3VR9A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
613
structure length
613
Chain Sequence
b'AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 199
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr9A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr9A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr9A04
5J60A 3K7MX 1TYPA 3D8XA 1PBBA 5EOWA 4A9WA 3DH9A 4USRA 1N4WA 4U8KA 4A6NB 4IA6A 1LJ1A 2BK4A 1B37A 2HQMA 1OJCA 1DXLA 2O9ZA 3ITJA 3NHOX 4OCGA 1AOGA 1PXCA 4X9MA 3RP6A 3URHA 2WBAA 2R4EA 4U8MA 2H88A 1S2QA 1FEBA 2JAEA 2XYOA 3RNMA 4C3YA 1GESA 2JB2A 1CJ4A 2H89A 1VRQB 1CC6A 3L8KA 4U2SA 1K0IA 3QJ4A 1GRTA 4UDPA 4H4UA 2Q0KA 1OJAA 4B63A 4EMIA 3DMEA 1PJ5A 4O5UA 1ONFA 4H4WA 1MO9A 3DJDA 2BS3A 1P2HA 2OAMA 3SUCA 1O5WA 2YM1A 1FCDA 3DA1A 2APGA 1YQZA 4APNA 2C3DA 2CDUA 2Y6RA 1K4QA 3FG2P 1N4VA 2C67A 2GMHA 4K2XA 4EQWA 4H4QA 1NENA 5BULA 1IUVA 3CTYA 4U8NA 4JY2A 5HXIA 2FJEA 1NEKA 3AECA 3NTAA 4U8OA 3GWFA 1TDFA 2VQBA 2WP6A 2BXRA 4H50A 3AEEA 4ICYA 2YVJA 4RG3A 5U63A 3GDPA 1UKVG 2GF3A 4FDCB 4MJWA 5IQ1A 5FS6A 2YVGA 2WOWA 5IPYA 4B67A 4A79A 3KA7A 3GMBA 2YR4A 3NK1X 4CRTA 3AEFA 5KOWA 3KU9A 2R4JA 1FECA 1LQUA 2X8HA 4I59A 3UKAA 4J31A 3IC9A 3NNEA 2IVDA 3UKHA 4OPDA 2XLPA 5JCKA 1DOCA 2R45A 4ECHA 2V6OA 4YKFA 4NEVA 1N4UA 4EQXA 4OPTA 2E5VA 1F8WA 3ZDNA 1ZOVA 3DK9A 5EB4A 3IF9A 3AE8A 2A8XA 1SEZA 1IJHA 2BACA 1MOKA 1CJ3A 1K0JA 4OPCA 3LB8A 4XWRA 3AE7A 3G5QA 3CPJG 3ICRA 2WS3A 2GR2A 4YT0A 1IUWA 3AYIA 1H6VA 2X8GA 2YLXA 1RYIA 1O94A 3Q6JA 1PJ7A 2TMDA 1EL7A 1PBDA 1CBOA 4H4TA 4C77A 2C70A 1COYA 3AEAA 1PBCA 3AEGA 1S3EA 2EQ8A 2YG5A 4YWOA 1JRZA 1KFYA 2JKCA 3I3LA 3OC4A 3GDNA 2VRLA 5KVIA 1GTEA 1GNDA 1IUSA 1XANA 3S61A 4J2WA 1NHSA 2BS4A 1Y0PA 3DGHA 5JCIA 1BGNA 1LTXR 4AP1A 2PYXA 2WOVA 4NTEA 5CKUA 2GMJA 3NN6X 4ZCDA 1S3BA 2C65A 3NTDA 3NT6A 3DK8A 2OLOA 3DJJA 2XFQA 2XVHA 1IUUA 4D03A 1FL2A 1KF6A 4K5RA 3AEBA 3M12A 3GD3A 4ZN0A 4EMJA 4Z44A 4EQSA 3UOYA 2AR8A 4U2LA 3GWDA 2EQ7A 4C5OA 2XVJA 4OPUA 1JNRA 1O95A 4I58A 4TM3A 2NPXA 1GRAA 5LV9A 1GERA 3REDA 2XFPA 3C4NA 2XCGA 2B7RA 2R0CA 3UKQA 4LIIA 1FEAA 3FBSA 3QVPA 4D04A 4J57A 2BC0A 3BI2A 2FJBA 2ZZCA 1N1PA 1P2EA 3UKPA 2Q6UA 2R0PA 3ALMA 3LZWA 2C7GA 1EL9A 2GEWA 3S5WA 3GRTA 3NIXA 2B9WA 2GR1A 3UTEA 4NZHA 1HYUA 3G5SA 2IVEA 1ZDLA 3AB1A 3GYIA 1KNRA 1RP0A 5J7XA 3NK2X 1VG9A 3NGCX 4B69A 1KDGA 2IIDA 3D1CA 2JBVA 3FMWA 3ABVA 1E1KA 1H86A 4Z43A 3P4RA 1JEHA 3BNMA 3VRDB 4DSGA 1M64A 3NKSA 1GV4A 3NYEA 3IHMA 1NHRA 3II4A 4UDRA 4CNKA 4U8IA 3QFAA 5C2TA 4BJYA 4BJZA 1H83A 1GT8A 1TDKA 1CL0A 3VR9A 1EBDA 1GXFA 2V3AA 3CN8A 2GB0A 2FJDA 5EBKA 1GREA 3CIRA 4LA1A 3C4AA 2VVLG 3GSIA 2JB1A 4FK1C 3KVEA 1GRBA 5CQFA 3CGDA 3EF6A 4YTNA 2WDRA 3HZLA 4J33A 4B1BA 3SQPA 1JNZA 3E1TA 1JU2A 4USQA 1TDEA 2WESA 1Q9IA 3ICSA 3ICTA 3UKLA 3OZ2A 2BA9A 3C96A 3CNDA 1DOEA 3AYJA 4H2PA 4JDRA 3ZYXA 4YSYA 4K8DA 4X4JA 4OVIA 3FIMB 1D4EA 3LZXA 3GYJA 2VVLA 1F3PA 2YVFA 3SFEA 4DGKA 3QFBA 4BURA 2DKHA 4AT2A 1E1LA 4B66A 3AXBA 3DJEA 1F6MA 1XHCA 3SFDA 3KLJA 3H8LA 4FK1A 1GOSA 4H4ZA 3F8DA 1E39A 2YLWA 2B9XA 4J36A 4J56A 3SGLA 1EL8A 1ZMCA 1YY5A 2B9YA 1TRBA 1GRHA 2VZ2A 1H81A 2V5ZA 3CPHG 4CNJA 1D7YA 2C75A 3UOXA 3P4QA 2Y6QA 3GD4A 3NYCA 3PVCA 2YWLA 1YQ4A 2WPFA 3V3OA 1D5TA 1ELIA 2X3NA 1Y56B 3ATQA 1NHQA 1DNCA 1MXTA 2XLRA 5JCMA 2W0HA 1LV0A 4K22A 4Y4NA 2WU2A 4Z2RA 5TR3A 2YLZA 3CNTA 4GCMA 3PS9A 5KOXA 1E7PA 1DOBA 3KPFA 4PAAA 4KX6A 2GH5A 2RGOA 4Z26A 1NG3A 3GQHA 4WX1A 3F8RA 2WDQA 3EAOA 4U8LA 3RHAA 2JK6A 2OLNA 1FOHA 1K0LA 2QA1A 4H4XA 4A65A 1PXAA 5JCLA 1VQWA 4H2QA 3UKFA 3G5RA 3JSKA 3K7QX 3H4KA 1V59A 5IQ4A 2GR0A 1QO8A 4H4VA 2GAHB 3IWAA 1PN0A 1GSNA 2R9ZA 1D4CA 3VR8A 3NN0X 4LU6A 2XVEA 2XVIA 3P1WA 2VOUA 1GPEA 3NK0X 2R46A 3CNPA 1CJ2A 1LQTA 3VQRA 5EB5A 2WHDA 4TM1A 2YG7A 3R9UA 2J3NA 4OPIA 4CBQA 1ZOYA 3NG7X 3AE9A 3KD9A 3UTHA 1CHUA 2BK5A 1OJDA 3LOVA 2C3CA 1D7LA 4GF7A 1NPXA 2XFOA 1VDCA 1KSSA 3AE2A 2BK3A 2GQFA 2ZZ0A 3UTGA 1REOA 4A7AA 3B6DA 2X8CA 3GMCA 1BWCA 4O5QA 4Z25A 2XLUA 1EL5A 1X31B 4NTDA 1DJNA 1TYTA 2F5ZA 2GQWA 2QCUA 4H4PA 5FMHA 4C3XA 3GYXA 1ZK7A 2GVCA 5M0ZA 2OALA 4TLXA 1CJCA 4XWZA 1DJQA 4GR1A 4H2NA 2Z5XA 2Q7VA 4H2RA 4H7UA 1B8SA 2YQUA 1H82A 2C66A 1CC2A 4A5LA 1B4VA 3QSEA 2V3BA 4XXGA 1GRGA 2GR3A 2I0ZA 2RGJA 3V76A 2YLRA 1NDAA 4BV6A 3ALLA 4RG4A 1L9DA 1L9EA 2PHHA 2QAEA 2WPCA 4NEWA 4P9SA 3AD8B 1PS9A 3BHKA 3UP5A 2BXSA 3UP4A 4EMWA 1TDNA 4BK2A 2BCPA 3AD9B 3BHFA 4BK1A 2YR5A 2YR6A 3M0OA 4FX9A 3WE0A 4U2TA 4EQRA 3LXDA 3VRBA 4GDEA 4N9XA 2TPRA 4E0VA 2WU5A 2JB3A 1F8SA 3DGZA 4H4RA 1H7WA 2WP9A 3ATRA 3NH3X 3CGEA 1VG0A 3L1RA 4H4SA 3CGBA 2V60A 5U25A 4AOSA 1KNPA 1QJDA 4DNAA 1KSUA 1XDIA 1OJTA 2CFYA 2XVFA 4CY8A 1OJ9A 1Y56A 4CCRA 1ZP0A 4TM4A 1PDHA 4Y4LA 2FBWA 3UOZA 1S2YA 4Z2UA 2C76A 3GQKA 2XLSA 3P4PA 3NLCA 1E1MA 2CVJA 3AD7B 1PXBA 4JNQA 5BVAA 2DKIA 1E1NA 2WETA 2YM2A 3ADAB 4NTCA 5ER0A 1CF3A 3UOVA 4AT0A 2Z5YA 3CNSA 2BS2A 2ZZBA 3P4SA 3EANA 4YTPA 3KKJA 3ALJA 3VRAA 4B64A 5BRTA 1L0VA 2B7SA 3I6DA 4K5SA 2NVKX 4KPRA 5KVHA 2VVMA 3PO7A 3AYLA 5HY5A 2AQJA 2GV8A 5C3JA 1Z6LA 2WOIA 3AWIA 3CPIG 4EIQA 4YSHA 5JCNA 4UP3A 2E1MA 3NRNA 4B68A 4DSHA 4Y4MA 3H8IA 2VQ7A 3K30A 1RSGA 4EIPA 5KRQA 2ACZA 4BK3A 4EM4A 1BGJA 2AAQA 3O0HA 5GRTA 3K7TA 2QA2A 2YG3A 4U8JA 4JQ9A 4WCTA 5HYMA 1YQ3A 5HHFA 3DK4A 2FJAA 1NG4A 4Z2TA 2WEUA 5FS7A 3QSSA 2BC1A 2XDOA 2WP5A 3UCLA 2WDVA 2A89A 3RP8A 2C64A 1Q1RA 4IVOB 2EQ6A 1PJ6A 4YXDA 1F8RA 2WPEA 2E4GA 1PHHA 4JNAA 2X99A 1QLBA 4YTMA 1ZY8A 4UDQA 5BUKA 2XLTA 4IV9A 2ARDA 3UTFA 4REKA 3RP7A 3LADA 4TM0A 3AE4A 2C73A 1B5QA 1NAAA 4EM3A 5DBJA 4J34A 5M10A 5KXJA 2RGHA 4M52A 2GRTA 1H84A 1M6IA 5GSNA 5U1OA 3Q9TA 1GALA 1ZKQA 2YLTA 4OPGA 3ISHA 1LVLA 1DODA 4A99A 3FPZA 2XFUA 2GAGB 2RABA 1W4XA 4Z24A 3AE3A 3LJPA 3T37A 1BZLA 1YKJA 2LFCA 4IVMB 4CCQA 2BYBA 1XPQA 4C74A 4HA6A 2YLSA 1BKWA 1JRXA 2BCGG 4U8PA 2Q0LA 5FS9A 3DJGX 1LPFA 3CGCA 3P9UA 2ZBWA 1NHPA 3QSMA 4PABA 2YG6A 3BI4A 2X50A 3AE5A 4A6NA 2WQYA 1ZMDA 5L46A 3IHGA 4YSXA 4GDPA 2XFNA 4GUVA 1D4DA 3M13A 4IA5A 3V3NA 1GETA 4OPLA 4YSZA 1PBFA 1E6EA 4JY3A 4TLZA 4AP3A 5FS8A 1GRFA 3AE6A 4H4YA 2BABA 1JRYA 2V61A 3GRSA 2CULA 1L9CA 4JN9A 3CNJA 1H7XA 2R0GA 1GTHA 3AEDA 3EPTA 3COXA 4AOXA 4GRTA 2UZZA 1BF3A 4YKGA 3AE1A 1GEUA 1Q1WA 4K7ZA 1IUTA 1PBEA 3BI5A 2A87A 1IUXA 5KWFA 4X9NA 2YG4A 2VRMA 2B76A 1TDOA 4CY6A 1ZX9A 1CC4A 2YAUA 4RSLA 3QVRA 3NYFA 2C72A 2EQ9A 3SM8A 4HB9A 4ZCCA 1JOAA 2OA1A 3UKKA 4ADWA 3BNUA 4B65A 3F8PA 3B3RA
chains in the Genus database with same CATH superfamily
5JREA 4JI6T 2KWHA 3D8XA 5EOWA 3DH9A 4DIDB 4X5TA 4HFDA 3NHOX 4IDNA 1HX8A 3M3ZB 4DMVA 3URHA 4KUMB 2VASA 3L8KA 2WY2A 2XAHB 1CJ4A 1VRQB 3MK7C 2X66A 1WFDA 3EHZA 2EHOC 4UV8B 3T0KA 4CI3B 3AXJA 3DMEA 4HFVA 5FXVA 3M65A 4H4WA 2QYWA 1MO9A 2BS3A 2EX3A 2QGSA 3SUCA 3RKGA 2YM1A 1WR0A 2APGA 2QA7A 1YQZA 2C3DA 2M67A 4IE6A 2Y6RA 3EDVA 4AQGA 2XAQB 2C67A 2GMHA 2J62A 3PTRB 4X1KE 4H4QA 1V9DA 1RUG4 5HXIA 1RHI4 3AECA 2WP6A 4H50A 5AQLB 2YVJA 1UKVG 5DJQC 2YVGA 2LEHA 2XQ4A 4A79A 1IJ5A 3SZ0A 4B3MT 2I0MA 4EOZB 5KOWA 4O4HE 1W9RA 1VOMA 4J31A 4ZHQE 3IC9A 3HI2A 4JYAT 5JCKA 2A72A 2V6OA 2G0UA 4IDPA 2HPLA 3ZDNA 4ZOLE 3CVRA 1I94T 1SEZA 2D0TA 3AAIA 1MOKA 1CJ3A 4OPCA 2CE7A 4FI5A 2YLXA 1PO14 3ZT5A 1O94A 1O3XA 2B1EA 4EEBA 1PJ7A 2TMDA 1EL7A 1PBDA 3R84B 1CBOA 2Q9QB 5FL0A 2C70A 1S3EA 4JEUB 1X9BA 2LSGA 3GDNA 1B7TA 1GNDA 1IUSA 4UIGA 3ZKRA 1NHSA 3TLVA 1Y0PA 2BG9E 5JCIA 3RF1A 1BGNA 4AP1A 2PYXA 2GMJA 2HPJA 4HTEA 1HG2A 2XFQA 2NW9A 5LGTB 2XVHA 4LF6T 1KF6A 4K5RA 4U33A 3GD3A 2XQ5A 2AR8A 4U2LA 2X9WA 4JI4T 1VBC4 4HKAA 4TM3A 2NPXA 1GRAA 3REDA 4AIUA 3ETVA 4LFBT 3C4NA 4JEHB 3ONJA 2JQHA 2PZSA 4B6XA 1MIYA 2BC0A 2FJBA 2WWVA 1N1PA 1AL24 3UU8A 1P2EA 3ZLIA 2YDQA 4L9IA 5FXZA 3UTEA 4NZHA 1HYUA 2V5DA 1ZDLA 3GYIA 1RP0A 4OX9T 1BR1A 4B69A 1KDGA 4X1YE 2IIDA 1HFAA 4I50E 2JJ9A 3FMWA 1E1KA 2NW7A 4F6RC 2X0HA 3CQGB 1JEHA 4WBOA 3BNMA 2XM2A 1U5PA 1GV4A 3II4A 4U8IA 3QFAA 3WAKA 1H83A 1CL0A 2BG9C 1GXFA 5JDNA 2LT3A 5EBKA 1GREA 3QC9A 2W4XA 3TLUA 2HN2A 5LGUB 2J1DG 4J33A 4B1BA 3HKCE 3E1TA 2CMRA 2WESA 1Q9IA 5FVKA 4IDOA 5ABFB 4JDRA 3AVSA 4YSYA 3LJCA 1VBA4 3RC3A 5BMVE 4JUYA 5DABA 4NUVA 1F3PA 5HWXA 3KBTA 4B66A 1F6MA 1RUJ4 5LBQB 2VB6A 1RUF4 3H8LA 4FK1A 1E39A 2B9XA 3SGLA 2DHRA 1EL8A 1TRBA 4CNJA 2V5ZA 2KT9A 2CCQA 2PBIA 3GMIA 4YJ3E 3NYCA 3PVCA 3CKDA 2JIWA 5JR9C 1D5TA 1ELIA 4XBFB 4YHHT 2W00A 5L3BB 4Y4NA 2YLZA 5CFBA 1E7PA 2RGOA 4GKJT 4Z26A 3AB3B 4H4XA 4HWIB 1FOHA 5LMUT 2R044 1VQWA 1I6ZA 5IQ4A 1OEDB 1D0ZA 3PURA 1QO8A 3IWAA 2IHR1 1NWMX 3OBVE 3PUXF 1D4CA 3VR8A 3NN0X 3L8RA 4L5GA 1GPEA 2CHNA 3NK0X 2R46A 3N9PA 3FZHB 2MBGA 2YG7A 2J3NA 1ZOYA 2VKDA 1XMOT 3UTHA 4EB6E 2ACXA 2V7LA 2CXLA 2WCAA 4GF7A 1MNDA 3UU5A 5AQNB 3CPZA 3AE2A 2BK3A 4L0RA 2K3WA 4A7AA 3G06A 2V7KA 4QX7B 1X31B 2LOPA 4C3XA 4H4PA 3SX6A 1VCSA 1POV0 4XWZA 1DJQA 4GR1A 4TWHA 4H2RA 4H7UA 5ABEA 1H82A 2JMKA 1CC2A 5JRCB 4XXGA 1GRGA 2GR3A 1M62A 4KBMB 4O4JE 4BV6A 2UUCT 3ALLA 5LJNA 1L9EA 4G73A 1LVFA 3AD8B 3FHNA 3C4ZA 3Q9DA 4LMKA 4BK2A 3IA3A 2WMNA 3BHFA 3WE0A 5IUXA 5L47A 3LXDA 5L3FB 4ERRA 4E0VA 2TPRA 2JB3A 4H4RA 2Q9QC 1XHXA 5U25A 4AOSA 4HFHA 4DNAA 2PY5A 1OJTA 2XVFA 5BR8T 3HKDE 2UU9T 1W0BA 4CCRA 2WB5A 5J1GA 1R084 4ILBA 3UUNA 3UOZA 2C76A 3Q5DA 1CF3A 3K3OA 3CNSA 2BS2A 2AXDS 2ZZBA 3UU3A 2QVAA 5HXSA 3LG7A 2V8SV 2B7SA 5KVHA 4AKHA 2NVKX 1FEWA 5L4HA 3PV0F 2LHRA 2UXDT 2DNXA 3NVOA 3CPIG 4YSHA 3F2EA 4WNKA 2JRKA 4QXBB 4Y4MA 2YU2A 4EM4A 3RX6A 2XQYA 3GN5A 4AKRB 4E7SA 2FJAA 2UUBT 2CRBA 3C4XA 2BC1A 2WP5A 3UCLA 3Q5WA 2A89A 3RP8A 1Q1RA 5LOVE 3IBPA 2XSAA 2J4GA 4GKKT 1ZY8A 4UDQA 2ARDA 4LF8T 4H9SE 3LADA 4TM0A 1B5QA 5M10A 4Q4X4 5GSNA 4ZI2D 1EV14 5AQIB 2XZEA 2XFUA 3T37A 1OEDE 2LFCA 4IVMB 4EGWA 3SXIA 2BCGG 4U8PA 2Q0LA 3JD74 4AKIA 4I43B 2ZBWA 2X0LB 4PABA 2VL8A 3BI4A 4ISSA 3IHGA 4YSXA 2NTXA 5LA6E 4TLZA 1E6EA 4CXXA 3MXZA 3CMLA 1GRFA 3KPKA 3OYXA 4O2BE 3AEDA 2UXNB 2CWOA 3FZKB 3QB5K 1BR4A 3N2OA 4K7ZA 3BI5A 2X67A 2A87A 2XQ8A 1XMQT 1IUXA 2RP4A 4CY6A 1ZX9A 3ANWB 1CC4A 2DWGA 2YAUA 1WYBA 1JOAA 3QB5A 2OA1A 3NZPA 3UKKA 3BNUA 3F8PA 5J60A 5JDLA 3K7MX 1FMVA 4PJNA 1MMGA 4AISA 4A9WA 4IL9A 1N4WA 2CXFA 1LJ1A 3ITJA 3OJAA 1S2QA 3T1YT 2H89A 5KMRA 4DR7T 2NP9A 4P09A 4CQIA 4IE0A 4UDPA 5AFUL 1IZNB 2L3LA 5HEJA 4H4UA 4EMIA 1PJ5A 3DJDA 4DV6T 4HWHA 2YK0A 5LXTE 4NXMT 4GAVA 2W66A 1FCDA 3DA1A 1U4QA 4WZXA 2I6HA 4APNA 4NWZA 2CDUA 1K4QA 4K2XA 3J7Yq 1XNQT 3HYXA 3ZMUB 5BULA 1NEKA 4EV6A 4X20E 3NTAA 5EK2A 3AEEA 4ICYA 2XM1A 3GDPA 4FDCB 4MJWA 5FS6A 4EXTA 1Z7S4 3KA7A 2YR4A 4CRTA 1MIWA 3KU9A 2WAUA 3RPUA 1FECA 1LQUA 4P0BA 2VKHA 4UEMA 3LBXB 5ETWA 3UKHA 4OPDA 3UU4A 2R45A 4ECHA 4NEVA 3L39A 2MTQA 1ZOVA 2LSJA 5EB4A 4JI7T 4X62T 1SA0E 3ZMTB 2BACA 3MA9A 3LB8A 3GA8A 3G5QA 3ICRA 3JBG4 3RIUA 3AYIA 2X8GA 2LOSA 3ZPOA 4PFOA 3WI3A 1RYIA 5H6QB 3Q6JA 4ZS3A 4OYJA 4O2AE 1YKHB 4C77A 1BEV4 1XHZA 1D0XA 4DUYT 2CLYC 2EQ8A 4EEDA 2JKCA 4CZZB 3CQCB 2VRLA 1XANA 2CBIA 3S61A 3BK9A 2QRXA 3DGHA 3S4UA 2LJLA 3T14A 4M1PA 4BA9A 2C65A 1BR2A 3NT6A 2OLOA 3HYVA 1IUUA 3PUQA 5HCJA 3M12A 2LM9A 3SY4A 2UXCT 3GWDA 2EQ7A 2HWB4 4OPUA 1JNRA 1O95A 3PJAJ 2Z6EA 5LV9A 3P7IA 1GERA 3FZLB 2LSYA 3FXDB 4ILCA 4ASKA 2B7RA 3RQWA 2IUBA 5LYJE 3QVPA 3PU8A 3QK6A 5HXEA 1IBLT 4AI6A 2ZZCA 4ILUA 2R0PA 2X9XA 3A7MA 3LK2B 3E08A 5ABFA 2B9WA 5JR9B 3JCFA 4DR2T 2BRYA 1COV4 3RH3A 4H9OC 4DV4T 1VG9A 5AQSB 5LHGB 3F57A 4ANJA 4JI8T 2RS14 3ABVA 2MPKA 3VRDB 4H9PC 4DSGA 5JH7E 4CNKA 1VRH4 4K0KT 4KHPT 5C2TA 2K5BB 5JDGA 3CX7B 1GT8A 4HWDA 4PJMA 1W09A 3D0TA 1UX4A 4DMWA 4Q4V4 1D1CA 1HF8A 3AA0B 1HS7A 2JB1A 2VVLG 2XY8B 3KVEA 4FK1C 1RUI4 2XPKA 3HZLA 3RI5A 2WDRA 1WR6A 4YTNA 4LF7T 3UFEA 1JU2A 4USQA 4HFBA 2RPAA 3ICTA 3OZ2A 3Q5EA 5FY0A 3C96A 3AYJA 1IJ6A 4TZ4C 3ZYXA 4K8DA 3OYZA 4ZI3D 4QH4A 1D4EA 4AXPA 4KI0F 3FIMB 3LZXA 3JAFA 3SFEA 4DGKA 4BURA 4U2YA 1E1LA 1WYCA 3DJEA 5JDQA 2JQ9A 2ZM8A 3ZYKA 4OHFA 3OVUA 2VURA 2UUAT 3PU3A 4DR1T 3LK42 2B9YA 1N36T 1H81A 3CPHG 4DNDA 1D7YA 3UOXA 3P4QA 2Y6QA 4P0AA 4DV0T 1YQ4A 4DV2T 2DLRA 1W0AA 3EABA 5KMPA 1Y56B 1DNCA 1MXTA 3K1SA 4K22A 4Z2RA 2C5JA 2E8IA 2WU2A 5JVDE 2UXXB 5L4EA 5A1LA 4GCMA 1OOPD 4PAAA 2CPTA 4GYRA 5HXRA 1NG3A 2KINB 4WX1A 2WDQA 3EAOA 4U8LA 4G63A 2QA1A 4A65A 3ZMVB 1PXAA 1MNEA 3ZT7A 2XASB 3UKFA 3TLTA 1V59A 5FY1A 2GR0A 2BKOA 3RIFA 1PN0A 5JRCA 3I9YA 3CWZB 4NXNT 3CNPA 1LQTA 2JQKA 4O4LE 4XAXB 5EB5A 2IAKA 3L09A 2WHDA 4CBQA 3NG7X 2V7IA 1XNRT 2OA5A 4CN1A 4K0UA 1CHUA 4WYVA 2BK5A 2VKJA 2C3CA 4YHJA 2XQ3A 1NPXA 2XFOA 2KXPB 2BZBA 5KMGP 4X65T 1KSSA 3ZCJA 2GQFA 1NA1D 2LRKA 5GONE 4DV7T 1REOA 5KMSA 4Q4Y4 3B6DA 2X8CA 1Z0PA 4Z25A 4KMCA 1N33T 1HNWT 3I0OA 4NTDA 1DJNA 2F5ZA 5FMHA 2VQET 5AQOB 5M0ZA 4PK5A 1CJCA 1Z8UA 4H2NA 5FVLA 4ZI2C 2I59A 2RM24 4II2A 4H9NC 4A5LA 2V3BA 3TLWA 3V76A 2RGJA 2YLRA 2NWBA 3KFWX 1HRV4 1YW0A 2PHHA 2QAEA 4P9SA 5L3EB 3T2KA 2BXSA 3UP4A 4BK1A 2YR6A 4NPPA 4EQRA 3VRBA 4GDEA 2WU5A 1H7WA 2JPFA 3ATRA 3NH3X 2IW5B 4H4SA 3QUJA 1QJDA 4JI1T 1XDIA 4CY8A 1OJ9A 4UVAB 3UULA 4MLKA 3NBXX 2LHNA 3GQKA 3PUSA 3P4PA 2CVJA 4JNQA 2YM2A 4C91A 4JBWF 3RQUA 4Z91A 5AQMB 3KKJA 2V6YA 3ALJA 1L0VA 5LNKA 2VVMA 3PO7A 4PJJA 5L3DB 5HY5A 2GV8A 5C3JA 5JCNA 3RYCE 3UU6A 4GAPA 4UP3A 1VBD4 1T98A 3ZCIA 3NRNA 2EHOA 3HKEE 5KRQA 2ACZA 3SS1A 1DU2A 1BGJA 2AAQA 2QA2A 4JQ9A 5HYMA 5HHFA 1IBMT 3IHRA 3QSSA 3I9WA 4DV5T 2YDRA 5EK4A 1MMNA 1LRZA 4DVDA 1F8RA 4ZXLA 4EIWA 2E4GA 2W61A 4YY3T 5BUKA 3K8PC 2XLTA 3A5XA 4REKA 5EZYE 3AE4A 4BAYB 4J34A 4IDQA 3V5UA 4M52A 5HAXA 1M6IA 1YKEB 5HEGA 5U1OA 4XZCA 1DODA 5F5WA 2GAGB 2PW9A 2SPCA 1YKJA 4CCQA 5FL1A 4G6GA 2BBJA 4G9KA 3P50A 1BKWA 1JRXA 4TN7B 2PLV4 4UV9B 1NAFA 1NHPA 3W15B 4HWFA 2YG6A 4LFAT 3AE5A 2KNDA 1RVF4 1X79A 2YINA 2CWYA 3K3QC 1D4DA 3V3NA 1PBFA 4JY3A 4AP3A 2Y6XA 5FS8A 2LLYA 1JRYA 3GRSA 2CULA 1L9CA 3CNJA 2H7OA 2IC6A 2XUEA 3EPTA 4YKGA 4PK6A 1Q1WA 1PBEA 2VL0A 3T31A 2ES0A 2B76A 2VWAA 1RUE4 4RSLA 3KINB 3QVRA 3NYFA 1Y64B 2EQ9A 3PUZF 5AQQB 2YKSA 4B65A 2N9DA 2E9XA 1TYPA 1PBBA 2XQAA 5ABGA 4F8HA 3MJXA 4A6NB 2BK4A 2HQMA 2O9ZA 1DXLA 4OCGA 1PXCA 2IIUA 3E0ZA 2R4EA 2X9YA 1FEBA 3RNMA 4C3YA 1XDPA 3NKZA 2V6XA 4U7YA 2YDSA 4U2SA 1K0IA 1HCIA 3QJ4A 4ISTA 1GRTA 5CJ5A 3F31A 3DP7A 2WM9A 2Q0KA 1RUH4 3FB2A 2WBLA 4O5UA 1ONFA 5AQHB 4Q25A 2CLYB 5L3GB 3RHWA 1O5WA 1T7SA 4PFPA 4QH1A 3FBZA 4AQFC 5HEHA 2Y8DA 1N4VA 4EQWA 5IHYA 1NENA 1EAH4 2FJEA 2L8KA 4GK5E 1TDFA 2VQBA 2WWUA 2A2FX 3MACA 2C5IT 5IQ1A 4X66T 2WOWA 5IPYA 4B67A 3UT5E 2BG9A 4DBRA 2BKPA 1RMU4 1QSDA 4NNJA 1XDOA 3C64A 4I59A 4G2AA 3N2GE 3U3IA 1N32T 2MAWA 3QOFA 5H6RB 4EQXA 3NRYA 4OPTA 1F8WA 1E2AA 4EZHA 3IF9A 1IJHA 2C0SA 3JC6C 1T72A 1K0JA 4XWRA 3AE7A 2X9HA 2WS3A 1QUUA 2GR2A 4LF9T 3KVBA 3ONXA 1H6VA 2IC9A 4WW0A 1J5WA 1XWMA 4UR9A 4ZZCA 2DL1A 1K5MD 4Q4W4 1UCUA 2BKNA 4KP3C 4ZI3C 1PBCA 4YWOA 4UELA 5M4YA 5JR9A 2AE9A 2PTFA 2W63A 1HX1B 4J2WA 4MBQA 3CK6A 2W67A 1LTXR 2WOVA 4ZCDA 2CBJA 1HRI4 1WCRA 3IF8B 2N2NA 4U74A 4CXWA 3DJJA 2BDEA 5LG3A 3AEBA 5HWYA 4Z44A 2D9DA 4C5OA 2XVJA 4I58A 1G73A 2GK9A 1S94A 3N9MA 2XFPA 3UKQA 1FEAA 3FBSA 5AQFB 4D04A 4J57A 5LB7B 3BI2A 4ZZBA 5LP6E 2PFVA 3LSVA 4ILAA 2Q6UA 3LZWA 4GYSA 1D1BA 3KBUA 3S5WA 3ZMZB 3GRTA 3H3MA 3NIXA 5J2TE 1WLXA 3EVYA 2IVEA 3AB1A 3PJAA 3PUVF 1Y01A 4DR6T 5LHIB 1NCQD 4EZ4A 3H3AA 4ZEYA 3D1CA 5IYZE 4QHOA 1H86A 3P4RA 4QX8B 5ABHA 1G8XA 1M64A 5HXCA 3IHMA 1NHRA 4UDRA 2VVNA 4BJYA 4BJZA 2A3DA 5FKYA 4B3ST 2FJDA 2XQ6A 2UXBT 3C4AA 3GSIA 4GOUA 5CA1E 1JNZA 3R6NA 4DUZT 1TDEA 3ICSA 3UKLA 2BA9A 4DBQA 3CNDA 3V5SA 2Q9QA 3ESLA 4X4JA 1UGOA 1YD8G 2VVLA 2CHOA 5J0ZA 2DKHA 4AT2A 4TX5A 1XHCA 3SFDA 2D0UA 5FP3A 2RMU4 5KNLA 4II3A 4H4ZA 3F8DA 5IWAT 4YJ2E 5KMQA 2YLWA 2LKGA 4J56A 1ZMCA 4N78D 1J1JA 1YXRA 3BQIA 3RRCA 2YWLA 4CI2B 2X0YA 3EI0A 4UVBB 2WPFA 3V3OA 1M7KA 4O4IE 3ETUA 1NHQA 5JCMA 2XLRA 1LV0A 3ZJ2A 3HL6A 5JDFA 3PS9A 3KPFA 4U7IA 4U72A 2GH5A 3F8RA 2JK6A 1K0LA 4JI5T 5JCLA 1MIVA 4H2QA 4MHCA 1VBB4 3K7QX 2OLTA 3H4KA 5FNVE 4H4VA 1GSNA 2R9ZA 4JI2T 4NIQA 4LU6A 2VOUA 2KWIB 5EK3A 3VQRA 5LJMA 5DQWA 4B3TT 4H63H 4OPIA 2E2AA 3AE9A 2KSRA 3KD9A 3GN5B 2V5CA 3KV4A 5ADXL 3LOVA 1HR0T 4PNIA 1D7LA 1HXS4 2ZZ0A 4IGUA 3UTGA 1CUNA 1N34T 4A5XA 3GMCA 1BWCA 4O5QA 3Q2MA 3O1JA 2XLUA 1BR0A 1EL5A 1HG5A 3L3PA 1TYTA 2GQWA 4X1IE 3GYXA 3AA1B 1HNXT 2GVCA 4TLXA 4AKLA 4IE4A 2XAGB 3UUMA 4TV9E 4PK4A 1KEYA 2NOXA 2Z5XA 4QH5A 3VU7H 3QSEA 2DWKA 3B13A 4RG4A 4NEWA 2WPCA 5LMNT 4UXNB 4P1NA 3BHKA 5HCMA 1XZYA 1UK5A 2XQ7A 2YN6A 2BVMA 3K3NA 2WP9A 3CGEA 4DR5T 3L1RA 3CGBA 2V60A 1KNPA 3O9XA 1KSUA 3LDQB 2CFYA 3J9X1 3JC6D 4JI3T 4RHV4 1ZP0A 5FYMA 1ZHCA 3HKBE 2FBWA 4TM4A 4JI0T 4Y4LA 4PDWD 4Z2UA 3CMMA 2XLSA 3AD7B 2WZHA 4DV3T 1PXBA 5ER0A 3ADAB 4NTCA 3SZWA 4AT0A 3H37A 2Z5YA 4YTPA 4MALA 5HEOA 2D5UA 3VRAA 4B64A 2XAJB 1OEDA 2VVSA 4PJLA 2C4CA 3AYLA 1Z6LA 3AWIA 2V26A 4EIQA 2E1MA 4H9QC 2V7MA 3H8IA 4EIPA 4JLEA 3KVAA 4BK3A 3O0HA 5GRTA 4TWDA 2YG3A 5F8PA 1AJ3A 3OTOT 4I55E 1YQ3A 4LF4T 3DK4A 1IAPA 4U31A 4Z2TA 2XDOA 2WDVA 1PIV4 2C64A 2P9BA 4IVOB 3B5MA 2WMOA 2EQ6A 4YXDA 3ZYLA 4TNWA 1RUD4 4UF0B 3ZMSB 4JNAA 1H7CA 2JMHA 1LKXA 3ZN1B 3T1HT 4IV9A 3IEEA 3KDSE 4EM3A 1AR64 3HA4A 3ZJ1A 5DBJA 4IE5A 5KXJA 2RGHA 4OFZA 4H9RC 2GRTA 3Q9TA 1ZKQA 3RYIE 2ZLYA 2ZM0A 5J2UE 2XQ9A 3ISHA 1LVLA 4LFCT 5JDMA 3N9NA 2RABA 1OXZA 1BZLA 4HFIA 2X5ID 3ZC0A 2BYBA 1XPQA 1UURA 4CI1B 4HA6A 2E5LT 2YLSA 3BQKA 5FS9A 3DJGX 3CGCA 4E7ZA 4QWNB 3P9UA 3QSMA 2HHHT 1XI1A 2X50A 4A6NA 2D2SA 4U2ZA 2WQYA 2BRAA 4GDPA 2KMFA 2NW8A 3ZEFB 4GUVA 2L9QA 4OPLA 4YSZA 2K9AA 1R094 3N9QA 4H4YA 2E9XC 1IBKT 3RYFE 1H7XA 3COXA 4AOXA 3PE0A 4GRTA 4HFCA 1BF3A 4DO0A 1IUTA 2PG8A 1OWAA 3X1DA 4X9NA 2VRMA 1TDOA 4WBNE 2OV9A 3UUBA 1S35A 1PVC4 2C72A 3ZC1A 4HB9A 5LCYA 5KX5E 5AQRB 3B3RA 1WRDA 2LM2A 3PUGA 3N9OA 4IREA 4USRA 2R074 2NTYA 4U8KA 4IA6A 3WAJA 1B37A 1OJCA 1SUMB 1AOGA 4KHZF 4BJNA 2A9UA 2LSIA 4X9MA 3RP6A 3FBLA 2WBAA 4Z90A 3ZN0B 2HH7A 2H88A 2JAEA 4U8MA 4EYUA 2XYOA 2VKOA 1GESA 3DJBA 2JB2A 1CC6A 3UUXB 2KZ7B 1GQEA 1J5ET 1OJAA 4B63A 1T8BA 3I1AA 2CA5A 1H8TD 2H3RA 1P2HA 5CA0E 3RGLA 2OAMA 2BVLA 3EUHA 5FMNA 5AQPB 2VK9A 3FG2P 3Q5XA 2LKHA 1IUVA 3CTYA 4U8NA 4JY2A 5AQKB 4OK0A 3VHLA 4U8OA 3T8OA 4IL4A 3GWFA 4GIWA 4H63V 2BXRA 4RG3A 5U63A 2GF3A 1MMAA 2V1DB 3MKDA 3PUYF 3PUWF 4U3CA 3GMBA 3NK1X 3AEFA 5JQGE 2HN1A 2R4JA 2M6BA 2X8HA 2YU1A 3UKAA 3A8YC 3NNEA 2IVDA 2XLPA 3AXJB 1DOCA 4YKFA 2YOEA 1N4UA 2W62A 2E5VA 2ZMAA 2W2UA 3DK9A 5L3CB 3AE8A 2A8XA 3MZKB 3ANWA 3CPJG 4YT0A 1IUWA 3RRWA 3O1IA 3N9LA 3T2YA 3P4WA 4FJOA 3RIAA 4H4TA 1COYA 3AEAA 3AEGA 2YG5A 1JRZA 1KFYA 3I3LA 3OC4A 5KDMC 5KVIA 1GTEA 1VBE4 2MOZA 1ZV4X 2BS4A 4G74A 1D1AA 2M6IA 4NTEA 5CKUA 3AA7B 2K48A 3NN6X 1S3BA 3NTDA 3DK8A 2EHOD 2XHEB 4D03A 1FL2A 2CXDA 3UQ7A 4ZN0A 4EMJA 4A97A 3KV9A 3JADA 3UOYA 4EQSA 4DR4T 1D4M4 3TLSA 1E1HB 3QNUA 5F3JA 3SRZA 5AQGB 1R8IA 2XCGA 2R0CA 2XSBA 4LIIA 3AAAB 4TUYE 2V7JA 3UKPA 3ALMA 2C7GA 1EL9A 2GEWA 4B3RT 5CGMA 5HXHA 2GR1A 4X64T 3RYHE 3G5SA 3O1HA 2XAFB 1KNRA 5J7XA 5E0OA 2NR4A 3NK2X 4JV5T 2XTLA 3NGCX 4HEAA 4J2CA 2X68A 3UQ4A 5AQJB 2JBVA 3LBXA 4Z43A 4GB34 3HYWA 3PDYA 3NKSA 1AR74 3NYEA 3VKGA 1ASJ4 5AQUB 3SWHA 1UUSA 1TDKA 3ZSTA 3VR9A 1EBDA 2V3AA 4EAHA 3CN8A 3RKOA 2GB0A 3CIRA 4LA1A 2W0GA 1GRBA 5FY7A 5CQFA 3CGDA 3EF6A 3SQPA 4C90A 4TNVA 3ZT6A 3CQXC 2JQQA 4H2PA 1DOEA 3O4XE 4OVIA 1KNZA 3GYJA 2C5KT 2YVFA 3QFBA 1VRBA 2YEVC 3ONLC 3AXBA 3RIUC 2WSSV 4YLHA 2R7FA 3KLJA 4AKGA 3KV6A 3AAEB 1RUC4 1GOSA 5LG4A 1HTJF 4IIJE 2E9XD 3UFGA 2R6GF 4DV1T 4J36A 4HFEA 2BBHA 1YY5A 2RS34 4CN4A 1LVKA 1GRHA 2VZ2A 3FI7A 3FZMB 4BJMA 5LBMA 2C75A 3GD4A 3C51A 2X3NA 2ODVA 3ATQA 2W0HA 5TR3A 3CNTA 5KOXA 1DOBA 4KX6A 3LK3B 3C50A 3GQHA 1ZKEA 3RHAA 2OLNA 2HWC4 2V6YB 3G5RA 4HN9A 2IDOB 3JSKA 3SZCA 5FXWA 2GAHB 1UX5A 2XVEA 2XVIA 3P1WA 4A98A 1CJ2A 1SHZC 2EHOB 4TM1A 3R9UA 2IMLA 2KLQA 3I0QA 4O8SA 2VQFT 2H7VC 4A56A 1OJDA 2LRLA 4TV8E 4Z8XA 2F4VT 1VDCA 4I0UA 4IT4A 1MMDA 4ZS2A 4TWFA 3E22E 2QCUA 4PAGA 1ZK7A 4YFSA 3OKQA 4UVCB 2OALA 3NWIA 2CM0A 1FJGT 2Q7VA 1B8SA 2YQUA 2LSKA 3NRXA 1FMWA 2C66A 1B4VA 3T2ZA 2I0ZA 4OYKA 1NDAA 1L9DA 2X51A 4IE7A 3C4WA 1PS9A 3UP5A 4EMWA 1TDNA 2BCPA 2DI4A 3AD9B 1AR84 2YR5A 4FX9A 3M0OA 4U2TA 4NUUA 2FUPA 4N9XA 2Y48B 3DGZA 4QXCB 3ZSSA 1F8SA 4HE8A 1VG0A 1OEDC 2DCFA 3ZYMA 4LF5T 1HNZT 4ADZA 3SZFA 4G6HA 1Y56A 1PDHA 2K24A 2RS54 4UF0A 1S2YA 3EAMA 4QXHB 3NLCA 1E1MA 5BVAA 2DKIA 1E1NA 2WETA 3UOVA 4I4TE 2LE8A 3P4SA 3EANA 3J8F4 4IDZA 3HR0A 2PYJA 2WZIA 5BRTA 1VCTA 3I6DA 4K5SA 4KPRA 5JDHA 3EDUA 1AR94 2AQJA 5C8YE 2E9XB 2WOIA 3CX8B 2ZM6T 4B68A 4AQYT 4DSHA 2VQ7A 3K30A 1RSGA 4CN6A 4QKNA 2RA1A 2PYLA 3K7TA 4U8JA 4WCTA 1ZEEA 1NG4A 2WEUA 5FS7A 1MQTD 2ODUA 3N5LA 1PJ6A 4DR3T 2WPEA 1KK7A 4AQFA 1PHHA 2RR14 2X99A 1QLBA 3C98B 4V1Av 4YTMA 5CB4E 4IHJE 3UTFA 5HEUA 3RP7A 2C73A 1NAAA 5FXXA 4PW8A 3PUAA 3SYIA 1H84A 3B57A 2ZM2A 3BQLA 1GALA 3NZQA 3P8CD 2R064 2YLTA 4OPGA 4COFA 4A99A 3FPZA 1W4XA 4Z24A 3FXEB 3AE3A 3LJPA 2CEAA 4LMLA 4ZI7E 4C74A 5DQVA 3AA6B 2N1GA 3LFMA 3SOLA 1LPFA 4HWCA 3AVRA 3VKHA 3UTKA 2XJ7A 5LGNB 1ZMDA 5L46A 2BG9B 2Q9QD 3OPCA 2XFNA 4CXYA 3M13A 4IA5A 2J47A 5L2LA 1GETA 3GWHA 3AE6A 4GK0E 2BABA 1US7B 4EYYR 2V61A 3U78A 4JN9A 2R0GA 3CX6B 3JAEA 1GTHA 5LHHB 5AQTB 3TKLB 3KV5A 3DTOA 2UZZA 5AQVB 1EZ3A 3AE1A 4MFRA 1D0YA 1GEUA 5JTGA 5HYAA 3FZFB 4LMJA 5KWFA 2YG4A 3N2KE 2PJQA 2MYSA 5TAOA 3RC8A 3SM8A 4HGAA 4ZCCA 4ADWA 1FIOA 3RLFF 1PO24 1SE7A
chains in the Genus database with same CATH topology
5J60A 3K7MX 1TYPA 3D8XA 1PBBA 5EOWA 4A9WA 3DH9A 4USRA 1N4WA 4U8KA 4A6NB 4IA6A 1LJ1A 2BK4A 1B37A 2HQMA 1OJCA 1DXLA 2O9ZA 3ITJA 3NHOX 4OCGA 1AOGA 1PXCA 4X9MA 3RP6A 3URHA 2WBAA 2R4EA 4U8MA 2H88A 1S2QA 1FEBA 2JAEA 2XYOA 3RNMA 4C3YA 1GESA 2JB2A 1CJ4A 2H89A 1VRQB 1CC6A 3L8KA 5KMRA 4U2SA 1K0IA 3QJ4A 1GRTA 3T0KA 4UDPA 4H4UA 2Q0KA 1OJAA 4B63A 4EMIA 3DMEA 1PJ5A 4O5UA 1ONFA 4H4WA 1MO9A 3DJDA 2BS3A 4GAVA 1P2HA 2OAMA 3SUCA 1O5WA 2YM1A 1FCDA 3DA1A 2APGA 1YQZA 4APNA 2C3DA 4NWZA 2CDUA 2Y6RA 1K4QA 3FG2P 1N4VA 2C67A 2GMHA 4K2XA 4EQWA 4H4QA 3HYXA 1NENA 5BULA 1IUVA 3CTYA 4U8NA 4JY2A 5HXIA 2FJEA 1NEKA 3AECA 3NTAA 4U8OA 3GWFA 1TDFA 2VQBA 2WP6A 2BXRA 4H50A 3AEEA 4ICYA 2YVJA 4RG3A 5U63A 3GDPA 1UKVG 2GF3A 4FDCB 4MJWA 5IQ1A 5FS6A 2YVGA 2WOWA 5IPYA 4B67A 4A79A 3SZ0A 3KA7A 3GMBA 2YR4A 3NK1X 4CRTA 3AEFA 5KOWA 3KU9A 2R4JA 4NNJA 1FECA 1LQUA 2X8HA 4I59A 3UKAA 4J31A 3IC9A 3NNEA 2IVDA 3UKHA 4OPDA 2XLPA 5JCKA 1DOCA 2R45A 4ECHA 2V6OA 4YKFA 4NEVA 1N4UA 4EQXA 4OPTA 2E5VA 1F8WA 3ZDNA 1ZOVA 3DK9A 5EB4A 3IF9A 3AE8A 2A8XA 1SEZA 1IJHA 2BACA 1MOKA 1CJ3A 1K0JA 4OPCA 3LB8A 4XWRA 3AE7A 3G5QA 3CPJG 3ICRA 2WS3A 2GR2A 4YT0A 1IUWA 3AYIA 1H6VA 2X8GA 2YLXA 1RYIA 3T2YA 1O94A 3Q6JA 1PJ7A 2TMDA 1EL7A 1PBDA 1CBOA 4H4TA 4C77A 2C70A 1COYA 3AEAA 1PBCA 3AEGA 1S3EA 2EQ8A 2YG5A 4YWOA 1JRZA 1KFYA 2JKCA 3I3LA 3OC4A 3GDNA 2VRLA 5KVIA 1GTEA 1GNDA 1IUSA 1XANA 3S61A 4J2WA 1NHSA 2BS4A 1Y0PA 3DGHA 4G74A 3T14A 5JCIA 1BGNA 1LTXR 4AP1A 2PYXA 2WOVA 4NTEA 5CKUA 2GMJA 3NN6X 4ZCDA 1S3BA 2C65A 3NTDA 3NT6A 3DK8A 2OLOA 3HYVA 3DJJA 2XFQA 2XVHA 1IUUA 4D03A 1FL2A 1KF6A 4K5RA 3AEBA 3M12A 3GD3A 4ZN0A 4EMJA 4Z44A 4EQSA 3UOYA 2AR8A 3SY4A 4U2LA 3GWDA 2EQ7A 4C5OA 2XVJA 4OPUA 1JNRA 1O95A 4I58A 4TM3A 2NPXA 1GRAA 5LV9A 1GERA 3REDA 2XFPA 3C4NA 2XCGA 2B7RA 2R0CA 3UKQA 4LIIA 1FEAA 3FBSA 3QVPA 4D04A 4J57A 2BC0A 3BI2A 2FJBA 2ZZCA 1N1PA 1P2EA 3UKPA 2Q6UA 2R0PA 3ALMA 3LZWA 2C7GA 1EL9A 2GEWA 3S5WA 3GRTA 3NIXA 2B9WA 2GR1A 3UTEA 4NZHA 1HYUA 3G5SA 2BRYA 1ZDLA 2IVEA 3AB1A 1KNRA 1RP0A 3GYIA 5J7XA 3NK2X 1VG9A 3NGCX 4B69A 1KDGA 2IIDA 3D1CA 2JBVA 3FMWA 3ABVA 1E1KA 1H86A 4Z43A 3P4RA 1JEHA 3BNMA 3VRDB 3HYWA 4DSGA 1M64A 3NKSA 1GV4A 3NYEA 3IHMA 1NHRA 3II4A 4UDRA 4CNKA 4U8IA 3QFAA 5C2TA 4BJYA 4BJZA 1H83A 1GT8A 1TDKA 1CL0A 3VR9A 1EBDA 1GXFA 2V3AA 3CN8A 2GB0A 2FJDA 5EBKA 1GREA 3CIRA 4LA1A 3C4AA 2VVLG 3GSIA 2JB1A 4FK1C 3KVEA 1GRBA 5CQFA 3CGDA 3EF6A 4YTNA 2WDRA 3HZLA 4J33A 4B1BA 3SQPA 1JNZA 3E1TA 1JU2A 4USQA 1TDEA 2WESA 1Q9IA 3ICSA 3ICTA 3UKLA 3OZ2A 2BA9A 3C96A 3CNDA 1DOEA 3AYJA 4H2PA 4JDRA 3ZYXA 4YSYA 4K8DA 4X4JA 4OVIA 3FIMB 1D4EA 3LZXA 3GYJA 2VVLA 1F3PA 2YVFA 3SFEA 4DGKA 3QFBA 4BURA 2DKHA 4AT2A 1E1LA 4B66A 3AXBA 3DJEA 1F6MA 1XHCA 3SFDA 3KLJA 3H8LA 5KNLA 4FK1A 4II3A 1GOSA 4H4ZA 3F8DA 1E39A 5KMQA 2YLWA 2B9XA 4J36A 4J56A 3SGLA 1EL8A 1ZMCA 1YY5A 2B9YA 1TRBA 1GRHA 2VZ2A 1H81A 2V5ZA 3CPHG 4CNJA 1D7YA 2C75A 3UOXA 3P4QA 2Y6QA 3GD4A 3NYCA 3PVCA 2YWLA 1YQ4A 2WPFA 3V3OA 5KMPA 1D5TA 1ELIA 2X3NA 1Y56B 3ATQA 1NHQA 1DNCA 1MXTA 2XLRA 5JCMA 2W0HA 1LV0A 4K22A 4Y4NA 2WU2A 4Z2RA 5TR3A 2YLZA 3CNTA 4GCMA 3PS9A 5KOXA 1E7PA 1DOBA 3KPFA 4PAAA 4KX6A 2GH5A 2RGOA 4Z26A 1NG3A 3GQHA 4WX1A 3F8RA 2WDQA 3EAOA 4U8LA 3RHAA 2JK6A 2OLNA 1FOHA 1K0LA 2QA1A 4H4XA 4A65A 1PXAA 5JCLA 1VQWA 4H2QA 3UKFA 3G5RA 3JSKA 3K7QX 3H4KA 1V59A 3SZCA 5IQ4A 2GR0A 1QO8A 4H4VA 2GAHB 3IWAA 1PN0A 1GSNA 2R9ZA 1D4CA 3VR8A 3NN0X 4LU6A 2XVEA 2XVIA 3P1WA 2VOUA 1GPEA 3NK0X 2R46A 3CNPA 1CJ2A 1LQTA 3VQRA 5EB5A 2WHDA 4TM1A 2YG7A 3R9UA 2J3NA 4OPIA 4CBQA 1ZOYA 3NG7X 3AE9A 3KD9A 3UTHA 1CHUA 2BK5A 1OJDA 3LOVA 2C3CA 1D7LA 4GF7A 1NPXA 2XFOA 1VDCA 1KSSA 3AE2A 2BK3A 2GQFA 2ZZ0A 3UTGA 1REOA 5KMSA 4A7AA 3B6DA 2X8CA 3GMCA 1BWCA 4O5QA 4Z25A 2XLUA 1EL5A 1X31B 4NTDA 1DJNA 1TYTA 2F5ZA 2GQWA 2QCUA 4H4PA 5FMHA 3SX6A 3GYXA 4C3XA 1ZK7A 2GVCA 5M0ZA 2OALA 4TLXA 1CJCA 4XWZA 1DJQA 4GR1A 4H2NA 2Z5XA 2Q7VA 4H2RA 4H7UA 1B8SA 2YQUA 4II2A 1H82A 2C66A 1CC2A 4A5LA 1B4VA 3QSEA 2V3BA 4XXGA 3T2ZA 1GRGA 2GR3A 2I0ZA 2RGJA 3V76A 2YLRA 1NDAA 4BV6A 3ALLA 4RG4A 1L9DA 1L9EA 2PHHA 2QAEA 2WPCA 4G73A 4NEWA 4P9SA 3AD8B 3T2KA 1PS9A 3BHKA 3UP5A 2BXSA 3UP4A 4EMWA 1TDNA 4BK2A 2BCPA 3AD9B 3BHFA 4BK1A 2YR5A 2YR6A 3M0OA 4FX9A 3WE0A 4U2TA 4EQRA 3LXDA 3VRBA 4GDEA 4N9XA 2TPRA 4E0VA 2WU5A 2JB3A 1F8SA 3DGZA 4H4RA 1H7WA 2WP9A 3ATRA 3NH3X 3CGEA 1VG0A 3L1RA 4H4SA 3CGBA 2V60A 5U25A 4AOSA 1KNPA 1QJDA 4DNAA 1KSUA 1XDIA 1OJTA 2CFYA 2XVFA 4CY8A 1OJ9A 3SZFA 4G6HA 1Y56A 4CCRA 1ZP0A 4TM4A 1PDHA 4Y4LA 2FBWA 3UOZA 1S2YA 4Z2UA 2C76A 3CMMA 2XLSA 3GQKA 3P4PA 3NLCA 1E1MA 2CVJA 3AD7B 1PXBA 4JNQA 5BVAA 2DKIA 1E1NA 2WETA 2YM2A 3ADAB 4NTCA 5ER0A 1CF3A 3SZWA 3UOVA 4AT0A 2Z5YA 3CNSA 2BS2A 2ZZBA 3P4SA 3EANA 4YTPA 3KKJA 3ALJA 3VRAA 4B64A 5BRTA 1L0VA 2B7SA 3I6DA 4K5SA 2NVKX 4KPRA 5KVHA 2VVMA 3PO7A 2C4CA 3AYLA 5HY5A 2AQJA 2GV8A 5C3JA 1Z6LA 2WOIA 3AWIA 3CPIG 4EIQA 4YSHA 5JCNA 4GAPA 4UP3A 2E1MA 3NRNA 4B68A 4DSHA 4Y4MA 3H8IA 2VQ7A 3K30A 1RSGA 4EIPA 5KRQA 2ACZA 4BK3A 4EM4A 1BGJA 2AAQA 3O0HA 5GRTA 3K7TA 2QA2A 2YG3A 4U8JA 4JQ9A 4WCTA 5HYMA 1YQ3A 5HHFA 3DK4A 2FJAA 1NG4A 4Z2TA 2WEUA 5FS7A 3QSSA 2BC1A 2XDOA 2WP5A 3UCLA 2WDVA 2A89A 3RP8A 2C64A 1Q1RA 4IVOB 2EQ6A 1PJ6A 4YXDA 1F8RA 2WPEA 2E4GA 1PHHA 4JNAA 2X99A 1QLBA 4YTMA 1ZY8A 4UDQA 5BUKA 2XLTA 4IV9A 2ARDA 3UTFA 4REKA 3RP7A 3LADA 4TM0A 3AE4A 2C73A 1B5QA 1NAAA 4EM3A 5DBJA 4J34A 5M10A 5KXJA 2RGHA 4M52A 2GRTA 1H84A 1M6IA 5GSNA 5U1OA 3Q9TA 1GALA 1ZKQA 3SYIA 2YLTA 4OPGA 3ISHA 1LVLA 1DODA 4A99A 3FPZA 2XFUA 2GAGB 2RABA 1W4XA 4Z24A 3AE3A 3LJPA 3T37A 1BZLA 1YKJA 2LFCA 4IVMB 4CCQA 2BYBA 1XPQA 4G6GA 4C74A 4G9KA 4HA6A 3SXIA 2YLSA 1BKWA 1JRXA 2BCGG 4U8PA 2Q0LA 5FS9A 3DJGX 1LPFA 3CGCA 3P9UA 2ZBWA 1NHPA 3QSMA 4PABA 2YG6A 3BI4A 2X50A 3AE5A 4A6NA 2WQYA 1ZMDA 5L46A 3IHGA 4YSXA 2BRAA 4GDPA 2XFNA 4GUVA 1D4DA 3M13A 4IA5A 3V3NA 1GETA 4OPLA 4YSZA 1PBFA 1E6EA 4JY3A 4TLZA 4AP3A 5FS8A 1GRFA 3AE6A 3KPKA 4H4YA 2BABA 1JRYA 2V61A 3GRSA 2CULA 1L9CA 4JN9A 3CNJA 1H7XA 2R0GA 1GTHA 3AEDA 3EPTA 3COXA 4AOXA 4GRTA 2UZZA 1BF3A 4YKGA 3AE1A 1GEUA 1Q1WA 4K7ZA 1IUTA 1PBEA 3BI5A 3T31A 2A87A 1IUXA 5KWFA 4X9NA 2YG4A 2VRMA 2B76A 1TDOA 4CY6A 1ZX9A 1CC4A 2YAUA 4RSLA 3QVRA 3NYFA 2C72A 2EQ9A 3SM8A 4HB9A 4ZCCA 1JOAA 2OA1A 3UKKA 4ADWA 3BNUA 4B65A 3F8PA 3B3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J60 A;  3K7M X;  1TYP A;  3D8X A;  1PBB A;  5EOW A;  4A9W A;  3DH9 A;  4USR A;  1N4W A;  4U8K A;  4A6N B;  4IA6 A;  1LJ1 A;  2BK4 A;  1B37 A;  2HQM A;  1OJC A;  1DXL A;  2O9Z A;  3ITJ A;  3NHO X;  4OCG A;  1AOG A;  1PXC A;  4X9M A;  3RP6 A;  3URH A;  2WBA A;  2R4E A;  4U8M A;  2H88 A;  1S2Q A;  1FEB A;  2JAE A;  2XYO A;  3RNM A;  4C3Y A;  1GES A;  2JB2 A;  1CJ4 A;  2H89 A;  1VRQ B;  1CC6 A;  3L8K A;  4U2S A;  1K0I A;  3QJ4 A;  1GRT A;  4UDP A;  4H4U A;  2Q0K A;  1OJA A;  4B63 A;  4EMI A;  3DME A;  1PJ5 A;  4O5U A;  1ONF A;  4H4W A;  1MO9 A;  3DJD A;  2BS3 A;  1P2H A;  2OAM A;  3SUC A;  1O5W A;  2YM1 A;  1FCD A;  3DA1 A;  2APG A;  1YQZ A;  4APN A;  2C3D A;  2CDU A;  2Y6R A;  1K4Q A;  3FG2 P;  1N4V A;  2C67 A;  2GMH A;  4K2X A;  4EQW A;  4H4Q A;  1NEN A;  5BUL A;  1IUV A;  3CTY A;  4U8N A;  4JY2 A;  5HXI A;  2FJE A;  1NEK A;  3AEC A;  3NTA A;  4U8O A;  3GWF A;  1TDF A;  2VQB A;  2WP6 A;  2BXR A;  4H50 A;  3AEE A;  4ICY A;  2YVJ A;  4RG3 A;  5U63 A;  3GDP A;  1UKV G;  2GF3 A;  4FDC B;  4MJW A;  5IQ1 A;  5FS6 A;  2YVG A;  2WOW A;  5IPY A;  4B67 A;  4A79 A;  3KA7 A;  3GMB A;  2YR4 A;  3NK1 X;  4CRT A;  3AEF A;  5KOW A;  3KU9 A;  2R4J A;  1FEC A;  1LQU A;  2X8H A;  4I59 A;  3UKA A;  4J31 A;  3IC9 A;  3NNE A;  2IVD A;  3UKH A;  4OPD A;  2XLP A;  5JCK A;  1DOC A;  2R45 A;  4ECH A;  2V6O A;  4YKF A;  4NEV A;  1N4U A;  4EQX A;  4OPT A;  2E5V A;  1F8W A;  3ZDN A;  1ZOV A;  3DK9 A;  5EB4 A;  3IF9 A;  3AE8 A;  2A8X A;  1SEZ A;  1IJH A;  2BAC A;  1MOK A;  1CJ3 A;  1K0J A;  4OPC A;  3LB8 A;  4XWR A;  3AE7 A;  3G5Q A;  3CPJ G;  3ICR A;  2WS3 A;  2GR2 A;  4YT0 A;  1IUW A;  3AYI A;  1H6V A;  2X8G A;  2YLX A;  1RYI A;  1O94 A;  3Q6J A;  1PJ7 A;  2TMD A;  1EL7 A;  1PBD A;  1CBO A;  4H4T A;  4C77 A;  2C70 A;  1COY A;  3AEA A;  1PBC A;  3AEG A;  1S3E A;  2EQ8 A;  2YG5 A;  4YWO A;  1JRZ A;  1KFY A;  2JKC A;  3I3L A;  3OC4 A;  3GDN A;  2VRL A;  5KVI A;  1GTE A;  1GND A;  1IUS A;  1XAN A;  3S61 A;  4J2W A;  1NHS A;  2BS4 A;  1Y0P A;  3DGH A;  5JCI A;  1BGN A;  1LTX R;  4AP1 A;  2PYX A;  2WOV A;  4NTE A;  5CKU A;  2GMJ A;  3NN6 X;  4ZCD A;  1S3B A;  2C65 A;  3NTD A;  3NT6 A;  3DK8 A;  2OLO A;  3DJJ A;  2XFQ A;  2XVH A;  1IUU A;  4D03 A;  1FL2 A;  1KF6 A;  4K5R A;  3AEB A;  3M12 A;  3GD3 A;  4ZN0 A;  4EMJ A;  4Z44 A;  4EQS A;  3UOY A;  2AR8 A;  4U2L A;  3GWD A;  2EQ7 A;  4C5O A;  2XVJ A;  4OPU A;  1JNR A;  1O95 A;  4I58 A;  4TM3 A;  2NPX A;  1GRA A;  5LV9 A;  1GER A;  3RED A;  2XFP A;  3C4N A;  2XCG A;  2B7R A;  2R0C A;  3UKQ A;  4LII A;  1FEA A;  3FBS A;  3QVP A;  4D04 A;  4J57 A;  2BC0 A;  3BI2 A;  2FJB A;  2ZZC A;  1N1P A;  1P2E A;  3UKP A;  2Q6U A;  2R0P A;  3ALM A;  3LZW A;  2C7G A;  1EL9 A;  2GEW A;  3S5W A;  3GRT A;  3NIX A;  2B9W A;  2GR1 A;  3UTE A;  4NZH A;  1HYU A;  3G5S A;  2IVE A;  1ZDL A;  3AB1 A;  3GYI A;  1KNR A;  1RP0 A;  5J7X A;  3NK2 X;  1VG9 A;  3NGC X;  4B69 A;  1KDG A;  2IID A;  3D1C A;  2JBV A;  3FMW A;  3ABV A;  1E1K A;  1H86 A;  4Z43 A;  3P4R A;  1JEH A;  3BNM A;  3VRD B;  4DSG A;  1M64 A;  3NKS A;  1GV4 A;  3NYE A;  3IHM A;  1NHR A;  3II4 A;  4UDR A;  4CNK A;  4U8I A;  3QFA A;  5C2T A;  4BJY A;  4BJZ A;  1H83 A;  1GT8 A;  1TDK A;  1CL0 A;  3VR9 A;  1EBD A;  1GXF A;  2V3A A;  3CN8 A;  2GB0 A;  2FJD A;  5EBK A;  1GRE A;  3CIR A;  4LA1 A;  3C4A A;  2VVL G;  3GSI A;  2JB1 A;  4FK1 C;  3KVE A;  1GRB A;  5CQF A;  3CGD A;  3EF6 A;  4YTN A;  2WDR A;  3HZL A;  4J33 A;  4B1B A;  3SQP A;  1JNZ A;  3E1T A;  1JU2 A;  4USQ A;  1TDE A;  2WES A;  1Q9I A;  3ICS A;  3ICT A;  3UKL A;  3OZ2 A;  2BA9 A;  3C96 A;  3CND A;  1DOE A;  3AYJ A;  4H2P A;  4JDR A;  3ZYX A;  4YSY A;  4K8D A;  4X4J A;  4OVI A;  3FIM B;  1D4E A;  3LZX A;  3GYJ A;  2VVL A;  1F3P A;  2YVF A;  3SFE A;  4DGK A;  3QFB A;  4BUR A;  2DKH A;  4AT2 A;  1E1L A;  4B66 A;  3AXB A;  3DJE A;  1F6M A;  1XHC A;  3SFD A;  3KLJ A;  3H8L A;  4FK1 A;  1GOS A;  4H4Z A;  3F8D A;  1E39 A;  2YLW A;  2B9X A;  4J36 A;  4J56 A;  3SGL A;  1EL8 A;  1ZMC A;  1YY5 A;  2B9Y A;  1TRB A;  1GRH A;  2VZ2 A;  1H81 A;  2V5Z A;  3CPH G;  4CNJ A;  1D7Y A;  2C75 A;  3UOX A;  3P4Q A;  2Y6Q A;  3GD4 A;  3NYC A;  3PVC A;  2YWL A;  1YQ4 A;  2WPF A;  3V3O A;  1D5T A;  1ELI A;  2X3N A;  1Y56 B;  3ATQ A;  1NHQ A;  1DNC A;  1MXT A;  2XLR A;  5JCM A;  2W0H A;  1LV0 A;  4K22 A;  4Y4N A;  2WU2 A;  4Z2R A;  5TR3 A;  2YLZ A;  3CNT A;  4GCM A;  3PS9 A;  5KOX A;  1E7P A;  1DOB A;  3KPF A;  4PAA A;  4KX6 A;  2GH5 A;  2RGO A;  4Z26 A;  1NG3 A;  3GQH A;  4WX1 A;  3F8R A;  2WDQ A;  3EAO A;  4U8L A;  3RHA A;  2JK6 A;  2OLN A;  1FOH A;  1K0L A;  2QA1 A;  4H4X A;  4A65 A;  1PXA A;  5JCL A;  1VQW A;  4H2Q A;  3UKF A;  3G5R A;  3JSK A;  3K7Q X;  3H4K A;  1V59 A;  5IQ4 A;  2GR0 A;  1QO8 A;  4H4V A;  2GAH B;  3IWA A;  1PN0 A;  1GSN A;  2R9Z A;  1D4C A;  3VR8 A;  3NN0 X;  4LU6 A;  2XVE A;  2XVI A;  3P1W A;  2VOU A;  1GPE A;  3NK0 X;  2R46 A;  3CNP A;  1CJ2 A;  1LQT A;  3VQR A;  5EB5 A;  2WHD A;  4TM1 A;  2YG7 A;  3R9U A;  2J3N A;  4OPI A;  4CBQ A;  1ZOY A;  3NG7 X;  3AE9 A;  3KD9 A;  3UTH A;  1CHU A;  2BK5 A;  1OJD A;  3LOV A;  2C3C A;  1D7L A;  4GF7 A;  1NPX A;  2XFO A;  1VDC A;  1KSS A;  3AE2 A;  2BK3 A;  2GQF A;  2ZZ0 A;  3UTG A;  1REO A;  4A7A A;  3B6D A;  2X8C A;  3GMC A;  1BWC A;  4O5Q A;  4Z25 A;  2XLU A;  1EL5 A;  1X31 B;  4NTD A;  1DJN A;  1TYT A;  2F5Z A;  2GQW A;  2QCU A;  4H4P A;  5FMH A;  4C3X A;  3GYX A;  1ZK7 A;  2GVC A;  5M0Z A;  2OAL A;  4TLX A;  1CJC A;  4XWZ A;  1DJQ A;  4GR1 A;  4H2N A;  2Z5X A;  2Q7V A;  4H2R A;  4H7U A;  1B8S A;  2YQU A;  1H82 A;  2C66 A;  1CC2 A;  4A5L A;  1B4V A;  3QSE A;  2V3B A;  4XXG A;  1GRG A;  2GR3 A;  2I0Z A;  2RGJ A;  3V76 A;  2YLR A;  1NDA A;  4BV6 A;  3ALL A;  4RG4 A;  1L9D A;  1L9E A;  2PHH A;  2QAE A;  2WPC A;  4NEW A;  4P9S A;  3AD8 B;  1PS9 A;  3BHK A;  3UP5 A;  2BXS A;  3UP4 A;  4EMW A;  1TDN A;  4BK2 A;  2BCP A;  3AD9 B;  3BHF A;  4BK1 A;  2YR5 A;  2YR6 A;  3M0O A;  4FX9 A;  3WE0 A;  4U2T A;  4EQR A;  3LXD A;  3VRB A;  4GDE A;  4N9X A;  2TPR A;  4E0V A;  2WU5 A;  2JB3 A;  1F8S A;  3DGZ A;  4H4R A;  1H7W A;  2WP9 A;  3ATR A;  3NH3 X;  3CGE A;  1VG0 A;  3L1R A;  4H4S A;  3CGB A;  2V60 A;  5U25 A;  4AOS A;  1KNP A;  1QJD A;  4DNA A;  1KSU A;  1XDI A;  1OJT A;  2CFY A;  2XVF A;  4CY8 A;  1OJ9 A;  1Y56 A;  4CCR A;  1ZP0 A;  4TM4 A;  1PDH A;  4Y4L A;  2FBW A;  3UOZ A;  1S2Y A;  4Z2U A;  2C76 A;  3GQK A;  2XLS A;  3P4P A;  3NLC A;  1E1M A;  2CVJ A;  3AD7 B;  1PXB A;  4JNQ A;  5BVA A;  2DKI A;  1E1N A;  2WET A;  2YM2 A;  3ADA B;  4NTC A;  5ER0 A;  1CF3 A;  3UOV A;  4AT0 A;  2Z5Y A;  3CNS A;  2BS2 A;  2ZZB A;  3P4S A;  3EAN A;  4YTP A;  3KKJ A;  3ALJ A;  3VRA A;  4B64 A;  5BRT A;  1L0V A;  2B7S A;  3I6D A;  4K5S A;  2NVK X;  4KPR A;  5KVH A;  2VVM A;  3PO7 A;  3AYL A;  5HY5 A;  2AQJ A;  2GV8 A;  5C3J A;  1Z6L A;  2WOI A;  3AWI A;  3CPI G;  4EIQ A;  4YSH A;  5JCN A;  4UP3 A;  2E1M A;  3NRN A;  4B68 A;  4DSH A;  4Y4M A;  3H8I A;  2VQ7 A;  3K30 A;  1RSG A;  4EIP A;  5KRQ A;  2ACZ A;  4BK3 A;  4EM4 A;  1BGJ A;  2AAQ A;  3O0H A;  5GRT A;  3K7T A;  2QA2 A;  2YG3 A;  4U8J A;  4JQ9 A;  4WCT A;  5HYM A;  1YQ3 A;  5HHF A;  3DK4 A;  2FJA A;  1NG4 A;  4Z2T A;  2WEU A;  5FS7 A;  3QSS A;  2BC1 A;  2XDO A;  2WP5 A;  3UCL A;  2WDV A;  2A89 A;  3RP8 A;  2C64 A;  1Q1R A;  4IVO B;  2EQ6 A;  1PJ6 A;  4YXD A;  1F8R A;  2WPE A;  2E4G A;  1PHH A;  4JNA A;  2X99 A;  1QLB A;  4YTM A;  1ZY8 A;  4UDQ A;  5BUK A;  2XLT A;  4IV9 A;  2ARD A;  3UTF A;  4REK A;  3RP7 A;  3LAD A;  4TM0 A;  3AE4 A;  2C73 A;  1B5Q A;  1NAA A;  4EM3 A;  5DBJ A;  4J34 A;  5M10 A;  5KXJ A;  2RGH A;  4M52 A;  2GRT A;  1H84 A;  1M6I A;  5GSN A;  5U1O A;  3Q9T A;  1GAL A;  1ZKQ A;  2YLT A;  4OPG A;  3ISH A;  1LVL A;  1DOD A;  4A99 A;  3FPZ A;  2XFU A;  2GAG B;  2RAB A;  1W4X A;  4Z24 A;  3AE3 A;  3LJP A;  3T37 A;  1BZL A;  1YKJ A;  2LFC A;  4IVM B;  4CCQ A;  2BYB A;  1XPQ A;  4C74 A;  4HA6 A;  2YLS A;  1BKW A;  1JRX A;  2BCG G;  4U8P A;  2Q0L A;  5FS9 A;  3DJG X;  1LPF A;  3CGC A;  3P9U A;  2ZBW A;  1NHP A;  3QSM A;  4PAB A;  2YG6 A;  3BI4 A;  2X50 A;  3AE5 A;  4A6N A;  2WQY A;  1ZMD A;  5L46 A;  3IHG A;  4YSX A;  4GDP A;  2XFN A;  4GUV A;  1D4D A;  3M13 A;  4IA5 A;  3V3N A;  1GET A;  4OPL A;  4YSZ A;  1PBF A;  1E6E A;  4JY3 A;  4TLZ A;  4AP3 A;  5FS8 A;  1GRF A;  3AE6 A;  4H4Y A;  2BAB A;  1JRY A;  2V61 A;  3GRS A;  2CUL A;  1L9C A;  4JN9 A;  3CNJ A;  1H7X A;  2R0G A;  1GTH A;  3AED A;  3EPT A;  3COX A;  4AOX A;  4GRT A;  2UZZ A;  1BF3 A;  4YKG A;  3AE1 A;  1GEU A;  1Q1W A;  4K7Z A;  1IUT A;  1PBE A;  3BI5 A;  2A87 A;  1IUX A;  5KWF A;  4X9N A;  2YG4 A;  2VRM A;  2B76 A;  1TDO A;  4CY6 A;  1ZX9 A;  1CC4 A;  2YAU A;  4RSL A;  3QVR A;  3NYF A;  2C72 A;  2EQ9 A;  3SM8 A;  4HB9 A;  4ZCC A;  1JOA A;  2OA1 A;  3UKK A;  4ADW A;  3BNU A;  4B65 A;  3F8P A;  3B3R A; 
#chains in the Genus database with same CATH topology
 5JRE A;  4JI6 T;  2KWH A;  3D8X A;  5EOW A;  3DH9 A;  4DID B;  4X5T A;  4HFD A;  3NHO X;  4IDN A;  1HX8 A;  3M3Z B;  4DMV A;  3URH A;  4KUM B;  2VAS A;  3L8K A;  2WY2 A;  2XAH B;  1CJ4 A;  1VRQ B;  3MK7 C;  2X66 A;  1WFD A;  3EHZ A;  2EHO C;  4UV8 B;  3T0K A;  4CI3 B;  3AXJ A;  3DME A;  4HFV A;  5FXV A;  3M65 A;  4H4W A;  2QYW A;  1MO9 A;  2BS3 A;  2EX3 A;  2QGS A;  3SUC A;  3RKG A;  2YM1 A;  1WR0 A;  2APG A;  2QA7 A;  1YQZ A;  2C3D A;  2M67 A;  4IE6 A;  2Y6R A;  3EDV A;  4AQG A;  2XAQ B;  2C67 A;  2GMH A;  2J62 A;  3PTR B;  4X1K E;  4H4Q A;  1V9D A;  1RUG 4;  5HXI A;  1RHI 4;  3AEC A;  2WP6 A;  4H50 A;  5AQL B;  2YVJ A;  1UKV G;  5DJQ C;  2YVG A;  2LEH A;  2XQ4 A;  4A79 A;  1IJ5 A;  3SZ0 A;  4B3M T;  2I0M A;  4EOZ B;  5KOW A;  4O4H E;  1W9R A;  1VOM A;  4J31 A;  4ZHQ E;  3IC9 A;  3HI2 A;  4JYA T;  5JCK A;  2A72 A;  2V6O A;  2G0U A;  4IDP A;  2HPL A;  3ZDN A;  4ZOL E;  3CVR A;  1I94 T;  1SEZ A;  2D0T A;  3AAI A;  1MOK A;  1CJ3 A;  4OPC A;  2CE7 A;  4FI5 A;  2YLX A;  1PO1 4;  3ZT5 A;  1O94 A;  1O3X A;  2B1E A;  4EEB A;  1PJ7 A;  2TMD A;  1EL7 A;  1PBD A;  3R84 B;  1CBO A;  2Q9Q B;  5FL0 A;  2C70 A;  1S3E A;  4JEU B;  1X9B A;  2LSG A;  3GDN A;  1B7T A;  1GND A;  1IUS A;  4UIG A;  3ZKR A;  1NHS A;  3TLV A;  1Y0P A;  2BG9 E;  5JCI A;  3RF1 A;  1BGN A;  4AP1 A;  2PYX A;  2GMJ A;  2HPJ A;  4HTE A;  1HG2 A;  2XFQ A;  2NW9 A;  5LGT B;  2XVH A;  4LF6 T;  1KF6 A;  4K5R A;  4U33 A;  3GD3 A;  2XQ5 A;  2AR8 A;  4U2L A;  2X9W A;  4JI4 T;  1VBC 4;  4HKA A;  4TM3 A;  2NPX A;  1GRA A;  3RED A;  4AIU A;  3ETV A;  4LFB T;  3C4N A;  4JEH B;  3ONJ A;  2JQH A;  2PZS A;  4B6X A;  1MIY A;  2BC0 A;  2FJB A;  2WWV A;  1N1P A;  1AL2 4;  3UU8 A;  1P2E A;  3ZLI A;  2YDQ A;  4L9I A;  5FXZ A;  3UTE A;  4NZH A;  1HYU A;  2V5D A;  1ZDL A;  3GYI A;  1RP0 A;  4OX9 T;  1BR1 A;  4B69 A;  1KDG A;  4X1Y E;  2IID A;  1HFA A;  4I50 E;  2JJ9 A;  3FMW A;  1E1K A;  2NW7 A;  4F6R C;  2X0H A;  3CQG B;  1JEH A;  4WBO A;  3BNM A;  2XM2 A;  1U5P A;  1GV4 A;  3II4 A;  4U8I A;  3QFA A;  3WAK A;  1H83 A;  1CL0 A;  2BG9 C;  1GXF A;  5JDN A;  2LT3 A;  5EBK A;  1GRE A;  3QC9 A;  2W4X A;  3TLU A;  2HN2 A;  5LGU B;  2J1D G;  4J33 A;  4B1B A;  3HKC E;  3E1T A;  2CMR A;  2WES A;  1Q9I A;  5FVK A;  4IDO A;  5ABF B;  4JDR A;  3AVS A;  4YSY A;  3LJC A;  1VBA 4;  3RC3 A;  5BMV E;  4JUY A;  5DAB A;  4NUV A;  1F3P A;  5HWX A;  3KBT A;  4B66 A;  1F6M A;  1RUJ 4;  5LBQ B;  2VB6 A;  1RUF 4;  3H8L A;  4FK1 A;  1E39 A;  2B9X A;  3SGL A;  2DHR A;  1EL8 A;  1TRB A;  4CNJ A;  2V5Z A;  2KT9 A;  2CCQ A;  2PBI A;  3GMI A;  4YJ3 E;  3NYC A;  3PVC A;  3CKD A;  2JIW A;  5JR9 C;  1D5T A;  1ELI A;  4XBF B;  4YHH T;  2W00 A;  5L3B B;  4Y4N A;  2YLZ A;  5CFB A;  1E7P A;  2RGO A;  4GKJ T;  4Z26 A;  3AB3 B;  4H4X A;  4HWI B;  1FOH A;  5LMU T;  2R04 4;  1VQW A;  1I6Z A;  5IQ4 A;  1OED B;  1D0Z A;  3PUR A;  1QO8 A;  3IWA A;  2IHR 1;  1NWM X;  3OBV E;  3PUX F;  1D4C A;  3VR8 A;  3NN0 X;  3L8R A;  4L5G A;  1GPE A;  2CHN A;  3NK0 X;  2R46 A;  3N9P A;  3FZH B;  2MBG A;  2YG7 A;  2J3N A;  1ZOY A;  2VKD A;  1XMO T;  3UTH A;  4EB6 E;  2ACX A;  2V7L A;  2CXL A;  2WCA A;  4GF7 A;  1MND A;  3UU5 A;  5AQN B;  3CPZ A;  3AE2 A;  2BK3 A;  4L0R A;  2K3W A;  4A7A A;  3G06 A;  2V7K A;  4QX7 B;  1X31 B;  2LOP A;  4C3X A;  4H4P A;  3SX6 A;  1VCS A;  1POV 0;  4XWZ A;  1DJQ A;  4GR1 A;  4TWH A;  4H2R A;  4H7U A;  5ABE A;  1H82 A;  2JMK A;  1CC2 A;  5JRC B;  4XXG A;  1GRG A;  2GR3 A;  1M62 A;  4KBM B;  4O4J E;  4BV6 A;  2UUC T;  3ALL A;  5LJN A;  1L9E A;  4G73 A;  1LVF A;  3AD8 B;  3FHN A;  3C4Z A;  3Q9D A;  4LMK A;  4BK2 A;  3IA3 A;  2WMN A;  3BHF A;  3WE0 A;  5IUX A;  5L47 A;  3LXD A;  5L3F B;  4ERR A;  4E0V A;  2TPR A;  2JB3 A;  4H4R A;  2Q9Q C;  1XHX A;  5U25 A;  4AOS A;  4HFH A;  4DNA A;  2PY5 A;  1OJT A;  2XVF A;  5BR8 T;  3HKD E;  2UU9 T;  1W0B A;  4CCR A;  2WB5 A;  5J1G A;  1R08 4;  4ILB A;  3UUN A;  3UOZ A;  2C76 A;  3Q5D A;  1CF3 A;  3K3O A;  3CNS A;  2BS2 A;  2AXD S;  2ZZB A;  3UU3 A;  2QVA A;  5HXS A;  3LG7 A;  2V8S V;  2B7S A;  5KVH A;  4AKH A;  2NVK X;  1FEW A;  5L4H A;  3PV0 F;  2LHR A;  2UXD T;  2DNX A;  3NVO A;  3CPI G;  4YSH A;  3F2E A;  4WNK A;  2JRK A;  4QXB B;  4Y4M A;  2YU2 A;  4EM4 A;  3RX6 A;  2XQY A;  3GN5 A;  4AKR B;  4E7S A;  2FJA A;  2UUB T;  2CRB A;  3C4X A;  2BC1 A;  2WP5 A;  3UCL A;  3Q5W A;  2A89 A;  3RP8 A;  1Q1R A;  5LOV E;  3IBP A;  2XSA A;  2J4G A;  4GKK T;  1ZY8 A;  4UDQ A;  2ARD A;  4LF8 T;  4H9S E;  3LAD A;  4TM0 A;  1B5Q A;  5M10 A;  4Q4X 4;  5GSN A;  4ZI2 D;  1EV1 4;  5AQI B;  2XZE A;  2XFU A;  3T37 A;  1OED E;  2LFC A;  4IVM B;  4EGW A;  3SXI A;  2BCG G;  4U8P A;  2Q0L A;  3JD7 4;  4AKI A;  4I43 B;  2ZBW A;  2X0L B;  4PAB A;  2VL8 A;  3BI4 A;  4ISS A;  3IHG A;  4YSX A;  2NTX A;  5LA6 E;  4TLZ A;  1E6E A;  4CXX A;  3MXZ A;  3CML A;  1GRF A;  3KPK A;  3OYX A;  4O2B E;  3AED A;  2UXN B;  2CWO A;  3FZK B;  3QB5 K;  1BR4 A;  3N2O A;  4K7Z A;  3BI5 A;  2X67 A;  2A87 A;  2XQ8 A;  1XMQ T;  1IUX A;  2RP4 A;  4CY6 A;  1ZX9 A;  3ANW B;  1CC4 A;  2DWG A;  2YAU A;  1WYB A;  1JOA A;  3QB5 A;  2OA1 A;  3NZP A;  3UKK A;  3BNU A;  3F8P A;  5J60 A;  5JDL A;  3K7M X;  1FMV A;  4PJN A;  1MMG A;  4AIS A;  4A9W A;  4IL9 A;  1N4W A;  2CXF A;  1LJ1 A;  3ITJ A;  3OJA A;  1S2Q A;  3T1Y T;  2H89 A;  5KMR A;  4DR7 T;  2NP9 A;  4P09 A;  4CQI A;  4IE0 A;  4UDP A;  5AFU L;  1IZN B;  2L3L A;  5HEJ A;  4H4U A;  4EMI A;  1PJ5 A;  3DJD A;  4DV6 T;  4HWH A;  2YK0 A;  5LXT E;  4NXM T;  4GAV A;  2W66 A;  1FCD A;  3DA1 A;  1U4Q A;  4WZX A;  2I6H A;  4APN A;  4NWZ A;  2CDU A;  1K4Q A;  4K2X A;  3J7Y q;  1XNQ T;  3HYX A;  3ZMU B;  5BUL A;  1NEK A;  4EV6 A;  4X20 E;  3NTA A;  5EK2 A;  3AEE A;  4ICY A;  2XM1 A;  3GDP A;  4FDC B;  4MJW A;  5FS6 A;  4EXT A;  1Z7S 4;  3KA7 A;  2YR4 A;  4CRT A;  1MIW A;  3KU9 A;  2WAU A;  3RPU A;  1FEC A;  1LQU A;  4P0B A;  2VKH A;  4UEM A;  3LBX B;  5ETW A;  3UKH A;  4OPD A;  3UU4 A;  2R45 A;  4ECH A;  4NEV A;  3L39 A;  2MTQ A;  1ZOV A;  2LSJ A;  5EB4 A;  4JI7 T;  4X62 T;  1SA0 E;  3ZMT B;  2BAC A;  3MA9 A;  3LB8 A;  3GA8 A;  3G5Q A;  3ICR A;  3JBG 4;  3RIU A;  3AYI A;  2X8G A;  2LOS A;  3ZPO A;  4PFO A;  3WI3 A;  1RYI A;  5H6Q B;  3Q6J A;  4ZS3 A;  4OYJ A;  4O2A E;  1YKH B;  4C77 A;  1BEV 4;  1XHZ A;  1D0X A;  4DUY T;  2CLY C;  2EQ8 A;  4EED A;  2JKC A;  4CZZ B;  3CQC B;  2VRL A;  1XAN A;  2CBI A;  3S61 A;  3BK9 A;  2QRX A;  3DGH A;  3S4U A;  2LJL A;  3T14 A;  4M1P A;  4BA9 A;  2C65 A;  1BR2 A;  3NT6 A;  2OLO A;  3HYV A;  1IUU A;  3PUQ A;  5HCJ A;  3M12 A;  2LM9 A;  3SY4 A;  2UXC T;  3GWD A;  2EQ7 A;  2HWB 4;  4OPU A;  1JNR A;  1O95 A;  3PJA J;  2Z6E A;  5LV9 A;  3P7I A;  1GER A;  3FZL B;  2LSY A;  3FXD B;  4ILC A;  4ASK A;  2B7R A;  3RQW A;  2IUB A;  5LYJ E;  3QVP A;  3PU8 A;  3QK6 A;  5HXE A;  1IBL T;  4AI6 A;  2ZZC A;  4ILU A;  2R0P A;  2X9X A;  3A7M A;  3LK2 B;  3E08 A;  5ABF A;  2B9W A;  5JR9 B;  3JCF A;  4DR2 T;  2BRY A;  1COV 4;  3RH3 A;  4H9O C;  4DV4 T;  1VG9 A;  5AQS B;  5LHG B;  3F57 A;  4ANJ A;  4JI8 T;  2RS1 4;  3ABV A;  2MPK A;  3VRD B;  4H9P C;  4DSG A;  5JH7 E;  4CNK A;  1VRH 4;  4K0K T;  4KHP T;  5C2T A;  2K5B B;  5JDG A;  3CX7 B;  1GT8 A;  4HWD A;  4PJM A;  1W09 A;  3D0T A;  1UX4 A;  4DMW A;  4Q4V 4;  1D1C A;  1HF8 A;  3AA0 B;  1HS7 A;  2JB1 A;  2VVL G;  2XY8 B;  3KVE A;  4FK1 C;  1RUI 4;  2XPK A;  3HZL A;  3RI5 A;  2WDR A;  1WR6 A;  4YTN A;  4LF7 T;  3UFE A;  1JU2 A;  4USQ A;  4HFB A;  2RPA A;  3ICT A;  3OZ2 A;  3Q5E A;  5FY0 A;  3C96 A;  3AYJ A;  1IJ6 A;  4TZ4 C;  3ZYX A;  4K8D A;  3OYZ A;  4ZI3 D;  4QH4 A;  1D4E A;  4AXP A;  4KI0 F;  3FIM B;  3LZX A;  3JAF A;  3SFE A;  4DGK A;  4BUR A;  4U2Y A;  1E1L A;  1WYC A;  3DJE A;  5JDQ A;  2JQ9 A;  2ZM8 A;  3ZYK A;  4OHF A;  3OVU A;  2VUR A;  2UUA T;  3PU3 A;  4DR1 T;  3LK4 2;  2B9Y A;  1N36 T;  1H81 A;  3CPH G;  4DND A;  1D7Y A;  3UOX A;  3P4Q A;  2Y6Q A;  4P0A A;  4DV0 T;  1YQ4 A;  4DV2 T;  2DLR A;  1W0A A;  3EAB A;  5KMP A;  1Y56 B;  1DNC A;  1MXT A;  3K1S A;  4K22 A;  4Z2R A;  2C5J A;  2E8I A;  2WU2 A;  5JVD E;  2UXX B;  5L4E A;  5A1L A;  4GCM A;  1OOP D;  4PAA A;  2CPT A;  4GYR A;  5HXR A;  1NG3 A;  2KIN B;  4WX1 A;  2WDQ A;  3EAO A;  4U8L A;  4G63 A;  2QA1 A;  4A65 A;  3ZMV B;  1PXA A;  1MNE A;  3ZT7 A;  2XAS B;  3UKF A;  3TLT A;  1V59 A;  5FY1 A;  2GR0 A;  2BKO A;  3RIF A;  1PN0 A;  5JRC A;  3I9Y A;  3CWZ B;  4NXN T;  3CNP A;  1LQT A;  2JQK A;  4O4L E;  4XAX B;  5EB5 A;  2IAK A;  3L09 A;  2WHD A;  4CBQ A;  3NG7 X;  2V7I A;  1XNR T;  2OA5 A;  4CN1 A;  4K0U A;  1CHU A;  4WYV A;  2BK5 A;  2VKJ A;  2C3C A;  4YHJ A;  2XQ3 A;  1NPX A;  2XFO A;  2KXP B;  2BZB A;  5KMG P;  4X65 T;  1KSS A;  3ZCJ A;  2GQF A;  1NA1 D;  2LRK A;  5GON E;  4DV7 T;  1REO A;  5KMS A;  4Q4Y 4;  3B6D A;  2X8C A;  1Z0P A;  4Z25 A;  4KMC A;  1N33 T;  1HNW T;  3I0O A;  4NTD A;  1DJN A;  2F5Z A;  5FMH A;  2VQE T;  5AQO B;  5M0Z A;  4PK5 A;  1CJC A;  1Z8U A;  4H2N A;  5FVL A;  4ZI2 C;  2I59 A;  2RM2 4;  4II2 A;  4H9N C;  4A5L A;  2V3B A;  3TLW A;  3V76 A;  2RGJ A;  2YLR A;  2NWB A;  3KFW X;  1HRV 4;  1YW0 A;  2PHH A;  2QAE A;  4P9S A;  5L3E B;  3T2K A;  2BXS A;  3UP4 A;  4BK1 A;  2YR6 A;  4NPP A;  4EQR A;  3VRB A;  4GDE A;  2WU5 A;  1H7W A;  2JPF A;  3ATR A;  3NH3 X;  2IW5 B;  4H4S A;  3QUJ A;  1QJD A;  4JI1 T;  1XDI A;  4CY8 A;  1OJ9 A;  4UVA B;  3UUL A;  4MLK A;  3NBX X;  2LHN A;  3GQK A;  3PUS A;  3P4P A;  2CVJ A;  4JNQ A;  2YM2 A;  4C91 A;  4JBW F;  3RQU A;  4Z91 A;  5AQM B;  3KKJ A;  2V6Y A;  3ALJ A;  1L0V A;  5LNK A;  2VVM A;  3PO7 A;  4PJJ A;  5L3D B;  5HY5 A;  2GV8 A;  5C3J A;  5JCN A;  3RYC E;  3UU6 A;  4GAP A;  4UP3 A;  1VBD 4;  1T98 A;  3ZCI A;  3NRN A;  2EHO A;  3HKE E;  5KRQ A;  2ACZ A;  3SS1 A;  1DU2 A;  1BGJ A;  2AAQ A;  2QA2 A;  4JQ9 A;  5HYM A;  5HHF A;  1IBM T;  3IHR A;  3QSS A;  3I9W A;  4DV5 T;  2YDR A;  5EK4 A;  1MMN A;  1LRZ A;  4DVD A;  1F8R A;  4ZXL A;  4EIW A;  2E4G A;  2W61 A;  4YY3 T;  5BUK A;  3K8P C;  2XLT A;  3A5X A;  4REK A;  5EZY E;  3AE4 A;  4BAY B;  4J34 A;  4IDQ A;  3V5U A;  4M52 A;  5HAX A;  1M6I A;  1YKE B;  5HEG A;  5U1O A;  4XZC A;  1DOD A;  5F5W A;  2GAG B;  2PW9 A;  2SPC A;  1YKJ A;  4CCQ A;  5FL1 A;  4G6G A;  2BBJ A;  4G9K A;  3P50 A;  1BKW A;  1JRX A;  4TN7 B;  2PLV 4;  4UV9 B;  1NAF A;  1NHP A;  3W15 B;  4HWF A;  2YG6 A;  4LFA T;  3AE5 A;  2KND A;  1RVF 4;  1X79 A;  2YIN A;  2CWY A;  3K3Q C;  1D4D A;  3V3N A;  1PBF A;  4JY3 A;  4AP3 A;  2Y6X A;  5FS8 A;  2LLY A;  1JRY A;  3GRS A;  2CUL A;  1L9C A;  3CNJ A;  2H7O A;  2IC6 A;  2XUE A;  3EPT A;  4YKG A;  4PK6 A;  1Q1W A;  1PBE A;  2VL0 A;  3T31 A;  2ES0 A;  2B76 A;  2VWA A;  1RUE 4;  4RSL A;  3KIN B;  3QVR A;  3NYF A;  1Y64 B;  2EQ9 A;  3PUZ F;  5AQQ B;  2YKS A;  4B65 A;  2N9D A;  2E9X A;  1TYP A;  1PBB A;  2XQA A;  5ABG A;  4F8H A;  3MJX A;  4A6N B;  2BK4 A;  2HQM A;  2O9Z A;  1DXL A;  4OCG A;  1PXC A;  2IIU A;  3E0Z A;  2R4E A;  2X9Y A;  1FEB A;  3RNM A;  4C3Y A;  1XDP A;  3NKZ A;  2V6X A;  4U7Y A;  2YDS A;  4U2S A;  1K0I A;  1HCI A;  3QJ4 A;  4IST A;  1GRT A;  5CJ5 A;  3F31 A;  3DP7 A;  2WM9 A;  2Q0K A;  1RUH 4;  3FB2 A;  2WBL A;  4O5U A;  1ONF A;  5AQH B;  4Q25 A;  2CLY B;  5L3G B;  3RHW A;  1O5W A;  1T7S A;  4PFP A;  4QH1 A;  3FBZ A;  4AQF C;  5HEH A;  2Y8D A;  1N4V A;  4EQW A;  5IHY A;  1NEN A;  1EAH 4;  2FJE A;  2L8K A;  4GK5 E;  1TDF A;  2VQB A;  2WWU A;  2A2F X;  3MAC A;  2C5I T;  5IQ1 A;  4X66 T;  2WOW A;  5IPY A;  4B67 A;  3UT5 E;  2BG9 A;  4DBR A;  2BKP A;  1RMU 4;  1QSD A;  4NNJ A;  1XDO A;  3C64 A;  4I59 A;  4G2A A;  3N2G E;  3U3I A;  1N32 T;  2MAW A;  3QOF A;  5H6R B;  4EQX A;  3NRY A;  4OPT A;  1F8W A;  1E2A A;  4EZH A;  3IF9 A;  1IJH A;  2C0S A;  3JC6 C;  1T72 A;  1K0J A;  4XWR A;  3AE7 A;  2X9H A;  2WS3 A;  1QUU A;  2GR2 A;  4LF9 T;  3KVB A;  3ONX A;  1H6V A;  2IC9 A;  4WW0 A;  1J5W A;  1XWM A;  4UR9 A;  4ZZC A;  2DL1 A;  1K5M D;  4Q4W 4;  1UCU A;  2BKN A;  4KP3 C;  4ZI3 C;  1PBC A;  4YWO A;  4UEL A;  5M4Y A;  5JR9 A;  2AE9 A;  2PTF A;  2W63 A;  1HX1 B;  4J2W A;  4MBQ A;  3CK6 A;  2W67 A;  1LTX R;  2WOV A;  4ZCD A;  2CBJ A;  1HRI 4;  1WCR A;  3IF8 B;  2N2N A;  4U74 A;  4CXW A;  3DJJ A;  2BDE A;  5LG3 A;  3AEB A;  5HWY A;  4Z44 A;  2D9D A;  4C5O A;  2XVJ A;  4I58 A;  1G73 A;  2GK9 A;  1S94 A;  3N9M A;  2XFP A;  3UKQ A;  1FEA A;  3FBS A;  5AQF B;  4D04 A;  4J57 A;  5LB7 B;  3BI2 A;  4ZZB A;  5LP6 E;  2PFV A;  3LSV A;  4ILA A;  2Q6U A;  3LZW A;  4GYS A;  1D1B A;  3KBU A;  3S5W A;  3ZMZ B;  3GRT A;  3H3M A;  3NIX A;  5J2T E;  1WLX A;  3EVY A;  2IVE A;  3AB1 A;  3PJA A;  3PUV F;  1Y01 A;  4DR6 T;  5LHI B;  1NCQ D;  4EZ4 A;  3H3A A;  4ZEY A;  3D1C A;  5IYZ E;  4QHO A;  1H86 A;  3P4R A;  4QX8 B;  5ABH A;  1G8X A;  1M64 A;  5HXC A;  3IHM A;  1NHR A;  4UDR A;  2VVN A;  4BJY A;  4BJZ A;  2A3D A;  5FKY A;  4B3S T;  2FJD A;  2XQ6 A;  2UXB T;  3C4A A;  3GSI A;  4GOU A;  5CA1 E;  1JNZ A;  3R6N A;  4DUZ T;  1TDE A;  3ICS A;  3UKL A;  2BA9 A;  4DBQ A;  3CND A;  3V5S A;  2Q9Q A;  3ESL A;  4X4J A;  1UGO A;  1YD8 G;  2VVL A;  2CHO A;  5J0Z A;  2DKH A;  4AT2 A;  4TX5 A;  1XHC A;  3SFD A;  2D0U A;  5FP3 A;  2RMU 4;  5KNL A;  4II3 A;  4H4Z A;  3F8D A;  5IWA T;  4YJ2 E;  5KMQ A;  2YLW A;  2LKG A;  4J56 A;  1ZMC A;  4N78 D;  1J1J A;  1YXR A;  3BQI A;  3RRC A;  2YWL A;  4CI2 B;  2X0Y A;  3EI0 A;  4UVB B;  2WPF A;  3V3O A;  1M7K A;  4O4I E;  3ETU A;  1NHQ A;  5JCM A;  2XLR A;  1LV0 A;  3ZJ2 A;  3HL6 A;  5JDF A;  3PS9 A;  3KPF A;  4U7I A;  4U72 A;  2GH5 A;  3F8R A;  2JK6 A;  1K0L A;  4JI5 T;  5JCL A;  1MIV A;  4H2Q A;  4MHC A;  1VBB 4;  3K7Q X;  2OLT A;  3H4K A;  5FNV E;  4H4V A;  1GSN A;  2R9Z A;  4JI2 T;  4NIQ A;  4LU6 A;  2VOU A;  2KWI B;  5EK3 A;  3VQR A;  5LJM A;  5DQW A;  4B3T T;  4H63 H;  4OPI A;  2E2A A;  3AE9 A;  2KSR A;  3KD9 A;  3GN5 B;  2V5C A;  3KV4 A;  5ADX L;  3LOV A;  1HR0 T;  4PNI A;  1D7L A;  1HXS 4;  2ZZ0 A;  4IGU A;  3UTG A;  1CUN A;  1N34 T;  4A5X A;  3GMC A;  1BWC A;  4O5Q A;  3Q2M A;  3O1J A;  2XLU A;  1BR0 A;  1EL5 A;  1HG5 A;  3L3P A;  1TYT A;  2GQW A;  4X1I E;  3GYX A;  3AA1 B;  1HNX T;  2GVC A;  4TLX A;  4AKL A;  4IE4 A;  2XAG B;  3UUM A;  4TV9 E;  4PK4 A;  1KEY A;  2NOX A;  2Z5X A;  4QH5 A;  3VU7 H;  3QSE A;  2DWK A;  3B13 A;  4RG4 A;  4NEW A;  2WPC A;  5LMN T;  4UXN B;  4P1N A;  3BHK A;  5HCM A;  1XZY A;  1UK5 A;  2XQ7 A;  2YN6 A;  2BVM A;  3K3N A;  2WP9 A;  3CGE A;  4DR5 T;  3L1R A;  3CGB A;  2V60 A;  1KNP A;  3O9X A;  1KSU A;  3LDQ B;  2CFY A;  3J9X 1;  3JC6 D;  4JI3 T;  4RHV 4;  1ZP0 A;  5FYM A;  1ZHC A;  3HKB E;  2FBW A;  4TM4 A;  4JI0 T;  4Y4L A;  4PDW D;  4Z2U A;  3CMM A;  2XLS A;  3AD7 B;  2WZH A;  4DV3 T;  1PXB A;  5ER0 A;  3ADA B;  4NTC A;  3SZW A;  4AT0 A;  3H37 A;  2Z5Y A;  4YTP A;  4MAL A;  5HEO A;  2D5U A;  3VRA A;  4B64 A;  2XAJ B;  1OED A;  2VVS A;  4PJL A;  2C4C A;  3AYL A;  1Z6L A;  3AWI A;  2V26 A;  4EIQ A;  2E1M A;  4H9Q C;  2V7M A;  3H8I A;  4EIP A;  4JLE A;  3KVA A;  4BK3 A;  3O0H A;  5GRT A;  4TWD A;  2YG3 A;  5F8P A;  1AJ3 A;  3OTO T;  4I55 E;  1YQ3 A;  4LF4 T;  3DK4 A;  1IAP A;  4U31 A;  4Z2T A;  2XDO A;  2WDV A;  1PIV 4;  2C64 A;  2P9B A;  4IVO B;  3B5M A;  2WMO A;  2EQ6 A;  4YXD A;  3ZYL A;  4TNW A;  1RUD 4;  4UF0 B;  3ZMS B;  4JNA A;  1H7C A;  2JMH A;  1LKX A;  3ZN1 B;  3T1H T;  4IV9 A;  3IEE A;  3KDS E;  4EM3 A;  1AR6 4;  3HA4 A;  3ZJ1 A;  5DBJ A;  4IE5 A;  5KXJ A;  2RGH A;  4OFZ A;  4H9R C;  2GRT A;  3Q9T A;  1ZKQ A;  3RYI E;  2ZLY A;  2ZM0 A;  5J2U E;  2XQ9 A;  3ISH A;  1LVL A;  4LFC T;  5JDM A;  3N9N A;  2RAB A;  1OXZ A;  1BZL A;  4HFI A;  2X5I D;  3ZC0 A;  2BYB A;  1XPQ A;  1UUR A;  4CI1 B;  4HA6 A;  2E5L T;  2YLS A;  3BQK A;  5FS9 A;  3DJG X;  3CGC A;  4E7Z A;  4QWN B;  3P9U A;  3QSM A;  2HHH T;  1XI1 A;  2X50 A;  4A6N A;  2D2S A;  4U2Z A;  2WQY A;  2BRA A;  4GDP A;  2KMF A;  2NW8 A;  3ZEF B;  4GUV A;  2L9Q A;  4OPL A;  4YSZ A;  2K9A A;  1R09 4;  3N9Q A;  4H4Y A;  2E9X C;  1IBK T;  3RYF E;  1H7X A;  3COX A;  4AOX A;  3PE0 A;  4GRT A;  4HFC A;  1BF3 A;  4DO0 A;  1IUT A;  2PG8 A;  1OWA A;  3X1D A;  4X9N A;  2VRM A;  1TDO A;  4WBN E;  2OV9 A;  3UUB A;  1S35 A;  1PVC 4;  2C72 A;  3ZC1 A;  4HB9 A;  5LCY A;  5KX5 E;  5AQR B;  3B3R A;  1WRD A;  2LM2 A;  3PUG A;  3N9O A;  4IRE A;  4USR A;  2R07 4;  2NTY A;  4U8K A;  4IA6 A;  3WAJ A;  1B37 A;  1OJC A;  1SUM B;  1AOG A;  4KHZ F;  4BJN A;  2A9U A;  2LSI A;  4X9M A;  3RP6 A;  3FBL A;  2WBA A;  4Z90 A;  3ZN0 B;  2HH7 A;  2H88 A;  2JAE A;  4U8M A;  4EYU A;  2XYO A;  2VKO A;  1GES A;  3DJB A;  2JB2 A;  1CC6 A;  3UUX B;  2KZ7 B;  1GQE A;  1J5E T;  1OJA A;  4B63 A;  1T8B A;  3I1A A;  2CA5 A;  1H8T D;  2H3R A;  1P2H A;  5CA0 E;  3RGL A;  2OAM A;  2BVL A;  3EUH A;  5FMN A;  5AQP B;  2VK9 A;  3FG2 P;  3Q5X A;  2LKH A;  1IUV A;  3CTY A;  4U8N A;  4JY2 A;  5AQK B;  4OK0 A;  3VHL A;  4U8O A;  3T8O A;  4IL4 A;  3GWF A;  4GIW A;  4H63 V;  2BXR A;  4RG3 A;  5U63 A;  2GF3 A;  1MMA A;  2V1D B;  3MKD A;  3PUY F;  3PUW F;  4U3C A;  3GMB A;  3NK1 X;  3AEF A;  5JQG E;  2HN1 A;  2R4J A;  2M6B A;  2X8H A;  2YU1 A;  3UKA A;  3A8Y C;  3NNE A;  2IVD A;  2XLP A;  3AXJ B;  1DOC A;  4YKF A;  2YOE A;  1N4U A;  2W62 A;  2E5V A;  2ZMA A;  2W2U A;  3DK9 A;  5L3C B;  3AE8 A;  2A8X A;  3MZK B;  3ANW A;  3CPJ G;  4YT0 A;  1IUW A;  3RRW A;  3O1I A;  3N9L A;  3T2Y A;  3P4W A;  4FJO A;  3RIA A;  4H4T A;  1COY A;  3AEA A;  3AEG A;  2YG5 A;  1JRZ A;  1KFY A;  3I3L A;  3OC4 A;  5KDM C;  5KVI A;  1GTE A;  1VBE 4;  2MOZ A;  1ZV4 X;  2BS4 A;  4G74 A;  1D1A A;  2M6I A;  4NTE A;  5CKU A;  3AA7 B;  2K48 A;  3NN6 X;  1S3B A;  3NTD A;  3DK8 A;  2EHO D;  2XHE B;  4D03 A;  1FL2 A;  2CXD A;  3UQ7 A;  4ZN0 A;  4EMJ A;  4A97 A;  3KV9 A;  3JAD A;  3UOY A;  4EQS A;  4DR4 T;  1D4M 4;  3TLS A;  1E1H B;  3QNU A;  5F3J A;  3SRZ A;  5AQG B;  1R8I A;  2XCG A;  2R0C A;  2XSB A;  4LII A;  3AAA B;  4TUY E;  2V7J A;  3UKP A;  3ALM A;  2C7G A;  1EL9 A;  2GEW A;  4B3R T;  5CGM A;  5HXH A;  2GR1 A;  4X64 T;  3RYH E;  3G5S A;  3O1H A;  2XAF B;  1KNR A;  5J7X A;  5E0O A;  2NR4 A;  3NK2 X;  4JV5 T;  2XTL A;  3NGC X;  4HEA A;  4J2C A;  2X68 A;  3UQ4 A;  5AQJ B;  2JBV A;  3LBX A;  4Z43 A;  4GB3 4;  3HYW A;  3PDY A;  3NKS A;  1AR7 4;  3NYE A;  3VKG A;  1ASJ 4;  5AQU B;  3SWH A;  1UUS A;  1TDK A;  3ZST A;  3VR9 A;  1EBD A;  2V3A A;  4EAH A;  3CN8 A;  3RKO A;  2GB0 A;  3CIR A;  4LA1 A;  2W0G A;  1GRB A;  5FY7 A;  5CQF A;  3CGD A;  3EF6 A;  3SQP A;  4C90 A;  4TNV A;  3ZT6 A;  3CQX C;  2JQQ A;  4H2P A;  1DOE A;  3O4X E;  4OVI A;  1KNZ A;  3GYJ A;  2C5K T;  2YVF A;  3QFB A;  1VRB A;  2YEV C;  3ONL C;  3AXB A;  3RIU C;  2WSS V;  4YLH A;  2R7F A;  3KLJ A;  4AKG A;  3KV6 A;  3AAE B;  1RUC 4;  1GOS A;  5LG4 A;  1HTJ F;  4IIJ E;  2E9X D;  3UFG A;  2R6G F;  4DV1 T;  4J36 A;  4HFE A;  2BBH A;  1YY5 A;  2RS3 4;  4CN4 A;  1LVK A;  1GRH A;  2VZ2 A;  3FI7 A;  3FZM B;  4BJM A;  5LBM A;  2C75 A;  3GD4 A;  3C51 A;  2X3N A;  2ODV A;  3ATQ A;  2W0H A;  5TR3 A;  3CNT A;  5KOX A;  1DOB A;  4KX6 A;  3LK3 B;  3C50 A;  3GQH A;  1ZKE A;  3RHA A;  2OLN A;  2HWC 4;  2V6Y B;  3G5R A;  4HN9 A;  2IDO B;  3JSK A;  3SZC A;  5FXW A;  2GAH B;  1UX5 A;  2XVE A;  2XVI A;  3P1W A;  4A98 A;  1CJ2 A;  1SHZ C;  2EHO B;  4TM1 A;  3R9U A;  2IML A;  2KLQ A;  3I0Q A;  4O8S A;  2VQF T;  2H7V C;  4A56 A;  1OJD A;  2LRL A;  4TV8 E;  4Z8X A;  2F4V T;  1VDC A;  4I0U A;  4IT4 A;  1MMD A;  4ZS2 A;  4TWF A;  3E22 E;  2QCU A;  4PAG A;  1ZK7 A;  4YFS A;  3OKQ A;  4UVC B;  2OAL A;  3NWI A;  2CM0 A;  1FJG T;  2Q7V A;  1B8S A;  2YQU A;  2LSK A;  3NRX A;  1FMW A;  2C66 A;  1B4V A;  3T2Z A;  2I0Z A;  4OYK A;  1NDA A;  1L9D A;  2X51 A;  4IE7 A;  3C4W A;  1PS9 A;  3UP5 A;  4EMW A;  1TDN A;  2BCP A;  2DI4 A;  3AD9 B;  1AR8 4;  2YR5 A;  4FX9 A;  3M0O A;  4U2T A;  4NUU A;  2FUP A;  4N9X A;  2Y48 B;  3DGZ A;  4QXC B;  3ZSS A;  1F8S A;  4HE8 A;  1VG0 A;  1OED C;  2DCF A;  3ZYM A;  4LF5 T;  1HNZ T;  4ADZ A;  3SZF A;  4G6H A;  1Y56 A;  1PDH A;  2K24 A;  2RS5 4;  4UF0 A;  1S2Y A;  3EAM A;  4QXH B;  3NLC A;  1E1M A;  5BVA A;  2DKI A;  1E1N A;  2WET A;  3UOV A;  4I4T E;  2LE8 A;  3P4S A;  3EAN A;  3J8F 4;  4IDZ A;  3HR0 A;  2PYJ A;  2WZI A;  5BRT A;  1VCT A;  3I6D A;  4K5S A;  4KPR A;  5JDH A;  3EDU A;  1AR9 4;  2AQJ A;  5C8Y E;  2E9X B;  2WOI A;  3CX8 B;  2ZM6 T;  4B68 A;  4AQY T;  4DSH A;  2VQ7 A;  3K30 A;  1RSG A;  4CN6 A;  4QKN A;  2RA1 A;  2PYL A;  3K7T A;  4U8J A;  4WCT A;  1ZEE A;  1NG4 A;  2WEU A;  5FS7 A;  1MQT D;  2ODU A;  3N5L A;  1PJ6 A;  4DR3 T;  2WPE A;  1KK7 A;  4AQF A;  1PHH A;  2RR1 4;  2X99 A;  1QLB A;  3C98 B;  4V1A v;  4YTM A;  5CB4 E;  4IHJ E;  3UTF A;  5HEU A;  3RP7 A;  2C73 A;  1NAA A;  5FXX A;  4PW8 A;  3PUA A;  3SYI A;  1H84 A;  3B57 A;  2ZM2 A;  3BQL A;  1GAL A;  3NZQ A;  3P8C D;  2R06 4;  2YLT A;  4OPG A;  4COF A;  4A99 A;  3FPZ A;  1W4X A;  4Z24 A;  3FXE B;  3AE3 A;  3LJP A;  2CEA A;  4LML A;  4ZI7 E;  4C74 A;  5DQV A;  3AA6 B;  2N1G A;  3LFM A;  3SOL A;  1LPF A;  4HWC A;  3AVR A;  3VKH A;  3UTK A;  2XJ7 A;  5LGN B;  1ZMD A;  5L46 A;  2BG9 B;  2Q9Q D;  3OPC A;  2XFN A;  4CXY A;  3M13 A;  4IA5 A;  2J47 A;  5L2L A;  1GET A;  3GWH A;  3AE6 A;  4GK0 E;  2BAB A;  1US7 B;  4EYY R;  2V61 A;  3U78 A;  4JN9 A;  2R0G A;  3CX6 B;  3JAE A;  1GTH A;  5LHH B;  5AQT B;  3TKL B;  3KV5 A;  3DTO A;  2UZZ A;  5AQV B;  1EZ3 A;  3AE1 A;  4MFR A;  1D0Y A;  1GEU A;  5JTG A;  5HYA A;  3FZF B;  4LMJ A;  5KWF A;  2YG4 A;  3N2K E;  2PJQ A;  2MYS A;  5TAO A;  3RC8 A;  3SM8 A;  4HGA A;  4ZCC A;  4ADW A;  1FIO A;  3RLF F;  1PO2 4;  1SE7 A; 
#chains in the Genus database with same CATH homology
 5J60 A;  3K7M X;  1TYP A;  3D8X A;  1PBB A;  5EOW A;  4A9W A;  3DH9 A;  4USR A;  1N4W A;  4U8K A;  4A6N B;  4IA6 A;  1LJ1 A;  2BK4 A;  1B37 A;  2HQM A;  1OJC A;  1DXL A;  2O9Z A;  3ITJ A;  3NHO X;  4OCG A;  1AOG A;  1PXC A;  4X9M A;  3RP6 A;  3URH A;  2WBA A;  2R4E A;  4U8M A;  2H88 A;  1S2Q A;  1FEB A;  2JAE A;  2XYO A;  3RNM A;  4C3Y A;  1GES A;  2JB2 A;  1CJ4 A;  2H89 A;  1VRQ B;  1CC6 A;  3L8K A;  5KMR A;  4U2S A;  1K0I A;  3QJ4 A;  1GRT A;  3T0K A;  4UDP A;  4H4U A;  2Q0K A;  1OJA A;  4B63 A;  4EMI A;  3DME A;  1PJ5 A;  4O5U A;  1ONF A;  4H4W A;  1MO9 A;  3DJD A;  2BS3 A;  4GAV A;  1P2H A;  2OAM A;  3SUC A;  1O5W A;  2YM1 A;  1FCD A;  3DA1 A;  2APG A;  1YQZ A;  4APN A;  2C3D A;  4NWZ A;  2CDU A;  2Y6R A;  1K4Q A;  3FG2 P;  1N4V A;  2C67 A;  2GMH A;  4K2X A;  4EQW A;  4H4Q A;  3HYX A;  1NEN A;  5BUL A;  1IUV A;  3CTY A;  4U8N A;  4JY2 A;  5HXI A;  2FJE A;  1NEK A;  3AEC A;  3NTA A;  4U8O A;  3GWF A;  1TDF A;  2VQB A;  2WP6 A;  2BXR A;  4H50 A;  3AEE A;  4ICY A;  2YVJ A;  4RG3 A;  5U63 A;  3GDP A;  1UKV G;  2GF3 A;  4FDC B;  4MJW A;  5IQ1 A;  5FS6 A;  2YVG A;  2WOW A;  5IPY A;  4B67 A;  4A79 A;  3SZ0 A;  3KA7 A;  3GMB A;  2YR4 A;  3NK1 X;  4CRT A;  3AEF A;  5KOW A;  3KU9 A;  2R4J A;  4NNJ A;  1FEC A;  1LQU A;  2X8H A;  4I59 A;  3UKA A;  4J31 A;  3IC9 A;  3NNE A;  2IVD A;  3UKH A;  4OPD A;  2XLP A;  5JCK A;  1DOC A;  2R45 A;  4ECH A;  2V6O A;  4YKF A;  4NEV A;  1N4U A;  4EQX A;  4OPT A;  2E5V A;  1F8W A;  3ZDN A;  1ZOV A;  3DK9 A;  5EB4 A;  3IF9 A;  3AE8 A;  2A8X A;  1SEZ A;  1IJH A;  2BAC A;  1MOK A;  1CJ3 A;  1K0J A;  4OPC A;  3LB8 A;  4XWR A;  3AE7 A;  3G5Q A;  3CPJ G;  3ICR A;  2WS3 A;  2GR2 A;  4YT0 A;  1IUW A;  3AYI A;  1H6V A;  2X8G A;  2YLX A;  1RYI A;  3T2Y A;  1O94 A;  3Q6J A;  1PJ7 A;  2TMD A;  1EL7 A;  1PBD A;  1CBO A;  4H4T A;  4C77 A;  2C70 A;  1COY A;  3AEA A;  1PBC A;  3AEG A;  1S3E A;  2EQ8 A;  2YG5 A;  4YWO A;  1JRZ A;  1KFY A;  2JKC A;  3I3L A;  3OC4 A;  3GDN A;  2VRL A;  5KVI A;  1GTE A;  1GND A;  1IUS A;  1XAN A;  3S61 A;  4J2W A;  1NHS A;  2BS4 A;  1Y0P A;  3DGH A;  4G74 A;  3T14 A;  5JCI A;  1BGN A;  1LTX R;  4AP1 A;  2PYX A;  2WOV A;  4NTE A;  5CKU A;  2GMJ A;  3NN6 X;  4ZCD A;  1S3B A;  2C65 A;  3NTD A;  3NT6 A;  3DK8 A;  2OLO A;  3HYV A;  3DJJ A;  2XFQ A;  2XVH A;  1IUU A;  4D03 A;  1FL2 A;  1KF6 A;  4K5R A;  3AEB A;  3M12 A;  3GD3 A;  4ZN0 A;  4EMJ A;  4Z44 A;  4EQS A;  3UOY A;  2AR8 A;  3SY4 A;  4U2L A;  3GWD A;  2EQ7 A;  4C5O A;  2XVJ A;  4OPU A;  1JNR A;  1O95 A;  4I58 A;  4TM3 A;  2NPX A;  1GRA A;  5LV9 A;  1GER A;  3RED A;  2XFP A;  3C4N A;  2XCG A;  2B7R A;  2R0C A;  3UKQ A;  4LII A;  1FEA A;  3FBS A;  3QVP A;  4D04 A;  4J57 A;  2BC0 A;  3BI2 A;  2FJB A;  2ZZC A;  1N1P A;  1P2E A;  3UKP A;  2Q6U A;  2R0P A;  3ALM A;  3LZW A;  2C7G A;  1EL9 A;  2GEW A;  3S5W A;  3GRT A;  3NIX A;  2B9W A;  2GR1 A;  3UTE A;  4NZH A;  1HYU A;  3G5S A;  2BRY A;  1ZDL A;  2IVE A;  3AB1 A;  1KNR A;  1RP0 A;  3GYI A;  5J7X A;  3NK2 X;  1VG9 A;  3NGC X;  4B69 A;  1KDG A;  2IID A;  3D1C A;  2JBV A;  3FMW A;  3ABV A;  1E1K A;  1H86 A;  4Z43 A;  3P4R A;  1JEH A;  3BNM A;  3VRD B;  3HYW A;  4DSG A;  1M64 A;  3NKS A;  1GV4 A;  3NYE A;  3IHM A;  1NHR A;  3II4 A;  4UDR A;  4CNK A;  4U8I A;  3QFA A;  5C2T A;  4BJY A;  4BJZ A;  1H83 A;  1GT8 A;  1TDK A;  1CL0 A;  3VR9 A;  1EBD A;  1GXF A;  2V3A A;  3CN8 A;  2GB0 A;  2FJD A;  5EBK A;  1GRE A;  3CIR A;  4LA1 A;  3C4A A;  2VVL G;  3GSI A;  2JB1 A;  4FK1 C;  3KVE A;  1GRB A;  5CQF A;  3CGD A;  3EF6 A;  4YTN A;  2WDR A;  3HZL A;  4J33 A;  4B1B A;  3SQP A;  1JNZ A;  3E1T A;  1JU2 A;  4USQ A;  1TDE A;  2WES A;  1Q9I A;  3ICS A;  3ICT A;  3UKL A;  3OZ2 A;  2BA9 A;  3C96 A;  3CND A;  1DOE A;  3AYJ A;  4H2P A;  4JDR A;  3ZYX A;  4YSY A;  4K8D A;  4X4J A;  4OVI A;  3FIM B;  1D4E A;  3LZX A;  3GYJ A;  2VVL A;  1F3P A;  2YVF A;  3SFE A;  4DGK A;  3QFB A;  4BUR A;  2DKH A;  4AT2 A;  1E1L A;  4B66 A;  3AXB A;  3DJE A;  1F6M A;  1XHC A;  3SFD A;  3KLJ A;  3H8L A;  5KNL A;  4FK1 A;  4II3 A;  1GOS A;  4H4Z A;  3F8D A;  1E39 A;  5KMQ A;  2YLW A;  2B9X A;  4J36 A;  4J56 A;  3SGL A;  1EL8 A;  1ZMC A;  1YY5 A;  2B9Y A;  1TRB A;  1GRH A;  2VZ2 A;  1H81 A;  2V5Z A;  3CPH G;  4CNJ A;  1D7Y A;  2C75 A;  3UOX A;  3P4Q A;  2Y6Q A;  3GD4 A;  3NYC A;  3PVC A;  2YWL A;  1YQ4 A;  2WPF A;  3V3O A;  5KMP A;  1D5T A;  1ELI A;  2X3N A;  1Y56 B;  3ATQ A;  1NHQ A;  1DNC A;  1MXT A;  2XLR A;  5JCM A;  2W0H A;  1LV0 A;  4K22 A;  4Y4N A;  2WU2 A;  4Z2R A;  5TR3 A;  2YLZ A;  3CNT A;  4GCM A;  3PS9 A;  5KOX A;  1E7P A;  1DOB A;  3KPF A;  4PAA A;  4KX6 A;  2GH5 A;  2RGO A;  4Z26 A;  1NG3 A;  3GQH A;  4WX1 A;  3F8R A;  2WDQ A;  3EAO A;  4U8L A;  3RHA A;  2JK6 A;  2OLN A;  1FOH A;  1K0L A;  2QA1 A;  4H4X A;  4A65 A;  1PXA A;  5JCL A;  1VQW A;  4H2Q A;  3UKF A;  3G5R A;  3JSK A;  3K7Q X;  3H4K A;  1V59 A;  3SZC A;  5IQ4 A;  2GR0 A;  1QO8 A;  4H4V A;  2GAH B;  3IWA A;  1PN0 A;  1GSN A;  2R9Z A;  1D4C A;  3VR8 A;  3NN0 X;  4LU6 A;  2XVE A;  2XVI A;  3P1W A;  2VOU A;  1GPE A;  3NK0 X;  2R46 A;  3CNP A;  1CJ2 A;  1LQT A;  3VQR A;  5EB5 A;  2WHD A;  4TM1 A;  2YG7 A;  3R9U A;  2J3N A;  4OPI A;  4CBQ A;  1ZOY A;  3NG7 X;  3AE9 A;  3KD9 A;  3UTH A;  1CHU A;  2BK5 A;  1OJD A;  3LOV A;  2C3C A;  1D7L A;  4GF7 A;  1NPX A;  2XFO A;  1VDC A;  1KSS A;  3AE2 A;  2BK3 A;  2GQF A;  2ZZ0 A;  3UTG A;  1REO A;  5KMS A;  4A7A A;  3B6D A;  2X8C A;  3GMC A;  1BWC A;  4O5Q A;  4Z25 A;  2XLU A;  1EL5 A;  1X31 B;  4NTD A;  1DJN A;  1TYT A;  2F5Z A;  2GQW A;  2QCU A;  4H4P A;  5FMH A;  3SX6 A;  3GYX A;  4C3X A;  1ZK7 A;  2GVC A;  5M0Z A;  2OAL A;  4TLX A;  1CJC A;  4XWZ A;  1DJQ A;  4GR1 A;  4H2N A;  2Z5X A;  2Q7V A;  4H2R A;  4H7U A;  1B8S A;  2YQU A;  4II2 A;  1H82 A;  2C66 A;  1CC2 A;  4A5L A;  1B4V A;  3QSE A;  2V3B A;  4XXG A;  3T2Z A;  1GRG A;  2GR3 A;  2I0Z A;  2RGJ A;  3V76 A;  2YLR A;  1NDA A;  4BV6 A;  3ALL A;  4RG4 A;  1L9D A;  1L9E A;  2PHH A;  2QAE A;  2WPC A;  4G73 A;  4NEW A;  4P9S A;  3AD8 B;  3T2K A;  1PS9 A;  3BHK A;  3UP5 A;  2BXS A;  3UP4 A;  4EMW A;  1TDN A;  4BK2 A;  2BCP A;  3AD9 B;  3BHF A;  4BK1 A;  2YR5 A;  2YR6 A;  3M0O A;  4FX9 A;  3WE0 A;  4U2T A;  4EQR A;  3LXD A;  3VRB A;  4GDE A;  4N9X A;  2TPR A;  4E0V A;  2WU5 A;  2JB3 A;  1F8S A;  3DGZ A;  4H4R A;  1H7W A;  2WP9 A;  3ATR A;  3NH3 X;  3CGE A;  1VG0 A;  3L1R A;  4H4S A;  3CGB A;  2V60 A;  5U25 A;  4AOS A;  1KNP A;  1QJD A;  4DNA A;  1KSU A;  1XDI A;  1OJT A;  2CFY A;  2XVF A;  4CY8 A;  1OJ9 A;  3SZF A;  4G6H A;  1Y56 A;  4CCR A;  1ZP0 A;  4TM4 A;  1PDH A;  4Y4L A;  2FBW A;  3UOZ A;  1S2Y A;  4Z2U A;  2C76 A;  3CMM A;  2XLS A;  3GQK A;  3P4P A;  3NLC A;  1E1M A;  2CVJ A;  3AD7 B;  1PXB A;  4JNQ A;  5BVA A;  2DKI A;  1E1N A;  2WET A;  2YM2 A;  3ADA B;  4NTC A;  5ER0 A;  1CF3 A;  3SZW A;  3UOV A;  4AT0 A;  2Z5Y A;  3CNS A;  2BS2 A;  2ZZB A;  3P4S A;  3EAN A;  4YTP A;  3KKJ A;  3ALJ A;  3VRA A;  4B64 A;  5BRT A;  1L0V A;  2B7S A;  3I6D A;  4K5S A;  2NVK X;  4KPR A;  5KVH A;  2VVM A;  3PO7 A;  2C4C A;  3AYL A;  5HY5 A;  2AQJ A;  2GV8 A;  5C3J A;  1Z6L A;  2WOI A;  3AWI A;  3CPI G;  4EIQ A;  4YSH A;  5JCN A;  4GAP A;  4UP3 A;  2E1M A;  3NRN A;  4B68 A;  4DSH A;  4Y4M A;  3H8I A;  2VQ7 A;  3K30 A;  1RSG A;  4EIP A;  5KRQ A;  2ACZ A;  4BK3 A;  4EM4 A;  1BGJ A;  2AAQ A;  3O0H A;  5GRT A;  3K7T A;  2QA2 A;  2YG3 A;  4U8J A;  4JQ9 A;  4WCT A;  5HYM A;  1YQ3 A;  5HHF A;  3DK4 A;  2FJA A;  1NG4 A;  4Z2T A;  2WEU A;  5FS7 A;  3QSS A;  2BC1 A;  2XDO A;  2WP5 A;  3UCL A;  2WDV A;  2A89 A;  3RP8 A;  2C64 A;  1Q1R A;  4IVO B;  2EQ6 A;  1PJ6 A;  4YXD A;  1F8R A;  2WPE A;  2E4G A;  1PHH A;  4JNA A;  2X99 A;  1QLB A;  4YTM A;  1ZY8 A;  4UDQ A;  5BUK A;  2XLT A;  4IV9 A;  2ARD A;  3UTF A;  4REK A;  3RP7 A;  3LAD A;  4TM0 A;  3AE4 A;  2C73 A;  1B5Q A;  1NAA A;  4EM3 A;  5DBJ A;  4J34 A;  5M10 A;  5KXJ A;  2RGH A;  4M52 A;  2GRT A;  1H84 A;  1M6I A;  5GSN A;  5U1O A;  3Q9T A;  1GAL A;  1ZKQ A;  3SYI A;  2YLT A;  4OPG A;  3ISH A;  1LVL A;  1DOD A;  4A99 A;  3FPZ A;  2XFU A;  2GAG B;  2RAB A;  1W4X A;  4Z24 A;  3AE3 A;  3LJP A;  3T37 A;  1BZL A;  1YKJ A;  2LFC A;  4IVM B;  4CCQ A;  2BYB A;  1XPQ A;  4G6G A;  4C74 A;  4G9K A;  4HA6 A;  3SXI A;  2YLS A;  1BKW A;  1JRX A;  2BCG G;  4U8P A;  2Q0L A;  5FS9 A;  3DJG X;  1LPF A;  3CGC A;  3P9U A;  2ZBW A;  1NHP A;  3QSM A;  4PAB A;  2YG6 A;  3BI4 A;  2X50 A;  3AE5 A;  4A6N A;  2WQY A;  1ZMD A;  5L46 A;  3IHG A;  4YSX A;  2BRA A;  4GDP A;  2XFN A;  4GUV A;  1D4D A;  3M13 A;  4IA5 A;  3V3N A;  1GET A;  4OPL A;  4YSZ A;  1PBF A;  1E6E A;  4JY3 A;  4TLZ A;  4AP3 A;  5FS8 A;  1GRF A;  3AE6 A;  3KPK A;  4H4Y A;  2BAB A;  1JRY A;  2V61 A;  3GRS A;  2CUL A;  1L9C A;  4JN9 A;  3CNJ A;  1H7X A;  2R0G A;  1GTH A;  3AED A;  3EPT A;  3COX A;  4AOX A;  4GRT A;  2UZZ A;  1BF3 A;  4YKG A;  3AE1 A;  1GEU A;  1Q1W A;  4K7Z A;  1IUT A;  1PBE A;  3BI5 A;  3T31 A;  2A87 A;  1IUX A;  5KWF A;  4X9N A;  2YG4 A;  2VRM A;  2B76 A;  1TDO A;  4CY6 A;  1ZX9 A;  1CC4 A;  2YAU A;  4RSL A;  3QVR A;  3NYF A;  2C72 A;  2EQ9 A;  3SM8 A;  4HB9 A;  4ZCC A;  1JOA A;  2OA1 A;  3UKK A;  4ADW A;  3BNU A;  4B65 A;  3F8P A;  3B3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...