3VR9A

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 199
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vr9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vr9A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vr9A02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vr9A04
3NK0X 3ALJA 3QSEA 3S61A 1TDNA 2QA1A 1LVLA 1DOEA 2YLXA 3SQPA 3M12A 2WS3A 2GQWA 4CY8A 1MOKA 4X4JA 3KLJA 2BABA 3GWFA 1L9EA 1YKJA 2GV8A 2XVJA 3ZDNA 1M64A 3ABVA 5JCLA 4B68A 3F8DA 1CF3A 4ICYA 4C77A 4NTCA 4I58A 4K5SA 3KPFA 3DK8A 4J2WA 5BRTA 3NG7X 4CNJA 1GALA 2ZZCA 2WBAA 1TYTA 2GAHB 5IPYA 3PS9A 4X9NA 3K7TA 3DJEA 1NHSA 4ZCCA 4LIIA 2QA2A 2R4EA 2ZZ0A 2X3NA 4U8NA 1ELIA 1GERA 3EPTA 1K0IA 4LA1A 4O5UA 4H7UA 4TM3A 1H84A 2V5ZA 3CNJA 3AEDA 4U2SA 5KRQA 4TLZA 3SGLA 1KDGA 1K0JA 2EQ8A 2Q6UA 2XVIA 4H4XA 1GXFA 4GRTA 1FECA 4DSGA 3DJDA 1F8SA 3OZ2A 4H4VA 3NK1X 4P9SA 3GRSA 2JB2A 4FDCB 5DBJA 3UOVA 1P2EA 2VQBA 2WHDA 3ZYXA 3UOYA 3CIRA 3R9UA 1CHUA 2R4JA 1JNZA 3GQKA 2RGOA 4H4UA 4FX9A 1GSNA 5IQ4A 2BXSA 2RGJA 4H50A 2WDVA 3K7QX 4JY2A 2JAEA 2AQJA 5HY5A 3M13A 2FJDA 1CC6A 3FBSA 3UKQA 2BCGG 2HQMA 2WPCA 2YR6A 3LZXA 3C4AA 3ISHA 4JY3A 1FEAA 5KVHA 3BI4A 1KF6A 3AD7B 4AP1A 2VVLG 3UCLA 2WESA 1HYUA 1LTXR 2X8CA 4YT0A 1E39A 4K8DA 1ZY8A 2BC1A 4IVOB 4J57A 4JNQA 4CNKA 3SUCA 3NN0X 1LJ1A 3NTAA 4JN9A 2BXRA 2WPEA 3IHGA 2C64A 2BYBA 4X9MA 3CGDA 2EQ7A 3AE4A 1D7YA 3EAOA 3VQRA 2XLRA 3ITJA 4CCRA 1BWCA 5EB5A 3BHFA 3Q6JA 2YM2A 1NAAA 3VR9A 1VG9A 1IUTA 2XVFA 2YG6A 2V3BA 2VVMA 3RHAA 5FS9A 1D5TA 1BKWA 2Q0LA 1KNPA 5BULA 3FMWA 2ZZBA 4HB9A 1PBDA 2OLNA 2R0PA 4OPIA 3ALLA 2WP9A 3NHOX 1D4CA 3AE2A 2GR3A 2CFYA 4XWZA 2E1MA 3AB1A 4GCMA 4RG3A 2BK3A 1PBEA 3COXA 4Z24A 1PXAA 2XVHA 1REOA 1JRZA 2IVEA 3LADA 3AXBA 3UKPA 2LFCA 4E0VA 1H81A 3CPJG 3H8IA 2BS4A 4J56A 1F6MA 4EMWA 4XWRA 1JRYA 2JKCA 4B63A 1OJAA 1VRQB 1B37A 2XVEA 4GDPA 1YQZA 1JRXA 2DKHA 3KKJA 1PBCA 3K30A 4EM4A 2GQFA 1GRGA 2B9YA 2TPRA 2X99A 1E1LA 4U2LA 1KFYA 3UP4A 3L1RA 3AE5A 2GVCA 1NHQA 4B65A 4A7AA 4EMIA 1FL2A 1COYA 3UTFA 2GAGB 3ATQA 5EB4A 5C2TA 2RGHA 3CNDA 3ADAB 2YLWA 2XCGA 3CTYA 2WP6A 3BI5A 2C67A 1K0LA 2YVJA 4OPCA 2JK6A 4TLXA 2WOVA 4Y4LA 5J60A 4U2TA 1ZP0A 4B1BA 2XLSA 3UOZA 3C96A 5JCKA 1MO9A 4REKA 1S2YA 4WCTA 1H6VA 2WEUA 4UDQA 1H82A 3DK9A 2ARDA 3KA7A 2TMDA 3NNEA 4D04A 1F3PA 2R0GA 4EIPA 4H4SA 2R0CA 4NEWA 5EOWA 1Y56B 4RSLA 1NHPA 1Y56A 1FCDA 1LPFA 3L8KA 4CCQA 1Q1WA 1D7LA 4OPTA 3CGCA 3NTDA 4H2PA 2C73A 2FBWA 3DMEA 3ICRA 1E7PA 5M0ZA 1DNCA 1PDHA 3VRBA 2VQ7A 2WOWA 4H4QA 4PAAA 4BK1A 4AOSA 1PHHA 2QAEA 2EQ9A 2WOIA 3UOXA 1EBDA 3JSKA 3QVRA 1O94A 3D8XA 5U63A 2ACZA 3AD8B 2IIDA 2IVDA 1GOSA 2B7SA 4Y4NA 4J34A 1YQ4A 3CPIG 1TDOA 2BS2A 4YSHA 3AE7A 1IUXA 3P4RA 4B66A 2YLZA 1B4VA 1GETA 2YG7A 3KD9A 4J33A 4U8LA 2FJAA 4NEVA 1GRFA 1CJCA 2WU2A 2YWLA 3K7MX 3G5SA 1CC2A 1D4EA 4H4WA 2J3NA 2A89A 2BA9A 2XFOA 2XLPA 5JCIA 4U8JA 3E1TA 1AOGA 2WPFA 1TDFA 2GR0A 1EL5A 1DOCA 1TRBA 1L9CA 4A65A 3IC9A 1K4QA 4TM0A 3AECA 1UKVG 3HZLA 5JCNA 4J36A 2GMJA 1GT8A 5EBKA 1ZOYA 4K7ZA 4NTEA 1BF3A 2CDUA 4H2QA 4A6NB 3CNTA 4K22A 4A6NA 2V60A 4C5OA 1ZOVA 2XLTA 3P4PA 1MXTA 2AR8A 2O9ZA 3S5WA 2BK5A 1Q9IA 3PO7A 2B9WA 4YTPA 4H4YA 4BK3A 2DKIA 2I0ZA 4CRTA 2F5ZA 1KNRA 1B5QA 2VRMA 1FOHA 1BGNA 4YSYA 3EANA 3GRTA 1O95A 3H8LA 2QCUA 4H2NA 3NYEA 1PS9A 4O5QA 4BJYA 4TM4A 3BHKA 3DJGX 1FEBA 1PN0A 3AEAA 1E1KA 1JU2A 2CVJA 3P1WA 4A5LA 1IUUA 1RYIA 1NHRA 3D1CA 1EL8A 2R9ZA 2YLTA 4Y4MA 5U1OA 3CGEA 3B3RA 4Z25A 1Y0PA 2C72A 1XPQA 1GTEA 1GNDA 3ICTA 3NYFA 3NLCA 4YSZA 1VG0A 3AYIA 3GQHA 4C74A 4U8MA 4B67A 1DJNA 4FK1A 3BNUA 1TDEA 4Z2UA 2UZZA 3REDA 2YM1A 3O0HA 2Q0KA 4JQ9A 1IJHA 1B8SA 1GRHA 4APNA 4GR1A 4C3YA 1ZMDA 4ZN0A 1ZMCA 1N4WA 2C70A 4EM3A 1PXBA 1EL7A 1ZKQA 4YKFA 1PXCA 3PVCA 3I6DA 2A87A 3NYCA 2CULA 3CNSA 1QLBA 4GUVA 3UTEA 1DOBA 3II4A 2Q7VA 3P4QA 5HHFA 1H7XA 1O5WA 3AE8A 2VRLA 2JBVA 3LXDA 2XYOA 1GV4A 1NG4A 2R45A 4YKGA 3NH3X 3KU9A 3QVPA 5CKUA 2BC0A 1KSSA 2C3DA 1LQTA 3CPHG 3F8RA 3OC4A 3V3NA 3GYIA 2VOUA 3UTGA 3AE3A 1Q1RA 3CGBA 1TYPA 4D03A 1E1MA 2C76A 5HXIA 1CJ4A 1NDAA 3VRAA 3LB8A 1DODA 4JDRA 2V6OA 1D4DA 3I3LA 4OPUA 5FS8A 4A9WA 4IA5A 4U8KA 4H4RA 3AEGA 4H4ZA 2Y6QA 5TR3A 1S3EA 3F8PA 3AEEA 1GRTA 1LQUA 1OJDA 3M0OA 3ATRA 1QJDA 3AE6A 1CBOA 2C65A 4XXGA 4YWOA 2XFQA 3V3OA 1IUWA 2BCPA 5FS6A 4ZCDA 2C75A 3GSIA 4DNAA 4FK1C 2H88A 1QO8A 3UKLA 4EIQA 4KX6A 2JB1A 1ZDLA 5LV9A 3QSMA 4Z2RA 2RABA 2OLOA 3GMCA 2WQYA 3AEFA 4OVIA 4U8PA 3UKHA 3RNMA 4BV6A 2Z5XA 2XDOA 4YXDA 4DSHA 2Z5YA 4C3XA 2WDQA 4BURA 4EQRA 3QFAA 1M6IA 2GEWA 3CN8A 1V59A 1W4XA 1CL0A 5C3JA 3LOVA 4TM1A 2GR1A 1E6EA 1E1NA 1Z6LA 1NEKA 2YLRA 4ECHA 1CJ3A 1OJCA 4PABA 1JNRA 1GEUA 3AE1A 3BNMA 4EQXA 2X50A 3DGZA 4IVMB 3IHMA 5CQFA 3C4NA 1KSUA 3UP5A 3NIXA 2GB0A 4J31A 2R46A 3DK4A 3GYXA 1YQ3A 4K2XA 2B7RA 4AT2A 3GMBA 2GH5A 3AEBA 4A99A 3GYJA 4H2RA 5KXJA 4YTMA 3EF6A 2E4GA 1VQWA 2XFPA 3GWDA 4LU6A 1GESA 4N9XA 4Z2TA 1N1PA 4EQSA 1PJ6A 3RP6A 3T37A 5L46A 2APGA 1N4VA 3GD4A 3ICSA 1GRBA 1F8WA 1S2QA 2VZ2A 2JB3A 1DJQA 2BK4A 4YTNA 3V76A 2YR5A 4Z43A 3FIMB 2H89A 3DH9A 4NZHA 2X8HA 3NK2X 4JNAA 3RP7A 3QFBA 4OPLA 3DA1A 3IF9A 2GR2A 2GRTA 1P2HA 2WDRA 1XANA 4GDEA 1LV0A 4U8OA 4EMJA 3GDNA 5IQ1A 1H7WA 1X31B 3G5QA 4BJZA 2YG3A 4M52A 3RP8A 1BZLA 1ZX9A 2GMHA 1VDCA 4EQWA 5BUKA 2YQUA 4USQA 4NTDA 3SFDA 1RSGA 3KVEA 1IUSA 3SFEA 4U8IA 4OPGA 1CC4A 3IWAA 3ALMA 1PBBA 1ZK7A 1L0VA 1YY5A 1NG3A 3QSSA 2OALA 2AAQA 3NN6X 1L9DA 3B6DA 4I59A 4IV9A 3DJJA 4CBQA 4CY6A 3NT6A 1NPXA 5FMHA 2YLSA 5GRTA 2E5VA 1GTHA 1F8RA 2WU5A 5KWFA 2NPXA 2YVFA 4UDRA 5HYMA 2XFNA 3AYLA 3AE9A 2B76A 1OJTA 3UKKA 4UDPA 3GDPA 1JOAA 2YG5A 1TDKA 4MJWA 2PYXA 3QJ4A 1S3BA 3DGHA 1PJ5A 4A79A 1CJ2A 1GPEA 2OAMA 2YG4A 4KPRA 2A8XA 2FJEA 1IUVA 2YR4A 3AD9B 1GREA 4AT0A 4AP3A 5M10A 3BI2A 4B69A 2GF3A 4BK2A 4HA6A 2V61A 3G5RA 2B9XA 1PBFA 3NKSA 2V3AA 5J7XA 1OJ9A 5FS7A 2PHHA 3NGCX 1H86A 1N4UA 5KVIA 3Q9TA 4H4TA 5BVAA 4OPDA 4Z44A 5U25A 4OCGA 4ADWA 5KOWA 2YVGA 4GF7A 4AOXA 4YSXA 1BGJA 2XLUA 3NRNA 4WX1A 3WE0A 3LZWA 2WP5A 2W0HA 1NENA 3FG2P 3AWIA 3URHA 3UKFA 3AYJA 4UP3A 2ZBWA 3VRDB 4Z26A 2C7GA 3H4KA 1H83A 2WETA 3FPZA 3SM8A 4B64A 3CNPA 3LJPA 4USRA 2BS3A 1XHCA 2XFUA 2C66A 1JEHA 2YAUA 1EL9A 1PJ7A 2EQ6A 3UKAA 1SEZA 3GD3A 5JCMA 2OA1A 3P9UA 3VR8A 2BACA 2X8GA 1RP0A 2FJBA 3P4SA 1DXLA 4IA6A 4RG4A 2NVKX 4H4PA 3UTHA 4K5RA 1GRAA 2Y6RA 5GSNA 2C3CA 2VVLA 5ER0A 1ONFA 5KOXA 1XDIA 4DGKA
chains in the Genus database with same CATH superfamily
3Q5WA 4MFRA 3T14A 3ALJA 3ZCJA 1HCIA 2YLXA 4MLKA 2GQWA 4BAYB 4IL9A 3PUSA 1M64A 5HXEA 2MPKA 4O4LE 2UUBT 2W61A 4ICYA 3HA4A 1FMWA 3RQUA 5FY1A 1WLXA 4HN9A 4CNJA 1GALA 4L5GA 5F3JA 2ZZCA 1RUF4 4GK0E 4DV6T 2NTYA 3OVUA 3SZ0A 4LIIA 2BVMA 1UK5A 2ZZ0A 5LCYA 4LA1A 3NWIA 2YINA 4H7UA 3EUHA 3HKBE 3AEDA 2UUAT 4EYYR 2HWB4 5JVDE 2EQ8A 2XVIA 4XZCA 4PFPA 4DV4T 5AQSB 4H4VA 2MOZA 3RHWA 3GRSA 2JB2A 2WCAA 4XAXB 4FDCB 5DBJA 3UOVA 3UUNA 3CIRA 3R9UA 2R4JA 5EK4A 1GSNA 5IQ4A 2WDVA 4JI0T 4JY2A 2FJDA 1CC6A 3UKQA 2HQMA 2C0SA 1FIOA 3ISHA 4DV0T 1KF6A 4AP1A 1J5ET 2WESA 2WMNA 4K8DA 2BC1A 5CFBA 2W4XA 2CRBA 4EAHA 1RMU4 3NN0X 3NTAA 3QUJA 2WPEA 4JLEA 3ZMSB 1UGOA 4ZZCA 3CGDA 1HX8A 4K0KT 1D7YA 4HWHA 2MTQA 3K1SA 4ZI7E 3Q6JA 5EB5A 2YM2A 1IAPA 3TKLB 2VVMA 3PUVF 4H9RC 4QXHB 3ONJA 4PJJA 1XHXA 2NW7A 3C64A 3NKZA 5FYMA 4IT4A 3ALLA 5IHYA 4UVAB 1D4CA 5L3GB 2E1MA 3Q5DA 4RG3A 1PXAA 2IVEA 3LADA 2K48A 4U2YA 3PDYA 2C4CA 3H8IA 5L3DB 2BS4A 1H8TD 2JKCA 2I6HA 4JYAT 3ANWB 2CA5A 1PBCA 3FXEB 3RLFF 2TPRA 1H7CA 3LFMA 2KINB 3L1RA 1R084 3AE5A 4UR9A 2GVCA 1NHQA 2WZHA 4EMIA 1FL2A 5CA0E 2GAGB 3C50A 3NBXX 1M62A 1E2AA 2RPAA 3AAIA 2XCGA 4U7IA 5ABGA 2HH7A 4TLXA 3TLTA 2BBHA 3T8OA 5AQVB 4YFSA 1WR6A 2LRLA 2IW5B 2XAHB 1ZP0A 4PJMA 2E9XA 3OTOT 3PUWF 1MO9A 4TUYE 5LJNA 3CX6B 4REKA 4WCTA 4UDQA 2DWKA 4H63V 1IJ5A 4LF9T 5JRCB 2WB5A 3UFEA 3F57A 3UU6A 2TMDA 1F3PA 1SHZC 1FCDA 3MKDA 3ZLIA 4OPTA 4H2PA 2CLYB 5M0ZA 5LMNT 3UULA 1DNCA 1PDHA 4JI8T 5FMNA 3VRBA 2WOWA 4PAAA 3AB3B 3AVSA 5LGTB 2WOIA 1J5WA 1S35A 2Z6EA 3K3QC 3ZKRA 1HG5A 2IIDA 5CGMA 1MMDA 4DV2T 5FXXA 2J62A 1TDOA 2LSKA 2Y8DA 4F6RC 3UU4A 2YLZA 4IHJE 2W67A 5JH7E 2ES0A 4MHCA 1WFDA 1CJCA 3EDUA 3K7MX 5CB4E 1I6ZA 4H4WA 2XLPA 2XFOA 4U8JA 4U31A 3ZN1B 1T98A 1RUH4 1GQEA 2K24A 5L3FB 1XI1A 2CEAA 3PUYF 3L09A 5EBKA 1BF3A 2CDUA 4TZ4C 5A1LA 1D1CA 2AR8A 2O9ZA 4ZOLE 4YTPA 5ABFA 2Q9QC 5ABEA 2I0ZA 4CRTA 2X9XA 1KNRA 1BGNA 2H3RA 4YSYA 4AQYT 3GRTA 3W15B 1O95A 4HFBA 4DV7T 4CI1B 1JU2A 2CVJA 4G2AA 3V5UA 3D1CA 1NHRA 2XQYA 1XMQT 1Y0PA 2C72A 1GTEA 4PJNA 1GNDA 2N1GA 3NYFA 3PUXF 3NLCA 4YSZA 1FJGT 4C74A 1B7TA 3DTOA 3O0HA 4LMKA 3JD74 3CQCB 3L8RA 2VVNA 3O9XA 1W09A 1IJ6A 2VKHA 1N4WA 4EM3A 3PVCA 1NAFA 3I6DA 5IWAT 3NYCA 3CNSA 4GUVA 4AI6A 3P4QA 5HHFA 3AA7B 3J7Yq 2PG8A 3LXDA 1NG4A 4V1Av 2R45A 2BC0A 1KSSA 1DODA 4QX7B 3I3LA 4A9WA 1UX5A 4H4ZA 4OYKA 5J2UE 1S3EA 1BR2A 3AEEA 4QKNA 3M0OA 5FKYA 2D0UA 4A97A 5AQNB 3AE6A 2EHOA 2BCPA 1OEDA 4ZCDA 4JBWF 3FZFB 3UKLA 4EIQA 3K3OA 4KX6A 2JB1A 2V8SV 1ZDLA 5LV9A 4UF0B 4HEAA 3RIUC 2WQYA 3O1JA 4OVIA 4U8PA 3UKHA 3FBLA 3KINB 4DSHA 3FB2A 2Z5YA 2WDQA 1WYCA 4QWNB 1FEWA 5KMQA 1V59A 1CL0A 3P8CD 4B3TT 1D0YA 4Q4W4 2GR1A 1E1NA 2LSJA 4ECHA 1U5PA 1GEUA 2VASA 3OPCA 4HWCA 3NIXA 2V7IA 3GYXA 3LBXB 1WCRA 2W00A 4WBOA 4A99A 4AKGA 4H2RA 3HI2A 4YTMA 3EF6A 1VQWA 3GWDA 4LU6A 1COV4 1HX1B 3T37A 1QUUA 4HFCA 3GD4A 4IREA 4WW0A 2KXPB 2CXFA 4HFDA 4WNKA 5AQOB 1YKHB 3V76A 1IZNB 2XQ9A 3FIMB 4Z43A 3O4XE 2NW9A 4ZI2D 1IBLT 3ZN0B 2X8HA 1RVF4 3QFBA 2UXBT 2VKOA 3AAAB 1XANA 4GDEA 1LV0A 2X68A 1LRZA 5IQ1A 2ACXA 3AXJA 3RP8A 1BZLA 2CBJA 3IBPA 2BVLA 3KDSE 4ADZA 2GMHA 2RR14 2YQUA 4USQA 5J2TE 2PYJA 3SFEA 1ZK7A 2E9XD 1EV14 1YY5A 1NG3A 4WZXA 2LJLA 4MBQA 3QSSA 4EIPA 3ESLA 3DJJA 3WI3A 4HE8A 5FMHA 1YKEB 3VKGA 4QHOA 5GRTA 2WU5A 5KWFA 2NTXA 2NPXA 3RKOA 2XFNA 2B76A 4UDPA 4GK5E 2ZM6T 1TDKA 2YG5A 4NIQA 4MJWA 5JR9B 5L3EB 3DGHA 3RYCE 3C4WA 1CJ2A 3RIUA 2FJEA 2YR4A 5KDMC 2UU9T 3FI7A 2QYWA 3RYIE 4AT0A 5M10A 3BI2A 2UXNB 4BK2A 3C51A 3G5RA 4UXNB 4Z90A 3NRXA 5KVIA 5J1GA 3CX7B 5BVAA 5L47A 4OCGA 4ADWA 5FL0A 4QXBB 4GF7A 4YSXA 2XQ4A 3NRNA 3URHA 4EEDA 5JDLA 3N2KE 5LGNB 4Q25A 4B64A 3PURA 3SM8A 2BS3A 2C66A 3L39A 2WMOA 2JMHA 4ZZBA 5LNKA 1HXS4 2PTFA 3RIFA 3VR8A 2BACA 3GMIA 3CKDA 4EIWA 2NVKX 4YY3T 3BQKA 1R094 3AA1B 4ISTA 4P9SA 5ER0A 4YJ3E 2BZBA 5FVLA 1HNXT 3NK0X 2R6GF 4H9OC 4DR4T 3SQPA 1D0XA 2WS3A 4CY8A 2XQ7A 2KT9A 4NXMT 2BABA 1XDOA 3KVAA 1YKJA 5KNLA 2XVJA 2X0HA 3ABVA 4ERRA 5LP6E 1CF3A 3KPFA 3DK8A 3P4WA 5BRTA 4JI1T 3HYVA 4CN4A 5IPYA 1TYTA 2GAHB 3PS9A 5CA1E 3K7TA 2BG9A 5F5WA 4OK0A 3IF8B 4II2A 4U74A 3B5MA 2X9YA 2QA2A 1GERA 1K0IA 1IBKT 4U2SA 5KRQA 4H9QC 2Y6XA 3SGLA 3K3NA 4II3A 2N9DA 4GRTA 1FECA 2BBJA 3Q5XA 1F8SA 3ZJ1A 3OZ2A 4GYRA 2A72A 3ETUA 2ZM2A 3LJCA 3NK1X 3MZKB 2ODUA 1P2EA 2VQBA 3ZYXA 3UOYA 5L3CB 5IYZE 1JNZA 3GQKA 2RGOA 2LSGA 2JQKA 3SZWA 2RGJA 1VBB4 5HY5A 4DO0A 3ZEFB 2V7KA 3C4AA 4TN7B 5LG4A 2VVLG 3UCLA 1IBMT 2LM9A 1HYUA 2X8CA 5KMRA 1ZY8A 3SUCA 1LJ1A 4WYVA 2EHOD 1SE7A 3IHGA 5AQMB 2J1DG 2C64A 4G74A 2BYBA 4LFCT 2EQ7A 3EAOA 4DNDA 2VURA 1N34T 1NAAA 5FNVE 4HFHA 3RHAA 3JADA 4ZS3A 2RS34 2X9WA 4O8SA 4KI0F 3FMWA 2JQQA 1PBDA 2R0PA 2WP9A 2CXDA 5AQLB 5AFUL 2CFYA 4XWZA 4O2BE 2BKOA 4Z24A 4ISSA 1REOA 2XVHA 1OOPD 4DMWA 1H81A 3T0KA 3CPJG 3RQWA 5EZYE 4J56A 1JRYA 4B63A 4M1PA 1PO14 1B37A 3LDQB 2X99A 1LVKA 1E1LA 2V26A 1HRV4 3KV9A 3UTFA 1Z0PA 4WBNE 2DLRA 4LMJA 3ATQA 5EB4A 3EDVA 2RGHA 3ADAB 5AQIB 1MIVA 1SUMB 3CTYA 4OPCA 2JK6A 5LB7B 2L9QA 5J60A 2LOSA 3RI5A 2DI4A 2WEUA 2XAGB 3RH3A 4DR7T 2ARDA 3UU5A 3SS1A 1T8BA 3NNEA 3RRCA 3I9YA 4H4SA 5EOWA 1Y56B 4RSLA 2V6YB 1Q1WA 2PLV4 1D7LA 3RKGA 5GONE 4GKKT 2V6XA 4AXPA 1XNRT 3RGLA 1E7PA 2Q9QB 4BK1A 4H4QA 3U78A 2EQ9A 4UVBB 3JSKA 4ZI2C 2XHEB 3QB5K 3GN5B 3U3IA 3AD8B 4I0UA 3M65A 3N9NA 4EZ4A 4Y4NA 3CPIG 4YSHA 3AE7A 2RS14 3IHRA 4BJNA 1B4VA 4U8LA 2GK9A 2LRKA 1GRFA 2E9XC 2JRKA 3G5SA 4X62T 2NP9A 2PYLA 1D4EA 2WWVA 2J3NA 2A89A 3SX6A 3E1TA 1AOGA 4LF6T 2WPFA 2GR0A 2E5LT 4A65A 3IC9A 3HZLA 1HR0T 5AQQB 2GMJA 5FY7A 3SZCA 4K7ZA 2XTLA 4IE0A 4A6NB 4K22A 5LA6E 1ZOVA 1MXTA 2UXCT 3S5WA 3OYXA 3LK2B 4H9SE 1Q9IA 4DIDB 3PO7A 3KV5A 4ZI3D 3SXIA 4BK3A 2DKIA 2V5DA 1B5QA 3H8LA 4O5QA 2XQ6A 1HF8A 2LLYA 3BHKA 3DJGX 1FEBA 4A5LA 3P1WA 4HWIB 2R9ZA 4Y4MA 3CGEA 5JDFA 3B3RA 3I0OA 1NCQD 1HFAA 3ICTA 1VG0A 3GQHA 3HR0A 5AQHB 1UX4A 4FK1A 2KZ7B 4YHJA 4UIGA 4JI4T 4O2AE 4NWZA 4JQ9A 4X64T 4C3YA 1BR0A 1PXBA 3F2EA 2CE7A 3UTEA 4GYSA 2M67A 3ZYLA 2FUPA 2Q7VA 3NH3X 2DWGA 2ODVA 5KMGP 1LQTA 3CPHG 2ZM8A 2JPFA 4JEHB 1Q1RA 3GYIA 3UTGA 1TYPA 1E1MA 1NDAA 3VRAA 5FP3A 4JDRA 1D4DA 4TX5A 1AR64 4QH4A 4U8KA 4Z91A 3RIAA 1BEV4 2Y6QA 5TR3A 3I0QA 1XZYA 3F8PA 3HKDE 3C4ZA 3B13A 3ATRA 5AQPB 1CBOA 5AQRB 4YWOA 1XHZA 4AQGA 2XFQA 1IUWA 3GSIA 2H88A 1QO8A 4AQFA 2QGSA 2VK9A 3T2KA 1HNZT 4Z2RA 4ZHQE 2Z5XA 4JI2T 3S4UA 1LVFA 4C3XA 2LKHA 4NPPA 2OA5A 2YDQA 2GEWA 3CN8A 4PDWD 4TM1A 5C3JA 3SRZA 1E6EA 4G9KA 5HEHA 1VBC4 3BNMA 4EQXA 2LKGA 3IHMA 2XY8B 3E08A 3WAKA 2J4GA 2GB0A 4J31A 2R46A 4DV3T 2IHR1 2B7RA 3N9LA 3CMMA 2RM24 3GMBA 4CN1A 1XDPA 3SY4A 3GYJA 3HYWA 3TLVA 2E4GA 2XFPA 2PBIA 1N1PA 1HNWT 4EQSA 4CXYA 4K0UA 2X9HA 2EHOC 4ILCA 2LT3A 5LJMA 3ICSA 2VZ2A 2JB3A 1OEDC 4YTNA 2YR5A 4X65T 2H89A 3NK2X 3JCFA 4OPLA 4EEBA 2HN1A 4CZZB 2GRTA 1H7WA 1X31B 3G5QA 2UUCT 2R7FA 4NTDA 3BK9A 3SFDA 3KVEA 4JI6T 4QX8B 3H37A 5HWXA 1L0VA 3Q2MA 3NN6X 4I59A 1L9DA 3B6DA 4IV9A 4CBQA 2R064 4QXCB 4CXWA 1Z8UA 4PFOA 3O1IA 1GTHA 3PUAA 3LK42 3FZLB 5KMSA 3P7IA 3UKKA 2OLTA 3GDPA 4U72A 3QJ4A 5EK2A 1S3BA 3EABA 1PJ5A 2YG4A 4KPRA 3C4XA 1IUVA 3EAMA 4DUYT 1PVC4 4AP3A 3LSVA 4X5TA 4HA6A 3RPUA 3PJAJ 3FZMB 1PBFA 3NKSA 3M3ZB 4UEMA 4H63H 3QB5A 2PHHA 3HYXA 2UXXB 1H86A 3NGCX 4LMLA 3AAEB 4Z44A 3MXZA 4PJLA 4E7ZA 1Z7S4 2V1DB 4EZHA 3LZWA 2WP5A 2PY5A 3FG2P 3AWIA 3J9X1 2WETA 4USRA 1XHCA 2XFUA 1AL24 3FZHB 1HG2A 2ZMAA 1SEZA 2OA1A 3JBG4 1U4QA 4X1KE 4K5RA 1GRAA 2YEVC 4X1YE 5GSNA 2X5ID 1XDIA 4DGKA 3QSEA 1TDNA 2SPCA 2QA1A 1DOEA 2K3WA 4LF7T 1K5MD 4TNVA 4X4JA 3GWFA 2GV8A 2LOPA 4ZS2A 3ZDNA 4KBMB 5JCLA 2DNXA 4DR3T 4C77A 4NTCA 4K5SA 4J2WA 1VRH4 4N78D 3NG7X 1MNDA 4PK5A 2WBAA 2LM2A 1Y64B 2HN2A 3CPZA 4IDQA 2YK0A 3KFWX 3FXDB 2A9UA 4EV6A 1ELIA 4TM3A 3CMLA 4EYUA 1H84A 3CNJA 5HAXA 4XBFB 4TLZA 3TLUA 1VOMA 1I94T 1KDGA 2PFVA 5E0OA 4H4XA 1GXFA 4DSGA 3N2OA 2CWOA 2XPKA 3FZKB 1CHUA 4ZI3C 3ZT7A 2YKSA 4H4UA 5JDQA 1US7B 3DJBA 2BXSA 2JQ9A 4H50A 4AKHA 4IDPA 3K7QX 2JAEA 2AQJA 4HTEA 3M13A 3RC3A 1PIV4 5J0ZA 3LZXA 5KVHA 2CXLA 4JI7T 3BI4A 3AD7B 2VL8A 5HXCA 2KWHA 4YT0A 4IVOB 4CNKA 4JNQA 4GAVA 4NUUA 3HKCE 2BG9C 3CVRA 2VL0A 4X9MA 2WY2A 4RHV4 3AE4A 3VQRA 3ITJA 2CHOA 3BHFA 4J2CA 2YG6A 5FS9A 1D5TA 4NXNT 2DHRA 5HXRA 1BKWA 2IDOB 1WRDA 5BMVE 2CBIA 2ZZBA 4HB9A 2UXDT 4JUYA 1RUI4 1VCTA 3AB1A 5AQFB 3PJAA 2XQ5A 1PBEA 2V7JA 2XM1A 5H6RB 2IMLA 2XQ8A 2LFCA 4E0VA 4I55E 4EMWA 2LSIA 4XWRA 3N2GE 2IUBA 3MA9A 2VKDA 3ANWA 2WAUA 3ZMTB 2DKHA 3KKJA 5F8PA 3CK6A 2WBLA 1GRGA 4U2LA 1AR84 4A7AA 2NR4A 1COYA 4JI3T 2YU2A 3CNDA 2VKJA 4YJ2E 3T31A 2LE8A 2A2FX 2WP6A 2YVJA 4PW8A 1RUE4 4JV5T 2WOVA 3N9QA 4G6HA 4Z8XA 3N9OA 4LFBT 1MIYA 2E9XB 4B1BA 2XLSA 3UOZA 5JCKA 1H6VA 4PNIA 2ZLYA 2V5CA 5HYAA 4U2ZA 1H82A 3DK9A 5JRCA 3CX8B 4CXXA 4D04A 2IAKA 1V9DA 1DU2A 1WYBA 4IE7A 2R0GA 2R074 4NEWA 4A56A 5FXVA 4HWFA 3L8KA 4CCQA 5JDHA 2V7LA 4I43B 4OHFA 2BKPA 3OJAA 2HPLA 3RF1A 2CCQA 2R044 4AIUA 3RYFE 1X9BA 3JAFA 4AOSA 4OFZA 2YU1A 3UOXA 1EBDA 5HCMA 3QVRA 1KNZA 1O94A 4U7YA 2ACZA 3VU7H 2IVDA 1GOSA 2B7SA 1YQ4A 3UU8A 2X66A 4HWDA 2BS2A 5EK3A 5HWYA 1POV0 4B66A 1GETA 3A7MA 2YDSA 4J33A 3H3MA 1E1HB 2WU2A 2YWLA 1VBE4 2BA9A 5JCIA 3QNUA 1WR0A 1EL5A 3N9PA 1DOCA 3PUZF 1L9CA 4UVCB 3R6NA 1K4QA 4TM0A 3AECA 4OX9T 5DQVA 1UKVG 5JCNA 3ZMUB 1GT8A 4H2QA 3GWHA 3P4PA 5ABFB 2B9WA 1XMOT 3D0TA 2F5ZA 5FL1A 2VRMA 1FOHA 2I59A 3SYIA 2BRAA 3RRWA 4YHHT 3NYEA 4BJYA 2JQHA 5FXZA 3KV6A 1PN0A 1E1KA 1IUUA 5U1OA 1EL8A 2YLTA 4ZXLA 4Z25A 1XPQA 3ZSSA 1VRBA 3N5LA 4B67A 1TDEA 4Z2UA 2LHRA 2YM1A 4YLHA 1VBA4 2Q0KA 4APNA 1MNEA 4GR1A 4X66T 1KK7A 3KBTA 1ZMDA 4LFAT 1EL7A 1ZKQA 1YD8G 1PXCA 4YKFA 3C98B 3ZYKA 1AJ3A 2A87A 3SOLA 3H3AA 1QLBA 2HWC4 4CQIA 2HPJA 3II4A 4TWFA 1H7XA 5TAOA 1O5WA 1MMNA 2E2AA 2N2NA 2JBVA 2XYOA 1GV4A 4YKGA 5LHGB 1PO24 2C3DA 3F8RA 3OC4A 2VOUA 5L2LA 4LF8T 5HXIA 4G73A 3UFGA 2V6OA 5FS8A 4HFVA 2PZSA 4U3CA 2LEHA 3KBUA 5L4HA 3RC8A 2EHOB 4XXGA 3JAEA 1OEDB 2W2UA 3I1AA 2C75A 4DNAA 2QA7A 4GKJT 4FK1C 3Q9DA 3QSMA 3GMCA 4TWHA 1FMVA 2L8KA 5CJ5A 3PU8A 4BV6A 2XDOA 1ZEEA 4BURA 4O4IE 1S94A 4EB6E 2MYSA 4TWDA 3PE0A 3QFAA 3G06A 2DCFA 3LK3B 1W4XA 3LOVA 3SWHA 1Z6LA 4AISA 5LHHB 4GAPA 3JC6D 1OJCA 4PABA 2L3LA 2X50A 4IVMB 3ZCIA 3C4NA 3Q5EA 4PK6A 3TLWA 1YQ3A 3LBXA 4P09A 4JI5T 4DR2T 1MQTD 3A8YC 4PK4A 2W66A 2VWAA 5LGUB 3I9WA 2XQ3A 1PJ6A 1OXZA 2YN6A 2APGA 1G73A 3ONLC 1F8WA 1S2QA 1DJQA 5HEOA 1BR1A 3AVRA 4AQFC 5LOVE 3DH9A 4NZHA 4HFEA 4JNAA 3RP7A 3IF9A 1P2HA 2WDRA 4U8OA 3X1DA 3GDNA 3AXJB 4M52A 2RA1A 3CQGB 3ZC1A 2D5UA 1VDCA 4G6GA 1ZKEA 4ILUA 1RSGA 4ILAA 4OPGA 1CC4A 3IWAA 2PW9A 2OALA 2AAQA 1ZV4X 5C8YE 1NPXA 2YLSA 2B1EA 2E5VA 3NRYA 2YOEA 2YVFA 5HYMA 2P9BA 3AE9A 1OJTA 2BKNA 5LXTE 2WZIA 5JR9A 3ZMZB 4A79A 1GPEA 3UQ4A 5HEJA 2A8XA 1GREA 4B69A 1MIWA 4HGAA 3ZT5A 4AKRB 2B9XA 4UV8B 3BQLA 2D9DA 2G0UA 3O1HA 2X67A 5H6QB 2HHHT 4H4TA 4OPDA 1OWAA 4AOXA 4DBQA 4B3RT 1Y01A 3ZYMA 4WX1A 3WE0A 1R8IA 2XASB 2W0HA 1NENA 4UP3A 4Z26A 2C7GA 3HL6A 5HEUA 1H83A 4Q4V4 2NWBA 1EL9A 4IE5A 3UKAA 4IE6A 2QVAA 3E22E 2QRXA 5JCMA 3P9UA 5KX5E 1RP0A 5LMUT 1W0BA 3A5XA 1RUC4 5JDMA 3P4SA 5HCJA 1KEYA 5AQJB 4RG4A 2Y6RA 1O3XA 1HS7A 1ONFA 5LBQB 5KOXA 4P0BA 3IEEA 2I0MA 4GIWA 3S61A 1LVLA 4DMVA 3M12A 5HXSA 1MOKA 4GB34 1AR74 3KLJA 2K9AA 1L9EA 4TV8E 4B68A 3F8DA 2C5IT 2KWIB 2H7OA 4HKAA 3K8PC 4I58A 3VHLA 2MAWA 2XM2A 2W63A 4X9NA 2BG9B 4FJOA 3DJEA 1NHSA 4ZCCA 2X51A 3ETVA 3T2ZA 2R4EA 2X3NA 4DR1T 4U8NA 3EPTA 4O5UA 1J1JA 2V5ZA 3IA3A 1K0JA 2Q6UA 3DJDA 1VBD4 2WHDA 2E8IA 2CM0A 4EGWA 1EAH4 4UV9B 4FX9A 2H7VC 1NA1D 2PJQA 2XJ7A 4A5XA 4LF4T 3FBSA 2BCGG 5L3BB 2WPCA 2YR6A 1D1AA 4JY3A 1FEAA 3QOFA 4A98A 2D0TA 3OBVE 1LTXR 1E39A 3BQIA 5ETWA 4J57A 3DP7A 4AKLA 4JN9A 4B6XA 2BXRA 1YXRA 3FBZA 4X1IE 4BJMA 3AA0B 3OYZA 4AKIA 3P50A 3MK7C 3EHZA 2XLRA 4CCRA 1BWCA 3CQXC 4EOZB 3VR9A 1VG9A 1IUTA 2XVFA 2V3BA 4DBRA 2X0YA 4KMCA 2Q0LA 1KNPA 5BULA 4HFIA 2OLNA 5IUXA 3T1HT 4OPIA 2C5JA 3NHOX 3AE2A 2GR3A 4ANJA 4GCMA 4ZEYA 2BK3A 2AE9A 3TLSA 3COXA 4DR5T 3VKHA 1JRZA 3AXBA 3UKPA 3EI0A 4I4TE 4DUZT 1F6MA 1OJAA 2YDRA 1VRQB 2XVEA 4X20E 4GDPA 1YQZA 1JRXA 3K30A 4EM4A 2GQFA 2LSYA 5BR8T 2CMRA 2B9YA 2VB6A 1KFYA 4MALA 3UP4A 3RYHE 1RUJ4 4B65A 3MACA 5C2TA 4BA9A 2YLWA 3ONXA 2XAJB 3FHNA 4NUVA 3BI5A 2DL1A 2C67A 1K0LA 4Y4LA 4H9NC 4U2TA 1OEDE 3JC6C 1UCUA 3C96A 3NZQA 1S2YA 5AQUB 1ZHCA 3SZFA 1AR94 2Y48B 2AXDS 3KA7A 1VCSA 2R0CA 1D4M4 1M7KA 3UUXB 1NHPA 1Y56A 1MMAA 2IC9A 4DV1T 1LPFA 2IIUA 4B3MT 2V6YA 2XSAA 3CGCA 3NTDA 2C73A 2WSSV 2FBWA 3DMEA 3ICRA 2Q9QA 5ADXL 2VQ7A 1RUD4 4IE4A 1PHHA 4L0RA 3UQ7A 2QAEA 2C5KT 3D8XA 5U63A 1XNQT 2CWYA 1SA0E 3GN5A 3J8F4 5FXWA 4J34A 2J47A 4PAGA 1QSDA 2XAQB 1IUXA 3QK6A 3P4RA 4IL4A 5HXHA 2YG7A 3KD9A 2FJAA 4NEVA 2JJ9A 1CC2A 2VVSA 3KV4A 2M6IA 4B3ST 1TDFA 1X79A 1TRBA 3KPKA 3NZPA 1BR4A 3WAJA 3ZC0A 4H9PC 4J36A 5L4EA 1ZOYA 3PUQA 2ZM0A 5FVKA 4NTEA 3CNTA 4A6NA 2V60A 4C5OA 3RX6A 2XLTA 2XAFB 3N9MA 2CLYC 2BK5A 4H4YA 1EZ3A 4IGUA 2D2SA 3KVBA 4CI3B 1RUG4 3EANA 3LG7A 2X0LB 2QCUA 4H2NA 1PS9A 2VQET 4L9IA 4TM4A 3AEAA 1RYIA 4E7SA 5JQGE 3NVOA 2V7MA 3T1YT 3AYIA 1D1BA 3OKQA 2JMKA 5FY0A 1DJNA 4U8MA 4IDNA 4P0AA 3BNUA 5JDNA 2UZZA 3REDA 3T2YA 1IJHA 3UUBA 1B8SA 1GRHA 3B57A 1T72A 3UT5E 1ZMCA 2JIWA 2LHNA 2C70A 4UELA 4ZN0A 3UU3A 5DABA 2CULA 3ZPOA 4IDZA 2F4VT 3ZT6A 1DOBA 5AQTB 3AE8A 1HTJF 4CN6A 2VRLA 3ZJ2A 1XWMA 3ZSTA 5AQGB 3KU9A 3QVPA 5CKUA 3V3NA 4D03A 3AE3A 3CGBA 4KP3C 2C76A 1CJ4A 1G8XA 3LB8A 5ABHA 4OPUA 1UUSA 1YW0A 4IA5A 4H4RA 3AEGA 1GRTA 1LQUA 1OJDA 5HEGA 4NNJA 4DV5T 1QJDA 2C65A 2RP4A 3V3OA 4EXTA 5FS6A 4TV9E 4COFA 2RABA 1D0ZA 2OLOA 3AEFA 5JREA 3RNMA 4YXDA 4P1NA 3R84B 3E0ZA 4EQRA 3MJXA 4QH1A 1M6IA 1W0AA 3UTKA 2EX3A 4IIJE 1NEKA 2BG9E 2YLRA 4GOUA 4I50E 4O4JE 1CJ3A 1JNRA 5KMPA 3EVYA 3AE1A 4KHPT 3DGZA 3UUMA 5CQFA 3AA6B 1KSUA 3UP5A 3V5SA 2XZEA 3DK4A 2KSRA 4K2XA 4AT2A 3CWZB 2GH5A 3AEBA 2W0GA 1T7SA 5KXJA 4N9XA 4Z2TA 4U33A 1GESA 1ASJ4 2KMFA 1RHI4 3RP6A 2NW8A 5L46A 3PTRB 1LKXA 1N4VA 4DVDA 1GRBA 2BK4A 3PV0F 4G63A 2M6BA 3GA8A 3HKEE 2XQAA 3DA1A 2GR2A 4C91A 1N32T 4EMJA 4Q4Y4 4Q4X4 4IDOA 4BJZA 1CUNA 5JTGA 2YG3A 5LBMA 1ZX9A 5AQKB 4OYJA 2MBGA 4EQWA 5BUKA 2A3DA 3PUGA 1IUSA 4U8IA 3ALMA 1PBBA 4DR6T 2RS54 4CY6A 2WWUA 4CI2B 2BRYA 3NT6A 2XSBA 2KNDA 1F8RA 4QH5A 3F31A 4UDRA 4C90A 4F8HA 3AYLA 4ILBA 1JOAA 4FI5A 2PYXA 2W62A 4TNWA 1W9RA 2VQFT 2OAMA 1N33T 3AD9B 3L3PA 2Q9QD 2GF3A 4O4HE 2V61A 1HRI4 2CPTA 5DQWA 5DJQC 2V3AA 5J7XA 1OJ9A 5FS7A 4ASKA 1N4UA 3Q9TA 5LHIB 2CHNA 5U25A 5KOWA 2YVGA 3PU3A 1BGJA 1UURA 2XLUA 4LF5T 1NWMX 5JDGA 3AYJA 3UKFA 2ZBWA 1N36T 3VRDB 3H4KA 3FPZA 2WM9A 3CNPA 3LJPA 2RMU4 2K5BB 1JEHA 2OV9A 2YAUA 1PJ7A 2EQ6A 3GD3A 2X8GA 2FJBA 4KUMB 5LG3A 2BDEA 1DXLA 5LYJE 2NOXA 2XUEA 3QC9A 4IA6A 4KHZF 2IC6A 4H4PA 4JEUB 1MMGA 3UTHA 2C3CA 2VVLA 5JR9C 3ZMVB 4UF0A 5M4YA 2KLQA
chains in the Genus database with same CATH topology
3NK0X 3T14A 3ALJA 3QSEA 3S61A 1TDNA 2QA1A 1LVLA 1DOEA 2YLXA 3SQPA 3M12A 2WS3A 2GQWA 4CY8A 1MOKA 4X4JA 3KLJA 2BABA 3GWFA 1L9EA 1YKJA 2GV8A 5KNLA 2XVJA 3ZDNA 1M64A 3ABVA 5JCLA 4B68A 3F8DA 1CF3A 4ICYA 4C77A 4NTCA 4I58A 4K5SA 3KPFA 3DK8A 4J2WA 5BRTA 3NG7X 4CNJA 1GALA 2ZZCA 3HYVA 2WBAA 1TYTA 2GAHB 5IPYA 3PS9A 4X9NA 5KMRA 3K7TA 3DJEA 1NHSA 4ZCCA 4II2A 3SZ0A 4LIIA 3T2ZA 2QA2A 2R4EA 2ZZ0A 2X3NA 4U8NA 1ELIA 1GERA 3EPTA 1K0IA 4LA1A 4O5UA 4H7UA 4TM3A 1H84A 2V5ZA 3CNJA 3AEDA 4U2SA 5KRQA 4TLZA 3SGLA 1KDGA 1K0JA 2EQ8A 2Q6UA 2XVIA 4H4XA 4II3A 1GXFA 4GRTA 1FECA 4DSGA 3DJDA 1F8SA 3OZ2A 4H4VA 3NK1X 4P9SA 3GRSA 2JB2A 4FDCB 5DBJA 3UOVA 1P2EA 2VQBA 2WHDA 3ZYXA 3UOYA 3CIRA 3R9UA 1CHUA 2R4JA 1JNZA 3GQKA 2RGOA 4H4UA 4FX9A 1GSNA 5IQ4A 2BXSA 3SZWA 2RGJA 4H50A 2WDVA 3K7QX 4JY2A 2JAEA 2AQJA 5HY5A 3M13A 2FJDA 1CC6A 3FBSA 3UKQA 2BCGG 2HQMA 2WPCA 2YR6A 3LZXA 3C4AA 3ISHA 4JY3A 1FEAA 5KVHA 3BI4A 1KF6A 3AD7B 4AP1A 2VVLG 3UCLA 2WESA 1HYUA 1LTXR 2X8CA 4YT0A 1E39A 4K8DA 1ZY8A 2BC1A 4IVOB 4J57A 4JNQA 4CNKA 3SUCA 4GAVA 3NN0X 1LJ1A 3NTAA 4JN9A 2BXRA 2WPEA 3IHGA 2C64A 4G74A 2BYBA 4X9MA 3CGDA 2EQ7A 3AE4A 1D7YA 3EAOA 3VQRA 2XLRA 3ITJA 4CCRA 1BWCA 5EB5A 3BHFA 3Q6JA 2YM2A 1NAAA 3VR9A 1VG9A 1IUTA 2XVFA 2YG6A 2V3BA 2VVMA 3RHAA 5FS9A 1D5TA 1BKWA 2Q0LA 1KNPA 5BULA 3FMWA 2ZZBA 4HB9A 1PBDA 2OLNA 2R0PA 4OPIA 3ALLA 2WP9A 3NHOX 1D4CA 3AE2A 2GR3A 2CFYA 4XWZA 2E1MA 3AB1A 4GCMA 4RG3A 2BK3A 1PBEA 3COXA 4Z24A 1PXAA 2XVHA 1REOA 1JRZA 2IVEA 3LADA 3AXBA 3UKPA 2LFCA 4E0VA 1H81A 3T0KA 2C4CA 3CPJG 3H8IA 2BS4A 4J56A 1F6MA 4EMWA 4XWRA 1JRYA 2JKCA 4B63A 1OJAA 1VRQB 1B37A 2XVEA 4GDPA 1YQZA 1JRXA 2DKHA 3KKJA 1PBCA 3K30A 4EM4A 2GQFA 1GRGA 2B9YA 2TPRA 2X99A 1E1LA 4U2LA 1KFYA 3UP4A 3L1RA 3AE5A 2GVCA 1NHQA 4B65A 4A7AA 4EMIA 1FL2A 1COYA 3UTFA 2GAGB 3ATQA 5EB4A 5C2TA 2RGHA 3CNDA 3ADAB 2YLWA 2XCGA 3T31A 3CTYA 2WP6A 3BI5A 2C67A 1K0LA 2YVJA 4OPCA 2JK6A 4TLXA 2WOVA 4Y4LA 4G6HA 5J60A 4U2TA 1ZP0A 4B1BA 2XLSA 3UOZA 3C96A 5JCKA 1MO9A 4REKA 1S2YA 4WCTA 1H6VA 2WEUA 4UDQA 3SZFA 1H82A 3DK9A 2ARDA 3KA7A 2TMDA 3NNEA 4D04A 1F3PA 2R0GA 4EIPA 4H4SA 2R0CA 4NEWA 5EOWA 1Y56B 4RSLA 1NHPA 1Y56A 1FCDA 1LPFA 3L8KA 4CCQA 1Q1WA 1D7LA 4OPTA 3CGCA 3NTDA 4H2PA 2C73A 2FBWA 3DMEA 3ICRA 1E7PA 5M0ZA 1DNCA 1PDHA 3VRBA 2VQ7A 2WOWA 4H4QA 4PAAA 4BK1A 4AOSA 1PHHA 2QAEA 2EQ9A 2WOIA 3UOXA 1EBDA 3JSKA 3QVRA 1O94A 3D8XA 5U63A 2ACZA 3AD8B 2IIDA 2IVDA 1GOSA 2B7SA 4Y4NA 4J34A 1YQ4A 3CPIG 1TDOA 2BS2A 4YSHA 3AE7A 1IUXA 3P4RA 4B66A 2YLZA 1B4VA 1GETA 2YG7A 3KD9A 4J33A 4U8LA 2FJAA 4NEVA 1GRFA 1CJCA 2WU2A 2YWLA 3K7MX 3G5SA 1CC2A 1D4EA 4H4WA 2J3NA 2A89A 2BA9A 2XFOA 2XLPA 3SX6A 5JCIA 4U8JA 3E1TA 1AOGA 2WPFA 1TDFA 2GR0A 1EL5A 1DOCA 1TRBA 3KPKA 1L9CA 4A65A 3IC9A 1K4QA 4TM0A 3AECA 1UKVG 3HZLA 5JCNA 4J36A 2GMJA 1GT8A 3SZCA 5EBKA 1ZOYA 4K7ZA 4NTEA 1BF3A 2CDUA 4H2QA 4A6NB 3CNTA 4K22A 4A6NA 2V60A 4C5OA 1ZOVA 2XLTA 3P4PA 1MXTA 2AR8A 2O9ZA 3S5WA 2BK5A 1Q9IA 3PO7A 2B9WA 4YTPA 4H4YA 3SXIA 4BK3A 2DKIA 2I0ZA 4CRTA 2F5ZA 1KNRA 1B5QA 2VRMA 1FOHA 1BGNA 4YSYA 3EANA 3GRTA 3SYIA 2BRAA 1O95A 3H8LA 2QCUA 4H2NA 3NYEA 1PS9A 4O5QA 4BJYA 4TM4A 3BHKA 3DJGX 1FEBA 1PN0A 3AEAA 1E1KA 1JU2A 2CVJA 3P1WA 4A5LA 1IUUA 1RYIA 1NHRA 3D1CA 1EL8A 2R9ZA 2YLTA 4Y4MA 5U1OA 3CGEA 3B3RA 4Z25A 1Y0PA 2C72A 1XPQA 1GTEA 1GNDA 3ICTA 3NYFA 3NLCA 4YSZA 1VG0A 3AYIA 3GQHA 4C74A 4U8MA 4B67A 1DJNA 4FK1A 3BNUA 1TDEA 4Z2UA 2UZZA 3REDA 2YM1A 3O0HA 3T2YA 2Q0KA 4NWZA 4JQ9A 1IJHA 1B8SA 1GRHA 4APNA 4GR1A 4C3YA 1ZMDA 4ZN0A 1ZMCA 1N4WA 2C70A 4EM3A 1PXBA 1EL7A 1ZKQA 4YKFA 1PXCA 3PVCA 3I6DA 2A87A 3NYCA 2CULA 3CNSA 1QLBA 4GUVA 3UTEA 1DOBA 3II4A 2Q7VA 3P4QA 5HHFA 1H7XA 1O5WA 3AE8A 2VRLA 2JBVA 3LXDA 2XYOA 1GV4A 1NG4A 2R45A 4YKGA 3NH3X 3KU9A 3QVPA 5CKUA 2BC0A 1KSSA 2C3DA 1LQTA 3CPHG 3F8RA 3OC4A 3V3NA 3GYIA 2VOUA 3UTGA 3AE3A 1Q1RA 3CGBA 1TYPA 4D03A 1E1MA 2C76A 5HXIA 1CJ4A 1NDAA 3VRAA 3LB8A 1DODA 4G73A 4JDRA 2V6OA 1D4DA 3I3LA 4OPUA 5FS8A 4A9WA 4IA5A 4U8KA 4H4RA 3AEGA 4H4ZA 2Y6QA 5TR3A 1S3EA 3F8PA 3AEEA 1GRTA 1LQUA 1OJDA 3M0OA 3ATRA 4NNJA 1QJDA 3AE6A 1CBOA 2C65A 4XXGA 4YWOA 2XFQA 3V3OA 1IUWA 2BCPA 5FS6A 4ZCDA 2C75A 3GSIA 4DNAA 4FK1C 2H88A 1QO8A 3UKLA 4EIQA 4KX6A 2JB1A 1ZDLA 5LV9A 3QSMA 3T2KA 4Z2RA 2RABA 2OLOA 3GMCA 2WQYA 3AEFA 4OVIA 4U8PA 3UKHA 3RNMA 4BV6A 2Z5XA 2XDOA 4YXDA 4DSHA 2Z5YA 4C3XA 2WDQA 4BURA 4EQRA 3QFAA 5KMQA 1M6IA 2GEWA 3CN8A 1V59A 1W4XA 1CL0A 5C3JA 3LOVA 4TM1A 2GR1A 1E6EA 1E1NA 1Z6LA 1NEKA 4G9KA 4GAPA 2YLRA 4ECHA 1CJ3A 1OJCA 4PABA 1JNRA 5KMPA 1GEUA 3AE1A 3BNMA 4EQXA 2X50A 3DGZA 4IVMB 3IHMA 5CQFA 3C4NA 1KSUA 3UP5A 3NIXA 2GB0A 4J31A 2R46A 3DK4A 3GYXA 1YQ3A 4K2XA 2B7RA 4AT2A 3CMMA 3GMBA 2GH5A 3AEBA 3SY4A 4A99A 3GYJA 3HYWA 4H2RA 5KXJA 4YTMA 3EF6A 2E4GA 1VQWA 2XFPA 3GWDA 4LU6A 1GESA 4N9XA 4Z2TA 1N1PA 4EQSA 1PJ6A 3RP6A 3T37A 5L46A 2APGA 1N4VA 3GD4A 3ICSA 1GRBA 1F8WA 1S2QA 2VZ2A 2JB3A 1DJQA 2BK4A 4YTNA 3V76A 2YR5A 4Z43A 3FIMB 2H89A 3DH9A 4NZHA 2X8HA 3NK2X 4JNAA 3RP7A 3QFBA 4OPLA 3DA1A 3IF9A 2GR2A 2GRTA 1P2HA 2WDRA 1XANA 4GDEA 1LV0A 4U8OA 4EMJA 3GDNA 5IQ1A 1H7WA 1X31B 3G5QA 4BJZA 2YG3A 4M52A 3RP8A 1BZLA 1ZX9A 2GMHA 1VDCA 4EQWA 5BUKA 2YQUA 4G6GA 4USQA 4NTDA 3SFDA 1RSGA 3KVEA 1IUSA 3SFEA 4U8IA 4OPGA 1CC4A 3IWAA 3ALMA 1PBBA 1ZK7A 1L0VA 1YY5A 1NG3A 3QSSA 2OALA 2AAQA 3NN6X 1L9DA 3B6DA 4I59A 2BRYA 3DJJA 4IV9A 4CBQA 3NT6A 4CY6A 1NPXA 5FMHA 2YLSA 5GRTA 2E5VA 1GTHA 1F8RA 2WU5A 5KWFA 2NPXA 2YVFA 4UDRA 5HYMA 2XFNA 5KMSA 3AYLA 3AE9A 2B76A 1OJTA 3UKKA 4UDPA 3GDPA 1JOAA 2YG5A 1TDKA 4MJWA 2PYXA 3QJ4A 1S3BA 3DGHA 1PJ5A 4A79A 1CJ2A 1GPEA 2OAMA 2YG4A 4KPRA 2A8XA 2FJEA 1IUVA 2YR4A 3AD9B 1GREA 4AT0A 4AP3A 5M10A 3BI2A 4B69A 2GF3A 4BK2A 4HA6A 2V61A 3G5RA 2B9XA 1PBFA 3NKSA 2V3AA 5J7XA 1OJ9A 5FS7A 2PHHA 3NGCX 3HYXA 1H86A 1N4UA 5KVIA 3Q9TA 4H4TA 5BVAA 4OPDA 4Z44A 5U25A 4OCGA 4ADWA 5KOWA 2YVGA 4GF7A 4AOXA 4YSXA 1BGJA 2XLUA 3NRNA 4WX1A 3WE0A 3LZWA 2WP5A 2W0HA 1NENA 3FG2P 3AWIA 3URHA 3UKFA 3AYJA 4UP3A 2ZBWA 3VRDB 4Z26A 2C7GA 3H4KA 1H83A 2WETA 3FPZA 3SM8A 4B64A 3CNPA 3LJPA 4USRA 2BS3A 1XHCA 2XFUA 2C66A 1JEHA 2YAUA 1EL9A 1PJ7A 2EQ6A 3UKAA 1SEZA 3GD3A 5JCMA 2OA1A 3P9UA 3VR8A 2BACA 2X8GA 1RP0A 2FJBA 3P4SA 1DXLA 4IA6A 4RG4A 2NVKX 4H4PA 3UTHA 4K5RA 1GRAA 2Y6RA 5GSNA 2C3CA 2VVLA 5ER0A 1ONFA 5KOXA 1XDIA 4DGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK0 X;  3ALJ A;  3QSE A;  3S61 A;  1TDN A;  2QA1 A;  1LVL A;  1DOE A;  2YLX A;  3SQP A;  3M12 A;  2WS3 A;  2GQW A;  4CY8 A;  1MOK A;  4X4J A;  3KLJ A;  2BAB A;  3GWF A;  1L9E A;  1YKJ A;  2GV8 A;  2XVJ A;  3ZDN A;  1M64 A;  3ABV A;  5JCL A;  4B68 A;  3F8D A;  1CF3 A;  4ICY A;  4C77 A;  4NTC A;  4I58 A;  4K5S A;  3KPF A;  3DK8 A;  4J2W A;  5BRT A;  3NG7 X;  4CNJ A;  1GAL A;  2ZZC A;  2WBA A;  1TYT A;  2GAH B;  5IPY A;  3PS9 A;  4X9N A;  3K7T A;  3DJE A;  1NHS A;  4ZCC A;  4LII A;  2QA2 A;  2R4E A;  2ZZ0 A;  2X3N A;  4U8N A;  1ELI A;  1GER A;  3EPT A;  1K0I A;  4LA1 A;  4O5U A;  4H7U A;  4TM3 A;  1H84 A;  2V5Z A;  3CNJ A;  3AED A;  4U2S A;  5KRQ A;  4TLZ A;  3SGL A;  1KDG A;  1K0J A;  2EQ8 A;  2Q6U A;  2XVI A;  4H4X A;  1GXF A;  4GRT A;  1FEC A;  4DSG A;  3DJD A;  1F8S A;  3OZ2 A;  4H4V A;  3NK1 X;  4P9S A;  3GRS A;  2JB2 A;  4FDC B;  5DBJ A;  3UOV A;  1P2E A;  2VQB A;  2WHD A;  3ZYX A;  3UOY A;  3CIR A;  3R9U A;  1CHU A;  2R4J A;  1JNZ A;  3GQK A;  2RGO A;  4H4U A;  4FX9 A;  1GSN A;  5IQ4 A;  2BXS A;  2RGJ A;  4H50 A;  2WDV A;  3K7Q X;  4JY2 A;  2JAE A;  2AQJ A;  5HY5 A;  3M13 A;  2FJD A;  1CC6 A;  3FBS A;  3UKQ A;  2BCG G;  2HQM A;  2WPC A;  2YR6 A;  3LZX A;  3C4A A;  3ISH A;  4JY3 A;  1FEA A;  5KVH A;  3BI4 A;  1KF6 A;  3AD7 B;  4AP1 A;  2VVL G;  3UCL A;  2WES A;  1HYU A;  1LTX R;  2X8C A;  4YT0 A;  1E39 A;  4K8D A;  1ZY8 A;  2BC1 A;  4IVO B;  4J57 A;  4JNQ A;  4CNK A;  3SUC A;  3NN0 X;  1LJ1 A;  3NTA A;  4JN9 A;  2BXR A;  2WPE A;  3IHG A;  2C64 A;  2BYB A;  4X9M A;  3CGD A;  2EQ7 A;  3AE4 A;  1D7Y A;  3EAO A;  3VQR A;  2XLR A;  3ITJ A;  4CCR A;  1BWC A;  5EB5 A;  3BHF A;  3Q6J A;  2YM2 A;  1NAA A;  3VR9 A;  1VG9 A;  1IUT A;  2XVF A;  2YG6 A;  2V3B A;  2VVM A;  3RHA A;  5FS9 A;  1D5T A;  1BKW A;  2Q0L A;  1KNP A;  5BUL A;  3FMW A;  2ZZB A;  4HB9 A;  1PBD A;  2OLN A;  2R0P A;  4OPI A;  3ALL A;  2WP9 A;  3NHO X;  1D4C A;  3AE2 A;  2GR3 A;  2CFY A;  4XWZ A;  2E1M A;  3AB1 A;  4GCM A;  4RG3 A;  2BK3 A;  1PBE A;  3COX A;  4Z24 A;  1PXA A;  2XVH A;  1REO A;  1JRZ A;  2IVE A;  3LAD A;  3AXB A;  3UKP A;  2LFC A;  4E0V A;  1H81 A;  3CPJ G;  3H8I A;  2BS4 A;  4J56 A;  1F6M A;  4EMW A;  4XWR A;  1JRY A;  2JKC A;  4B63 A;  1OJA A;  1VRQ B;  1B37 A;  2XVE A;  4GDP A;  1YQZ A;  1JRX A;  2DKH A;  3KKJ A;  1PBC A;  3K30 A;  4EM4 A;  2GQF A;  1GRG A;  2B9Y A;  2TPR A;  2X99 A;  1E1L A;  4U2L A;  1KFY A;  3UP4 A;  3L1R A;  3AE5 A;  2GVC A;  1NHQ A;  4B65 A;  4A7A A;  4EMI A;  1FL2 A;  1COY A;  3UTF A;  2GAG B;  3ATQ A;  5EB4 A;  5C2T A;  2RGH A;  3CND A;  3ADA B;  2YLW A;  2XCG A;  3CTY A;  2WP6 A;  3BI5 A;  2C67 A;  1K0L A;  2YVJ A;  4OPC A;  2JK6 A;  4TLX A;  2WOV A;  4Y4L A;  5J60 A;  4U2T A;  1ZP0 A;  4B1B A;  2XLS A;  3UOZ A;  3C96 A;  5JCK A;  1MO9 A;  4REK A;  1S2Y A;  4WCT A;  1H6V A;  2WEU A;  4UDQ A;  1H82 A;  3DK9 A;  2ARD A;  3KA7 A;  2TMD A;  3NNE A;  4D04 A;  1F3P A;  2R0G A;  4EIP A;  4H4S A;  2R0C A;  4NEW A;  5EOW A;  1Y56 B;  4RSL A;  1NHP A;  1Y56 A;  1FCD A;  1LPF A;  3L8K A;  4CCQ A;  1Q1W A;  1D7L A;  4OPT A;  3CGC A;  3NTD A;  4H2P A;  2C73 A;  2FBW A;  3DME A;  3ICR A;  1E7P A;  5M0Z A;  1DNC A;  1PDH A;  3VRB A;  2VQ7 A;  2WOW A;  4H4Q A;  4PAA A;  4BK1 A;  4AOS A;  1PHH A;  2QAE A;  2EQ9 A;  2WOI A;  3UOX A;  1EBD A;  3JSK A;  3QVR A;  1O94 A;  3D8X A;  5U63 A;  2ACZ A;  3AD8 B;  2IID A;  2IVD A;  1GOS A;  2B7S A;  4Y4N A;  4J34 A;  1YQ4 A;  3CPI G;  1TDO A;  2BS2 A;  4YSH A;  3AE7 A;  1IUX A;  3P4R A;  4B66 A;  2YLZ A;  1B4V A;  1GET A;  2YG7 A;  3KD9 A;  4J33 A;  4U8L A;  2FJA A;  4NEV A;  1GRF A;  1CJC A;  2WU2 A;  2YWL A;  3K7M X;  3G5S A;  1CC2 A;  1D4E A;  4H4W A;  2J3N A;  2A89 A;  2BA9 A;  2XFO A;  2XLP A;  5JCI A;  4U8J A;  3E1T A;  1AOG A;  2WPF A;  1TDF A;  2GR0 A;  1EL5 A;  1DOC A;  1TRB A;  1L9C A;  4A65 A;  3IC9 A;  1K4Q A;  4TM0 A;  3AEC A;  1UKV G;  3HZL A;  5JCN A;  4J36 A;  2GMJ A;  1GT8 A;  5EBK A;  1ZOY A;  4K7Z A;  4NTE A;  1BF3 A;  2CDU A;  4H2Q A;  4A6N B;  3CNT A;  4K22 A;  4A6N A;  2V60 A;  4C5O A;  1ZOV A;  2XLT A;  3P4P A;  1MXT A;  2AR8 A;  2O9Z A;  3S5W A;  2BK5 A;  1Q9I A;  3PO7 A;  2B9W A;  4YTP A;  4H4Y A;  4BK3 A;  2DKI A;  2I0Z A;  4CRT A;  2F5Z A;  1KNR A;  1B5Q A;  2VRM A;  1FOH A;  1BGN A;  4YSY A;  3EAN A;  3GRT A;  1O95 A;  3H8L A;  2QCU A;  4H2N A;  3NYE A;  1PS9 A;  4O5Q A;  4BJY A;  4TM4 A;  3BHK A;  3DJG X;  1FEB A;  1PN0 A;  3AEA A;  1E1K A;  1JU2 A;  2CVJ A;  3P1W A;  4A5L A;  1IUU A;  1RYI A;  1NHR A;  3D1C A;  1EL8 A;  2R9Z A;  2YLT A;  4Y4M A;  5U1O A;  3CGE A;  3B3R A;  4Z25 A;  1Y0P A;  2C72 A;  1XPQ A;  1GTE A;  1GND A;  3ICT A;  3NYF A;  3NLC A;  4YSZ A;  1VG0 A;  3AYI A;  3GQH A;  4C74 A;  4U8M A;  4B67 A;  1DJN A;  4FK1 A;  3BNU A;  1TDE A;  4Z2U A;  2UZZ A;  3RED A;  2YM1 A;  3O0H A;  2Q0K A;  4JQ9 A;  1IJH A;  1B8S A;  1GRH A;  4APN A;  4GR1 A;  4C3Y A;  1ZMD A;  4ZN0 A;  1ZMC A;  1N4W A;  2C70 A;  4EM3 A;  1PXB A;  1EL7 A;  1ZKQ A;  4YKF A;  1PXC A;  3PVC A;  3I6D A;  2A87 A;  3NYC A;  2CUL A;  3CNS A;  1QLB A;  4GUV A;  3UTE A;  1DOB A;  3II4 A;  2Q7V A;  3P4Q A;  5HHF A;  1H7X A;  1O5W A;  3AE8 A;  2VRL A;  2JBV A;  3LXD A;  2XYO A;  1GV4 A;  1NG4 A;  2R45 A;  4YKG A;  3NH3 X;  3KU9 A;  3QVP A;  5CKU A;  2BC0 A;  1KSS A;  2C3D A;  1LQT A;  3CPH G;  3F8R A;  3OC4 A;  3V3N A;  3GYI A;  2VOU A;  3UTG A;  3AE3 A;  1Q1R A;  3CGB A;  1TYP A;  4D03 A;  1E1M A;  2C76 A;  5HXI A;  1CJ4 A;  1NDA A;  3VRA A;  3LB8 A;  1DOD A;  4JDR A;  2V6O A;  1D4D A;  3I3L A;  4OPU A;  5FS8 A;  4A9W A;  4IA5 A;  4U8K A;  4H4R A;  3AEG A;  4H4Z A;  2Y6Q A;  5TR3 A;  1S3E A;  3F8P A;  3AEE A;  1GRT A;  1LQU A;  1OJD A;  3M0O A;  3ATR A;  1QJD A;  3AE6 A;  1CBO A;  2C65 A;  4XXG A;  4YWO A;  2XFQ A;  3V3O A;  1IUW A;  2BCP A;  5FS6 A;  4ZCD A;  2C75 A;  3GSI A;  4DNA A;  4FK1 C;  2H88 A;  1QO8 A;  3UKL A;  4EIQ A;  4KX6 A;  2JB1 A;  1ZDL A;  5LV9 A;  3QSM A;  4Z2R A;  2RAB A;  2OLO A;  3GMC A;  2WQY A;  3AEF A;  4OVI A;  4U8P A;  3UKH A;  3RNM A;  4BV6 A;  2Z5X A;  2XDO A;  4YXD A;  4DSH A;  2Z5Y A;  4C3X A;  2WDQ A;  4BUR A;  4EQR A;  3QFA A;  1M6I A;  2GEW A;  3CN8 A;  1V59 A;  1W4X A;  1CL0 A;  5C3J A;  3LOV A;  4TM1 A;  2GR1 A;  1E6E A;  1E1N A;  1Z6L A;  1NEK A;  2YLR A;  4ECH A;  1CJ3 A;  1OJC A;  4PAB A;  1JNR A;  1GEU A;  3AE1 A;  3BNM A;  4EQX A;  2X50 A;  3DGZ A;  4IVM B;  3IHM A;  5CQF A;  3C4N A;  1KSU A;  3UP5 A;  3NIX A;  2GB0 A;  4J31 A;  2R46 A;  3DK4 A;  3GYX A;  1YQ3 A;  4K2X A;  2B7R A;  4AT2 A;  3GMB A;  2GH5 A;  3AEB A;  4A99 A;  3GYJ A;  4H2R A;  5KXJ A;  4YTM A;  3EF6 A;  2E4G A;  1VQW A;  2XFP A;  3GWD A;  4LU6 A;  1GES A;  4N9X A;  4Z2T A;  1N1P A;  4EQS A;  1PJ6 A;  3RP6 A;  3T37 A;  5L46 A;  2APG A;  1N4V A;  3GD4 A;  3ICS A;  1GRB A;  1F8W A;  1S2Q A;  2VZ2 A;  2JB3 A;  1DJQ A;  2BK4 A;  4YTN A;  3V76 A;  2YR5 A;  4Z43 A;  3FIM B;  2H89 A;  3DH9 A;  4NZH A;  2X8H A;  3NK2 X;  4JNA A;  3RP7 A;  3QFB A;  4OPL A;  3DA1 A;  3IF9 A;  2GR2 A;  2GRT A;  1P2H A;  2WDR A;  1XAN A;  4GDE A;  1LV0 A;  4U8O A;  4EMJ A;  3GDN A;  5IQ1 A;  1H7W A;  1X31 B;  3G5Q A;  4BJZ A;  2YG3 A;  4M52 A;  3RP8 A;  1BZL A;  1ZX9 A;  2GMH A;  1VDC A;  4EQW A;  5BUK A;  2YQU A;  4USQ A;  4NTD A;  3SFD A;  1RSG A;  3KVE A;  1IUS A;  3SFE A;  4U8I A;  4OPG A;  1CC4 A;  3IWA A;  3ALM A;  1PBB A;  1ZK7 A;  1L0V A;  1YY5 A;  1NG3 A;  3QSS A;  2OAL A;  2AAQ A;  3NN6 X;  1L9D A;  3B6D A;  4I59 A;  4IV9 A;  3DJJ A;  4CBQ A;  4CY6 A;  3NT6 A;  1NPX A;  5FMH A;  2YLS A;  5GRT A;  2E5V A;  1GTH A;  1F8R A;  2WU5 A;  5KWF A;  2NPX A;  2YVF A;  4UDR A;  5HYM A;  2XFN A;  3AYL A;  3AE9 A;  2B76 A;  1OJT A;  3UKK A;  4UDP A;  3GDP A;  1JOA A;  2YG5 A;  1TDK A;  4MJW A;  2PYX A;  3QJ4 A;  1S3B A;  3DGH A;  1PJ5 A;  4A79 A;  1CJ2 A;  1GPE A;  2OAM A;  2YG4 A;  4KPR A;  2A8X A;  2FJE A;  1IUV A;  2YR4 A;  3AD9 B;  1GRE A;  4AT0 A;  4AP3 A;  5M10 A;  3BI2 A;  4B69 A;  2GF3 A;  4BK2 A;  4HA6 A;  2V61 A;  3G5R A;  2B9X A;  1PBF A;  3NKS A;  2V3A A;  5J7X A;  1OJ9 A;  5FS7 A;  2PHH A;  3NGC X;  1H86 A;  1N4U A;  5KVI A;  3Q9T A;  4H4T A;  5BVA A;  4OPD A;  4Z44 A;  5U25 A;  4OCG A;  4ADW A;  5KOW A;  2YVG A;  4GF7 A;  4AOX A;  4YSX A;  1BGJ A;  2XLU A;  3NRN A;  4WX1 A;  3WE0 A;  3LZW A;  2WP5 A;  2W0H A;  1NEN A;  3FG2 P;  3AWI A;  3URH A;  3UKF A;  3AYJ A;  4UP3 A;  2ZBW A;  3VRD B;  4Z26 A;  2C7G A;  3H4K A;  1H83 A;  2WET A;  3FPZ A;  3SM8 A;  4B64 A;  3CNP A;  3LJP A;  4USR A;  2BS3 A;  1XHC A;  2XFU A;  2C66 A;  1JEH A;  2YAU A;  1EL9 A;  1PJ7 A;  2EQ6 A;  3UKA A;  1SEZ A;  3GD3 A;  5JCM A;  2OA1 A;  3P9U A;  3VR8 A;  2BAC A;  2X8G A;  1RP0 A;  2FJB A;  3P4S A;  1DXL A;  4IA6 A;  4RG4 A;  2NVK X;  4H4P A;  3UTH A;  4K5R A;  1GRA A;  2Y6R A;  5GSN A;  2C3C A;  2VVL A;  5ER0 A;  1ONF A;  5KOX A;  1XDI A;  4DGK A; 
#chains in the Genus database with same CATH topology
 3Q5W A;  4MFR A;  3T14 A;  3ALJ A;  3ZCJ A;  1HCI A;  2YLX A;  4MLK A;  2GQW A;  4BAY B;  4IL9 A;  3PUS A;  1M64 A;  5HXE A;  2MPK A;  4O4L E;  2UUB T;  2W61 A;  4ICY A;  3HA4 A;  1FMW A;  3RQU A;  5FY1 A;  1WLX A;  4HN9 A;  4CNJ A;  1GAL A;  4L5G A;  5F3J A;  2ZZC A;  1RUF 4;  4GK0 E;  4DV6 T;  2NTY A;  3OVU A;  3SZ0 A;  4LII A;  2BVM A;  1UK5 A;  2ZZ0 A;  5LCY A;  4LA1 A;  3NWI A;  2YIN A;  4H7U A;  3EUH A;  3HKB E;  3AED A;  2UUA T;  4EYY R;  2HWB 4;  5JVD E;  2EQ8 A;  2XVI A;  4XZC A;  4PFP A;  4DV4 T;  5AQS B;  4H4V A;  2MOZ A;  3RHW A;  3GRS A;  2JB2 A;  2WCA A;  4XAX B;  4FDC B;  5DBJ A;  3UOV A;  3UUN A;  3CIR A;  3R9U A;  2R4J A;  5EK4 A;  1GSN A;  5IQ4 A;  2WDV A;  4JI0 T;  4JY2 A;  2FJD A;  1CC6 A;  3UKQ A;  2HQM A;  2C0S A;  1FIO A;  3ISH A;  4DV0 T;  1KF6 A;  4AP1 A;  1J5E T;  2WES A;  2WMN A;  4K8D A;  2BC1 A;  5CFB A;  2W4X A;  2CRB A;  4EAH A;  1RMU 4;  3NN0 X;  3NTA A;  3QUJ A;  2WPE A;  4JLE A;  3ZMS B;  1UGO A;  4ZZC A;  3CGD A;  1HX8 A;  4K0K T;  1D7Y A;  4HWH A;  2MTQ A;  3K1S A;  4ZI7 E;  3Q6J A;  5EB5 A;  2YM2 A;  1IAP A;  3TKL B;  2VVM A;  3PUV F;  4H9R C;  4QXH B;  3ONJ A;  4PJJ A;  1XHX A;  2NW7 A;  3C64 A;  3NKZ A;  5FYM A;  4IT4 A;  3ALL A;  5IHY A;  4UVA B;  1D4C A;  5L3G B;  2E1M A;  3Q5D A;  4RG3 A;  1PXA A;  2IVE A;  3LAD A;  2K48 A;  4U2Y A;  3PDY A;  2C4C A;  3H8I A;  5L3D B;  2BS4 A;  1H8T D;  2JKC A;  2I6H A;  4JYA T;  3ANW B;  2CA5 A;  1PBC A;  3FXE B;  3RLF F;  2TPR A;  1H7C A;  3LFM A;  2KIN B;  3L1R A;  1R08 4;  3AE5 A;  4UR9 A;  2GVC A;  1NHQ A;  2WZH A;  4EMI A;  1FL2 A;  5CA0 E;  2GAG B;  3C50 A;  3NBX X;  1M62 A;  1E2A A;  2RPA A;  3AAI A;  2XCG A;  4U7I A;  5ABG A;  2HH7 A;  4TLX A;  3TLT A;  2BBH A;  3T8O A;  5AQV B;  4YFS A;  1WR6 A;  2LRL A;  2IW5 B;  2XAH B;  1ZP0 A;  4PJM A;  2E9X A;  3OTO T;  3PUW F;  1MO9 A;  4TUY E;  5LJN A;  3CX6 B;  4REK A;  4WCT A;  4UDQ A;  2DWK A;  4H63 V;  1IJ5 A;  4LF9 T;  5JRC B;  2WB5 A;  3UFE A;  3F57 A;  3UU6 A;  2TMD A;  1F3P A;  1SHZ C;  1FCD A;  3MKD A;  3ZLI A;  4OPT A;  4H2P A;  2CLY B;  5M0Z A;  5LMN T;  3UUL A;  1DNC A;  1PDH A;  4JI8 T;  5FMN A;  3VRB A;  2WOW A;  4PAA A;  3AB3 B;  3AVS A;  5LGT B;  2WOI A;  1J5W A;  1S35 A;  2Z6E A;  3K3Q C;  3ZKR A;  1HG5 A;  2IID A;  5CGM A;  1MMD A;  4DV2 T;  5FXX A;  2J62 A;  1TDO A;  2LSK A;  2Y8D A;  4F6R C;  3UU4 A;  2YLZ A;  4IHJ E;  2W67 A;  5JH7 E;  2ES0 A;  4MHC A;  1WFD A;  1CJC A;  3EDU A;  3K7M X;  5CB4 E;  1I6Z A;  4H4W A;  2XLP A;  2XFO A;  4U8J A;  4U31 A;  3ZN1 B;  1T98 A;  1RUH 4;  1GQE A;  2K24 A;  5L3F B;  1XI1 A;  2CEA A;  3PUY F;  3L09 A;  5EBK A;  1BF3 A;  2CDU A;  4TZ4 C;  5A1L A;  1D1C A;  2AR8 A;  2O9Z A;  4ZOL E;  4YTP A;  5ABF A;  2Q9Q C;  5ABE A;  2I0Z A;  4CRT A;  2X9X A;  1KNR A;  1BGN A;  2H3R A;  4YSY A;  4AQY T;  3GRT A;  3W15 B;  1O95 A;  4HFB A;  4DV7 T;  4CI1 B;  1JU2 A;  2CVJ A;  4G2A A;  3V5U A;  3D1C A;  1NHR A;  2XQY A;  1XMQ T;  1Y0P A;  2C72 A;  1GTE A;  4PJN A;  1GND A;  2N1G A;  3NYF A;  3PUX F;  3NLC A;  4YSZ A;  1FJG T;  4C74 A;  1B7T A;  3DTO A;  3O0H A;  4LMK A;  3JD7 4;  3CQC B;  3L8R A;  2VVN A;  3O9X A;  1W09 A;  1IJ6 A;  2VKH A;  1N4W A;  4EM3 A;  3PVC A;  1NAF A;  3I6D A;  5IWA T;  3NYC A;  3CNS A;  4GUV A;  4AI6 A;  3P4Q A;  5HHF A;  3AA7 B;  3J7Y q;  2PG8 A;  3LXD A;  1NG4 A;  4V1A v;  2R45 A;  2BC0 A;  1KSS A;  1DOD A;  4QX7 B;  3I3L A;  4A9W A;  1UX5 A;  4H4Z A;  4OYK A;  5J2U E;  1S3E A;  1BR2 A;  3AEE A;  4QKN A;  3M0O A;  5FKY A;  2D0U A;  4A97 A;  5AQN B;  3AE6 A;  2EHO A;  2BCP A;  1OED A;  4ZCD A;  4JBW F;  3FZF B;  3UKL A;  4EIQ A;  3K3O A;  4KX6 A;  2JB1 A;  2V8S V;  1ZDL A;  5LV9 A;  4UF0 B;  4HEA A;  3RIU C;  2WQY A;  3O1J A;  4OVI A;  4U8P A;  3UKH A;  3FBL A;  3KIN B;  4DSH A;  3FB2 A;  2Z5Y A;  2WDQ A;  1WYC A;  4QWN B;  1FEW A;  5KMQ A;  1V59 A;  1CL0 A;  3P8C D;  4B3T T;  1D0Y A;  4Q4W 4;  2GR1 A;  1E1N A;  2LSJ A;  4ECH A;  1U5P A;  1GEU A;  2VAS A;  3OPC A;  4HWC A;  3NIX A;  2V7I A;  3GYX A;  3LBX B;  1WCR A;  2W00 A;  4WBO A;  4A99 A;  4AKG A;  4H2R A;  3HI2 A;  4YTM A;  3EF6 A;  1VQW A;  3GWD A;  4LU6 A;  1COV 4;  1HX1 B;  3T37 A;  1QUU A;  4HFC A;  3GD4 A;  4IRE A;  4WW0 A;  2KXP B;  2CXF A;  4HFD A;  4WNK A;  5AQO B;  1YKH B;  3V76 A;  1IZN B;  2XQ9 A;  3FIM B;  4Z43 A;  3O4X E;  2NW9 A;  4ZI2 D;  1IBL T;  3ZN0 B;  2X8H A;  1RVF 4;  3QFB A;  2UXB T;  2VKO A;  3AAA B;  1XAN A;  4GDE A;  1LV0 A;  2X68 A;  1LRZ A;  5IQ1 A;  2ACX A;  3AXJ A;  3RP8 A;  1BZL A;  2CBJ A;  3IBP A;  2BVL A;  3KDS E;  4ADZ A;  2GMH A;  2RR1 4;  2YQU A;  4USQ A;  5J2T E;  2PYJ A;  3SFE A;  1ZK7 A;  2E9X D;  1EV1 4;  1YY5 A;  1NG3 A;  4WZX A;  2LJL A;  4MBQ A;  3QSS A;  4EIP A;  3ESL A;  3DJJ A;  3WI3 A;  4HE8 A;  5FMH A;  1YKE B;  3VKG A;  4QHO A;  5GRT A;  2WU5 A;  5KWF A;  2NTX A;  2NPX A;  3RKO A;  2XFN A;  2B76 A;  4UDP A;  4GK5 E;  2ZM6 T;  1TDK A;  2YG5 A;  4NIQ A;  4MJW A;  5JR9 B;  5L3E B;  3DGH A;  3RYC E;  3C4W A;  1CJ2 A;  3RIU A;  2FJE A;  2YR4 A;  5KDM C;  2UU9 T;  3FI7 A;  2QYW A;  3RYI E;  4AT0 A;  5M10 A;  3BI2 A;  2UXN B;  4BK2 A;  3C51 A;  3G5R A;  4UXN B;  4Z90 A;  3NRX A;  5KVI A;  5J1G A;  3CX7 B;  5BVA A;  5L47 A;  4OCG A;  4ADW A;  5FL0 A;  4QXB B;  4GF7 A;  4YSX A;  2XQ4 A;  3NRN A;  3URH A;  4EED A;  5JDL A;  3N2K E;  5LGN B;  4Q25 A;  4B64 A;  3PUR A;  3SM8 A;  2BS3 A;  2C66 A;  3L39 A;  2WMO A;  2JMH A;  4ZZB A;  5LNK A;  1HXS 4;  2PTF A;  3RIF A;  3VR8 A;  2BAC A;  3GMI A;  3CKD A;  4EIW A;  2NVK X;  4YY3 T;  3BQK A;  1R09 4;  3AA1 B;  4IST A;  4P9S A;  5ER0 A;  4YJ3 E;  2BZB A;  5FVL A;  1HNX T;  3NK0 X;  2R6G F;  4H9O C;  4DR4 T;  3SQP A;  1D0X A;  2WS3 A;  4CY8 A;  2XQ7 A;  2KT9 A;  4NXM T;  2BAB A;  1XDO A;  3KVA A;  1YKJ A;  5KNL A;  2XVJ A;  2X0H A;  3ABV A;  4ERR A;  5LP6 E;  1CF3 A;  3KPF A;  3DK8 A;  3P4W A;  5BRT A;  4JI1 T;  3HYV A;  4CN4 A;  5IPY A;  1TYT A;  2GAH B;  3PS9 A;  5CA1 E;  3K7T A;  2BG9 A;  5F5W A;  4OK0 A;  3IF8 B;  4II2 A;  4U74 A;  3B5M A;  2X9Y A;  2QA2 A;  1GER A;  1K0I A;  1IBK T;  4U2S A;  5KRQ A;  4H9Q C;  2Y6X A;  3SGL A;  3K3N A;  4II3 A;  2N9D A;  4GRT A;  1FEC A;  2BBJ A;  3Q5X A;  1F8S A;  3ZJ1 A;  3OZ2 A;  4GYR A;  2A72 A;  3ETU A;  2ZM2 A;  3LJC A;  3NK1 X;  3MZK B;  2ODU A;  1P2E A;  2VQB A;  3ZYX A;  3UOY A;  5L3C B;  5IYZ E;  1JNZ A;  3GQK A;  2RGO A;  2LSG A;  2JQK A;  3SZW A;  2RGJ A;  1VBB 4;  5HY5 A;  4DO0 A;  3ZEF B;  2V7K A;  3C4A A;  4TN7 B;  5LG4 A;  2VVL G;  3UCL A;  1IBM T;  2LM9 A;  1HYU A;  2X8C A;  5KMR A;  1ZY8 A;  3SUC A;  1LJ1 A;  4WYV A;  2EHO D;  1SE7 A;  3IHG A;  5AQM B;  2J1D G;  2C64 A;  4G74 A;  2BYB A;  4LFC T;  2EQ7 A;  3EAO A;  4DND A;  2VUR A;  1N34 T;  1NAA A;  5FNV E;  4HFH A;  3RHA A;  3JAD A;  4ZS3 A;  2RS3 4;  2X9W A;  4O8S A;  4KI0 F;  3FMW A;  2JQQ A;  1PBD A;  2R0P A;  2WP9 A;  2CXD A;  5AQL B;  5AFU L;  2CFY A;  4XWZ A;  4O2B E;  2BKO A;  4Z24 A;  4ISS A;  1REO A;  2XVH A;  1OOP D;  4DMW A;  1H81 A;  3T0K A;  3CPJ G;  3RQW A;  5EZY E;  4J56 A;  1JRY A;  4B63 A;  4M1P A;  1PO1 4;  1B37 A;  3LDQ B;  2X99 A;  1LVK A;  1E1L A;  2V26 A;  1HRV 4;  3KV9 A;  3UTF A;  1Z0P A;  4WBN E;  2DLR A;  4LMJ A;  3ATQ A;  5EB4 A;  3EDV A;  2RGH A;  3ADA B;  5AQI B;  1MIV A;  1SUM B;  3CTY A;  4OPC A;  2JK6 A;  5LB7 B;  2L9Q A;  5J60 A;  2LOS A;  3RI5 A;  2DI4 A;  2WEU A;  2XAG B;  3RH3 A;  4DR7 T;  2ARD A;  3UU5 A;  3SS1 A;  1T8B A;  3NNE A;  3RRC A;  3I9Y A;  4H4S A;  5EOW A;  1Y56 B;  4RSL A;  2V6Y B;  1Q1W A;  2PLV 4;  1D7L A;  3RKG A;  5GON E;  4GKK T;  2V6X A;  4AXP A;  1XNR T;  3RGL A;  1E7P A;  2Q9Q B;  4BK1 A;  4H4Q A;  3U78 A;  2EQ9 A;  4UVB B;  3JSK A;  4ZI2 C;  2XHE B;  3QB5 K;  3GN5 B;  3U3I A;  3AD8 B;  4I0U A;  3M65 A;  3N9N A;  4EZ4 A;  4Y4N A;  3CPI G;  4YSH A;  3AE7 A;  2RS1 4;  3IHR A;  4BJN A;  1B4V A;  4U8L A;  2GK9 A;  2LRK A;  1GRF A;  2E9X C;  2JRK A;  3G5S A;  4X62 T;  2NP9 A;  2PYL A;  1D4E A;  2WWV A;  2J3N A;  2A89 A;  3SX6 A;  3E1T A;  1AOG A;  4LF6 T;  2WPF A;  2GR0 A;  2E5L T;  4A65 A;  3IC9 A;  3HZL A;  1HR0 T;  5AQQ B;  2GMJ A;  5FY7 A;  3SZC A;  4K7Z A;  2XTL A;  4IE0 A;  4A6N B;  4K22 A;  5LA6 E;  1ZOV A;  1MXT A;  2UXC T;  3S5W A;  3OYX A;  3LK2 B;  4H9S E;  1Q9I A;  4DID B;  3PO7 A;  3KV5 A;  4ZI3 D;  3SXI A;  4BK3 A;  2DKI A;  2V5D A;  1B5Q A;  3H8L A;  4O5Q A;  2XQ6 A;  1HF8 A;  2LLY A;  3BHK A;  3DJG X;  1FEB A;  4A5L A;  3P1W A;  4HWI B;  2R9Z A;  4Y4M A;  3CGE A;  5JDF A;  3B3R A;  3I0O A;  1NCQ D;  1HFA A;  3ICT A;  1VG0 A;  3GQH A;  3HR0 A;  5AQH B;  1UX4 A;  4FK1 A;  2KZ7 B;  4YHJ A;  4UIG A;  4JI4 T;  4O2A E;  4NWZ A;  4JQ9 A;  4X64 T;  4C3Y A;  1BR0 A;  1PXB A;  3F2E A;  2CE7 A;  3UTE A;  4GYS A;  2M67 A;  3ZYL A;  2FUP A;  2Q7V A;  3NH3 X;  2DWG A;  2ODV A;  5KMG P;  1LQT A;  3CPH G;  2ZM8 A;  2JPF A;  4JEH B;  1Q1R A;  3GYI A;  3UTG A;  1TYP A;  1E1M A;  1NDA A;  3VRA A;  5FP3 A;  4JDR A;  1D4D A;  4TX5 A;  1AR6 4;  4QH4 A;  4U8K A;  4Z91 A;  3RIA A;  1BEV 4;  2Y6Q A;  5TR3 A;  3I0Q A;  1XZY A;  3F8P A;  3HKD E;  3C4Z A;  3B13 A;  3ATR A;  5AQP B;  1CBO A;  5AQR B;  4YWO A;  1XHZ A;  4AQG A;  2XFQ A;  1IUW A;  3GSI A;  2H88 A;  1QO8 A;  4AQF A;  2QGS A;  2VK9 A;  3T2K A;  1HNZ T;  4Z2R A;  4ZHQ E;  2Z5X A;  4JI2 T;  3S4U A;  1LVF A;  4C3X A;  2LKH A;  4NPP A;  2OA5 A;  2YDQ A;  2GEW A;  3CN8 A;  4PDW D;  4TM1 A;  5C3J A;  3SRZ A;  1E6E A;  4G9K A;  5HEH A;  1VBC 4;  3BNM A;  4EQX A;  2LKG A;  3IHM A;  2XY8 B;  3E08 A;  3WAK A;  2J4G A;  2GB0 A;  4J31 A;  2R46 A;  4DV3 T;  2IHR 1;  2B7R A;  3N9L A;  3CMM A;  2RM2 4;  3GMB A;  4CN1 A;  1XDP A;  3SY4 A;  3GYJ A;  3HYW A;  3TLV A;  2E4G A;  2XFP A;  2PBI A;  1N1P A;  1HNW T;  4EQS A;  4CXY A;  4K0U A;  2X9H A;  2EHO C;  4ILC A;  2LT3 A;  5LJM A;  3ICS A;  2VZ2 A;  2JB3 A;  1OED C;  4YTN A;  2YR5 A;  4X65 T;  2H89 A;  3NK2 X;  3JCF A;  4OPL A;  4EEB A;  2HN1 A;  4CZZ B;  2GRT A;  1H7W A;  1X31 B;  3G5Q A;  2UUC T;  2R7F A;  4NTD A;  3BK9 A;  3SFD A;  3KVE A;  4JI6 T;  4QX8 B;  3H37 A;  5HWX A;  1L0V A;  3Q2M A;  3NN6 X;  4I59 A;  1L9D A;  3B6D A;  4IV9 A;  4CBQ A;  2R06 4;  4QXC B;  4CXW A;  1Z8U A;  4PFO A;  3O1I A;  1GTH A;  3PUA A;  3LK4 2;  3FZL B;  5KMS A;  3P7I A;  3UKK A;  2OLT A;  3GDP A;  4U72 A;  3QJ4 A;  5EK2 A;  1S3B A;  3EAB A;  1PJ5 A;  2YG4 A;  4KPR A;  3C4X A;  1IUV A;  3EAM A;  4DUY T;  1PVC 4;  4AP3 A;  3LSV A;  4X5T A;  4HA6 A;  3RPU A;  3PJA J;  3FZM B;  1PBF A;  3NKS A;  3M3Z B;  4UEM A;  4H63 H;  3QB5 A;  2PHH A;  3HYX A;  2UXX B;  1H86 A;  3NGC X;  4LML A;  3AAE B;  4Z44 A;  3MXZ A;  4PJL A;  4E7Z A;  1Z7S 4;  2V1D B;  4EZH A;  3LZW A;  2WP5 A;  2PY5 A;  3FG2 P;  3AWI A;  3J9X 1;  2WET A;  4USR A;  1XHC A;  2XFU A;  1AL2 4;  3FZH B;  1HG2 A;  2ZMA A;  1SEZ A;  2OA1 A;  3JBG 4;  1U4Q A;  4X1K E;  4K5R A;  1GRA A;  2YEV C;  4X1Y E;  5GSN A;  2X5I D;  1XDI A;  4DGK A;  3QSE A;  1TDN A;  2SPC A;  2QA1 A;  1DOE A;  2K3W A;  4LF7 T;  1K5M D;  4TNV A;  4X4J A;  3GWF A;  2GV8 A;  2LOP A;  4ZS2 A;  3ZDN A;  4KBM B;  5JCL A;  2DNX A;  4DR3 T;  4C77 A;  4NTC A;  4K5S A;  4J2W A;  1VRH 4;  4N78 D;  3NG7 X;  1MND A;  4PK5 A;  2WBA A;  2LM2 A;  1Y64 B;  2HN2 A;  3CPZ A;  4IDQ A;  2YK0 A;  3KFW X;  3FXD B;  2A9U A;  4EV6 A;  1ELI A;  4TM3 A;  3CML A;  4EYU A;  1H84 A;  3CNJ A;  5HAX A;  4XBF B;  4TLZ A;  3TLU A;  1VOM A;  1I94 T;  1KDG A;  2PFV A;  5E0O A;  4H4X A;  1GXF A;  4DSG A;  3N2O A;  2CWO A;  2XPK A;  3FZK B;  1CHU A;  4ZI3 C;  3ZT7 A;  2YKS A;  4H4U A;  5JDQ A;  1US7 B;  3DJB A;  2BXS A;  2JQ9 A;  4H50 A;  4AKH A;  4IDP A;  3K7Q X;  2JAE A;  2AQJ A;  4HTE A;  3M13 A;  3RC3 A;  1PIV 4;  5J0Z A;  3LZX A;  5KVH A;  2CXL A;  4JI7 T;  3BI4 A;  3AD7 B;  2VL8 A;  5HXC A;  2KWH A;  4YT0 A;  4IVO B;  4CNK A;  4JNQ A;  4GAV A;  4NUU A;  3HKC E;  2BG9 C;  3CVR A;  2VL0 A;  4X9M A;  2WY2 A;  4RHV 4;  3AE4 A;  3VQR A;  3ITJ A;  2CHO A;  3BHF A;  4J2C A;  2YG6 A;  5FS9 A;  1D5T A;  4NXN T;  2DHR A;  5HXR A;  1BKW A;  2IDO B;  1WRD A;  5BMV E;  2CBI A;  2ZZB A;  4HB9 A;  2UXD T;  4JUY A;  1RUI 4;  1VCT A;  3AB1 A;  5AQF B;  3PJA A;  2XQ5 A;  1PBE A;  2V7J A;  2XM1 A;  5H6R B;  2IML A;  2XQ8 A;  2LFC A;  4E0V A;  4I55 E;  4EMW A;  2LSI A;  4XWR A;  3N2G E;  2IUB A;  3MA9 A;  2VKD A;  3ANW A;  2WAU A;  3ZMT B;  2DKH A;  3KKJ A;  5F8P A;  3CK6 A;  2WBL A;  1GRG A;  4U2L A;  1AR8 4;  4A7A A;  2NR4 A;  1COY A;  4JI3 T;  2YU2 A;  3CND A;  2VKJ A;  4YJ2 E;  3T31 A;  2LE8 A;  2A2F X;  2WP6 A;  2YVJ A;  4PW8 A;  1RUE 4;  4JV5 T;  2WOV A;  3N9Q A;  4G6H A;  4Z8X A;  3N9O A;  4LFB T;  1MIY A;  2E9X B;  4B1B A;  2XLS A;  3UOZ A;  5JCK A;  1H6V A;  4PNI A;  2ZLY A;  2V5C A;  5HYA A;  4U2Z A;  1H82 A;  3DK9 A;  5JRC A;  3CX8 B;  4CXX A;  4D04 A;  2IAK A;  1V9D A;  1DU2 A;  1WYB A;  4IE7 A;  2R0G A;  2R07 4;  4NEW A;  4A56 A;  5FXV A;  4HWF A;  3L8K A;  4CCQ A;  5JDH A;  2V7L A;  4I43 B;  4OHF A;  2BKP A;  3OJA A;  2HPL A;  3RF1 A;  2CCQ A;  2R04 4;  4AIU A;  3RYF E;  1X9B A;  3JAF A;  4AOS A;  4OFZ A;  2YU1 A;  3UOX A;  1EBD A;  5HCM A;  3QVR A;  1KNZ A;  1O94 A;  4U7Y A;  2ACZ A;  3VU7 H;  2IVD A;  1GOS A;  2B7S A;  1YQ4 A;  3UU8 A;  2X66 A;  4HWD A;  2BS2 A;  5EK3 A;  5HWY A;  1POV 0;  4B66 A;  1GET A;  3A7M A;  2YDS A;  4J33 A;  3H3M A;  1E1H B;  2WU2 A;  2YWL A;  1VBE 4;  2BA9 A;  5JCI A;  3QNU A;  1WR0 A;  1EL5 A;  3N9P A;  1DOC A;  3PUZ F;  1L9C A;  4UVC B;  3R6N A;  1K4Q A;  4TM0 A;  3AEC A;  4OX9 T;  5DQV A;  1UKV G;  5JCN A;  3ZMU B;  1GT8 A;  4H2Q A;  3GWH A;  3P4P A;  5ABF B;  2B9W A;  1XMO T;  3D0T A;  2F5Z A;  5FL1 A;  2VRM A;  1FOH A;  2I59 A;  3SYI A;  2BRA A;  3RRW A;  4YHH T;  3NYE A;  4BJY A;  2JQH A;  5FXZ A;  3KV6 A;  1PN0 A;  1E1K A;  1IUU A;  5U1O A;  1EL8 A;  2YLT A;  4ZXL A;  4Z25 A;  1XPQ A;  3ZSS A;  1VRB A;  3N5L A;  4B67 A;  1TDE A;  4Z2U A;  2LHR A;  2YM1 A;  4YLH A;  1VBA 4;  2Q0K A;  4APN A;  1MNE A;  4GR1 A;  4X66 T;  1KK7 A;  3KBT A;  1ZMD A;  4LFA T;  1EL7 A;  1ZKQ A;  1YD8 G;  1PXC A;  4YKF A;  3C98 B;  3ZYK A;  1AJ3 A;  2A87 A;  3SOL A;  3H3A A;  1QLB A;  2HWC 4;  4CQI A;  2HPJ A;  3II4 A;  4TWF A;  1H7X A;  5TAO A;  1O5W A;  1MMN A;  2E2A A;  2N2N A;  2JBV A;  2XYO A;  1GV4 A;  4YKG A;  5LHG B;  1PO2 4;  2C3D A;  3F8R A;  3OC4 A;  2VOU A;  5L2L A;  4LF8 T;  5HXI A;  4G73 A;  3UFG A;  2V6O A;  5FS8 A;  4HFV A;  2PZS A;  4U3C A;  2LEH A;  3KBU A;  5L4H A;  3RC8 A;  2EHO B;  4XXG A;  3JAE A;  1OED B;  2W2U A;  3I1A A;  2C75 A;  4DNA A;  2QA7 A;  4GKJ T;  4FK1 C;  3Q9D A;  3QSM A;  3GMC A;  4TWH A;  1FMV A;  2L8K A;  5CJ5 A;  3PU8 A;  4BV6 A;  2XDO A;  1ZEE A;  4BUR A;  4O4I E;  1S94 A;  4EB6 E;  2MYS A;  4TWD A;  3PE0 A;  3QFA A;  3G06 A;  2DCF A;  3LK3 B;  1W4X A;  3LOV A;  3SWH A;  1Z6L A;  4AIS A;  5LHH B;  4GAP A;  3JC6 D;  1OJC A;  4PAB A;  2L3L A;  2X50 A;  4IVM B;  3ZCI A;  3C4N A;  3Q5E A;  4PK6 A;  3TLW A;  1YQ3 A;  3LBX A;  4P09 A;  4JI5 T;  4DR2 T;  1MQT D;  3A8Y C;  4PK4 A;  2W66 A;  2VWA A;  5LGU B;  3I9W A;  2XQ3 A;  1PJ6 A;  1OXZ A;  2YN6 A;  2APG A;  1G73 A;  3ONL C;  1F8W A;  1S2Q A;  1DJQ A;  5HEO A;  1BR1 A;  3AVR A;  4AQF C;  5LOV E;  3DH9 A;  4NZH A;  4HFE A;  4JNA A;  3RP7 A;  3IF9 A;  1P2H A;  2WDR A;  4U8O A;  3X1D A;  3GDN A;  3AXJ B;  4M52 A;  2RA1 A;  3CQG B;  3ZC1 A;  2D5U A;  1VDC A;  4G6G A;  1ZKE A;  4ILU A;  1RSG A;  4ILA A;  4OPG A;  1CC4 A;  3IWA A;  2PW9 A;  2OAL A;  2AAQ A;  1ZV4 X;  5C8Y E;  1NPX A;  2YLS A;  2B1E A;  2E5V A;  3NRY A;  2YOE A;  2YVF A;  5HYM A;  2P9B A;  3AE9 A;  1OJT A;  2BKN A;  5LXT E;  2WZI A;  5JR9 A;  3ZMZ B;  4A79 A;  1GPE A;  3UQ4 A;  5HEJ A;  2A8X A;  1GRE A;  4B69 A;  1MIW A;  4HGA A;  3ZT5 A;  4AKR B;  2B9X A;  4UV8 B;  3BQL A;  2D9D A;  2G0U A;  3O1H A;  2X67 A;  5H6Q B;  2HHH T;  4H4T A;  4OPD A;  1OWA A;  4AOX A;  4DBQ A;  4B3R T;  1Y01 A;  3ZYM A;  4WX1 A;  3WE0 A;  1R8I A;  2XAS B;  2W0H A;  1NEN A;  4UP3 A;  4Z26 A;  2C7G A;  3HL6 A;  5HEU A;  1H83 A;  4Q4V 4;  2NWB A;  1EL9 A;  4IE5 A;  3UKA A;  4IE6 A;  2QVA A;  3E22 E;  2QRX A;  5JCM A;  3P9U A;  5KX5 E;  1RP0 A;  5LMU T;  1W0B A;  3A5X A;  1RUC 4;  5JDM A;  3P4S A;  5HCJ A;  1KEY A;  5AQJ B;  4RG4 A;  2Y6R A;  1O3X A;  1HS7 A;  1ONF A;  5LBQ B;  5KOX A;  4P0B A;  3IEE A;  2I0M A;  4GIW A;  3S61 A;  1LVL A;  4DMV A;  3M12 A;  5HXS A;  1MOK A;  4GB3 4;  1AR7 4;  3KLJ A;  2K9A A;  1L9E A;  4TV8 E;  4B68 A;  3F8D A;  2C5I T;  2KWI B;  2H7O A;  4HKA A;  3K8P C;  4I58 A;  3VHL A;  2MAW A;  2XM2 A;  2W63 A;  4X9N A;  2BG9 B;  4FJO A;  3DJE A;  1NHS A;  4ZCC A;  2X51 A;  3ETV A;  3T2Z A;  2R4E A;  2X3N A;  4DR1 T;  4U8N A;  3EPT A;  4O5U A;  1J1J A;  2V5Z A;  3IA3 A;  1K0J A;  2Q6U A;  3DJD A;  1VBD 4;  2WHD A;  2E8I A;  2CM0 A;  4EGW A;  1EAH 4;  4UV9 B;  4FX9 A;  2H7V C;  1NA1 D;  2PJQ A;  2XJ7 A;  4A5X A;  4LF4 T;  3FBS A;  2BCG G;  5L3B B;  2WPC A;  2YR6 A;  1D1A A;  4JY3 A;  1FEA A;  3QOF A;  4A98 A;  2D0T A;  3OBV E;  1LTX R;  1E39 A;  3BQI A;  5ETW A;  4J57 A;  3DP7 A;  4AKL A;  4JN9 A;  4B6X A;  2BXR A;  1YXR A;  3FBZ A;  4X1I E;  4BJM A;  3AA0 B;  3OYZ A;  4AKI A;  3P50 A;  3MK7 C;  3EHZ A;  2XLR A;  4CCR A;  1BWC A;  3CQX C;  4EOZ B;  3VR9 A;  1VG9 A;  1IUT A;  2XVF A;  2V3B A;  4DBR A;  2X0Y A;  4KMC A;  2Q0L A;  1KNP A;  5BUL A;  4HFI A;  2OLN A;  5IUX A;  3T1H T;  4OPI A;  2C5J A;  3NHO X;  3AE2 A;  2GR3 A;  4ANJ A;  4GCM A;  4ZEY A;  2BK3 A;  2AE9 A;  3TLS A;  3COX A;  4DR5 T;  3VKH A;  1JRZ A;  3AXB A;  3UKP A;  3EI0 A;  4I4T E;  4DUZ T;  1F6M A;  1OJA A;  2YDR A;  1VRQ B;  2XVE A;  4X20 E;  4GDP A;  1YQZ A;  1JRX A;  3K30 A;  4EM4 A;  2GQF A;  2LSY A;  5BR8 T;  2CMR A;  2B9Y A;  2VB6 A;  1KFY A;  4MAL A;  3UP4 A;  3RYH E;  1RUJ 4;  4B65 A;  3MAC A;  5C2T A;  4BA9 A;  2YLW A;  3ONX A;  2XAJ B;  3FHN A;  4NUV A;  3BI5 A;  2DL1 A;  2C67 A;  1K0L A;  4Y4L A;  4H9N C;  4U2T A;  1OED E;  3JC6 C;  1UCU A;  3C96 A;  3NZQ A;  1S2Y A;  5AQU B;  1ZHC A;  3SZF A;  1AR9 4;  2Y48 B;  2AXD S;  3KA7 A;  1VCS A;  2R0C A;  1D4M 4;  1M7K A;  3UUX B;  1NHP A;  1Y56 A;  1MMA A;  2IC9 A;  4DV1 T;  1LPF A;  2IIU A;  4B3M T;  2V6Y A;  2XSA A;  3CGC A;  3NTD A;  2C73 A;  2WSS V;  2FBW A;  3DME A;  3ICR A;  2Q9Q A;  5ADX L;  2VQ7 A;  1RUD 4;  4IE4 A;  1PHH A;  4L0R A;  3UQ7 A;  2QAE A;  2C5K T;  3D8X A;  5U63 A;  1XNQ T;  2CWY A;  1SA0 E;  3GN5 A;  3J8F 4;  5FXW A;  4J34 A;  2J47 A;  4PAG A;  1QSD A;  2XAQ B;  1IUX A;  3QK6 A;  3P4R A;  4IL4 A;  5HXH A;  2YG7 A;  3KD9 A;  2FJA A;  4NEV A;  2JJ9 A;  1CC2 A;  2VVS A;  3KV4 A;  2M6I A;  4B3S T;  1TDF A;  1X79 A;  1TRB A;  3KPK A;  3NZP A;  1BR4 A;  3WAJ A;  3ZC0 A;  4H9P C;  4J36 A;  5L4E A;  1ZOY A;  3PUQ A;  2ZM0 A;  5FVK A;  4NTE A;  3CNT A;  4A6N A;  2V60 A;  4C5O A;  3RX6 A;  2XLT A;  2XAF B;  3N9M A;  2CLY C;  2BK5 A;  4H4Y A;  1EZ3 A;  4IGU A;  2D2S A;  3KVB A;  4CI3 B;  1RUG 4;  3EAN A;  3LG7 A;  2X0L B;  2QCU A;  4H2N A;  1PS9 A;  2VQE T;  4L9I A;  4TM4 A;  3AEA A;  1RYI A;  4E7S A;  5JQG E;  3NVO A;  2V7M A;  3T1Y T;  3AYI A;  1D1B A;  3OKQ A;  2JMK A;  5FY0 A;  1DJN A;  4U8M A;  4IDN A;  4P0A A;  3BNU A;  5JDN A;  2UZZ A;  3RED A;  3T2Y A;  1IJH A;  3UUB A;  1B8S A;  1GRH A;  3B57 A;  1T72 A;  3UT5 E;  1ZMC A;  2JIW A;  2LHN A;  2C70 A;  4UEL A;  4ZN0 A;  3UU3 A;  5DAB A;  2CUL A;  3ZPO A;  4IDZ A;  2F4V T;  3ZT6 A;  1DOB A;  5AQT B;  3AE8 A;  1HTJ F;  4CN6 A;  2VRL A;  3ZJ2 A;  1XWM A;  3ZST A;  5AQG B;  3KU9 A;  3QVP A;  5CKU A;  3V3N A;  4D03 A;  3AE3 A;  3CGB A;  4KP3 C;  2C76 A;  1CJ4 A;  1G8X A;  3LB8 A;  5ABH A;  4OPU A;  1UUS A;  1YW0 A;  4IA5 A;  4H4R A;  3AEG A;  1GRT A;  1LQU A;  1OJD A;  5HEG A;  4NNJ A;  4DV5 T;  1QJD A;  2C65 A;  2RP4 A;  3V3O A;  4EXT A;  5FS6 A;  4TV9 E;  4COF A;  2RAB A;  1D0Z A;  2OLO A;  3AEF A;  5JRE A;  3RNM A;  4YXD A;  4P1N A;  3R84 B;  3E0Z A;  4EQR A;  3MJX A;  4QH1 A;  1M6I A;  1W0A A;  3UTK A;  2EX3 A;  4IIJ E;  1NEK A;  2BG9 E;  2YLR A;  4GOU A;  4I50 E;  4O4J E;  1CJ3 A;  1JNR A;  5KMP A;  3EVY A;  3AE1 A;  4KHP T;  3DGZ A;  3UUM A;  5CQF A;  3AA6 B;  1KSU A;  3UP5 A;  3V5S A;  2XZE A;  3DK4 A;  2KSR A;  4K2X A;  4AT2 A;  3CWZ B;  2GH5 A;  3AEB A;  2W0G A;  1T7S A;  5KXJ A;  4N9X A;  4Z2T A;  4U33 A;  1GES A;  1ASJ 4;  2KMF A;  1RHI 4;  3RP6 A;  2NW8 A;  5L46 A;  3PTR B;  1LKX A;  1N4V A;  4DVD A;  1GRB A;  2BK4 A;  3PV0 F;  4G63 A;  2M6B A;  3GA8 A;  3HKE E;  2XQA A;  3DA1 A;  2GR2 A;  4C91 A;  1N32 T;  4EMJ A;  4Q4Y 4;  4Q4X 4;  4IDO A;  4BJZ A;  1CUN A;  5JTG A;  2YG3 A;  5LBM A;  1ZX9 A;  5AQK B;  4OYJ A;  2MBG A;  4EQW A;  5BUK A;  2A3D A;  3PUG A;  1IUS A;  4U8I A;  3ALM A;  1PBB A;  4DR6 T;  2RS5 4;  4CY6 A;  2WWU A;  4CI2 B;  2BRY A;  3NT6 A;  2XSB A;  2KND A;  1F8R A;  4QH5 A;  3F31 A;  4UDR A;  4C90 A;  4F8H A;  3AYL A;  4ILB A;  1JOA A;  4FI5 A;  2PYX A;  2W62 A;  4TNW A;  1W9R A;  2VQF T;  2OAM A;  1N33 T;  3AD9 B;  3L3P A;  2Q9Q D;  2GF3 A;  4O4H E;  2V61 A;  1HRI 4;  2CPT A;  5DQW A;  5DJQ C;  2V3A A;  5J7X A;  1OJ9 A;  5FS7 A;  4ASK A;  1N4U A;  3Q9T A;  5LHI B;  2CHN A;  5U25 A;  5KOW A;  2YVG A;  3PU3 A;  1BGJ A;  1UUR A;  2XLU A;  4LF5 T;  1NWM X;  5JDG A;  3AYJ A;  3UKF A;  2ZBW A;  1N36 T;  3VRD B;  3H4K A;  3FPZ A;  2WM9 A;  3CNP A;  3LJP A;  2RMU 4;  2K5B B;  1JEH A;  2OV9 A;  2YAU A;  1PJ7 A;  2EQ6 A;  3GD3 A;  2X8G A;  2FJB A;  4KUM B;  5LG3 A;  2BDE A;  1DXL A;  5LYJ E;  2NOX A;  2XUE A;  3QC9 A;  4IA6 A;  4KHZ F;  2IC6 A;  4H4P A;  4JEU B;  1MMG A;  3UTH A;  2C3C A;  2VVL A;  5JR9 C;  3ZMV B;  4UF0 A;  5M4Y A;  2KLQ A; 
#chains in the Genus database with same CATH homology
 3NK0 X;  3T14 A;  3ALJ A;  3QSE A;  3S61 A;  1TDN A;  2QA1 A;  1LVL A;  1DOE A;  2YLX A;  3SQP A;  3M12 A;  2WS3 A;  2GQW A;  4CY8 A;  1MOK A;  4X4J A;  3KLJ A;  2BAB A;  3GWF A;  1L9E A;  1YKJ A;  2GV8 A;  5KNL A;  2XVJ A;  3ZDN A;  1M64 A;  3ABV A;  5JCL A;  4B68 A;  3F8D A;  1CF3 A;  4ICY A;  4C77 A;  4NTC A;  4I58 A;  4K5S A;  3KPF A;  3DK8 A;  4J2W A;  5BRT A;  3NG7 X;  4CNJ A;  1GAL A;  2ZZC A;  3HYV A;  2WBA A;  1TYT A;  2GAH B;  5IPY A;  3PS9 A;  4X9N A;  5KMR A;  3K7T A;  3DJE A;  1NHS A;  4ZCC A;  4II2 A;  3SZ0 A;  4LII A;  3T2Z A;  2QA2 A;  2R4E A;  2ZZ0 A;  2X3N A;  4U8N A;  1ELI A;  1GER A;  3EPT A;  1K0I A;  4LA1 A;  4O5U A;  4H7U A;  4TM3 A;  1H84 A;  2V5Z A;  3CNJ A;  3AED A;  4U2S A;  5KRQ A;  4TLZ A;  3SGL A;  1KDG A;  1K0J A;  2EQ8 A;  2Q6U A;  2XVI A;  4H4X A;  4II3 A;  1GXF A;  4GRT A;  1FEC A;  4DSG A;  3DJD A;  1F8S A;  3OZ2 A;  4H4V A;  3NK1 X;  4P9S A;  3GRS A;  2JB2 A;  4FDC B;  5DBJ A;  3UOV A;  1P2E A;  2VQB A;  2WHD A;  3ZYX A;  3UOY A;  3CIR A;  3R9U A;  1CHU A;  2R4J A;  1JNZ A;  3GQK A;  2RGO A;  4H4U A;  4FX9 A;  1GSN A;  5IQ4 A;  2BXS A;  3SZW A;  2RGJ A;  4H50 A;  2WDV A;  3K7Q X;  4JY2 A;  2JAE A;  2AQJ A;  5HY5 A;  3M13 A;  2FJD A;  1CC6 A;  3FBS A;  3UKQ A;  2BCG G;  2HQM A;  2WPC A;  2YR6 A;  3LZX A;  3C4A A;  3ISH A;  4JY3 A;  1FEA A;  5KVH A;  3BI4 A;  1KF6 A;  3AD7 B;  4AP1 A;  2VVL G;  3UCL A;  2WES A;  1HYU A;  1LTX R;  2X8C A;  4YT0 A;  1E39 A;  4K8D A;  1ZY8 A;  2BC1 A;  4IVO B;  4J57 A;  4JNQ A;  4CNK A;  3SUC A;  4GAV A;  3NN0 X;  1LJ1 A;  3NTA A;  4JN9 A;  2BXR A;  2WPE A;  3IHG A;  2C64 A;  4G74 A;  2BYB A;  4X9M A;  3CGD A;  2EQ7 A;  3AE4 A;  1D7Y A;  3EAO A;  3VQR A;  2XLR A;  3ITJ A;  4CCR A;  1BWC A;  5EB5 A;  3BHF A;  3Q6J A;  2YM2 A;  1NAA A;  3VR9 A;  1VG9 A;  1IUT A;  2XVF A;  2YG6 A;  2V3B A;  2VVM A;  3RHA A;  5FS9 A;  1D5T A;  1BKW A;  2Q0L A;  1KNP A;  5BUL A;  3FMW A;  2ZZB A;  4HB9 A;  1PBD A;  2OLN A;  2R0P A;  4OPI A;  3ALL A;  2WP9 A;  3NHO X;  1D4C A;  3AE2 A;  2GR3 A;  2CFY A;  4XWZ A;  2E1M A;  3AB1 A;  4GCM A;  4RG3 A;  2BK3 A;  1PBE A;  3COX A;  4Z24 A;  1PXA A;  2XVH A;  1REO A;  1JRZ A;  2IVE A;  3LAD A;  3AXB A;  3UKP A;  2LFC A;  4E0V A;  1H81 A;  3T0K A;  2C4C A;  3CPJ G;  3H8I A;  2BS4 A;  4J56 A;  1F6M A;  4EMW A;  4XWR A;  1JRY A;  2JKC A;  4B63 A;  1OJA A;  1VRQ B;  1B37 A;  2XVE A;  4GDP A;  1YQZ A;  1JRX A;  2DKH A;  3KKJ A;  1PBC A;  3K30 A;  4EM4 A;  2GQF A;  1GRG A;  2B9Y A;  2TPR A;  2X99 A;  1E1L A;  4U2L A;  1KFY A;  3UP4 A;  3L1R A;  3AE5 A;  2GVC A;  1NHQ A;  4B65 A;  4A7A A;  4EMI A;  1FL2 A;  1COY A;  3UTF A;  2GAG B;  3ATQ A;  5EB4 A;  5C2T A;  2RGH A;  3CND A;  3ADA B;  2YLW A;  2XCG A;  3T31 A;  3CTY A;  2WP6 A;  3BI5 A;  2C67 A;  1K0L A;  2YVJ A;  4OPC A;  2JK6 A;  4TLX A;  2WOV A;  4Y4L A;  4G6H A;  5J60 A;  4U2T A;  1ZP0 A;  4B1B A;  2XLS A;  3UOZ A;  3C96 A;  5JCK A;  1MO9 A;  4REK A;  1S2Y A;  4WCT A;  1H6V A;  2WEU A;  4UDQ A;  3SZF A;  1H82 A;  3DK9 A;  2ARD A;  3KA7 A;  2TMD A;  3NNE A;  4D04 A;  1F3P A;  2R0G A;  4EIP A;  4H4S A;  2R0C A;  4NEW A;  5EOW A;  1Y56 B;  4RSL A;  1NHP A;  1Y56 A;  1FCD A;  1LPF A;  3L8K A;  4CCQ A;  1Q1W A;  1D7L A;  4OPT A;  3CGC A;  3NTD A;  4H2P A;  2C73 A;  2FBW A;  3DME A;  3ICR A;  1E7P A;  5M0Z A;  1DNC A;  1PDH A;  3VRB A;  2VQ7 A;  2WOW A;  4H4Q A;  4PAA A;  4BK1 A;  4AOS A;  1PHH A;  2QAE A;  2EQ9 A;  2WOI A;  3UOX A;  1EBD A;  3JSK A;  3QVR A;  1O94 A;  3D8X A;  5U63 A;  2ACZ A;  3AD8 B;  2IID A;  2IVD A;  1GOS A;  2B7S A;  4Y4N A;  4J34 A;  1YQ4 A;  3CPI G;  1TDO A;  2BS2 A;  4YSH A;  3AE7 A;  1IUX A;  3P4R A;  4B66 A;  2YLZ A;  1B4V A;  1GET A;  2YG7 A;  3KD9 A;  4J33 A;  4U8L A;  2FJA A;  4NEV A;  1GRF A;  1CJC A;  2WU2 A;  2YWL A;  3K7M X;  3G5S A;  1CC2 A;  1D4E A;  4H4W A;  2J3N A;  2A89 A;  2BA9 A;  2XFO A;  2XLP A;  3SX6 A;  5JCI A;  4U8J A;  3E1T A;  1AOG A;  2WPF A;  1TDF A;  2GR0 A;  1EL5 A;  1DOC A;  1TRB A;  3KPK A;  1L9C A;  4A65 A;  3IC9 A;  1K4Q A;  4TM0 A;  3AEC A;  1UKV G;  3HZL A;  5JCN A;  4J36 A;  2GMJ A;  1GT8 A;  3SZC A;  5EBK A;  1ZOY A;  4K7Z A;  4NTE A;  1BF3 A;  2CDU A;  4H2Q A;  4A6N B;  3CNT A;  4K22 A;  4A6N A;  2V60 A;  4C5O A;  1ZOV A;  2XLT A;  3P4P A;  1MXT A;  2AR8 A;  2O9Z A;  3S5W A;  2BK5 A;  1Q9I A;  3PO7 A;  2B9W A;  4YTP A;  4H4Y A;  3SXI A;  4BK3 A;  2DKI A;  2I0Z A;  4CRT A;  2F5Z A;  1KNR A;  1B5Q A;  2VRM A;  1FOH A;  1BGN A;  4YSY A;  3EAN A;  3GRT A;  3SYI A;  2BRA A;  1O95 A;  3H8L A;  2QCU A;  4H2N A;  3NYE A;  1PS9 A;  4O5Q A;  4BJY A;  4TM4 A;  3BHK A;  3DJG X;  1FEB A;  1PN0 A;  3AEA A;  1E1K A;  1JU2 A;  2CVJ A;  3P1W A;  4A5L A;  1IUU A;  1RYI A;  1NHR A;  3D1C A;  1EL8 A;  2R9Z A;  2YLT A;  4Y4M A;  5U1O A;  3CGE A;  3B3R A;  4Z25 A;  1Y0P A;  2C72 A;  1XPQ A;  1GTE A;  1GND A;  3ICT A;  3NYF A;  3NLC A;  4YSZ A;  1VG0 A;  3AYI A;  3GQH A;  4C74 A;  4U8M A;  4B67 A;  1DJN A;  4FK1 A;  3BNU A;  1TDE A;  4Z2U A;  2UZZ A;  3RED A;  2YM1 A;  3O0H A;  3T2Y A;  2Q0K A;  4NWZ A;  4JQ9 A;  1IJH A;  1B8S A;  1GRH A;  4APN A;  4GR1 A;  4C3Y A;  1ZMD A;  4ZN0 A;  1ZMC A;  1N4W A;  2C70 A;  4EM3 A;  1PXB A;  1EL7 A;  1ZKQ A;  4YKF A;  1PXC A;  3PVC A;  3I6D A;  2A87 A;  3NYC A;  2CUL A;  3CNS A;  1QLB A;  4GUV A;  3UTE A;  1DOB A;  3II4 A;  2Q7V A;  3P4Q A;  5HHF A;  1H7X A;  1O5W A;  3AE8 A;  2VRL A;  2JBV A;  3LXD A;  2XYO A;  1GV4 A;  1NG4 A;  2R45 A;  4YKG A;  3NH3 X;  3KU9 A;  3QVP A;  5CKU A;  2BC0 A;  1KSS A;  2C3D A;  1LQT A;  3CPH G;  3F8R A;  3OC4 A;  3V3N A;  3GYI A;  2VOU A;  3UTG A;  3AE3 A;  1Q1R A;  3CGB A;  1TYP A;  4D03 A;  1E1M A;  2C76 A;  5HXI A;  1CJ4 A;  1NDA A;  3VRA A;  3LB8 A;  1DOD A;  4G73 A;  4JDR A;  2V6O A;  1D4D A;  3I3L A;  4OPU A;  5FS8 A;  4A9W A;  4IA5 A;  4U8K A;  4H4R A;  3AEG A;  4H4Z A;  2Y6Q A;  5TR3 A;  1S3E A;  3F8P A;  3AEE A;  1GRT A;  1LQU A;  1OJD A;  3M0O A;  3ATR A;  4NNJ A;  1QJD A;  3AE6 A;  1CBO A;  2C65 A;  4XXG A;  4YWO A;  2XFQ A;  3V3O A;  1IUW A;  2BCP A;  5FS6 A;  4ZCD A;  2C75 A;  3GSI A;  4DNA A;  4FK1 C;  2H88 A;  1QO8 A;  3UKL A;  4EIQ A;  4KX6 A;  2JB1 A;  1ZDL A;  5LV9 A;  3QSM A;  3T2K A;  4Z2R A;  2RAB A;  2OLO A;  3GMC A;  2WQY A;  3AEF A;  4OVI A;  4U8P A;  3UKH A;  3RNM A;  4BV6 A;  2Z5X A;  2XDO A;  4YXD A;  4DSH A;  2Z5Y A;  4C3X A;  2WDQ A;  4BUR A;  4EQR A;  3QFA A;  5KMQ A;  1M6I A;  2GEW A;  3CN8 A;  1V59 A;  1W4X A;  1CL0 A;  5C3J A;  3LOV A;  4TM1 A;  2GR1 A;  1E6E A;  1E1N A;  1Z6L A;  1NEK A;  4G9K A;  4GAP A;  2YLR A;  4ECH A;  1CJ3 A;  1OJC A;  4PAB A;  1JNR A;  5KMP A;  1GEU A;  3AE1 A;  3BNM A;  4EQX A;  2X50 A;  3DGZ A;  4IVM B;  3IHM A;  5CQF A;  3C4N A;  1KSU A;  3UP5 A;  3NIX A;  2GB0 A;  4J31 A;  2R46 A;  3DK4 A;  3GYX A;  1YQ3 A;  4K2X A;  2B7R A;  4AT2 A;  3CMM A;  3GMB A;  2GH5 A;  3AEB A;  3SY4 A;  4A99 A;  3GYJ A;  3HYW A;  4H2R A;  5KXJ A;  4YTM A;  3EF6 A;  2E4G A;  1VQW A;  2XFP A;  3GWD A;  4LU6 A;  1GES A;  4N9X A;  4Z2T A;  1N1P A;  4EQS A;  1PJ6 A;  3RP6 A;  3T37 A;  5L46 A;  2APG A;  1N4V A;  3GD4 A;  3ICS A;  1GRB A;  1F8W A;  1S2Q A;  2VZ2 A;  2JB3 A;  1DJQ A;  2BK4 A;  4YTN A;  3V76 A;  2YR5 A;  4Z43 A;  3FIM B;  2H89 A;  3DH9 A;  4NZH A;  2X8H A;  3NK2 X;  4JNA A;  3RP7 A;  3QFB A;  4OPL A;  3DA1 A;  3IF9 A;  2GR2 A;  2GRT A;  1P2H A;  2WDR A;  1XAN A;  4GDE A;  1LV0 A;  4U8O A;  4EMJ A;  3GDN A;  5IQ1 A;  1H7W A;  1X31 B;  3G5Q A;  4BJZ A;  2YG3 A;  4M52 A;  3RP8 A;  1BZL A;  1ZX9 A;  2GMH A;  1VDC A;  4EQW A;  5BUK A;  2YQU A;  4G6G A;  4USQ A;  4NTD A;  3SFD A;  1RSG A;  3KVE A;  1IUS A;  3SFE A;  4U8I A;  4OPG A;  1CC4 A;  3IWA A;  3ALM A;  1PBB A;  1ZK7 A;  1L0V A;  1YY5 A;  1NG3 A;  3QSS A;  2OAL A;  2AAQ A;  3NN6 X;  1L9D A;  3B6D A;  4I59 A;  2BRY A;  3DJJ A;  4IV9 A;  4CBQ A;  3NT6 A;  4CY6 A;  1NPX A;  5FMH A;  2YLS A;  5GRT A;  2E5V A;  1GTH A;  1F8R A;  2WU5 A;  5KWF A;  2NPX A;  2YVF A;  4UDR A;  5HYM A;  2XFN A;  5KMS A;  3AYL A;  3AE9 A;  2B76 A;  1OJT A;  3UKK A;  4UDP A;  3GDP A;  1JOA A;  2YG5 A;  1TDK A;  4MJW A;  2PYX A;  3QJ4 A;  1S3B A;  3DGH A;  1PJ5 A;  4A79 A;  1CJ2 A;  1GPE A;  2OAM A;  2YG4 A;  4KPR A;  2A8X A;  2FJE A;  1IUV A;  2YR4 A;  3AD9 B;  1GRE A;  4AT0 A;  4AP3 A;  5M10 A;  3BI2 A;  4B69 A;  2GF3 A;  4BK2 A;  4HA6 A;  2V61 A;  3G5R A;  2B9X A;  1PBF A;  3NKS A;  2V3A A;  5J7X A;  1OJ9 A;  5FS7 A;  2PHH A;  3NGC X;  3HYX A;  1H86 A;  1N4U A;  5KVI A;  3Q9T A;  4H4T A;  5BVA A;  4OPD A;  4Z44 A;  5U25 A;  4OCG A;  4ADW A;  5KOW A;  2YVG A;  4GF7 A;  4AOX A;  4YSX A;  1BGJ A;  2XLU A;  3NRN A;  4WX1 A;  3WE0 A;  3LZW A;  2WP5 A;  2W0H A;  1NEN A;  3FG2 P;  3AWI A;  3URH A;  3UKF A;  3AYJ A;  4UP3 A;  2ZBW A;  3VRD B;  4Z26 A;  2C7G A;  3H4K A;  1H83 A;  2WET A;  3FPZ A;  3SM8 A;  4B64 A;  3CNP A;  3LJP A;  4USR A;  2BS3 A;  1XHC A;  2XFU A;  2C66 A;  1JEH A;  2YAU A;  1EL9 A;  1PJ7 A;  2EQ6 A;  3UKA A;  1SEZ A;  3GD3 A;  5JCM A;  2OA1 A;  3P9U A;  3VR8 A;  2BAC A;  2X8G A;  1RP0 A;  2FJB A;  3P4S A;  1DXL A;  4IA6 A;  4RG4 A;  2NVK X;  4H4P A;  3UTH A;  4K5R A;  1GRA A;  2Y6R A;  5GSN A;  2C3C A;  2VVL A;  5ER0 A;  1ONF A;  5KOX A;  1XDI A;  4DGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...