK2A 2BG9E 3PUGA 2XFUA 4DV3T 3FZFB 2CBIA 3O1IA 2PYLA 4X66T 1MIVA 2GQFA 3C51A 1ZOYA 2XZEA 3I6DA 1RSGA 5BRTA 3E08A 3T2YA 4YSHA 4GOUA 4HFDA 5ABGA 1HNXT 1BKWA 3C4AA 4C5OA 1BZLA 5JDHA 3CN8A 2Y6RA 4TN7B 2F5ZA 2K5BB 2W0HA 3BQLA 4EMIA 3KV5A 4UVAB 3O9XA 2BS3A 1GEUA 4WZXA 3CNSA 4IVOB 1UK5A 3LK42 4NEVA 4A5XA 2JMKA 4GYSA 4JI3T 4OYJA 4EMJA 2H88A 3RQUA 1GERA 3FG2P 3BK9A 4ECHA 3DH9A 4UDPA 3VRBA 4EZHA 2X3NA 2DNXA 1GESA 2YN6A 1Q1RA 4GUVA 4ASKA 1KNZA 1GRGA 1ZKQA 3Q9TA 2KWIB 2C5KT 3SRZA 2UXDT 1PBBA 1G73A 3NTAA 2BRAA 3AE8A 1N1PA 2UU9T 4PDWD 3PVCA 3FBZA 2RA1A 4HFBA 5JDNA 5HXHA 1LQTA 1E7PA 1I6ZA 4IE6A 3AE1A 3RHWA 2C76A 4ZN0A 2NW9A 4H2PA 2KSRA 2Y6XA 4O5QA 5JCKA 2NVKX 1E39A 3DP7A 1R8IA 3C4ZA 3ZMVB 3NH3X 4JY3A 3S4UA 4J2WA 3MJXA 2OA1A 2WPCA 5KMSA 1R094 2V6XA 1S35A 1ASJ4 3ALJA 3LSVA 2AQJA 2JK6A 1KFYA 1BR0A 1D7LA 4HKAA 2XQ6A 1K4QA 1IZNB 3FXEB 5LJMA 5FXZA 2RGHA 4EEDA 4G2AA 5H6RB 1YY5A 4Q4W4 1JRXA 1LTXR 1Q1WA 2A9UA 3FIMB 3TLTA 3ISHA 1RUC4 2CEAA 3AEBA 4U2LA 4EIQA 1IJHA 4AP1A 3RIUA 2VVNA 4LF8T 4BJZA 3LXDA 4GKJT 3EANA 2R7FA 2JJ9A 3GYXA 2GF3A 4P0AA 3HYXA 3TLVA 3V5UA 3CPHG 4X20E 3RHAA 4O5UA 2LM2A 4IA6A 2CXFA 2UUCT 1WYBA 1OEDC 2GMHA 2Q6UA 3A5XA 2J1DG 1Y56A 3BI2A 4BJYA 2WS3A 5IQ4A 2QRXA 3EAOA 1H7CA 3I9YA 2R0CA 4DR3T 3UOXA 3JBG4 4U31A 3VRAA 4AP3A 3RGLA 2K3WA 4KX6A 4U33A 3P4QA 3DJDA 1V9DA 1O3XA 2X9WA 3A8YC 4LF6T 4IE7A 4FX9A 1L0VA 4C3YA 5J0ZA 3T8OA 1GRFA 2QVAA 3GYIA 3TLUA 4QH5A 3KVEA 3QSSA 2LRKA 4I59A 2CULA 4E7ZA 4II2A 3H8LA 1AOGA 1PBEA 3QB5K 3GRSA 1YQZA 3UU8A 3GD4A 1R084 5AQMB 2YLWA 4JNAA 3D8XA 5KWFA 3A7MA 5AQIB 3DGHA 4REKA 3UTGA 2WBLA 4PJMA 2V61A 5GRTA 2DHRA 1PBCA 2ZMAA 2RM24 2YDQA 3OKQA 1YXRA 4B3ST 1VDCA 3PDYA 1FJGT 2ODUA 2CFYA 4AQYT 2PLV4 4JI0T 3M3ZB 4EQWA 1IUWA 3GSIA 3NKZA 1WCRA 1D5TA 1H7WA 2JBVA 4D04A 1H6VA 3CGDA 3GMIA 1BEV4 3K3NA 4BJMA 3ETUA 2V6OA 1NDAA 4AKLA 1H8TD 2BC1A 3PUXF 5JCMA 4UDQA 4YSXA 4I58A 3AAIA 3PJAA 2XAFB 1ZEEA 1VRH4 2QGSA 2WM9A 3UQ4A 2X66A 4Z91A 1FOHA 2XM2A 3CQXC 1H86A 3AA1B 1L9CA 1J5ET 1CC4A 4IDZA 2YDRA 2NWBA 2KLQA 1W0BA 2XDOA 3B3RA 3AD7B 3CPIG 3B57A 3LG7A 1X31B 5ABFA 3G5RA 4ZI7E 2C64A 4LA1A 4U3CA 4CN4A 3HKEE 3IHMA 5U1OA 2YR6A 3H8IA 1EV14 5FYMA 3ZYXA 3KD9A 1ZOVA 3NRYA 3CQGB 1JNRA 5LBQB 4FK1A 4EV6A 1L9EA 1AJ3A 4A65A 2PJQA 2CHNA 1NEKA 2W2UA 3CNDA 4J56A 5CA1E 5H6QB 4NXNT 5AQRB 1M7KA 2N1GA 3DJJA 2LM9A 1O5WA 4DV0T 5LYJE 3AAAB 4QXCB 4TWFA 2UXCT 4CXXA 4KP3C 2GK9A 3UUXB 4KMCA 4JBWF 2IC9A 3RKOA 4DIDB 3GRTA 5LHHB 2AE9A 3V3NA 3CK6A 4ZCDA 2NW8A 2WOIA 2OALA 1BR2A 3AA6B 3ANWA 3CKDA 1VBB4 2X67A 4TNWA 4Q25A 3VKGA 4Z2UA 2RR14 3SS1A 1DXLA 4M52A 5KDMC 4G74A 3LBXB 3NKSA 2C66A 4JUYA 4TLZA 3ZPOA 3DK4A 4ZI2D 5J2UE 3S61A 3I0OA 2C3CA 2VL8A 4Z90A 1XNQT 4OPIA 4H4UA 2C5JA 3BHKA 1D4DA 2NOXA 1QSDA 2APGA 3UTEA 2YG7A 1VBD4 4AKGA 1UX4A 5HXRA 4H63H 2F4VT 2GVCA 4JLEA 2P9BA 2X68A 4UXNB 1HYUA 2C72A 3ONXA 2CRBA 2Y6QA 4H2QA 2ZM8A 4X1KE 5FL1A 4QH1A 1E1HB 2XLPA 4H4WA 3ABVA 4PAGA 3FPZA 4ISSA 2XAJB 1MMGA 1RUH4 2VKOA 4EZ4A 4OCGA 1YKEB 3EVYA 4O4LE 1PXAA 3PE0A 3CX7B 4U8LA 4CI3B 1DOCA 2A3DA 1MIYA 4UP3A 4ZXLA 2X5ID 2QA7A 4XBFB 2WMNA 5L3EB 1SA0E 4X65T 1LPFA 1EBDA 4BK2A 4WBOA
chains in the Genus database with same CATH topology
3UCLA 4DNAA 4J33A 3UTHA 3I3LA 3CGEA 3GWDA 5U63A 1E1NA 1F3PA 3NYCA 4H7UA 1DJQA 1DNCA 1CJ3A 4H4SA 4H4YA 4YSYA 3G5SA 3UKKA 2C73A 2YG6A 3ICRA 1NENA 1DJNA 2YVGA 4CCQA 3T14A 2BXRA 3ADAB 1ONFA 4U8NA 3SXIA 2OLNA 2BK3A 1K0LA 4H4VA 4NNJA 3RP7A 1KDGA 3T0KA 1YQ4A 4N9XA 1TYPA 4Z24A 3SM8A 3D1CA 4CY8A 3UKPA 4J57A 2XFPA 3SZCA 3VR9A 4EMWA 1E1LA 5KOWA 4A7AA 1VG0A 2GQWA 2YR4A 2RGOA 3AEDA 1M64A 4OPUA 4ZCCA 3ICTA 2ACZA 2YM1A 3BNUA 3DGZA 3IHGA 4B67A 3DJGX 4USQA 3UOVA 2XVFA 2BS2A 4Y4LA 1L9DA 3NN0X 3ZDNA 2B7RA 3AYLA 1TDKA 2FJEA 5GSNA 3BI5A 1GSNA 2B9XA 3NIXA 4CCRA 1H82A 5C2TA 4CRTA 2NPXA 3F8DA 4U8KA 2XLUA 3UOYA 3RP6A 1CC6A 3AB1A 1CJ4A 5KVIA 3AEGA 2Z5YA 4U8OA 2XVIA 4GF7A 3CPJG 4YT0A 4B66A 2E5VA 1IUUA 3VRDB 3P4SA 2GMJA 2XYOA 3M0OA 4K2XA 5M10A 1V59A 4U2TA 5BUKA 1CC2A 2BRYA 3QVRA 1CHUA 1EL7A 1KF6A 1BWCA 2XFUA 4G6HA 1KSUA 2GR3A 4GDEA 3VR8A 3UP4A 4DGKA 1XPQA 2YVFA 2C4CA 3P4PA 1GTEA 2GQFA 1ZOYA 3I6DA 1RSGA 5BRTA 1XHCA 3QSMA 3T2YA 4NTDA 4C74A 1ZDLA 4YSHA 4LU6A 4BK1A 5KVHA 1BKWA 4C5OA 3C4AA 2WU5A 3AE3A 1BZLA 3OZ2A 4Y4NA 2VVLG 3CN8A 4K5RA 1PXCA 2C3DA 2Y6RA 5EOWA 4OPGA 1ZY8A 2F5ZA 4D03A 4AOSA 2ZZBA 3AE7A 2W0HA 4EMIA 4A9WA 3C4NA 4OPTA 2BS3A 1GEUA 3RP8A 1TDOA 3GQHA 2X8CA 3CNSA 4IVOB 4WCTA 1JU2A 5DBJA 3DK8A 1H81A 4NEVA 1UKVG 1PJ5A 3FBSA 2GEWA 4AT2A 4EMJA 1JRYA 2EQ8A 2H88A 2V3BA 3CTYA 1GERA 3L8KA 4NTCA 1TRBA 3S5WA 4G9KA 3NT6A 2IIDA 3FG2P 5IQ1A 4ECHA 3GDNA 3DH9A 3URHA 3SZFA 4B64A 4UDPA 3VRBA 2X3NA 2WOVA 1JNZA 3F8RA 1GESA 3GD3A 1E1KA 4H2NA 1Q1RA 4GUVA 1GRGA 1ZKQA 1NPXA 2BACA 3Q9TA 4JQ9A 1PBBA 4RG4A 4X9MA 3NTAA 1NAAA 1XANA 2BRAA 1N4WA 2WP9A 3AE8A 4P9SA 3AEEA 1N1PA 1TDFA 4XWZA 3PVCA 3C96A 2YLTA 3GQKA 3AECA 3FMWA 1EL5A 2PHHA 5CKUA 5KMRA 2FJBA 1S2YA 2B9WA 1NHQA 1JOAA 1LQTA 1E7PA 2C65A 4USRA 3AE1A 3NTDA 4TLXA 3NG7X 2C76A 2V3AA 2WDQA 3AE5A 4BURA 3ATQA 4ZN0A 4H2PA 5KRQA 2EQ9A 2WETA 4O5QA 5JCKA 3CMMA 1PJ7A 2JAEA 2NVKX 1E39A 1NHPA 3CNTA 1YQ3A 1VG9A 3PO7A 4Y4MA 5FS6A 4EQXA 1FCDA 4H2RA 2VQ7A 3NH3X 4JY3A 4J2WA 4A99A 2ARDA 2JB3A 2OA1A 2WPCA 4Z26A 5KMSA 3ICSA 4IVMB 4GCMA 3BI4A 1MO9A 2Q0LA 3ALJA 1H7XA 2YLXA 1CJ2A 3M13A 2AQJA 2A8XA 2JK6A 1KFYA 1D7LA 1OJAA 4KPRA 1N4UA 3QJ4A 1B8SA 1P2EA 4U8IA 2WOWA 1K4QA 3NK2X 1FEBA 2X50A 1OJCA 1GRBA 3DJEA 4H50A 3SQPA 2RGHA 2GAHB 2GR0A 1PN0A 4B1BA 1TDNA 1YY5A 2R4EA 2BYBA 3UKFA 1D7YA 2FJAA 1JRXA 1LTXR 3ALLA 2WPEA 3DA1A 3HZLA 1Q1WA 4U8PA 3FIMB 1MOKA 3ISHA 4E0VA 2BK4A 4U2LA 3AEBA 1CBOA 3COXA 3LOVA 1IJHA 4EIQA 2AR8A 2V60A 1FECA 1VQWA 4UDRA 4AP1A 4BJZA 3LXDA 2BK5A 2JB1A 1EL8A 5JCLA 3NGCX 3EANA 1GV4A 2BC0A 1Y0PA 3GYXA 4EQRA 4PABA 2GF3A 5TR3A 3P1WA 2XLSA 4ICYA 3HYXA 2C7GA 3CGCA 2AAQA 3CPHG 3KLJA 3RHAA 3SY4A 3RNMA 4X4JA 3SYIA 1RP0A 4O5UA 1BF3A 1W4XA 1CF3A 2X8GA 2R9ZA 4IA6A 3T2KA 4YKFA 4EM4A 2XVHA 2Q6UA 2GMHA 2WEUA 1Y56A 1NG3A 3BI2A 4BJYA 2WS3A 5IQ4A 3EAOA 1Z6LA 2GH5A 1IUVA 2R0CA 3GWFA 3UP5A 3UOXA 4LIIA 1GRAA 3VRAA 4K8DA 3NN6X 1GALA 4AP3A 4Z43A 1Y56B 2UZZA 2GRTA 3UOZA 2R46A 5HXIA 3K7MX 1ZK7A 4KX6A 1D4CA 2BCGG 1O95A 2X8HA 3P4QA 3WE0A 4YTMA 4ADWA 3DJDA 1F8RA 3V3OA 2QAEA 4FX9A 2BCPA 4NEWA 4TM4A 2WQYA 1L0VA 2ZZ0A 2YM2A 3REDA 4U2SA 4C3YA 1GRFA 2V5ZA 1ZX9A 4TM3A 2VRLA 3ALMA 3GYIA 3KVEA 3QSSA 5EB4A 3UKQA 1ELIA 4I59A 2CULA 1LV0A 4B69A 2CDUA 4GDPA 1B37A 4II2A 1Q9IA 1VRQB 4YXDA 3H8LA 2IVEA 1OJDA 1AOGA 5CQFA 2DKIA 4YTPA 1PBEA 3AE9A 3GRSA 3SZWA 3CIRA 1YQZA 3P9UA 2J3NA 3GD4A 2YLWA 3AE6A 4K5SA 1JEHA 4JNAA 3D8XA 5KXJA 5KWFA 3AXBA 1IUTA 3DGHA 2WHDA 4REKA 4Z25A 2C70A 3UTGA 1OJTA 4APNA 3SUCA 2WDRA 2YLSA 4RSLA 2V61A 1S3EA 5GRTA 1NHRA 4RG3A 1ZMCA 2IVDA 1PBCA 5U25A 4AT0A 2QA1A 2Q0KA 1VDCA 4BV6A 1YKJA 1GRHA 2R0GA 2CFYA 3GYJA 1QJDA 4HA6A 1KNRA 1E1MA 3AYIA 4EQWA 1IUWA 3GSIA 2LFCA 4H4ZA 1H83A 3EPTA 5HHFA 2FJDA 1D5TA 1H7WA 3AD8B 2JBVA 4K22A 4D04A 1H6VA 2BABA 4FDCB 2C67A 3CGDA 2R0PA 3QVPA 3UKHA 3KU9A 2V6OA 1NDAA 4GAPA 1CL0A 3ITJA 3QSEA 2BC1A 3Q6JA 3KPKA 2OAMA 3DK9A 5JCMA 3NYFA 4YSXA 4I58A 4UDQA 1ZMDA 1PXBA 3QFBA 2B9YA 3T37A 1MXTA 1TDEA 3T31A 4IA5A 2VVLA 3BHFA 2H89A 2VRMA 3CGBA 3SZ0A 4EM3A 2JB2A 1QLBA 1LJ1A 3NK1X 3UTFA 3E1TA 4NZHA 3PS9A 1FOHA 2WP6A 3AEFA 2XVJA 2YVJA 3CNJA 5HY5A 3R9UA 1H86A 1L9CA 2XFOA 1CC4A 1H84A 4A79A 1DODA 4CY6A 4OVIA 2YG4A 4C77A 1S2QA 2XDOA 2WESA 3B3RA 3AD7B 3CPIG 1X31B 1RYIA 4JN9A 3G5RA 2C64A 3AE2A 4LA1A 1FL2A 4YTNA 2TMDA 3HYWA 3IHMA 1K0IA 4YKGA 3QFAA 1O94A 1GETA 4J36A 5U1OA 2YR6A 4B65A 3NHOX 2BXSA 2B76A 2YR5A 3KA7A 4TM0A 5M0ZA 3H8IA 2GR2A 1GTHA 2RGJA 4H4RA 3EF6A 3ZYXA 2XCGA 2XVEA 5KMQA 3KD9A 1ZOVA 2EQ7A 5LV9A 4Z44A 1JNRA 1DOEA 4FK1A 4U8JA 3SX6A 1GXFA 1LQUA 1L9EA 1JRZA 5FS7A 3UKAA 2YLZA 4JDRA 4A65A 1DOBA 1IUXA 1NEKA 2A89A 3CNDA 4J56A 3G5QA 2GAGB 4DSHA 1GOSA 1NG4A 5FS8A 5ER0A 3OC4A 3DJJA 3DMEA 2YG3A 5L46A 4K7ZA 2XLTA 4XWRA 1PDHA 1O5WA 3K7QX 4AOXA 3AE4A 1OJ9A 2X99A 3B6DA 4CNKA 1BGJA 3IWAA 1REOA 1S3BA 1LVLA 2EQ6A 3M12A 4B63A 1PHHA 1PS9A 3K30A 2BA9A 1ZP0A 1CJCA 1GNDA 5JCNA 4X9NA 4CBQA 2WU2A 1NHSA 3GRTA 3V3NA 3KKJA 3AD9B 4ZCDA 5KOXA 2YQUA 4J34A 2O9ZA 2OALA 2WOIA 2VZ2A 2XLRA 5FMHA 4II3A 2FBWA 1B4VA 4G6GA 4J31A 5C3JA 5IPYA 1B5QA 5EB5A 4Z2RA 2A87A 2ZBWA 2I0ZA 4Z2UA 2WDVA 3KPFA 1DXLA 4M52A 4G74A 3H4KA 3NKSA 4GR1A 2C66A 2RABA 3NLCA 4OPDA 5EBKA 2WP5A 4TLZA 3DK4A 4H4TA 4OPLA 3LZWA 2ZZCA 4JNQA 3IC9A 5KNLA 3S61A 2QCUA 3NRNA 2C3CA 4YWOA 3AWIA 4G73A 4GAVA 5HYMA 3SFEA 1QO8A 3LB8A 4OPIA 3F8PA 1GPEA 4H4UA 4CNJA 2XFNA 2YG5A 1F8WA 3BNMA 2JKCA 1IUSA 1KSSA 3BHKA 1D4DA 3K7TA 3NYEA 2R4JA 1PBFA 3T2ZA 2BS4A 3AEAA 1F8SA 2APGA 2VOUA 3L1RA 3GMBA 5BVAA 3UTEA 4H4QA 4A6NA 5FS9A 1E6EA 2YG7A 4A5LA 4DSGA 4JY2A 2GB0A 1PJ6A 3NK0X 5KMPA 4B68A 2XFQA 4H4XA 2GVCA 2QA2A 4YSZA 4XXGA 5J7XA 2OLOA 2TPRA 4Z2TA 1HYUA 2C72A 3AYJA 3V76A 2CVJA 1GT8A 2Y6QA 4H2QA 4OPCA 2GR1A 4NWZA 4FK1C 1GRTA 3NNEA 4EQSA 3JSKA 1XDIA 4WX1A 3GMCA 3ATRA 3SGLA 2XLPA 1N4VA 1KNPA 1EL9A 4H4WA 3IF9A 3ABVA 2Z5XA 1PBDA 4HB9A 2VVMA 3P4RA 2VQBA 4H4PA 3FPZA 4NTEA 2WPFA 4IV9A 3HYVA 1FEAA 4C3XA 3SFDA 2HQMA 3LADA 4U8MA 4OCGA 2Q7VA 5BULA 1PXAA 3LJPA 4U8LA 2PYXA 1GREA 1DOCA 2B7SA 2YLRA 4MJWA 5J60A 2YWLA 1P2HA 4PAAA 4UP3A 1M6IA 1SEZA 2DKHA 3O0HA 3VQRA 4EIPA 2E1MA 2YAUA 2C75A 1K0JA 2R45A 1BGNA 3UKLA 4BK3A 3LZXA 3II4A 1D4EA 1LPFA 2WBAA 1F6MA 4GRTA 4TM1A 1EBDA 2GV8A 3CNPA 4A6NB 1COYA 3GDPA 4BK2A 1TYTA 2E4GA 5JCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UCL A;  4DNA A;  4J33 A;  3UTH A;  3I3L A;  3CGE A;  3GWD A;  5U63 A;  1E1N A;  1F3P A;  3NYC A;  4H7U A;  1DJQ A;  1DNC A;  1CJ3 A;  4H4S A;  4H4Y A;  4YSY A;  3G5S A;  3UKK A;  2C73 A;  2YG6 A;  3ICR A;  1NEN A;  1DJN A;  2YVG A;  4CCQ A;  2BXR A;  3ADA B;  1ONF A;  4U8N A;  2OLN A;  2BK3 A;  1K0L A;  4H4V A;  3RP7 A;  1KDG A;  1YQ4 A;  4N9X A;  1TYP A;  4Z24 A;  3SM8 A;  3D1C A;  4CY8 A;  3UKP A;  4J57 A;  2XFP A;  3VR9 A;  4EMW A;  1E1L A;  5KOW A;  4A7A A;  1VG0 A;  2GQW A;  2YR4 A;  2RGO A;  3AED A;  1M64 A;  4OPU A;  4ZCC A;  3ICT A;  2ACZ A;  2YM1 A;  3BNU A;  3DGZ A;  3IHG A;  4B67 A;  3DJG X;  4USQ A;  3UOV A;  2XVF A;  2BS2 A;  4Y4L A;  1L9D A;  3NN0 X;  3ZDN A;  2B7R A;  3AYL A;  1TDK A;  2FJE A;  5GSN A;  3BI5 A;  1GSN A;  2B9X A;  3NIX A;  4CCR A;  1H82 A;  5C2T A;  4CRT A;  2NPX A;  3F8D A;  4U8K A;  2XLU A;  3UOY A;  3RP6 A;  1CC6 A;  3AB1 A;  1CJ4 A;  5KVI A;  3AEG A;  2Z5Y A;  4U8O A;  2XVI A;  4GF7 A;  3CPJ G;  4YT0 A;  4B66 A;  2E5V A;  1IUU A;  3VRD B;  3P4S A;  2GMJ A;  2XYO A;  3M0O A;  4K2X A;  5M10 A;  1V59 A;  4U2T A;  5BUK A;  1CC2 A;  3QVR A;  1CHU A;  1EL7 A;  1KF6 A;  1BWC A;  2XFU A;  4GDE A;  1KSU A;  2GR3 A;  3VR8 A;  3UP4 A;  4DGK A;  1XPQ A;  2YVF A;  2GQF A;  3P4P A;  1GTE A;  1ZOY A;  3I6D A;  1RSG A;  5BRT A;  1XHC A;  3QSM A;  4NTD A;  4C74 A;  1ZDL A;  4YSH A;  4LU6 A;  4BK1 A;  5KVH A;  1BKW A;  4C5O A;  3C4A A;  2WU5 A;  3AE3 A;  1BZL A;  3OZ2 A;  4Y4N A;  2VVL G;  3CN8 A;  4K5R A;  1PXC A;  2C3D A;  2Y6R A;  5EOW A;  4OPG A;  1ZY8 A;  2F5Z A;  4D03 A;  4AOS A;  2ZZB A;  3AE7 A;  2W0H A;  4EMI A;  4A9W A;  3C4N A;  4OPT A;  2BS3 A;  1GEU A;  3RP8 A;  1TDO A;  3GQH A;  2X8C A;  3CNS A;  4IVO B;  4WCT A;  1JU2 A;  5DBJ A;  3DK8 A;  1H81 A;  4NEV A;  1UKV G;  1PJ5 A;  3FBS A;  2GEW A;  4AT2 A;  4EMJ A;  1JRY A;  2EQ8 A;  2H88 A;  2V3B A;  3CTY A;  1GER A;  3L8K A;  4NTC A;  1TRB A;  3S5W A;  3NT6 A;  2IID A;  3FG2 P;  5IQ1 A;  4ECH A;  3GDN A;  3DH9 A;  3URH A;  4B64 A;  4UDP A;  3VRB A;  2X3N A;  2WOV A;  1JNZ A;  3F8R A;  1GES A;  3GD3 A;  1E1K A;  4H2N A;  1Q1R A;  4GUV A;  1GRG A;  1ZKQ A;  1NPX A;  2BAC A;  3Q9T A;  4JQ9 A;  1PBB A;  4RG4 A;  4X9M A;  3NTA A;  1NAA A;  1XAN A;  1N4W A;  2WP9 A;  3AE8 A;  4P9S A;  3AEE A;  1N1P A;  1TDF A;  4XWZ A;  3PVC A;  3C96 A;  2YLT A;  3GQK A;  3AEC A;  3FMW A;  1EL5 A;  2PHH A;  5CKU A;  2FJB A;  1S2Y A;  2B9W A;  1NHQ A;  1JOA A;  1LQT A;  1E7P A;  2C65 A;  4USR A;  3AE1 A;  3NTD A;  4TLX A;  3NG7 X;  2C76 A;  2V3A A;  2WDQ A;  3AE5 A;  4BUR A;  3ATQ A;  4ZN0 A;  4H2P A;  5KRQ A;  2EQ9 A;  2WET A;  4O5Q A;  5JCK A;  1PJ7 A;  2JAE A;  2NVK X;  1E39 A;  1NHP A;  3CNT A;  1YQ3 A;  1VG9 A;  3PO7 A;  4Y4M A;  5FS6 A;  4EQX A;  1FCD A;  4H2R A;  2VQ7 A;  3NH3 X;  4JY3 A;  4J2W A;  4A99 A;  2ARD A;  2JB3 A;  2OA1 A;  2WPC A;  4Z26 A;  3ICS A;  4IVM B;  4GCM A;  3BI4 A;  1MO9 A;  2Q0L A;  3ALJ A;  1H7X A;  2YLX A;  1CJ2 A;  3M13 A;  2AQJ A;  2A8X A;  2JK6 A;  1KFY A;  1D7L A;  1OJA A;  4KPR A;  1N4U A;  3QJ4 A;  1B8S A;  1P2E A;  4U8I A;  2WOW A;  1K4Q A;  3NK2 X;  1FEB A;  2X50 A;  1OJC A;  1GRB A;  3DJE A;  4H50 A;  3SQP A;  2RGH A;  2GAH B;  2GR0 A;  1PN0 A;  4B1B A;  1TDN A;  1YY5 A;  2R4E A;  2BYB A;  3UKF A;  1D7Y A;  2FJA A;  1JRX A;  1LTX R;  3ALL A;  2WPE A;  3DA1 A;  3HZL A;  1Q1W A;  4U8P A;  3FIM B;  1MOK A;  3ISH A;  4E0V A;  2BK4 A;  4U2L A;  3AEB A;  1CBO A;  3COX A;  3LOV A;  1IJH A;  4EIQ A;  2AR8 A;  2V60 A;  1FEC A;  1VQW A;  4UDR A;  4AP1 A;  4BJZ A;  3LXD A;  2BK5 A;  2JB1 A;  1EL8 A;  5JCL A;  3NGC X;  3EAN A;  1GV4 A;  2BC0 A;  1Y0P A;  3GYX A;  4EQR A;  4PAB A;  2GF3 A;  5TR3 A;  3P1W A;  2XLS A;  4ICY A;  2C7G A;  3CGC A;  2AAQ A;  3CPH G;  3KLJ A;  3RHA A;  3RNM A;  4X4J A;  1RP0 A;  4O5U A;  1BF3 A;  1W4X A;  1CF3 A;  2X8G A;  2R9Z A;  4IA6 A;  4EM4 A;  4YKF A;  2XVH A;  2Q6U A;  2GMH A;  2WEU A;  1Y56 A;  1NG3 A;  3BI2 A;  4BJY A;  2WS3 A;  5IQ4 A;  3EAO A;  1Z6L A;  2GH5 A;  1IUV A;  2R0C A;  3GWF A;  3UP5 A;  3UOX A;  4LII A;  1GRA A;  3VRA A;  4K8D A;  3NN6 X;  1GAL A;  4AP3 A;  4Z43 A;  1Y56 B;  2UZZ A;  2GRT A;  3UOZ A;  2R46 A;  5HXI A;  3K7M X;  1ZK7 A;  4KX6 A;  1D4C A;  2BCG G;  1O95 A;  2X8H A;  3P4Q A;  3WE0 A;  4YTM A;  4ADW A;  3DJD A;  1F8R A;  3V3O A;  2QAE A;  4FX9 A;  2BCP A;  4NEW A;  4TM4 A;  2WQY A;  1L0V A;  2ZZ0 A;  2YM2 A;  3RED A;  4U2S A;  4C3Y A;  1GRF A;  2V5Z A;  1ZX9 A;  4TM3 A;  2VRL A;  3ALM A;  3GYI A;  3KVE A;  3QSS A;  5EB4 A;  3UKQ A;  1ELI A;  4I59 A;  2CUL A;  1LV0 A;  4B69 A;  2CDU A;  4GDP A;  1B37 A;  1Q9I A;  1VRQ B;  4YXD A;  3H8L A;  2IVE A;  1OJD A;  1AOG A;  5CQF A;  2DKI A;  4YTP A;  1PBE A;  3AE9 A;  3GRS A;  3CIR A;  1YQZ A;  3P9U A;  2J3N A;  3GD4 A;  2YLW A;  3AE6 A;  4K5S A;  1JEH A;  4JNA A;  3D8X A;  5KXJ A;  5KWF A;  3AXB A;  1IUT A;  3DGH A;  2WHD A;  4REK A;  4Z25 A;  2C70 A;  3UTG A;  1OJT A;  4APN A;  3SUC A;  2WDR A;  2YLS A;  4RSL A;  2V61 A;  1S3E A;  5GRT A;  1NHR A;  4RG3 A;  1ZMC A;  2IVD A;  1PBC A;  5U25 A;  4AT0 A;  2QA1 A;  2Q0K A;  1VDC A;  4BV6 A;  1YKJ A;  1GRH A;  2R0G A;  2CFY A;  3GYJ A;  1QJD A;  4HA6 A;  1KNR A;  1E1M A;  3AYI A;  4EQW A;  1IUW A;  3GSI A;  2LFC A;  4H4Z A;  1H83 A;  3EPT A;  5HHF A;  2FJD A;  1D5T A;  1H7W A;  3AD8 B;  2JBV A;  4K22 A;  4D04 A;  1H6V A;  2BAB A;  4FDC B;  2C67 A;  3CGD A;  2R0P A;  3QVP A;  3UKH A;  3KU9 A;  2V6O A;  1NDA A;  1CL0 A;  3ITJ A;  3QSE A;  2BC1 A;  3Q6J A;  2OAM A;  3DK9 A;  5JCM A;  3NYF A;  4YSX A;  4I58 A;  4UDQ A;  1ZMD A;  1PXB A;  3QFB A;  2B9Y A;  3T37 A;  1MXT A;  1TDE A;  4IA5 A;  2VVL A;  3BHF A;  2H89 A;  2VRM A;  3CGB A;  4EM3 A;  2JB2 A;  1QLB A;  1LJ1 A;  3NK1 X;  3UTF A;  3E1T A;  4NZH A;  3PS9 A;  1FOH A;  2WP6 A;  3AEF A;  2XVJ A;  2YVJ A;  3CNJ A;  5HY5 A;  3R9U A;  1H86 A;  1L9C A;  2XFO A;  1CC4 A;  1H84 A;  4A79 A;  1DOD A;  4CY6 A;  4OVI A;  2YG4 A;  4C77 A;  1S2Q A;  2XDO A;  2WES A;  3B3R A;  3AD7 B;  3CPI G;  1X31 B;  1RYI A;  4JN9 A;  3G5R A;  2C64 A;  3AE2 A;  4LA1 A;  1FL2 A;  4YTN A;  2TMD A;  3IHM A;  1K0I A;  4YKG A;  3QFA A;  1O94 A;  1GET A;  4J36 A;  5U1O A;  2YR6 A;  4B65 A;  3NHO X;  2BXS A;  2B76 A;  2YR5 A;  3KA7 A;  4TM0 A;  5M0Z A;  3H8I A;  2GR2 A;  1GTH A;  2RGJ A;  4H4R A;  3EF6 A;  3ZYX A;  2XCG A;  2XVE A;  3KD9 A;  1ZOV A;  2EQ7 A;  5LV9 A;  4Z44 A;  1JNR A;  1DOE A;  4FK1 A;  4U8J A;  1GXF A;  1LQU A;  1L9E A;  1JRZ A;  5FS7 A;  3UKA A;  2YLZ A;  4JDR A;  4A65 A;  1DOB A;  1IUX A;  1NEK A;  2A89 A;  3CND A;  4J56 A;  3G5Q A;  2GAG B;  4DSH A;  1GOS A;  1NG4 A;  5FS8 A;  5ER0 A;  3OC4 A;  3DJJ A;  3DME A;  2YG3 A;  5L46 A;  4K7Z A;  2XLT A;  4XWR A;  1PDH A;  1O5W A;  3K7Q X;  4AOX A;  3AE4 A;  1OJ9 A;  2X99 A;  3B6D A;  4CNK A;  1BGJ A;  3IWA A;  1REO A;  1S3B A;  1LVL A;  2EQ6 A;  3M12 A;  4B63 A;  1PHH A;  1PS9 A;  3K30 A;  2BA9 A;  1ZP0 A;  1CJC A;  1GND A;  5JCN A;  4X9N A;  4CBQ A;  2WU2 A;  1NHS A;  3GRT A;  3V3N A;  3KKJ A;  3AD9 B;  4ZCD A;  5KOX A;  2YQU A;  4J34 A;  2O9Z A;  2OAL A;  2WOI A;  2VZ2 A;  2XLR A;  5FMH A;  2FBW A;  1B4V A;  4J31 A;  5C3J A;  5IPY A;  1B5Q A;  5EB5 A;  4Z2R A;  2A87 A;  2ZBW A;  2I0Z A;  4Z2U A;  2WDV A;  3KPF A;  1DXL A;  4M52 A;  3H4K A;  3NKS A;  4GR1 A;  2C66 A;  2RAB A;  3NLC A;  4OPD A;  5EBK A;  2WP5 A;  4TLZ A;  3DK4 A;  4H4T A;  4OPL A;  3LZW A;  2ZZC A;  4JNQ A;  3IC9 A;  3S61 A;  2QCU A;  3NRN A;  2C3C A;  4YWO A;  3AWI A;  5HYM A;  3SFE A;  1QO8 A;  3LB8 A;  4OPI A;  3F8P A;  1GPE A;  4H4U A;  4CNJ A;  2XFN A;  2YG5 A;  1F8W A;  3BNM A;  2JKC A;  1IUS A;  1KSS A;  3BHK A;  1D4D A;  3K7T A;  3NYE A;  2R4J A;  1PBF A;  2BS4 A;  3AEA A;  1F8S A;  2APG A;  2VOU A;  3L1R A;  3GMB A;  5BVA A;  3UTE A;  4H4Q A;  4A6N A;  5FS9 A;  1E6E A;  2YG7 A;  4A5L A;  4DSG A;  4JY2 A;  2GB0 A;  1PJ6 A;  3NK0 X;  4B68 A;  2XFQ A;  4H4X A;  2GVC A;  2QA2 A;  4YSZ A;  4XXG A;  5J7X A;  2OLO A;  2TPR A;  4Z2T A;  1HYU A;  2C72 A;  3AYJ A;  3V76 A;  2CVJ A;  1GT8 A;  2Y6Q A;  4H2Q A;  4OPC A;  2GR1 A;  4FK1 C;  1GRT A;  3NNE A;  4EQS A;  3JSK A;  1XDI A;  4WX1 A;  3GMC A;  3ATR A;  3SGL A;  2XLP A;  1N4V A;  1KNP A;  1EL9 A;  4H4W A;  3IF9 A;  3ABV A;  2Z5X A;  1PBD A;  4HB9 A;  2VVM A;  3P4R A;  2VQB A;  4H4P A;  3FPZ A;  4NTE A;  2WPF A;  4IV9 A;  1FEA A;  4C3X A;  3SFD A;  2HQM A;  3LAD A;  4U8M A;  4OCG A;  2Q7V A;  5BUL A;  1PXA A;  3LJP A;  4U8L A;  2PYX A;  1GRE A;  1DOC A;  2B7S A;  2YLR A;  4MJW A;  5J60 A;  2YWL A;  1P2H A;  4PAA A;  4UP3 A;  1M6I A;  1SEZ A;  2DKH A;  3O0H A;  3VQR A;  4EIP A;  2E1M A;  2YAU A;  2C75 A;  1K0J A;  2R45 A;  1BGN A;  3UKL A;  4BK3 A;  3LZX A;  3II4 A;  1D4E A;  1LPF A;  2WBA A;  1F6M A;  4GRT A;  4TM1 A;  1EBD A;  2GV8 A;  3CNP A;  4A6N B;  1COY A;  3GDP A;  4BK2 A;  1TYT A;  2E4G A;  5JCI A; 
#chains in the Genus database with same CATH topology
 3UCL A;  4J33 A;  3I3L A;  5U63 A;  2LLY A;  4B3R T;  3RLF F;  3ICR A;  1NEN A;  3J8F 4;  3L09 A;  2EHO D;  4CCQ A;  4DMV A;  3T14 A;  1N36 T;  2BXR A;  5IUX A;  4NNJ A;  3KVB A;  4CY8 A;  2EX3 A;  1E1L A;  5KOW A;  4HWH A;  4A7A A;  1VG0 A;  5HAX A;  2IW5 B;  3AED A;  2RGO A;  3ZKR A;  2YM1 A;  3DGZ A;  1IJ6 A;  3UOV A;  2HHH T;  2BS2 A;  2WY2 A;  3NWI A;  3R6N A;  2LSG A;  2B7R A;  4DR5 T;  3VU7 H;  4CCR A;  1RVF 4;  3F8D A;  4U8K A;  3GA8 A;  1XHZ A;  4U7I A;  2WB5 A;  1XDP A;  5KVI A;  2E8I A;  3AEG A;  5FXV A;  2XVI A;  2LEH A;  4GK0 E;  3M0O A;  5JRC A;  1CC2 A;  2WWV A;  3FZL B;  1CHU A;  1BR1 A;  5LHG B;  1KF6 A;  3AB3 B;  1XWM A;  1XPQ A;  2YVF A;  3RC8 A;  2KXP B;  1GTE A;  5L3G B;  3JCF A;  4ZS3 A;  4I43 B;  1XHC A;  3PJA J;  3QSM A;  5KVH A;  2WU5 A;  5EOW A;  5HEU A;  1ZY8 A;  3C4N A;  4YHJ A;  3RP8 A;  1TDO A;  2XUE A;  4HFC A;  4DV6 T;  3ZC0 A;  2R04 4;  1PJ5 A;  5LMU T;  4C91 A;  3FBS A;  2V3B A;  1TRB A;  3NT6 A;  4ZI3 C;  2XSB A;  2LJL A;  4B3M T;  5IQ1 A;  2E9X C;  3URH A;  5L47 A;  3CWZ B;  4H9S E;  1U5P A;  2WMO A;  4JQ9 A;  4J2C A;  1N4W A;  1W9R A;  2WP9 A;  4IIJ E;  4P9S A;  4XWZ A;  1HCI A;  4N78 D;  3ANW B;  3C96 A;  2KND A;  1YKH B;  4EEB A;  2UUB T;  4YJ3 E;  3GQK A;  2PHH A;  2L3L A;  1IJ5 A;  1MNE A;  3K3Q C;  5CKU A;  5ADX L;  3RQW A;  1NHQ A;  5JDL A;  3JC6 C;  3NTD A;  4TLX A;  2V3A A;  2WDQ A;  2NTY A;  5AQQ B;  3ATQ A;  4KHZ F;  2XM1 A;  2EQ9 A;  3ZT5 A;  1PJ7 A;  4FJO A;  1VG9 A;  1FCD A;  3UFG A;  2CPT A;  2VQ7 A;  4NUV A;  1UUR A;  1MMD A;  4A99 A;  2ARD A;  2JB3 A;  4Z26 A;  2BG9 B;  4H63 V;  2Q0L A;  1H7X A;  4UF0 A;  5FY7 A;  1OJA A;  3L39 A;  2Y48 B;  1N4U A;  1B8S A;  4U8I A;  2WOW A;  3NK2 X;  2X50 A;  3RKG A;  2WZI A;  3RX6 A;  1WFD A;  4OYK A;  3MAC A;  5GON E;  1PN0 A;  3I0Q A;  4B1B A;  4JYA T;  2BYB A;  3ALL A;  2WPE A;  2MBG A;  1D0Z A;  5L3B B;  3R84 B;  4ZZC A;  3T1Y T;  4JEH B;  3ZJ2 A;  3COX A;  1Z7S 4;  2AR8 A;  2V60 A;  3RI5 A;  4O8S A;  2OV9 A;  5JCL A;  2H7V C;  1Y0P A;  4TX5 A;  2M67 A;  3ZYL A;  2HPJ A;  3P1W A;  4ICY A;  1LVF A;  3CGC A;  2AAQ A;  1XHX A;  3RNM A;  3HI2 A;  1RP0 A;  4I4T E;  4EM4 A;  1CF3 A;  3FZM B;  3ZT7 A;  2XVH A;  2CLY B;  4WW0 A;  2BDE A;  1Z6L A;  1W09 A;  3GWF A;  1YD8 G;  2UZZ A;  3UOZ A;  2GRT A;  2XQ5 A;  2V7I A;  2R46 A;  4QX7 B;  1D4C A;  1O95 A;  2X8H A;  3QC9 A;  5EK4 A;  2JQH A;  4YJ2 E;  1F8R A;  3N5L A;  3RYC E;  4MFR A;  3KVA A;  2WQY A;  2PG8 A;  2H3R A;  1POV 0;  2CWY A;  4YLH A;  4TM3 A;  4I55 E;  4HWI B;  5HCJ A;  2K24 A;  3UKQ A;  1ELI A;  2CA5 A;  1LV0 A;  2H7O A;  4JI6 T;  4B69 A;  1Q9I A;  3W15 B;  4AI6 A;  2WWU A;  2IVE A;  2W66 A;  5BR8 T;  5CQF A;  4YTP A;  3AE9 A;  3SZW A;  2LSY A;  4M1P A;  2UUA T;  2J3N A;  4MAL A;  3AE6 A;  4G63 A;  2BZB A;  4Z25 A;  2WHD A;  5AQJ B;  1OJT A;  3OBV E;  2YLS A;  4RSL A;  4H9R C;  1S3E A;  4RG3 A;  1ZMC A;  2IVD A;  5U25 A;  4AT0 A;  5M4Y A;  4BV6 A;  2R0G A;  3UU4 A;  4PK5 A;  3JAF A;  3AYI A;  1E1M A;  2DLR A;  4H4Z A;  3EHZ A;  3PU3 A;  4K22 A;  1MIW A;  2BAB A;  3PUW F;  3ZSS A;  4CI1 B;  5LHI B;  1IBM T;  4DND A;  4O4J E;  4Q4X 4;  3UKH A;  3KU9 A;  3RF1 A;  3ITJ A;  4B3T T;  3KPK A;  3DK9 A;  3IEE A;  3ETV A;  3Q5W A;  3ZC1 A;  1TDE A;  4ZOL E;  2VVL A;  3BHF A;  2VRM A;  3CGB A;  4EM3 A;  1OED E;  5AQT B;  3E1T A;  4NZH A;  3PS9 A;  2WP6 A;  3AEF A;  3HKB E;  3CNJ A;  4KHP T;  5FY0 A;  1XNR T;  3EI0 A;  4A79 A;  4OVI A;  2YG4 A;  2X0Y A;  1XMO T;  3ONJ A;  1S2Q A;  2WES A;  3SWH A;  3LFM A;  1RYI A;  4JN9 A;  1FEW A;  1VCT A;  2NR4 A;  2DI4 A;  1OXZ A;  5E0O A;  4PW8 A;  3WAK A;  4YTN A;  2IAK A;  3HYW A;  2YKS A;  1O94 A;  4J36 A;  2BXS A;  2YK0 A;  4PNI A;  2GR2 A;  2RGJ A;  1COV 4;  4DV2 T;  5LV9 A;  4Z44 A;  4Q4V 4;  5LOV E;  1DOE A;  3UKA A;  2YLZ A;  2YEV C;  1DOB A;  4WNK A;  2XAS B;  3UUN A;  3MA9 A;  2V7M A;  5LXT E;  4DSH A;  2E9X B;  3OC4 A;  2D2S A;  2AXD S;  3DME A;  5L46 A;  2XLT A;  4XWR A;  3K7Q X;  3RRW A;  4AOX A;  1OJ9 A;  2PTF A;  4UEL A;  1REO A;  4IHJ E;  5AFU L;  1LVL A;  4KUM B;  2EQ6 A;  2QYW A;  4B63 A;  1PHH A;  1PS9 A;  3K30 A;  5FY1 A;  1CJC A;  4X9N A;  2WU2 A;  3KKJ A;  3RRC A;  4JV5 T;  2LOS A;  1LKX A;  2JQ9 A;  2YQU A;  4J34 A;  2VZ2 A;  1S94 A;  3H37 A;  2FBW A;  3X1D A;  5C3J A;  5IPY A;  4HE8 A;  2ZBW A;  3QUJ A;  2I0Z A;  4PFP A;  3ONL C;  5AQU B;  5FXX A;  1AR7 4;  3RC3 A;  4OPD A;  2WP5 A;  2BKN A;  4Q4Y 4;  2JPF A;  4OPL A;  2W63 A;  3UFE A;  1HTJ F;  3IC9 A;  4JNQ A;  3O1H A;  2X9Y A;  4H9P C;  4G73 A;  4GAV A;  3F8P A;  3PUR A;  4CNJ A;  2V7L A;  2EHO B;  2XFN A;  1DU2 A;  2IML A;  2MTQ A;  3K7T A;  2ZM2 A;  5HEO A;  4IE0 A;  3CVR A;  2KIN B;  2LHR A;  5BVA A;  1UGO A;  3UU6 A;  4H4Q A;  4A6N A;  4X1I E;  4X5T A;  4WYV A;  2KT9 A;  4JY2 A;  3NK0 X;  3LBX A;  4B68 A;  5LA6 E;  2XFQ A;  4DR2 T;  4YSZ A;  2VKH A;  4PFO A;  3AYJ A;  3V76 A;  2L9Q A;  4O2B E;  2CVJ A;  1GT8 A;  4OPC A;  4ZZB A;  5FXW A;  5L3C B;  1HXS 4;  4EQS A;  1VBC 4;  4IST A;  3JSK A;  2E9X D;  4EXT A;  3GMC A;  1AR6 4;  4B6X A;  1N4V A;  3RIA A;  1PBD A;  5JR9 A;  4HB9 A;  3P4R A;  1N34 T;  4HTE A;  4IV9 A;  3SFD A;  3LAD A;  2Q7V A;  5BUL A;  2Z6E A;  5L4E A;  2CBJ A;  1PVC 4;  4MJW A;  2YWL A;  1P2H A;  1M6I A;  1SEZ A;  4EIP A;  4TNV A;  4AXP A;  3RIF A;  1K0J A;  2R45 A;  3UKL A;  2LHN A;  2XTL A;  3HKC E;  2WBA A;  1F6M A;  2GV8 A;  4A6N B;  5F3J A;  1TYT A;  2E4G A;  3UTH A;  2MAW A;  3CGE A;  1E1N A;  5LGU B;  2VVS A;  1DJQ A;  1FMW A;  5JDQ A;  2R07 4;  3G5S A;  3UKK A;  4ANJ A;  4RHV 4;  2LOP A;  4JI5 T;  4U8N A;  4LF5 T;  1ONF A;  2OLN A;  1MND A;  2BK3 A;  4H4V A;  3RP7 A;  2MOZ A;  1KDG A;  1YQ4 A;  4N9X A;  3LK3 B;  1HX8 A;  2XFP A;  3VR9 A;  3C64 A;  2ODV A;  3DTO A;  3QOF A;  2ACZ A;  3IHG A;  4YFS A;  2XVF A;  1L9D A;  5HYA A;  3I9W A;  5CGM A;  1TDK A;  2FJE A;  3BI5 A;  2B9X A;  3NIX A;  1H82 A;  5C2T A;  1ZHC A;  5BMV E;  5L3F B;  4TWD A;  2XLU A;  3UOY A;  3FI7 A;  3PU8 A;  3F31 A;  1CUN A;  3AB1 A;  4KI0 F;  2Z5Y A;  3ZMT B;  4U8O A;  1IAP A;  1RMU 4;  3GN5 B;  4GB3 4;  3VRD B;  3P4S A;  2C0S A;  5LG4 A;  5M10 A;  1V59 A;  1AR9 4;  4Z8X A;  1VCS A;  3AVS A;  2BRY A;  3KDS E;  1EL7 A;  3GN5 A;  4V1A v;  1BWC A;  4G6H A;  4GDE A;  3VR8 A;  2XQA A;  1OED B;  2VB6 A;  4DGK A;  3ESL A;  3N9M A;  5LBM A;  2W00 A;  1HX1 B;  4GYR A;  2XAH B;  2LKG A;  1G8X A;  2J47 A;  2XJ7 A;  4MBQ A;  3CML A;  3NZP A;  4NTD A;  4C74 A;  4LU6 A;  4BK1 A;  4ADZ A;  5FNV E;  3OZ2 A;  5CFB A;  2VVL G;  4K5R A;  4OPG A;  4D03 A;  3I1A A;  4AOS A;  2ZZB A;  4TUY E;  1T72 A;  4A9W A;  4ZS2 A;  4OPT A;  5LG3 A;  4EOZ B;  2R6G F;  2X8C A;  2BBJ A;  5DBJ A;  3DK8 A;  5ABH A;  4UF0 B;  2GEW A;  4AT2 A;  3RIU C;  1ZKE A;  2V8S V;  1JRY A;  3CTY A;  4G9K A;  3G06 A;  2IID A;  2CXD A;  4K0U A;  3GDN A;  2C5I T;  3SZF A;  4CN6 A;  4JEU B;  3PUQ A;  2WOV A;  1JNZ A;  4EYY R;  3F8R A;  1E1K A;  2MYS A;  2JRK A;  4H2N A;  1K5M D;  2BBH A;  2CMR A;  1Z8U A;  4O2A E;  4WBN E;  1NPX A;  2BAC A;  4EYU A;  4RG4 A;  3RYI E;  3ZMS B;  3N9P A;  5AQL B;  3ZST A;  4DUZ T;  1RUD 4;  3AEE A;  1TDF A;  5CA0 E;  4LFB T;  3AEC A;  3FMW A;  2RMU 4;  3PUY F;  1S2Y A;  2B9W A;  1UX5 A;  4ZI3 D;  2C65 A;  4H9N C;  4ERR A;  5L3D B;  3NG7 X;  3AE5 A;  3Q2M A;  3K1S A;  3CMM A;  1RUI 4;  1NHP A;  5FS6 A;  1YQ3 A;  4EQX A;  5F8P A;  4H2R A;  1EZ3 A;  2FUP A;  4UR9 A;  4GKK T;  4GCM A;  3BI4 A;  2WZH A;  3ZLI A;  3Q9D A;  4U2Z A;  2YLX A;  1RHI 4;  3JD7 4;  4KPR A;  2WAU A;  1FEB A;  4X1Y E;  2XAG B;  2R06 4;  1OJC A;  1GRB A;  4MHC A;  3C4X A;  4QXH B;  2R4E A;  3DA1 A;  2FJA A;  4U8P A;  1MOK A;  1HFA A;  5LP6 E;  1CBO A;  5CJ5 A;  3LOV A;  2OA5 A;  4L9I A;  1VQW A;  4UDR A;  2LT3 A;  2BK5 A;  1EL8 A;  3NGC X;  2VUR A;  1GV4 A;  3EDV A;  2VL0 A;  5TR3 A;  3O1J A;  2LSJ A;  3SYI A;  2XQ3 A;  3KLJ A;  4X4J A;  1W4X A;  4YKF A;  2NTX A;  1D0X A;  1Z0P A;  5EZY E;  3FZH B;  5F5W A;  1HNZ T;  2WEU A;  5FVL A;  3EAB A;  1IUV A;  5AQS B;  3UP5 A;  2V7K A;  4TV9 E;  4K8D A;  3NN6 X;  1GAL A;  4Z43 A;  2XQ4 A;  1RUF 4;  3OTO T;  2EHO C;  2CXL A;  1ZK7 A;  1VBA 4;  4HN9 A;  4LML A;  2CLY C;  2RPA A;  1HG2 A;  4NEW A;  5FKY A;  2ZZ0 A;  3HR0 A;  5A1L A;  2YM2 A;  3RED A;  4U2S A;  2V5Z A;  1ZX9 A;  2VRL A;  1RUE 4;  3ALM A;  4HWD A;  5EB4 A;  3MKD A;  1UCU A;  3VKH A;  2JQQ A;  4YXD A;  1IBK T;  2EHO A;  4AQF A;  5ABE A;  4HFI A;  5L4H A;  4FI5 A;  4AIU A;  3AXB A;  1LRZ A;  1IUT A;  1U4Q A;  4APN A;  3SUC A;  1EAH 4;  2PW9 A;  1N33 T;  2MPK A;  3EUH A;  2OLT A;  4IDP A;  3AAE B;  2XY8 B;  1YKJ A;  4CZZ B;  5JQG E;  3GYJ A;  1QJD A;  4JI8 T;  4DO0 A;  3NZQ A;  4UIG A;  1H83 A;  5HHF A;  2BG9 C;  3TLW A;  4FDC B;  3K3O A;  1HNW T;  2C67 A;  4QX8 B;  4LF9 T;  3QVP A;  2VQE T;  3P50 A;  4GAP A;  3QSE A;  4CXY A;  2OAM A;  3NYF A;  1ZMD A;  3QFB A;  1NA1 D;  1MXT A;  3E0Z A;  3L3P A;  4IA5 A;  2Y8D A;  3H3A A;  4CN1 A;  3OJA A;  1WYC A;  2B1E A;  2N9D A;  1LJ1 A;  3NK1 X;  3KV6 A;  3R9U A;  4CI2 B;  1H84 A;  2LSK A;  5JRC B;  4CY6 A;  4L0R A;  3UT5 E;  4UEM A;  3GWH A;  3AE2 A;  1VRB A;  2Q9Q D;  1FL2 A;  2TMD A;  2BKP A;  1K0I A;  3UUL A;  1GET A;  4B65 A;  5ABF B;  4ILC A;  2E2A A;  2B76 A;  2BVL A;  2RP4 A;  4TM0 A;  5M0Z A;  1GTH A;  4IT4 A;  3EF6 A;  2EQ7 A;  1XDO A;  4IGU A;  4JI1 T;  1LQU A;  4EB6 E;  1JRZ A;  4DR1 T;  5FS7 A;  4IL9 A;  4JDR A;  1IUX A;  5FVK A;  4JI7 T;  1GOS A;  2HPL A;  1NG4 A;  5FS8 A;  5ER0 A;  4LFA T;  2A72 A;  4UV9 B;  2VQF T;  5LMN T;  2YG3 A;  1N32 T;  2LKH A;  3OYX A;  1PDH A;  1NCQ D;  2I6H A;  1VOM A;  3AE4 A;  2X99 A;  3B6D A;  1BGJ A;  3IWA A;  2PYJ A;  1KK7 A;  2WSS V;  2BA9 A;  1ZP0 A;  4DBQ A;  4CBQ A;  4AKH A;  1NHS A;  5DQV A;  3HA4 A;  3AD9 B;  3PUV F;  5JDG A;  5FMH A;  1KEY A;  4X62 T;  4II3 A;  4G6G A;  1B5Q A;  3O4X E;  5EB5 A;  3NRX A;  4LF7 T;  3KPF A;  3TKL B;  3H4K A;  2RAB A;  3NLC A;  4A98 A;  1WLX A;  3UTK A;  3U3I A;  3IHR A;  4OHF A;  3LZW A;  2ZZC A;  3UU5 A;  5KNL A;  3P7I A;  3AWI A;  1HRV 4;  4MLK A;  1HS7 A;  1QO8 A;  3LB8 A;  3H3M A;  1PO2 4;  4PJL A;  4TWH A;  1F8W A;  3BNM A;  1US7 B;  1QUU A;  2R4J A;  2VKJ A;  3T2Z A;  4DR4 T;  2BS4 A;  3AEA A;  2VOU A;  3L1R A;  5IHY A;  1I94 T;  2ES0 A;  1E6E A;  4DSG A;  2GB0 A;  1PJ6 A;  5KMP A;  4HFV A;  3KBU A;  4E7S A;  2YU2 A;  5J7X A;  2OLO A;  2TPR A;  4Z2T A;  5LB7 B;  2RS1 4;  4JI2 T;  4FK1 C;  3IBP A;  4QXB B;  5IYZ E;  4AIS A;  1XDI A;  5IWA T;  3RH3 A;  2LSI A;  1EL9 A;  3IF9 A;  3C4W A;  2SPC A;  2VVM A;  5EK3 A;  2BVM A;  1AL2 4;  4H4P A;  1MQT D;  3AA0 B;  2PY5 A;  4ILU A;  5ETW A;  4L5G A;  5FP3 A;  3HYV A;  1FEA A;  2NP9 A;  2Q9Q B;  2PYX A;  3N9N A;  2B7S A;  5J60 A;  2RS3 4;  4K0K T;  1GQE A;  3FB2 A;  2DKH A;  3VQR A;  2IIU A;  4ILB A;  4QKN A;  5AQO B;  2YAU A;  2C75 A;  1WRD A;  5CB4 E;  4DVD A;  3LZX A;  3II4 A;  3N2O A;  1M62 A;  2V7J A;  4GRT A;  4TM1 A;  4DV1 T;  1B7T A;  5JCI A;  3GDP A;  1YW0 A;  2K48 A;  5AQV B;  5JTG A;  1F3P A;  3JAD A;  3OVU A;  2A2F X;  1DNC A;  1CJ3 A;  4H4S A;  4H4Y A;  2XQ9 A;  4XZC A;  2YG6 A;  4ILA A;  3BQI A;  4KBM B;  2YVG A;  4UV8 B;  4C90 A;  4DUY T;  5AQF B;  5HEJ A;  3ADA B;  1K0L A;  3F2E A;  3CX6 B;  3P4W A;  1TYP A;  2ZM0 A;  3SM8 A;  3D1C A;  4J57 A;  4IL4 A;  2X0L B;  3SZC A;  4EMW A;  1ZV4 X;  2GQW A;  1M64 A;  4OPU A;  4OX9 T;  3LJC A;  5TAO A;  3DJG X;  4A97 A;  2BKO A;  3OYZ A;  4Y4L A;  4YHH T;  4HGA A;  3CX8 B;  3ZDN A;  3AYL A;  2XQ8 A;  1RUJ 4;  3P8C D;  4DV4 T;  4EAH A;  4CRT A;  3MXZ A;  1X79 A;  2D5U A;  3RP6 A;  2YIN A;  4AQG A;  1CJ4 A;  3PUZ F;  3HKD E;  3CPJ G;  4YT0 A;  4B66 A;  2XYO A;  3LDQ B;  4U2T A;  5BUK A;  3QVR A;  4DV7 T;  1AR8 4;  4LMJ A;  3B13 A;  5LJN A;  1KSU A;  2GR3 A;  3UP4 A;  3L8R A;  3CQC B;  2C4C A;  3P4P A;  5FL0 A;  2YDS A;  2W61 A;  1W0A A;  1ZDL A;  3TLS A;  3KBT A;  2CCQ A;  3AE3 A;  4A56 A;  4Y4N A;  1PXC A;  2C3D A;  4JI4 T;  4U74 A;  4NIQ A;  3AE7 A;  2LRL A;  3Q5X A;  3C50 A;  4X64 T;  2IUB A;  1MMN A;  2D0T A;  3GQH A;  4WCT A;  2L8K A;  1JU2 A;  1H81 A;  2ZM6 T;  1UKV G;  3JAE A;  3N2K E;  2EQ8 A;  3L8K A;  4NTC A;  3S5W A;  2W67 A;  3KIN B;  4LFC T;  3FZK B;  4B64 A;  3GD3 A;  1D4M 4;  3HL6 A;  2G0U A;  4X9M A;  1NAA A;  1XAN A;  2PBI A;  3ZN1 B;  2YLT A;  3QK6 A;  5AQP B;  5KX5 E;  1EL5 A;  2JMH A;  4DV5 T;  5KMR A;  2FJB A;  3AA7 B;  1JOA A;  4USR A;  1WR0 A;  4PK6 A;  2PFV A;  4BUR A;  5KRQ A;  3MK7 C;  2WET A;  2HWC 4;  4TV8 E;  1Y01 A;  4ZI2 C;  2IHR 1;  2JAE A;  3CNT A;  2IC6 A;  3N9Q A;  2J62 A;  3PO7 A;  4Y4M A;  1FIO A;  5LCY A;  1LVK A;  3ZCJ A;  3DJB A;  3ICS A;  4IVM B;  1OWA A;  3EAM A;  2I0M A;  1MO9 A;  2E5L T;  2XAQ B;  3C98 B;  4DR6 T;  5J2T E;  1CJ2 A;  3M13 A;  2A8X A;  4EGW A;  5C8Y E;  3QJ4 A;  4QHO A;  1P2E A;  3ZMU B;  4NUU A;  3Q5E A;  3LK2 B;  3DJE A;  4H50 A;  3SQP A;  5HXE A;  2GAH B;  4P1N A;  2GR0 A;  1TDN A;  4IE5 A;  3UKF A;  1D7Y A;  3HZL A;  1IBL T;  2JIW A;  1SHZ C;  3PTR B;  4E0V A;  2BK4 A;  1FEC A;  4BA9 A;  2JB1 A;  3E22 E;  2BC0 A;  4EQR A;  4PAB A;  2XLS A;  2JQK A;  2C7G A;  3SY4 A;  1BF3 A;  2X8G A;  2R9Z A;  2XSA A;  3T2K A;  3PUS A;  5KMG P;  4IDN A;  1NG3 A;  3ZYK A;  5JDM A;  4P09 A;  2GH5 A;  4DR7 T;  1VBE 4;  4LII A;  1GRA A;  3ZN0 B;  1FMV A;  1Y56 B;  5HXI A;  5AQG B;  3K7M X;  4ADW A;  2BCG G;  3WE0 A;  4YTM A;  5JDF A;  3V3O A;  2QAE A;  2BCP A;  2J4G A;  4TM4 A;  4O4I E;  2Q9Q A;  5JVD E;  2VK9 A;  5LNK A;  2D9D A;  2CDU A;  4GDP A;  1B37 A;  2E9X A;  2DL1 A;  1XMQ T;  1VRQ B;  3ZCI A;  2UXB T;  3CPZ A;  1OJD A;  1HF8 A;  2DKI A;  4UVB B;  4QWN B;  2K9A A;  1T8B A;  2XQ7 A;  3AXJ A;  3CIR A;  3P9U A;  4K5S A;  1JEH A;  4IDQ A;  1XZY A;  2DWK A;  2KZ7 B;  5KXJ A;  2C70 A;  2X51 A;  2WDR A;  3D0T A;  4DMW A;  1NHR A;  5HXS A;  3AVR A;  1NWM X;  5LGN B;  2QA1 A;  3K8P C;  2Q0K A;  3KV9 A;  1GRH A;  4HA6 A;  3IF8 B;  4PJJ A;  1KNR A;  3RYF E;  2LFC A;  3BQK A;  3RYH E;  3EPT A;  4U2Y A;  2FJD A;  2ACX A;  4OK0 A;  3AD8 B;  4HWF A;  2R0P A;  2YOE A;  2DCF A;  4AKI A;  2XQY A;  5HEG A;  1J5W A;  4XAX B;  1CL0 A;  3Q6J A;  3PUA A;  4CXW A;  1PXB A;  2B9Y A;  3T37 A;  4HFE A;  3T31 A;  1T98 A;  2H89 A;  2X9H A;  3SZ0 A;  2JB2 A;  1QLB A;  3ZJ1 A;  3UTF A;  3KV4 A;  1XI1 A;  2XVJ A;  2YVJ A;  2BG9 A;  3JC6 D;  5HWX A;  5HY5 A;  2XFO A;  2IDO B;  2ZLY A;  1WR6 A;  1DOD A;  3UU3 A;  4C77 A;  3ZEF B;  2RS5 4;  4H9Q C;  4TZ4 C;  1UUS A;  3QB5 A;  3IA3 A;  4NXM T;  4I50 E;  3PV0 F;  2HWB 4;  1SUM B;  3QFA A;  4YKG A;  4PJN A;  3NHO X;  2YR5 A;  3KA7 A;  2VWA A;  1HRI 4;  2M6I A;  2XCG A;  2XHE B;  2XVE A;  3UUB A;  5KMQ A;  2CWO A;  4U8J A;  3SX6 A;  1GXF A;  4GK5 E;  1BR4 A;  2V5C A;  2A89 A;  3G5Q A;  2NW7 A;  2GAG B;  1MMA A;  2PZS A;  3ZMZ B;  5LGT B;  4PK4 A;  4K7Z A;  4H9O C;  4IDO A;  1D1C A;  4LMK A;  3KFW X;  4CNK A;  3AXJ B;  1S3B A;  4COF A;  5FMN A;  4ZHQ E;  2DWG A;  2YU1 A;  3N2G E;  3V5S A;  3M12 A;  4U72 A;  3UQ7 A;  1GND A;  5JCN A;  1D1B A;  4BAY B;  3QNU A;  4I0U A;  3WAJ A;  5KOX A;  5DAB A;  2O9Z A;  2XLR A;  3F57 A;  1B4V A;  4J31 A;  5JRE A;  4Z2R A;  1T7S A;  2A87 A;  3UUM A;  2WDV A;  2HH7 A;  1PO1 4;  4GR1 A;  5EBK A;  5JR9 C;  5DQW A;  5JH7 E;  3FXD B;  4H4T A;  3RPU A;  2M6B A;  2QCU A;  5AQN B;  3NRN A;  4YWO A;  2CE7 A;  5HYM A;  1E2A A;  3SFE A;  2X0H A;  1GPE A;  2V6Y A;  2YG5 A;  5HCM A;  2JKC A;  1IUS A;  1KSS A;  1OOP D;  3NYE A;  2V5D A;  1PBF A;  1D1A A;  3NVO A;  1F8S A;  3GMB A;  3WI3 A;  4CQI A;  4F8H A;  5FS9 A;  3N9O A;  4A5L A;  1Y64 B;  1HG5 A;  4U7Y A;  4H4X A;  2QA2 A;  4XXG A;  5AQK B;  3ZT6 A;  2LE8 A;  1NAF A;  2GR1 A;  4NWZ A;  3M65 A;  3ZYM A;  1GRT A;  3NNE A;  2HN1 A;  2KWH A;  3FHN A;  4WX1 A;  4UVC B;  3ATR A;  3SGL A;  1D0Y A;  3T1H T;  1KNP A;  1OED A;  4ZEY A;  2Z5X A;  2VKD A;  2VQB A;  2UXN B;  2CHO A;  2HN2 A;  1J1J A;  4NTE A;  3U78 A;  2WPF A;  3J7Y q;  4C3X A;  2HQM A;  4U8M A;  4LF4 T;  4DBR A;  2XPK A;  4F6R C;  2KMF A;  4EIW A;  3LJP A;  2X9X A;  2W62 A;  1GRE A;  2YLR A;  4PAA A;  3O0H A;  3MZK B;  2E1M A;  3B5M A;  3Q5D A;  1RUG 4;  4GIW A;  4BK3 A;  1BGN A;  3J9X 1;  1D4E A;  3FBL A;  3N9L A;  5DJQ C;  3CNP A;  1COY A;  4H4R A;  2CM0 A;  2Q9Q C;  4DNA A;  3GWD A;  2D0U A;  2VAS A;  3NYC A;  4H7U A;  4YSY A;  4OFZ A;  4IRE A;  2C73 A;  1PIV 4;  1DJN A;  5AQH B;  3EDU A;  3SXI A;  1SE7 A;  4IE4 A;  5J1G A;  3T0K A;  2W4X A;  4O4H E;  4HEA A;  2I59 A;  4Z24 A;  5HXC A;  5JR9 B;  3UKP A;  2YR4 A;  4ZCC A;  3ICT A;  2V6Y B;  2UXX B;  2WCA A;  3BNU A;  4B67 A;  4USQ A;  3SOL A;  3NN0 X;  4YY3 T;  3NBX X;  4AKR B;  5GSN A;  5HEH A;  1X9B A;  4BJN A;  4AQF C;  1GSN A;  2NPX A;  4P0B A;  3VHL A;  4HWC A;  2W0G A;  4HFH A;  1CC6 A;  3OPC A;  4QH4 A;  5HWY A;  1HR0 T;  4GF7 A;  2V1D B;  2E5V A;  1IUU A;  2N2N A;  2GMJ A;  5L2L A;  2V26 A;  4K2X A;  4NPP A;  5EK2 A;  2BG9 E;  3PUG A;  2XFU A;  4DV3 T;  3FZF B;  2CBI A;  3O1I A;  2PYL A;  4X66 T;  1MIV A;  2GQF A;  3C51 A;  1ZOY A;  2XZE A;  3I6D A;  1RSG A;  5BRT A;  3E08 A;  3T2Y A;  4YSH A;  4GOU A;  4HFD A;  5ABG A;  1HNX T;  1BKW A;  3C4A A;  4C5O A;  1BZL A;  5JDH A;  3CN8 A;  2Y6R A;  4TN7 B;  2F5Z A;  2K5B B;  2W0H A;  3BQL A;  4EMI A;  3KV5 A;  4UVA B;  3O9X A;  2BS3 A;  1GEU A;  4WZX A;  3CNS A;  4IVO B;  1UK5 A;  3LK4 2;  4NEV A;  4A5X A;  2JMK A;  4GYS A;  4JI3 T;  4OYJ A;  4EMJ A;  2H88 A;  3RQU A;  1GER A;  3FG2 P;  3BK9 A;  4ECH A;  3DH9 A;  4UDP A;  3VRB A;  4EZH A;  2X3N A;  2DNX A;  1GES A;  2YN6 A;  1Q1R A;  4GUV A;  4ASK A;  1KNZ A;  1GRG A;  1ZKQ A;  3Q9T A;  2KWI B;  2C5K T;  3SRZ A;  2UXD T;  1PBB A;  1G73 A;  3NTA A;  2BRA A;  3AE8 A;  1N1P A;  2UU9 T;  4PDW D;  3PVC A;  3FBZ A;  2RA1 A;  4HFB A;  5JDN A;  5HXH A;  1LQT A;  1E7P A;  1I6Z A;  4IE6 A;  3AE1 A;  3RHW A;  2C76 A;  4ZN0 A;  2NW9 A;  4H2P A;  2KSR A;  2Y6X A;  4O5Q A;  5JCK A;  2NVK X;  1E39 A;  3DP7 A;  1R8I A;  3C4Z A;  3ZMV B;  3NH3 X;  4JY3 A;  3S4U A;  4J2W A;  3MJX A;  2OA1 A;  2WPC A;  5KMS A;  1R09 4;  2V6X A;  1S35 A;  1ASJ 4;  3ALJ A;  3LSV A;  2AQJ A;  2JK6 A;  1KFY A;  1BR0 A;  1D7L A;  4HKA A;  2XQ6 A;  1K4Q A;  1IZN B;  3FXE B;  5LJM A;  5FXZ A;  2RGH A;  4EED A;  4G2A A;  5H6R B;  1YY5 A;  4Q4W 4;  1JRX A;  1LTX R;  1Q1W A;  2A9U A;  3FIM B;  3TLT A;  3ISH A;  1RUC 4;  2CEA A;  3AEB A;  4U2L A;  4EIQ A;  1IJH A;  4AP1 A;  3RIU A;  2VVN A;  4LF8 T;  4BJZ A;  3LXD A;  4GKJ T;  3EAN A;  2R7F A;  2JJ9 A;  3GYX A;  2GF3 A;  4P0A A;  3HYX A;  3TLV A;  3V5U A;  3CPH G;  4X20 E;  3RHA A;  4O5U A;  2LM2 A;  4IA6 A;  2CXF A;  2UUC T;  1WYB A;  1OED C;  2GMH A;  2Q6U A;  3A5X A;  2J1D G;  1Y56 A;  3BI2 A;  4BJY A;  2WS3 A;  5IQ4 A;  2QRX A;  3EAO A;  1H7C A;  3I9Y A;  2R0C A;  4DR3 T;  3UOX A;  3JBG 4;  4U31 A;  3VRA A;  4AP3 A;  3RGL A;  2K3W A;  4KX6 A;  4U33 A;  3P4Q A;  3DJD A;  1V9D A;  1O3X A;  2X9W A;  3A8Y C;  4LF6 T;  4IE7 A;  4FX9 A;  1L0V A;  4C3Y A;  5J0Z A;  3T8O A;  1GRF A;  2QVA A;  3GYI A;  3TLU A;  4QH5 A;  3KVE A;  3QSS A;  2LRK A;  4I59 A;  2CUL A;  4E7Z A;  4II2 A;  3H8L A;  1AOG A;  1PBE A;  3QB5 K;  3GRS A;  1YQZ A;  3UU8 A;  3GD4 A;  1R08 4;  5AQM B;  2YLW A;  4JNA A;  3D8X A;  5KWF A;  3A7M A;  5AQI B;  3DGH A;  4REK A;  3UTG A;  2WBL A;  4PJM A;  2V61 A;  5GRT A;  2DHR A;  1PBC A;  2ZMA A;  2RM2 4;  2YDQ A;  3OKQ A;  1YXR A;  4B3S T;  1VDC A;  3PDY A;  1FJG T;  2ODU A;  2CFY A;  4AQY T;  2PLV 4;  4JI0 T;  3M3Z B;  4EQW A;  1IUW A;  3GSI A;  3NKZ A;  1WCR A;  1D5T A;  1H7W A;  2JBV A;  4D04 A;  1H6V A;  3CGD A;  3GMI A;  1BEV 4;  3K3N A;  4BJM A;  3ETU A;  2V6O A;  1NDA A;  4AKL A;  1H8T D;  2BC1 A;  3PUX F;  5JCM A;  4UDQ A;  4YSX A;  4I58 A;  3AAI A;  3PJA A;  2XAF B;  1ZEE A;  1VRH 4;  2QGS A;  2WM9 A;  3UQ4 A;  2X66 A;  4Z91 A;  1FOH A;  2XM2 A;  3CQX C;  1H86 A;  3AA1 B;  1L9C A;  1J5E T;  1CC4 A;  4IDZ A;  2YDR A;  2NWB A;  2KLQ A;  1W0B A;  2XDO A;  3B3R A;  3AD7 B;  3CPI G;  3B57 A;  3LG7 A;  1X31 B;  5ABF A;  3G5R A;  4ZI7 E;  2C64 A;  4LA1 A;  4U3C A;  4CN4 A;  3HKE E;  3IHM A;  5U1O A;  2YR6 A;  3H8I A;  1EV1 4;  5FYM A;  3ZYX A;  3KD9 A;  1ZOV A;  3NRY A;  3CQG B;  1JNR A;  5LBQ B;  4FK1 A;  4EV6 A;  1L9E A;  1AJ3 A;  4A65 A;  2PJQ A;  2CHN A;  1NEK A;  2W2U A;  3CND A;  4J56 A;  5CA1 E;  5H6Q B;  4NXN T;  5AQR B;  1M7K A;  2N1G A;  3DJJ A;  2LM9 A;  1O5W A;  4DV0 T;  5LYJ E;  3AAA B;  4QXC B;  4TWF A;  2UXC T;  4CXX A;  4KP3 C;  2GK9 A;  3UUX B;  4KMC A;  4JBW F;  2IC9 A;  3RKO A;  4DID B;  3GRT A;  5LHH B;  2AE9 A;  3V3N A;  3CK6 A;  4ZCD A;  2NW8 A;  2WOI A;  2OAL A;  1BR2 A;  3AA6 B;  3ANW A;  3CKD A;  1VBB 4;  2X67 A;  4TNW A;  4Q25 A;  3VKG A;  4Z2U A;  2RR1 4;  3SS1 A;  1DXL A;  4M52 A;  5KDM C;  4G74 A;  3LBX B;  3NKS A;  2C66 A;  4JUY A;  4TLZ A;  3ZPO A;  3DK4 A;  4ZI2 D;  5J2U E;  3S61 A;  3I0O A;  2C3C A;  2VL8 A;  4Z90 A;  1XNQ T;  4OPI A;  4H4U A;  2C5J A;  3BHK A;  1D4D A;  2NOX A;  1QSD A;  2APG A;  3UTE A;  2YG7 A;  1VBD 4;  4AKG A;  1UX4 A;  5HXR A;  4H63 H;  2F4V T;  2GVC A;  4JLE A;  2P9B A;  2X68 A;  4UXN B;  1HYU A;  2C72 A;  3ONX A;  2CRB A;  2Y6Q A;  4H2Q A;  2ZM8 A;  4X1K E;  5FL1 A;  4QH1 A;  1E1H B;  2XLP A;  4H4W A;  3ABV A;  4PAG A;  3FPZ A;  4ISS A;  2XAJ B;  1MMG A;  1RUH 4;  2VKO A;  4EZ4 A;  4OCG A;  1YKE B;  3EVY A;  4O4L E;  1PXA A;  3PE0 A;  3CX7 B;  4U8L A;  4CI3 B;  1DOC A;  2A3D A;  1MIY A;  4UP3 A;  4ZXL A;  2X5I D;  2QA7 A;  4XBF B;  2WMN A;  5L3E B;  1SA0 E;  4X65 T;  1LPF A;  1EBD A;  4BK2 A;  4WBO A; 
#chains in the Genus database with same CATH homology
 3UCL A;  4DNA A;  4J33 A;  3UTH A;  3I3L A;  3CGE A;  3GWD A;  5U63 A;  1E1N A;  1F3P A;  3NYC A;  4H7U A;  1DJQ A;  1DNC A;  1CJ3 A;  4H4S A;  4H4Y A;  4YSY A;  3G5S A;  3UKK A;  2C73 A;  2YG6 A;  3ICR A;  1NEN A;  1DJN A;  2YVG A;  4CCQ A;  3T14 A;  2BXR A;  3ADA B;  1ONF A;  4U8N A;  3SXI A;  2OLN A;  2BK3 A;  1K0L A;  4H4V A;  4NNJ A;  3RP7 A;  1KDG A;  3T0K A;  1YQ4 A;  4N9X A;  1TYP A;  4Z24 A;  3SM8 A;  3D1C A;  4CY8 A;  3UKP A;  4J57 A;  2XFP A;  3SZC A;  3VR9 A;  4EMW A;  1E1L A;  5KOW A;  4A7A A;  1VG0 A;  2GQW A;  2YR4 A;  2RGO A;  3AED A;  1M64 A;  4OPU A;  4ZCC A;  3ICT A;  2ACZ A;  2YM1 A;  3BNU A;  3DGZ A;  3IHG A;  4B67 A;  3DJG X;  4USQ A;  3UOV A;  2XVF A;  2BS2 A;  4Y4L A;  1L9D A;  3NN0 X;  3ZDN A;  2B7R A;  3AYL A;  1TDK A;  2FJE A;  5GSN A;  3BI5 A;  1GSN A;  2B9X A;  3NIX A;  4CCR A;  1H82 A;  5C2T A;  4CRT A;  2NPX A;  3F8D A;  4U8K A;  2XLU A;  3UOY A;  3RP6 A;  1CC6 A;  3AB1 A;  1CJ4 A;  5KVI A;  3AEG A;  2Z5Y A;  4U8O A;  2XVI A;  4GF7 A;  3CPJ G;  4YT0 A;  4B66 A;  2E5V A;  1IUU A;  3VRD B;  3P4S A;  2GMJ A;  2XYO A;  3M0O A;  4K2X A;  5M10 A;  1V59 A;  4U2T A;  5BUK A;  1CC2 A;  2BRY A;  3QVR A;  1CHU A;  1EL7 A;  1KF6 A;  1BWC A;  2XFU A;  4G6H A;  1KSU A;  2GR3 A;  4GDE A;  3VR8 A;  3UP4 A;  4DGK A;  1XPQ A;  2YVF A;  2C4C A;  3P4P A;  1GTE A;  2GQF A;  1ZOY A;  3I6D A;  1RSG A;  5BRT A;  1XHC A;  3QSM A;  3T2Y A;  4NTD A;  4C74 A;  1ZDL A;  4YSH A;  4LU6 A;  4BK1 A;  5KVH A;  1BKW A;  4C5O A;  3C4A A;  2WU5 A;  3AE3 A;  1BZL A;  3OZ2 A;  4Y4N A;  2VVL G;  3CN8 A;  4K5R A;  1PXC A;  2C3D A;  2Y6R A;  5EOW A;  4OPG A;  1ZY8 A;  2F5Z A;  4D03 A;  4AOS A;  2ZZB A;  3AE7 A;  2W0H A;  4EMI A;  4A9W A;  3C4N A;  4OPT A;  2BS3 A;  1GEU A;  3RP8 A;  1TDO A;  3GQH A;  2X8C A;  3CNS A;  4IVO B;  4WCT A;  1JU2 A;  5DBJ A;  3DK8 A;  1H81 A;  4NEV A;  1UKV G;  1PJ5 A;  3FBS A;  2GEW A;  4AT2 A;  4EMJ A;  1JRY A;  2EQ8 A;  2H88 A;  2V3B A;  3CTY A;  1GER A;  3L8K A;  4NTC A;  1TRB A;  3S5W A;  4G9K A;  3NT6 A;  2IID A;  3FG2 P;  5IQ1 A;  4ECH A;  3GDN A;  3DH9 A;  3URH A;  3SZF A;  4B64 A;  4UDP A;  3VRB A;  2X3N A;  2WOV A;  1JNZ A;  3F8R A;  1GES A;  3GD3 A;  1E1K A;  4H2N A;  1Q1R A;  4GUV A;  1GRG A;  1ZKQ A;  1NPX A;  2BAC A;  3Q9T A;  4JQ9 A;  1PBB A;  4RG4 A;  4X9M A;  3NTA A;  1NAA A;  1XAN A;  2BRA A;  1N4W A;  2WP9 A;  3AE8 A;  4P9S A;  3AEE A;  1N1P A;  1TDF A;  4XWZ A;  3PVC A;  3C96 A;  2YLT A;  3GQK A;  3AEC A;  3FMW A;  1EL5 A;  2PHH A;  5CKU A;  5KMR A;  2FJB A;  1S2Y A;  2B9W A;  1NHQ A;  1JOA A;  1LQT A;  1E7P A;  2C65 A;  4USR A;  3AE1 A;  3NTD A;  4TLX A;  3NG7 X;  2C76 A;  2V3A A;  2WDQ A;  3AE5 A;  4BUR A;  3ATQ A;  4ZN0 A;  4H2P A;  5KRQ A;  2EQ9 A;  2WET A;  4O5Q A;  5JCK A;  3CMM A;  1PJ7 A;  2JAE A;  2NVK X;  1E39 A;  1NHP A;  3CNT A;  1YQ3 A;  1VG9 A;  3PO7 A;  4Y4M A;  5FS6 A;  4EQX A;  1FCD A;  4H2R A;  2VQ7 A;  3NH3 X;  4JY3 A;  4J2W A;  4A99 A;  2ARD A;  2JB3 A;  2OA1 A;  2WPC A;  4Z26 A;  5KMS A;  3ICS A;  4IVM B;  4GCM A;  3BI4 A;  1MO9 A;  2Q0L A;  3ALJ A;  1H7X A;  2YLX A;  1CJ2 A;  3M13 A;  2AQJ A;  2A8X A;  2JK6 A;  1KFY A;  1D7L A;  1OJA A;  4KPR A;  1N4U A;  3QJ4 A;  1B8S A;  1P2E A;  4U8I A;  2WOW A;  1K4Q A;  3NK2 X;  1FEB A;  2X50 A;  1OJC A;  1GRB A;  3DJE A;  4H50 A;  3SQP A;  2RGH A;  2GAH B;  2GR0 A;  1PN0 A;  4B1B A;  1TDN A;  1YY5 A;  2R4E A;  2BYB A;  3UKF A;  1D7Y A;  2FJA A;  1JRX A;  1LTX R;  3ALL A;  2WPE A;  3DA1 A;  3HZL A;  1Q1W A;  4U8P A;  3FIM B;  1MOK A;  3ISH A;  4E0V A;  2BK4 A;  4U2L A;  3AEB A;  1CBO A;  3COX A;  3LOV A;  1IJH A;  4EIQ A;  2AR8 A;  2V60 A;  1FEC A;  1VQW A;  4UDR A;  4AP1 A;  4BJZ A;  3LXD A;  2BK5 A;  2JB1 A;  1EL8 A;  5JCL A;  3NGC X;  3EAN A;  1GV4 A;  2BC0 A;  1Y0P A;  3GYX A;  4EQR A;  4PAB A;  2GF3 A;  5TR3 A;  3P1W A;  2XLS A;  4ICY A;  3HYX A;  2C7G A;  3CGC A;  2AAQ A;  3CPH G;  3KLJ A;  3RHA A;  3SY4 A;  3RNM A;  4X4J A;  3SYI A;  1RP0 A;  4O5U A;  1BF3 A;  1W4X A;  1CF3 A;  2X8G A;  2R9Z A;  4IA6 A;  3T2K A;  4YKF A;  4EM4 A;  2XVH A;  2Q6U A;  2GMH A;  2WEU A;  1Y56 A;  1NG3 A;  3BI2 A;  4BJY A;  2WS3 A;  5IQ4 A;  3EAO A;  1Z6L A;  2GH5 A;  1IUV A;  2R0C A;  3GWF A;  3UP5 A;  3UOX A;  4LII A;  1GRA A;  3VRA A;  4K8D A;  3NN6 X;  1GAL A;  4AP3 A;  4Z43 A;  1Y56 B;  2UZZ A;  2GRT A;  3UOZ A;  2R46 A;  5HXI A;  3K7M X;  1ZK7 A;  4KX6 A;  1D4C A;  2BCG G;  1O95 A;  2X8H A;  3P4Q A;  3WE0 A;  4YTM A;  4ADW A;  3DJD A;  1F8R A;  3V3O A;  2QAE A;  4FX9 A;  2BCP A;  4NEW A;  4TM4 A;  2WQY A;  1L0V A;  2ZZ0 A;  2YM2 A;  3RED A;  4U2S A;  4C3Y A;  1GRF A;  2V5Z A;  1ZX9 A;  4TM3 A;  2VRL A;  3ALM A;  3GYI A;  3KVE A;  3QSS A;  5EB4 A;  3UKQ A;  1ELI A;  4I59 A;  2CUL A;  1LV0 A;  4B69 A;  2CDU A;  4GDP A;  1B37 A;  4II2 A;  1Q9I A;  1VRQ B;  4YXD A;  3H8L A;  2IVE A;  1OJD A;  1AOG A;  5CQF A;  2DKI A;  4YTP A;  1PBE A;  3AE9 A;  3GRS A;  3SZW A;  3CIR A;  1YQZ A;  3P9U A;  2J3N A;  3GD4 A;  2YLW A;  3AE6 A;  4K5S A;  1JEH A;  4JNA A;  3D8X A;  5KXJ A;  5KWF A;  3AXB A;  1IUT A;  3DGH A;  2WHD A;  4REK A;  4Z25 A;  2C70 A;  3UTG A;  1OJT A;  4APN A;  3SUC A;  2WDR A;  2YLS A;  4RSL A;  2V61 A;  1S3E A;  5GRT A;  1NHR A;  4RG3 A;  1ZMC A;  2IVD A;  1PBC A;  5U25 A;  4AT0 A;  2QA1 A;  2Q0K A;  1VDC A;  4BV6 A;  1YKJ A;  1GRH A;  2R0G A;  2CFY A;  3GYJ A;  1QJD A;  4HA6 A;  1KNR A;  1E1M A;  3AYI A;  4EQW A;  1IUW A;  3GSI A;  2LFC A;  4H4Z A;  1H83 A;  3EPT A;  5HHF A;  2FJD A;  1D5T A;  1H7W A;  3AD8 B;  2JBV A;  4K22 A;  4D04 A;  1H6V A;  2BAB A;  4FDC B;  2C67 A;  3CGD A;  2R0P A;  3QVP A;  3UKH A;  3KU9 A;  2V6O A;  1NDA A;  4GAP A;  1CL0 A;  3ITJ A;  3QSE A;  2BC1 A;  3Q6J A;  3KPK A;  2OAM A;  3DK9 A;  5JCM A;  3NYF A;  4YSX A;  4I58 A;  4UDQ A;  1ZMD A;  1PXB A;  3QFB A;  2B9Y A;  3T37 A;  1MXT A;  1TDE A;  3T31 A;  4IA5 A;  2VVL A;  3BHF A;  2H89 A;  2VRM A;  3CGB A;  3SZ0 A;  4EM3 A;  2JB2 A;  1QLB A;  1LJ1 A;  3NK1 X;  3UTF A;  3E1T A;  4NZH A;  3PS9 A;  1FOH A;  2WP6 A;  3AEF A;  2XVJ A;  2YVJ A;  3CNJ A;  5HY5 A;  3R9U A;  1H86 A;  1L9C A;  2XFO A;  1CC4 A;  1H84 A;  4A79 A;  1DOD A;  4CY6 A;  4OVI A;  2YG4 A;  4C77 A;  1S2Q A;  2XDO A;  2WES A;  3B3R A;  3AD7 B;  3CPI G;  1X31 B;  1RYI A;  4JN9 A;  3G5R A;  2C64 A;  3AE2 A;  4LA1 A;  1FL2 A;  4YTN A;  2TMD A;  3HYW A;  3IHM A;  1K0I A;  4YKG A;  3QFA A;  1O94 A;  1GET A;  4J36 A;  5U1O A;  2YR6 A;  4B65 A;  3NHO X;  2BXS A;  2B76 A;  2YR5 A;  3KA7 A;  4TM0 A;  5M0Z A;  3H8I A;  2GR2 A;  1GTH A;  2RGJ A;  4H4R A;  3EF6 A;  3ZYX A;  2XCG A;  2XVE A;  5KMQ A;  3KD9 A;  1ZOV A;  2EQ7 A;  5LV9 A;  4Z44 A;  1JNR A;  1DOE A;  4FK1 A;  4U8J A;  3SX6 A;  1GXF A;  1LQU A;  1L9E A;  1JRZ A;  5FS7 A;  3UKA A;  2YLZ A;  4JDR A;  4A65 A;  1DOB A;  1IUX A;  1NEK A;  2A89 A;  3CND A;  4J56 A;  3G5Q A;  2GAG B;  4DSH A;  1GOS A;  1NG4 A;  5FS8 A;  5ER0 A;  3OC4 A;  3DJJ A;  3DME A;  2YG3 A;  5L46 A;  4K7Z A;  2XLT A;  4XWR A;  1PDH A;  1O5W A;  3K7Q X;  4AOX A;  3AE4 A;  1OJ9 A;  2X99 A;  3B6D A;  4CNK A;  1BGJ A;  3IWA A;  1REO A;  1S3B A;  1LVL A;  2EQ6 A;  3M12 A;  4B63 A;  1PHH A;  1PS9 A;  3K30 A;  2BA9 A;  1ZP0 A;  1CJC A;  1GND A;  5JCN A;  4X9N A;  4CBQ A;  2WU2 A;  1NHS A;  3GRT A;  3V3N A;  3KKJ A;  3AD9 B;  4ZCD A;  5KOX A;  2YQU A;  4J34 A;  2O9Z A;  2OAL A;  2WOI A;  2VZ2 A;  2XLR A;  5FMH A;  4II3 A;  2FBW A;  1B4V A;  4G6G A;  4J31 A;  5C3J A;  5IPY A;  1B5Q A;  5EB5 A;  4Z2R A;  2A87 A;  2ZBW A;  2I0Z A;  4Z2U A;  2WDV A;  3KPF A;  1DXL A;  4M52 A;  4G74 A;  3H4K A;  3NKS A;  4GR1 A;  2C66 A;  2RAB A;  3NLC A;  4OPD A;  5EBK A;  2WP5 A;  4TLZ A;  3DK4 A;  4H4T A;  4OPL A;  3LZW A;  2ZZC A;  4JNQ A;  3IC9 A;  5KNL A;  3S61 A;  2QCU A;  3NRN A;  2C3C A;  4YWO A;  3AWI A;  4G73 A;  4GAV A;  5HYM A;  3SFE A;  1QO8 A;  3LB8 A;  4OPI A;  3F8P A;  1GPE A;  4H4U A;  4CNJ A;  2XFN A;  2YG5 A;  1F8W A;  3BNM A;  2JKC A;  1IUS A;  1KSS A;  3BHK A;  1D4D A;  3K7T A;  3NYE A;  2R4J A;  1PBF A;  3T2Z A;  2BS4 A;  3AEA A;  1F8S A;  2APG A;  2VOU A;  3L1R A;  3GMB A;  5BVA A;  3UTE A;  4H4Q A;  4A6N A;  5FS9 A;  1E6E A;  2YG7 A;  4A5L A;  4DSG A;  4JY2 A;  2GB0 A;  1PJ6 A;  3NK0 X;  5KMP A;  4B68 A;  2XFQ A;  4H4X A;  2GVC A;  2QA2 A;  4YSZ A;  4XXG A;  5J7X A;  2OLO A;  2TPR A;  4Z2T A;  1HYU A;  2C72 A;  3AYJ A;  3V76 A;  2CVJ A;  1GT8 A;  2Y6Q A;  4H2Q A;  4OPC A;  2GR1 A;  4NWZ A;  4FK1 C;  1GRT A;  3NNE A;  4EQS A;  3JSK A;  1XDI A;  4WX1 A;  3GMC A;  3ATR A;  3SGL A;  2XLP A;  1N4V A;  1KNP A;  1EL9 A;  4H4W A;  3IF9 A;  3ABV A;  2Z5X A;  1PBD A;  4HB9 A;  2VVM A;  3P4R A;  2VQB A;  4H4P A;  3FPZ A;  4NTE A;  2WPF A;  4IV9 A;  3HYV A;  1FEA A;  4C3X A;  3SFD A;  2HQM A;  3LAD A;  4U8M A;  4OCG A;  2Q7V A;  5BUL A;  1PXA A;  3LJP A;  4U8L A;  2PYX A;  1GRE A;  1DOC A;  2B7S A;  2YLR A;  4MJW A;  5J60 A;  2YWL A;  1P2H A;  4PAA A;  4UP3 A;  1M6I A;  1SEZ A;  2DKH A;  3O0H A;  3VQR A;  4EIP A;  2E1M A;  2YAU A;  2C75 A;  1K0J A;  2R45 A;  1BGN A;  3UKL A;  4BK3 A;  3LZX A;  3II4 A;  1D4E A;  1LPF A;  2WBA A;  1F6M A;  4GRT A;  4TM1 A;  1EBD A;  2GV8 A;  3CNP A;  4A6N B;  1COY A;  3GDP A;  4BK2 A;  1TYT A;  2E4G A;  5JCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...