4AT0A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
483
structure length
483
Chain Sequence
b'IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
molecule tags Oxidoreductase
total genus 164
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at0A02
3AWIA 1GTHA 4YTPA 2BK4A 5EB5A 2GR1A 3AYLA 4X9MA 3VR8A 5GRTA 1EL5A 2ZZBA 2XFNA 3I6DA 2XVHA 3Q9TA 4J33A 3EAOA 1BZLA 2GH5A 4Z2TA 5HXIA 3CNJA 4GCMA 4NTCA 1W4XA 3KPFA 1EL9A 3OZ2A 4PAAA 4B66A 3H8LA 3Q6JA 2YLRA 2W0HA 3I3LA 1Q1RA 1TDFA 1ZOVA 4TLXA 3UKQA 1NHPA 4J2WA 3FG2P 3GD3A 2Z5XA 4FX9A 5M0ZA 4U8KA 5KXJA 4IA6A 2XLSA 1OJTA 1E1KA 2VQBA 3PS9A 2VZ2A 4EMJA 1PHHA 3G5SA 3ALLA 2YM1A 4H4WA 3ZYXA 1PBDA 1F6MA 2BC0A 4JNAA 1XHCA 4OPLA 4C77A 3JSKA 4B64A 1ZDLA 2CULA 2XVEA 1H86A 4EQXA 3AE4A 4XXGA 1QO8A 1D4CA 4H2RA 1PN0A 4YT0A 1NENA 4H4TA 1GXFA 3S61A 4Z43A 4U2TA 1KNPA 4EM3A 2C3DA 1L9DA 3AE5A 4GRTA 4BJYA 4A7AA 2QCUA 2BABA 2CFYA 2VVLA 3NK2X 2Y6RA 2RGHA 3SFEA 5JCMA 1UKVG 1GRFA 2X8GA 1EL7A 1CC6A 3AE8A 3SGLA 1TDOA 4H4VA 3IWAA 3CTYA 3QFAA 2YG3A 4H50A 4Z2RA 3AE6A 3NT6A 4OPDA 4CNJA 2BACA 4U2SA 3F8DA 4O5UA 4CCQA 1N1PA 3QFBA 3C4NA 2C67A 5CKUA 3RHAA 3UKFA 3L8KA 3LADA 4NEVA 4H4ZA 4K5SA 1E1MA 2GAHB 3ATRA 1NG4A 1ZMCA 2XFOA 2C3CA 3VRAA 3K30A 2GQFA 3NTDA 3AD7B 4J57A 2XFPA 1H6VA 4BURA 4CCRA 2C76A 2YLWA 3H8IA 1CC2A 5EB4A 3BI5A 2IIDA 1PXBA 2PYXA 2AAQA 2WDRA 1XPQA 1F8RA 2IVDA 2B7RA 3NK0X 2X99A 3ALMA 3NKSA 3CNSA 2VVLG 2YQUA 4TM0A 2GR2A 3VRDB 2V60A 4P9SA 3E1TA 3UP5A 1B4VA 4TM4A 4EIQA 2YLTA 5ER0A 2WOIA 4OPTA 5FS6A 1D7YA 1P2HA 2B7SA 4RSLA 5FMHA 2GRTA 3AE3A 1GRBA 4A6NB 4AOSA 1NPXA 2VOUA 3DGZA 2EQ8A 2FBWA 2GMHA 4EQRA 1H7XA 1PXCA 2E4GA 4PABA 3UTHA 2C64A 4K2XA 4YSZA 3UTGA 4GDEA 4Z26A 4B1BA 4OCGA 4YSXA 5KVIA 4H4PA 2BK3A 2IVEA 3UKHA 1GRGA 1CBOA 1CF3A 2ZBWA 1RP0A 1IUXA 4NTDA 3B3RA 4EMIA 4OPCA 4USQA 3P4PA 4IV9A 5KOXA 4H4YA 1XDIA 4LU6A 3DJJA 3NHOX 2C73A 1P2EA 2JAEA 4ECHA 2XVFA 2RGJA 2RABA 4A6NA 4IVMB 3AB1A 3FIMB 3ICSA 3AE7A 3R9UA 4CRTA 4MJWA 1E7PA 3L1RA 2WPFA 3ALJA 3GDPA 5KOWA 2GVCA 3CIRA 3COXA 2O9ZA 1E39A 5U25A 3KVEA 4UP3A 2V5ZA 3IHGA 3LZWA 4M52A 1PBEA 3C96A 2YLZA 1GNDA 3UTEA 1ZMDA 3AEGA 4K5RA 2XLPA 4GUVA 4B69A 4UDPA 5C2TA 3RP6A 5M10A 2J3NA 4U8LA 1N4UA 2AR8A 2JB2A 2B76A 5TR3A 4A9WA 1MO9A 4AP1A 2BS4A 3CGCA 2BA9A 4ICYA 4YWOA 1Y0PA 1K0IA 1IUVA 4H2QA 2YAUA 2ACZA 4U8NA 1GEUA 3NK1X 3CNDA 4HA6A 4EQWA 2ARDA 2XYOA 4Y4NA 5LV9A 2HQMA 1DXLA 1Q1WA 3D1CA 4IA5A 1VG9A 3NH3X 1L0VA 5L46A 4KX6A 3ICRA 3NTAA 2UZZA 3SQPA 3LXDA 3QSSA 2WP5A 2I0ZA 2C7GA 4H4UA 2VQ7A 2CVJA 4KPRA 1K4QA 4CBQA 1M6IA 3DJEA 2GEWA 4LA1A 4WCTA 4BV6A 5HYMA 2XFQA 3CNPA 1JU2A 3P4RA 1DOEA 3CN8A 4D03A 3G5RA 1LV0A 5J7XA 1GREA 2WBAA 5JCKA 2XDOA 4AOXA 3FPZA 1KSUA 2XLRA 4J31A 2AQJA 3CGEA 2XFUA 1D7LA 4RG3A 3HZLA 1KDGA 2ZZ0A 1PBFA 1GTEA 4EIPA 3ATQA 3GMBA 3GYXA 3NYFA 1FECA 1JOAA 3V3OA 3AE9A 3GYJA 1QLBA 2JB1A 5CQFA 3AD9B 4K22A 1CJCA 1V59A 2APGA 1JNZA 4H4SA 4EQSA 3VR9A 2OLNA 1YQ3A 3LOVA 2E1MA 4I59A 4OPIA 3DK8A 1ONFA 5FS9A 3DK9A 4K8DA 1DJQA 1RSGA 1IUTA 3EPTA 3NN0X 2FJAA 3UOYA 2EQ7A 3GWDA 1TRBA 4APNA 2C70A 1Y56B 2YR6A 4XWRA 4AT2A 2BC1A 2NPXA 3BHFA 1JEHA 4OPUA 1IUUA 1DOCA 2X3NA 1K0JA 4YXDA 4H4QA 1LQTA 1BGJA 2BS2A 1IJHA 3SFDA 4C3YA 4E0VA 5BRTA 1E1LA 1NHRA 1VG0A 4U8IA 1CJ3A 3K7MX 3UKAA 3CPJG 1ZP0A 2V3BA 1H84A 4Z25A 2BXSA 4GR1A 2BCPA 4BJZA 2GR0A 3V3NA 4A65A 3EANA 1ZOYA 1DNCA 3GSIA 1IUSA 3IC9A 3GRSA 4J36A 2QAEA 1KFYA 2WPEA 3ICTA 1NDAA 2R4JA 3KU9A 2WU2A 5U63A 2R0GA 2R0PA 4UDRA 3KKJA 5EOWA 1H82A 2H88A 2Q0LA 1NHQA 1Y56A 2WS3A 4A79A 3UCLA 1F8SA 4OPGA 2R46A 4C5OA 3CGDA 3GYIA 1OJAA 1S2YA 3NG7X 4A5LA 2WESA 4GF7A 1B5QA 1B8SA 5JCLA 2BS3A 2RGOA 3NLCA 1GESA 1OJCA 2C65A 4NZHA 1TDEA 2FJBA 3UOXA 3IF9A 1ZK7A 3AXBA 5C3JA 3QSMA 2A87A 2WU5A 1PJ5A 4C74A 4X4JA 1O95A 1O94A 2TMDA 2YR5A 3AYJA 3H4KA 2XVJA 3KD9A 4USRA 4ZCDA 4D04A 1BWCA 2WOVA 2R9ZA 3VQRA 4H2NA 1TYPA 1FEAA 2PHHA 1L9EA 2WDQA 3AEAA 3GD4A 1S2QA 2QA1A 2GB0A 3AECA 5IPYA 2V6OA 1GALA 3NN6X 4REKA 1H83A 3P4QA 1GETA 3OC4A 4TLZA 2X8HA 3KLJA 3CNTA 3RP8A 1LTXR 1TYTA 3GMCA 2DKIA 2YG4A 2WP9A 3II4A 1LPFA 2R45A 3DGHA 4NTEA 3LJPA 3O0HA 4Y4MA 3DA1A 2H89A 4XWZA 3UTFA 3V76A 3CPHG 4DSGA 1H7WA 3QJ4A 3S5WA 2EQ9A 1AOGA 3WE0A 4DGKA 4YTNA 2YLXA 4EM4A 1CC4A 1GRAA 4RG4A 1VQWA 1GT8A 1L9CA 1COYA 2BXRA 2ZZCA 3AEFA 1JNRA 2JK6A 2FJEA 2V61A 3P9UA 2YM2A 4FK1A 2A89A 4AP3A 1H81A 4O5QA 3NYEA 4A99A 4ADWA 1N4WA 4JY3A 1S3EA 3AEEA 3AD8B 2GQWA 4Z44A 2GAGB 2OAMA 1LJ1A 1LVLA 4Z24A 3IHMA 3M12A 2XLUA 2YG7A 2YG6A 2WDVA 3ITJA 3NIXA 2NVKX 4B63A 3UKKA 2WETA 1YY5A 4UDQA 4N9XA 1NHSA 1GRTA 1B37A 1XANA 3M0OA 3BNMA 5KRQA 3DJDA 3PVCA 1D5TA 1F8WA 4JQ9A 2Q7VA 2CDUA 2XCGA 2GF3A 4BK3A 4J34A 2YG5A 3D8XA 3NYCA 3UP4A 3UOZA 2XLTA 1O5WA 3K7TA 1DOBA 4HB9A 4K7ZA 4DSHA 2VVMA 3BI2A 2YVFA 4H2PA 1VDCA 2V3AA 2QA2A 2Q6UA 1N4VA 3VRBA 4Z2UA 1MXTA 1NAAA 2Q0KA 2OALA 2R4EA 1MOKA 1YKJA 2YVGA 4ZCCA 3T37A 3F8RA 1CJ4A 5FS8A 3C4AA 4AT0A 4BK1A 4ZN0A 3SM8A 2GMJA 4H7UA 1TDKA 2A8XA 4X9NA 1FCDA 3AE2A 2B9WA 1D4EA 3QSEA 3KA7A 1FOHA 1KNRA 3UKLA 4TM1A 2YVJA 1YQ4A 2OLOA 4FDCB 1PBBA 4LIIA 5DBJA 4FK1C 1DODA 3P4SA 5JCIA 1GPEA 1CJ2A 3FMWA 1E1NA 2X50A 1BGNA 2Z5YA 4U2LA 3UKPA 2Y6QA 4U8MA 2BYBA 4B67A 3BHKA 3DH9A 1GSNA 1PJ7A 5IQ1A 2VRLA 1FL2A 1F3PA 1REOA 3AE1A 3G5QA 3DMEA 1LQUA 3QVPA 5EBKA 3LB8A 1GERA 1ZX9A 3BI4A 4JNQA 4C3XA 2GR3A 1SEZA 1PS9A 3PO7A 2WEUA 5GSNA 1QJDA 2OA1A 4B65A 4B68A 1HYUA 4CNKA 4H4XA 4YKGA 2TPRA 3RNMA 1EL8A 3CPIG 2C72A 3LZXA 1BKWA 1JRYA 1PXAA 4YKFA 1YQZA 2YWLA 5JCNA 5FS7A 3NGCX 4JY2A 4EMWA 1OJ9A 1PDHA 4U8PA 1M64A 4I58A 3ADAB 4OVIA 3QVRA 3ISHA 1GOSA 4IVOB 4JDRA 5BUKA 1JRXA 4CY8A 1PBCA 1FEBA 2B9XA 4J56A 4TM3A 3FBSA 3CGBA 2C66A 3URHA 5IQ4A 2BCGG 3ABVA 1EBDA 2GV8A 2JBVA 2JKCA 1CHUA 1RYIA 4JN9A 3REDA 5KWFA 3BNUA 2WHDA 1Q9IA 1S3BA 1K0LA 2WPCA 1TDNA 3NNEA 4WX1A 1E6EA 1ZY8A 2DKHA 3ZDNA 2XVIA 3M13A 1VRQB 3GDNA 2R0CA 3AEBA 2WOWA 2F5ZA 2WP6A 2E5VA 3AYIA 2LFCA 4YSHA 4BK2A 1GRHA 1NEKA 2FJDA 1BF3A 2X8CA 3UOVA 1NG3A 3F8PA 5HY5A 1D4DA 2JB3A 3P1WA 4U8JA 1IUWA 2YR4A 3DK4A 3EF6A 1OJDA 2YLSA 1DJNA 4Y4LA 3DJGX 2C75A 5U1OA 1Z6LA 3GRTA 2B9YA 1KF6A 4YSYA 5BVAA 5J60A 3AEDA 3NRNA 4U8OA 1KSSA 4H4RA 3GWFA 4GDPA 1CL0A 1X31B 5HHFA 3RP7A 4CY6A 1JRZA 1PJ6A 1ELIA 1ZKQA 1GV4A 4YTMA 3K7QX 3B6DA 4NEWA 2EQ6A 2WQYA 4DNAA 5KVHA 2BK5A 2VRMA 5BULA
chains in the Genus database with same CATH superfamily
3AWIA 1GTHA 4YTPA 2BK4A 5EB5A 2GR1A 3AYLA 4NWZA 4X9MA 3VR8A 5GRTA 1EL5A 2ZZBA 2XFNA 3I6DA 2XVHA 3Q9TA 4J33A 3EAOA 1BZLA 2GH5A 4Z2TA 5HXIA 3CNJA 4GCMA 4NTCA 1W4XA 3KPFA 1EL9A 3OZ2A 4PAAA 4B66A 3H8LA 3Q6JA 2YLRA 2W0HA 3I3LA 1Q1RA 1TDFA 1ZOVA 4TLXA 3UKQA 1NHPA 4J2WA 3FG2P 3GD3A 2Z5XA 4FX9A 5M0ZA 4U8KA 5KXJA 4IA6A 2XLSA 1OJTA 1E1KA 2VQBA 3PS9A 2VZ2A 4EMJA 1PHHA 3G5SA 3ALLA 2YM1A 4H4WA 3ZYXA 1PBDA 1F6MA 2BC0A 4JNAA 1XHCA 4OPLA 4C77A 3JSKA 4B64A 1ZDLA 2CULA 2XVEA 1H86A 4EQXA 3AE4A 4XXGA 1QO8A 1D4CA 4H2RA 1PN0A 4YT0A 1NENA 4H4TA 4G74A 1GXFA 3S61A 4Z43A 4U2TA 1KNPA 4EM3A 2C3DA 1L9DA 3AE5A 4GRTA 4BJYA 4A7AA 2QCUA 2BABA 2CFYA 2VVLA 3NK2X 2Y6RA 2RGHA 3SFEA 5JCMA 1UKVG 1GRFA 2X8GA 1EL7A 1CC6A 3AE8A 3SGLA 1TDOA 4H4VA 3IWAA 3CTYA 3QFAA 2YG3A 4H50A 4Z2RA 3AE6A 3NT6A 4OPDA 4CNJA 2BACA 4U2SA 5KMRA 3F8DA 4O5UA 4CCQA 1N1PA 3QFBA 3C4NA 3T2ZA 2C67A 5CKUA 3RHAA 3UKFA 3L8KA 3LADA 4NEVA 4H4ZA 4K5SA 1E1MA 2GAHB 3ATRA 1NG4A 1ZMCA 2XFOA 2C3CA 3VRAA 3K30A 2GQFA 3NTDA 3AD7B 2BRYA 4J57A 2XFPA 1H6VA 4BURA 4CCRA 2C76A 2YLWA 3H8IA 1CC2A 5EB4A 3BI5A 2IIDA 1PXBA 2PYXA 2AAQA 2WDRA 1XPQA 1F8RA 2IVDA 2B7RA 3NK0X 2X99A 3ALMA 3NKSA 3CNSA 3T2YA 2VVLG 2YQUA 4TM0A 2GR2A 3VRDB 2V60A 4P9SA 3E1TA 3UP5A 1B4VA 4TM4A 4EIQA 3T31A 2YLTA 5ER0A 2WOIA 4OPTA 5FS6A 1D7YA 1P2HA 2B7SA 4RSLA 5FMHA 2GRTA 3AE3A 1GRBA 4A6NB 4AOSA 1NPXA 2VOUA 3DGZA 2EQ8A 2FBWA 2GMHA 4EQRA 3HYXA 1H7XA 1PXCA 2E4GA 4PABA 3UTHA 2C64A 4K2XA 4YSZA 3UTGA 4GDEA 4Z26A 4B1BA 4OCGA 4YSXA 5KVIA 4H4PA 2BK3A 2IVEA 3UKHA 1GRGA 1CBOA 1CF3A 2ZBWA 1RP0A 3HYWA 1IUXA 4NTDA 3B3RA 4EMIA 4OPCA 4G6GA 4USQA 3P4PA 4IV9A 5KOXA 4H4YA 1XDIA 4LU6A 3DJJA 3NHOX 2C73A 1P2EA 2JAEA 4ECHA 2XVFA 2RGJA 2RABA 4A6NA 4IVMB 3AB1A 3FIMB 3ICSA 3AE7A 3R9UA 4CRTA 4MJWA 1E7PA 3L1RA 2WPFA 3ALJA 3GDPA 4G73A 3SXIA 2GVCA 5KOWA 3T14A 3CIRA 3COXA 3SZFA 2O9ZA 1E39A 5U25A 3KVEA 4UP3A 2V5ZA 3IHGA 3LZWA 4M52A 1PBEA 3C96A 2YLZA 1GNDA 3UTEA 1ZMDA 3AEGA 4K5RA 2XLPA 4GUVA 4B69A 4UDPA 5C2TA 3RP6A 5M10A 2J3NA 4U8LA 1N4UA 2AR8A 2JB2A 2B76A 5TR3A 4A9WA 1MO9A 4AP1A 2BS4A 3CGCA 2BA9A 4ICYA 4YWOA 1Y0PA 4NNJA 1K0IA 1IUVA 4H2QA 2YAUA 2ACZA 4U8NA 1GEUA 3NK1X 3CNDA 4HA6A 4EQWA 2ARDA 2XYOA 4Y4NA 5LV9A 4G9KA 2HQMA 1DXLA 1Q1WA 3D1CA 4IA5A 1VG9A 3NH3X 1L0VA 5L46A 4KX6A 3ICRA 3NTAA 2UZZA 3SQPA 3LXDA 3QSSA 2WP5A 2I0ZA 2C7GA 4G6HA 4H4UA 2VQ7A 2CVJA 4KPRA 1K4QA 4CBQA 1M6IA 3DJEA 2GEWA 4LA1A 4WCTA 4BV6A 5HYMA 2XFQA 3CNPA 1JU2A 3P4RA 1DOEA 3CN8A 4D03A 3G5RA 1LV0A 5J7XA 1GREA 2WBAA 5JCKA 2XDOA 4AOXA 3FPZA 1KSUA 2XLRA 4J31A 2AQJA 3CGEA 2XFUA 1D7LA 4RG3A 3HZLA 1KDGA 2ZZ0A 1PBFA 1GTEA 4EIPA 3ATQA 3GMBA 3GYXA 3NYFA 1FECA 1JOAA 3SYIA 3V3OA 3AE9A 3GYJA 1QLBA 2JB1A 5CQFA 3AD9B 4K22A 1CJCA 2BRAA 1V59A 1JNZA 2APGA 4H4SA 4EQSA 3VR9A 2OLNA 1YQ3A 3LOVA 2E1MA 4II2A 4I59A 4OPIA 3DK8A 1ONFA 5FS9A 3DK9A 4K8DA 1DJQA 1RSGA 1IUTA 3EPTA 3NN0X 2FJAA 3UOYA 2EQ7A 3GWDA 1TRBA 4APNA 2C70A 1Y56B 2YR6A 4XWRA 4AT2A 2BC1A 2NPXA 3BHFA 1JEHA 4OPUA 1IUUA 1DOCA 2X3NA 1K0JA 4YXDA 4H4QA 1LQTA 1BGJA 2BS2A 1IJHA 4II3A 3SFDA 4C3YA 4E0VA 5BRTA 1E1LA 1NHRA 1VG0A 4U8IA 1CJ3A 3K7MX 3UKAA 3CPJG 1ZP0A 2V3BA 1H84A 4Z25A 2BXSA 4GR1A 2BCPA 4BJZA 2GR0A 3V3NA 4A65A 3EANA 1ZOYA 1DNCA 3GSIA 1IUSA 3IC9A 3GRSA 4J36A 2QAEA 1KFYA 2WPEA 3ICTA 1NDAA 2R4JA 3KU9A 2WU2A 5U63A 2R0GA 2R0PA 4GAVA 4UDRA 3KKJA 5EOWA 1H82A 2H88A 2Q0LA 1NHQA 1Y56A 2WS3A 4A79A 3UCLA 1F8SA 4OPGA 2R46A 4C5OA 3CGDA 3GYIA 1OJAA 1S2YA 3NG7X 4A5LA 2WESA 4GF7A 1B5QA 1B8SA 5JCLA 2BS3A 2RGOA 3NLCA 1GESA 1OJCA 2C65A 4NZHA 1TDEA 2FJBA 3UOXA 3IF9A 1ZK7A 3AXBA 5C3JA 3QSMA 2A87A 2WU5A 1PJ5A 4C74A 4X4JA 1O95A 1O94A 2TMDA 2YR5A 3AYJA 3H4KA 2XVJA 3KD9A 4USRA 4ZCDA 4D04A 1BWCA 2WOVA 2R9ZA 3VQRA 4H2NA 1TYPA 1FEAA 2PHHA 1L9EA 2WDQA 3AEAA 3GD4A 1S2QA 3CMMA 2QA1A 2GB0A 3AECA 5IPYA 2V6OA 1GALA 3NN6X 4REKA 1H83A 3P4QA 1GETA 3OC4A 4TLZA 2X8HA 3KLJA 3CNTA 3RP8A 1LTXR 1TYTA 3GMCA 2DKIA 2YG4A 2WP9A 3II4A 1LPFA 2R45A 3DGHA 4NTEA 3LJPA 3T2KA 3O0HA 4Y4MA 3DA1A 2H89A 4XWZA 3UTFA 3V76A 3CPHG 4DSGA 1H7WA 3QJ4A 3S5WA 2EQ9A 1AOGA 3WE0A 4DGKA 4GAPA 4YTNA 2YLXA 4EM4A 1CC4A 1GRAA 4RG4A 1VQWA 1GT8A 1L9CA 1COYA 2BXRA 2ZZCA 3AEFA 1JNRA 2JK6A 2FJEA 2V61A 3P9UA 2YM2A 4FK1A 2A89A 4AP3A 1H81A 4O5QA 3NYEA 5KMSA 4A99A 4ADWA 1N4WA 4JY3A 1S3EA 3AEEA 3AD8B 2GQWA 4Z44A 2GAGB 2OAMA 1LJ1A 5KMPA 1LVLA 4Z24A 3IHMA 3M12A 2XLUA 2YG7A 2YG6A 2WDVA 3ITJA 3KPKA 2NVKX 3NIXA 3UKKA 2WETA 1YY5A 4B63A 4UDQA 4N9XA 1NHSA 1GRTA 1B37A 1XANA 3M0OA 3BNMA 5KRQA 3DJDA 3PVCA 1D5TA 1F8WA 4JQ9A 2Q7VA 2CDUA 2XCGA 2GF3A 4BK3A 4J34A 2YG5A 3D8XA 3NYCA 3UP4A 3UOZA 2XLTA 1O5WA 3K7TA 1DOBA 4HB9A 4K7ZA 4DSHA 2VVMA 3BI2A 2YVFA 4H2PA 1VDCA 2V3AA 2QA2A 2Q6UA 1N4VA 3VRBA 4Z2UA 1MXTA 1NAAA 2Q0KA 2OALA 2R4EA 1MOKA 1YKJA 2YVGA 4ZCCA 3T37A 3F8RA 1CJ4A 5FS8A 3C4AA 4AT0A 4BK1A 4ZN0A 3SM8A 2GMJA 4H7UA 1TDKA 2A8XA 4X9NA 3HYVA 1FCDA 3AE2A 2B9WA 1D4EA 3QSEA 3SY4A 3KA7A 1FOHA 1KNRA 3UKLA 4TM1A 2YVJA 1YQ4A 2OLOA 2C4CA 1PBBA 4FDCB 4LIIA 4FK1C 1DODA 3P4SA 5DBJA 1GPEA 5JCIA 1CJ2A 3FMWA 1E1NA 2X50A 1BGNA 2Z5YA 4U2LA 3UKPA 2Y6QA 4U8MA 2BYBA 4B67A 3BHKA 3DH9A 1GSNA 1PJ7A 5IQ1A 2VRLA 1FL2A 1F3PA 1REOA 3AE1A 3T0KA 3G5QA 3DMEA 1LQUA 3QVPA 5EBKA 3LB8A 1GERA 1ZX9A 3BI4A 4JNQA 4C3XA 3SZWA 2GR3A 1SEZA 1PS9A 3PO7A 2WEUA 5GSNA 1QJDA 2OA1A 4B65A 4B68A 1HYUA 4CNKA 3SZ0A 4H4XA 4YKGA 2TPRA 3RNMA 1EL8A 3CPIG 2C72A 3LZXA 1BKWA 1JRYA 1PXAA 4YKFA 1YQZA 2YWLA 5KMQA 3SZCA 5JCNA 5FS7A 3NGCX 4JY2A 4EMWA 1OJ9A 1PDHA 4U8PA 1M64A 4I58A 3ADAB 4OVIA 3QVRA 3ISHA 1GOSA 5KNLA 4IVOB 4JDRA 5BUKA 1JRXA 4CY8A 1PBCA 1FEBA 2B9XA 4J56A 4TM3A 3SX6A 3FBSA 3CGBA 2C66A 3URHA 5IQ4A 2BCGG 3ABVA 1EBDA 2GV8A 2JBVA 2JKCA 1CHUA 1RYIA 4JN9A 3REDA 5KWFA 3BNUA 2WHDA 1Q9IA 1S3BA 1K0LA 2WPCA 1TDNA 3NNEA 4WX1A 1E6EA 1ZY8A 2DKHA 3ZDNA 2XVIA 3M13A 1VRQB 3GDNA 2R0CA 3AEBA 2WOWA 2F5ZA 2WP6A 2E5VA 3AYIA 2LFCA 4YSHA 4BK2A 1GRHA 1NEKA 2FJDA 1BF3A 2X8CA 3UOVA 1NG3A 3F8PA 5HY5A 1D4DA 2JB3A 3P1WA 4U8JA 1IUWA 2YR4A 3DK4A 3EF6A 1OJDA 2YLSA 1DJNA 4Y4LA 3DJGX 2C75A 5U1OA 1Z6LA 3GRTA 2B9YA 1KF6A 4YSYA 5BVAA 5J60A 3AEDA 3NRNA 4U8OA 1KSSA 4H4RA 3GWFA 4GDPA 1CL0A 1X31B 5HHFA 3RP7A 4CY6A 1JRZA 1PJ6A 1ELIA 1ZKQA 1GV4A 4YTMA 3K7QX 3B6DA 4NEWA 2EQ6A 2WQYA 4DNAA 5KVHA 2BK5A 2VRMA 5BULA
chains in the Genus database with same CATH topology
3AWIA 1GTHA 4YTPA 2BK4A 5EB5A 2GR1A 3AYLA 4NWZA 4X9MA 3VR8A 5GRTA 1EL5A 2ZZBA 2XFNA 3I6DA 2XVHA 3Q9TA 4J33A 3EAOA 1BZLA 2GH5A 4Z2TA 5HXIA 3CNJA 4GCMA 4NTCA 1W4XA 3KPFA 1EL9A 3OZ2A 4PAAA 4B66A 3H8LA 3Q6JA 2YLRA 2W0HA 3I3LA 1Q1RA 1TDFA 1ZOVA 4TLXA 3UKQA 1NHPA 4J2WA 3FG2P 3GD3A 2Z5XA 4FX9A 5M0ZA 4U8KA 5KXJA 4IA6A 2XLSA 1OJTA 1E1KA 2VQBA 3PS9A 2VZ2A 4EMJA 1PHHA 3G5SA 3ALLA 2YM1A 4H4WA 3ZYXA 1PBDA 1F6MA 2BC0A 4JNAA 1XHCA 4OPLA 4C77A 3JSKA 4B64A 1ZDLA 2CULA 2XVEA 1H86A 4EQXA 3AE4A 4XXGA 1QO8A 1D4CA 4H2RA 1PN0A 4YT0A 1NENA 4H4TA 4G74A 1GXFA 3S61A 4Z43A 4U2TA 1KNPA 4EM3A 2C3DA 1L9DA 3AE5A 4GRTA 4BJYA 4A7AA 2QCUA 2BABA 2CFYA 2VVLA 3NK2X 2Y6RA 2RGHA 3SFEA 5JCMA 1UKVG 1GRFA 2X8GA 1EL7A 1CC6A 3AE8A 3SGLA 1TDOA 4H4VA 3IWAA 3CTYA 3QFAA 2YG3A 4H50A 4Z2RA 3AE6A 3NT6A 4OPDA 4CNJA 2BACA 4U2SA 5KMRA 3F8DA 4O5UA 4CCQA 1N1PA 3QFBA 3C4NA 3T2ZA 2C67A 5CKUA 3RHAA 3UKFA 3L8KA 3LADA 4NEVA 4H4ZA 4K5SA 1E1MA 2GAHB 3ATRA 1NG4A 1ZMCA 2XFOA 2C3CA 3VRAA 3K30A 2GQFA 3NTDA 3AD7B 2BRYA 4J57A 2XFPA 1H6VA 4BURA 4CCRA 2C76A 2YLWA 3H8IA 1CC2A 5EB4A 3BI5A 2IIDA 1PXBA 2PYXA 2AAQA 2WDRA 1XPQA 1F8RA 2IVDA 2B7RA 3NK0X 2X99A 3ALMA 3NKSA 3CNSA 3T2YA 2VVLG 2YQUA 4TM0A 2GR2A 3VRDB 2V60A 4P9SA 3E1TA 3UP5A 1B4VA 4TM4A 4EIQA 3T31A 2YLTA 5ER0A 2WOIA 4OPTA 5FS6A 1D7YA 1P2HA 2B7SA 4RSLA 5FMHA 2GRTA 3AE3A 1GRBA 4A6NB 4AOSA 1NPXA 2VOUA 3DGZA 2EQ8A 2FBWA 2GMHA 4EQRA 3HYXA 1H7XA 1PXCA 2E4GA 4PABA 3UTHA 2C64A 4K2XA 4YSZA 3UTGA 4GDEA 4Z26A 4B1BA 4OCGA 4YSXA 5KVIA 4H4PA 2BK3A 2IVEA 3UKHA 1GRGA 1CBOA 1CF3A 2ZBWA 1RP0A 3HYWA 1IUXA 4NTDA 3B3RA 4EMIA 4OPCA 4G6GA 4USQA 3P4PA 4IV9A 5KOXA 4H4YA 1XDIA 4LU6A 3DJJA 3NHOX 2C73A 1P2EA 2JAEA 4ECHA 2XVFA 2RGJA 2RABA 4A6NA 4IVMB 3AB1A 3FIMB 3ICSA 3AE7A 3R9UA 4CRTA 4MJWA 1E7PA 3L1RA 2WPFA 3ALJA 3GDPA 4G73A 3SXIA 2GVCA 5KOWA 3T14A 3CIRA 3COXA 3SZFA 2O9ZA 1E39A 5U25A 3KVEA 4UP3A 2V5ZA 3IHGA 3LZWA 4M52A 1PBEA 3C96A 2YLZA 1GNDA 3UTEA 1ZMDA 3AEGA 4K5RA 2XLPA 4GUVA 4B69A 4UDPA 5C2TA 3RP6A 5M10A 2J3NA 4U8LA 1N4UA 2AR8A 2JB2A 2B76A 5TR3A 4A9WA 1MO9A 4AP1A 2BS4A 3CGCA 2BA9A 4ICYA 4YWOA 1Y0PA 4NNJA 1K0IA 1IUVA 4H2QA 2YAUA 2ACZA 4U8NA 1GEUA 3NK1X 3CNDA 4HA6A 4EQWA 2ARDA 2XYOA 4Y4NA 5LV9A 4G9KA 2HQMA 1DXLA 1Q1WA 3D1CA 4IA5A 1VG9A 3NH3X 1L0VA 5L46A 4KX6A 3ICRA 3NTAA 2UZZA 3SQPA 3LXDA 3QSSA 2WP5A 2I0ZA 2C7GA 4G6HA 4H4UA 2VQ7A 2CVJA 4KPRA 1K4QA 4CBQA 1M6IA 3DJEA 2GEWA 4LA1A 4WCTA 4BV6A 5HYMA 2XFQA 3CNPA 1JU2A 3P4RA 1DOEA 3CN8A 4D03A 3G5RA 1LV0A 5J7XA 1GREA 2WBAA 5JCKA 2XDOA 4AOXA 3FPZA 1KSUA 2XLRA 4J31A 2AQJA 3CGEA 2XFUA 1D7LA 4RG3A 3HZLA 1KDGA 2ZZ0A 1PBFA 1GTEA 4EIPA 3ATQA 3GMBA 3GYXA 3NYFA 1FECA 1JOAA 3SYIA 3V3OA 3AE9A 3GYJA 1QLBA 2JB1A 5CQFA 3AD9B 4K22A 1CJCA 2BRAA 1V59A 1JNZA 2APGA 4H4SA 4EQSA 3VR9A 2OLNA 1YQ3A 3LOVA 2E1MA 4II2A 4I59A 4OPIA 3DK8A 1ONFA 5FS9A 3DK9A 4K8DA 1DJQA 1RSGA 1IUTA 3EPTA 3NN0X 2FJAA 3UOYA 2EQ7A 3GWDA 1TRBA 4APNA 2C70A 1Y56B 2YR6A 4XWRA 4AT2A 2BC1A 2NPXA 3BHFA 1JEHA 4OPUA 1IUUA 1DOCA 2X3NA 1K0JA 4YXDA 4H4QA 1LQTA 1BGJA 2BS2A 1IJHA 4II3A 3SFDA 4C3YA 4E0VA 5BRTA 1E1LA 1NHRA 1VG0A 4U8IA 1CJ3A 3K7MX 3UKAA 3CPJG 1ZP0A 2V3BA 1H84A 4Z25A 2BXSA 4GR1A 2BCPA 4BJZA 2GR0A 3V3NA 4A65A 3EANA 1ZOYA 1DNCA 3GSIA 1IUSA 3IC9A 3GRSA 4J36A 2QAEA 1KFYA 2WPEA 3ICTA 1NDAA 2R4JA 3KU9A 2WU2A 5U63A 2R0GA 2R0PA 4GAVA 4UDRA 3KKJA 5EOWA 1H82A 2H88A 2Q0LA 1NHQA 1Y56A 2WS3A 4A79A 3UCLA 1F8SA 4OPGA 2R46A 4C5OA 3CGDA 3GYIA 1OJAA 1S2YA 3NG7X 4A5LA 2WESA 4GF7A 1B5QA 1B8SA 5JCLA 2BS3A 2RGOA 3NLCA 1GESA 1OJCA 2C65A 4NZHA 1TDEA 2FJBA 3UOXA 3IF9A 1ZK7A 3AXBA 5C3JA 3QSMA 2A87A 2WU5A 1PJ5A 4C74A 4X4JA 1O95A 1O94A 2TMDA 2YR5A 3AYJA 3H4KA 2XVJA 3KD9A 4USRA 4ZCDA 4D04A 1BWCA 2WOVA 2R9ZA 3VQRA 4H2NA 1TYPA 1FEAA 2PHHA 1L9EA 2WDQA 3AEAA 3GD4A 1S2QA 3CMMA 2QA1A 2GB0A 3AECA 5IPYA 2V6OA 1GALA 3NN6X 4REKA 1H83A 3P4QA 1GETA 3OC4A 4TLZA 2X8HA 3KLJA 3CNTA 3RP8A 1LTXR 1TYTA 3GMCA 2DKIA 2YG4A 2WP9A 3II4A 1LPFA 2R45A 3DGHA 4NTEA 3LJPA 3T2KA 3O0HA 4Y4MA 3DA1A 2H89A 4XWZA 3UTFA 3V76A 3CPHG 4DSGA 1H7WA 3QJ4A 3S5WA 2EQ9A 1AOGA 3WE0A 4DGKA 4GAPA 4YTNA 2YLXA 4EM4A 1CC4A 1GRAA 4RG4A 1VQWA 1GT8A 1L9CA 1COYA 2BXRA 2ZZCA 3AEFA 1JNRA 2JK6A 2FJEA 2V61A 3P9UA 2YM2A 4FK1A 2A89A 4AP3A 1H81A 4O5QA 3NYEA 5KMSA 4A99A 4ADWA 1N4WA 4JY3A 1S3EA 3AEEA 3AD8B 2GQWA 4Z44A 2GAGB 2OAMA 1LJ1A 5KMPA 1LVLA 4Z24A 3IHMA 3M12A 2XLUA 2YG7A 2YG6A 2WDVA 3ITJA 3KPKA 2NVKX 3NIXA 3UKKA 2WETA 1YY5A 4B63A 4UDQA 4N9XA 1NHSA 1GRTA 1B37A 1XANA 3M0OA 3BNMA 5KRQA 3DJDA 3PVCA 1D5TA 1F8WA 4JQ9A 2Q7VA 2CDUA 2XCGA 2GF3A 4BK3A 4J34A 2YG5A 3D8XA 3NYCA 3UP4A 3UOZA 2XLTA 1O5WA 3K7TA 1DOBA 4HB9A 4K7ZA 4DSHA 2VVMA 3BI2A 2YVFA 4H2PA 1VDCA 2V3AA 2QA2A 2Q6UA 1N4VA 3VRBA 4Z2UA 1MXTA 1NAAA 2Q0KA 2OALA 2R4EA 1MOKA 1YKJA 2YVGA 4ZCCA 3T37A 3F8RA 1CJ4A 5FS8A 3C4AA 4AT0A 4BK1A 4ZN0A 3SM8A 2GMJA 4H7UA 1TDKA 2A8XA 4X9NA 3HYVA 1FCDA 3AE2A 2B9WA 1D4EA 3QSEA 3SY4A 3KA7A 1FOHA 1KNRA 3UKLA 4TM1A 2YVJA 1YQ4A 2OLOA 2C4CA 1PBBA 4FDCB 4LIIA 4FK1C 1DODA 3P4SA 5DBJA 1GPEA 5JCIA 1CJ2A 3FMWA 1E1NA 2X50A 1BGNA 2Z5YA 4U2LA 3UKPA 2Y6QA 4U8MA 2BYBA 4B67A 3BHKA 3DH9A 1GSNA 1PJ7A 5IQ1A 2VRLA 1FL2A 1F3PA 1REOA 3AE1A 3T0KA 3G5QA 3DMEA 1LQUA 3QVPA 5EBKA 3LB8A 1GERA 1ZX9A 3BI4A 4JNQA 4C3XA 3SZWA 2GR3A 1SEZA 1PS9A 3PO7A 2WEUA 5GSNA 1QJDA 2OA1A 4B65A 4B68A 1HYUA 4CNKA 3SZ0A 4H4XA 4YKGA 2TPRA 3RNMA 1EL8A 3CPIG 2C72A 3LZXA 1BKWA 1JRYA 1PXAA 4YKFA 1YQZA 2YWLA 5KMQA 3SZCA 5JCNA 5FS7A 3NGCX 4JY2A 4EMWA 1OJ9A 1PDHA 4U8PA 1M64A 4I58A 3ADAB 4OVIA 3QVRA 3ISHA 1GOSA 5KNLA 4IVOB 4JDRA 5BUKA 1JRXA 4CY8A 1PBCA 1FEBA 2B9XA 4J56A 4TM3A 3SX6A 3FBSA 3CGBA 2C66A 3URHA 5IQ4A 2BCGG 3ABVA 1EBDA 2GV8A 2JBVA 2JKCA 1CHUA 1RYIA 4JN9A 3REDA 5KWFA 3BNUA 2WHDA 1Q9IA 1S3BA 1K0LA 2WPCA 1TDNA 3NNEA 4WX1A 1E6EA 1ZY8A 2DKHA 3ZDNA 2XVIA 3M13A 1VRQB 3GDNA 2R0CA 3AEBA 2WOWA 2F5ZA 2WP6A 2E5VA 3AYIA 2LFCA 4YSHA 4BK2A 1GRHA 1NEKA 2FJDA 1BF3A 2X8CA 3UOVA 1NG3A 3F8PA 5HY5A 1D4DA 2JB3A 3P1WA 4U8JA 1IUWA 2YR4A 3DK4A 3EF6A 1OJDA 2YLSA 1DJNA 4Y4LA 3DJGX 2C75A 5U1OA 1Z6LA 3GRTA 2B9YA 1KF6A 4YSYA 5BVAA 5J60A 3AEDA 3NRNA 4U8OA 1KSSA 4H4RA 3GWFA 4GDPA 1CL0A 1X31B 5HHFA 3RP7A 4CY6A 1JRZA 1PJ6A 1ELIA 1ZKQA 1GV4A 4YTMA 3K7QX 3B6DA 4NEWA 2EQ6A 2WQYA 4DNAA 5KVHA 2BK5A 2VRMA 5BULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWI A;  1GTH A;  4YTP A;  2BK4 A;  5EB5 A;  2GR1 A;  3AYL A;  4X9M A;  3VR8 A;  5GRT A;  1EL5 A;  2ZZB A;  2XFN A;  3I6D A;  2XVH A;  3Q9T A;  4J33 A;  3EAO A;  1BZL A;  2GH5 A;  4Z2T A;  5HXI A;  3CNJ A;  4GCM A;  4NTC A;  1W4X A;  3KPF A;  1EL9 A;  3OZ2 A;  4PAA A;  4B66 A;  3H8L A;  3Q6J A;  2YLR A;  2W0H A;  3I3L A;  1Q1R A;  1TDF A;  1ZOV A;  4TLX A;  3UKQ A;  1NHP A;  4J2W A;  3FG2 P;  3GD3 A;  2Z5X A;  4FX9 A;  5M0Z A;  4U8K A;  5KXJ A;  4IA6 A;  2XLS A;  1OJT A;  1E1K A;  2VQB A;  3PS9 A;  2VZ2 A;  4EMJ A;  1PHH A;  3G5S A;  3ALL A;  2YM1 A;  4H4W A;  3ZYX A;  1PBD A;  1F6M A;  2BC0 A;  4JNA A;  1XHC A;  4OPL A;  4C77 A;  3JSK A;  4B64 A;  1ZDL A;  2CUL A;  2XVE A;  1H86 A;  4EQX A;  3AE4 A;  4XXG A;  1QO8 A;  1D4C A;  4H2R A;  1PN0 A;  4YT0 A;  1NEN A;  4H4T A;  1GXF A;  3S61 A;  4Z43 A;  4U2T A;  1KNP A;  4EM3 A;  2C3D A;  1L9D A;  3AE5 A;  4GRT A;  4BJY A;  4A7A A;  2QCU A;  2BAB A;  2CFY A;  2VVL A;  3NK2 X;  2Y6R A;  2RGH A;  3SFE A;  5JCM A;  1UKV G;  1GRF A;  2X8G A;  1EL7 A;  1CC6 A;  3AE8 A;  3SGL A;  1TDO A;  4H4V A;  3IWA A;  3CTY A;  3QFA A;  2YG3 A;  4H50 A;  4Z2R A;  3AE6 A;  3NT6 A;  4OPD A;  4CNJ A;  2BAC A;  4U2S A;  3F8D A;  4O5U A;  4CCQ A;  1N1P A;  3QFB A;  3C4N A;  2C67 A;  5CKU A;  3RHA A;  3UKF A;  3L8K A;  3LAD A;  4NEV A;  4H4Z A;  4K5S A;  1E1M A;  2GAH B;  3ATR A;  1NG4 A;  1ZMC A;  2XFO A;  2C3C A;  3VRA A;  3K30 A;  2GQF A;  3NTD A;  3AD7 B;  4J57 A;  2XFP A;  1H6V A;  4BUR A;  4CCR A;  2C76 A;  2YLW A;  3H8I A;  1CC2 A;  5EB4 A;  3BI5 A;  2IID A;  1PXB A;  2PYX A;  2AAQ A;  2WDR A;  1XPQ A;  1F8R A;  2IVD A;  2B7R A;  3NK0 X;  2X99 A;  3ALM A;  3NKS A;  3CNS A;  2VVL G;  2YQU A;  4TM0 A;  2GR2 A;  3VRD B;  2V60 A;  4P9S A;  3E1T A;  3UP5 A;  1B4V A;  4TM4 A;  4EIQ A;  2YLT A;  5ER0 A;  2WOI A;  4OPT A;  5FS6 A;  1D7Y A;  1P2H A;  2B7S A;  4RSL A;  5FMH A;  2GRT A;  3AE3 A;  1GRB A;  4A6N B;  4AOS A;  1NPX A;  2VOU A;  3DGZ A;  2EQ8 A;  2FBW A;  2GMH A;  4EQR A;  1H7X A;  1PXC A;  2E4G A;  4PAB A;  3UTH A;  2C64 A;  4K2X A;  4YSZ A;  3UTG A;  4GDE A;  4Z26 A;  4B1B A;  4OCG A;  4YSX A;  5KVI A;  4H4P A;  2BK3 A;  2IVE A;  3UKH A;  1GRG A;  1CBO A;  1CF3 A;  2ZBW A;  1RP0 A;  1IUX A;  4NTD A;  3B3R A;  4EMI A;  4OPC A;  4USQ A;  3P4P A;  4IV9 A;  5KOX A;  4H4Y A;  1XDI A;  4LU6 A;  3DJJ A;  3NHO X;  2C73 A;  1P2E A;  2JAE A;  4ECH A;  2XVF A;  2RGJ A;  2RAB A;  4A6N A;  4IVM B;  3AB1 A;  3FIM B;  3ICS A;  3AE7 A;  3R9U A;  4CRT A;  4MJW A;  1E7P A;  3L1R A;  2WPF A;  3ALJ A;  3GDP A;  5KOW A;  2GVC A;  3CIR A;  3COX A;  2O9Z A;  1E39 A;  5U25 A;  3KVE A;  4UP3 A;  2V5Z A;  3IHG A;  3LZW A;  4M52 A;  1PBE A;  3C96 A;  2YLZ A;  1GND A;  3UTE A;  1ZMD A;  3AEG A;  4K5R A;  2XLP A;  4GUV A;  4B69 A;  4UDP A;  5C2T A;  3RP6 A;  5M10 A;  2J3N A;  4U8L A;  1N4U A;  2AR8 A;  2JB2 A;  2B76 A;  5TR3 A;  4A9W A;  1MO9 A;  4AP1 A;  2BS4 A;  3CGC A;  2BA9 A;  4ICY A;  4YWO A;  1Y0P A;  1K0I A;  1IUV A;  4H2Q A;  2YAU A;  2ACZ A;  4U8N A;  1GEU A;  3NK1 X;  3CND A;  4HA6 A;  4EQW A;  2ARD A;  2XYO A;  4Y4N A;  5LV9 A;  2HQM A;  1DXL A;  1Q1W A;  3D1C A;  4IA5 A;  1VG9 A;  3NH3 X;  1L0V A;  5L46 A;  4KX6 A;  3ICR A;  3NTA A;  2UZZ A;  3SQP A;  3LXD A;  3QSS A;  2WP5 A;  2I0Z A;  2C7G A;  4H4U A;  2VQ7 A;  2CVJ A;  4KPR A;  1K4Q A;  4CBQ A;  1M6I A;  3DJE A;  2GEW A;  4LA1 A;  4WCT A;  4BV6 A;  5HYM A;  2XFQ A;  3CNP A;  1JU2 A;  3P4R A;  1DOE A;  3CN8 A;  4D03 A;  3G5R A;  1LV0 A;  5J7X A;  1GRE A;  2WBA A;  5JCK A;  2XDO A;  4AOX A;  3FPZ A;  1KSU A;  2XLR A;  4J31 A;  2AQJ A;  3CGE A;  2XFU A;  1D7L A;  4RG3 A;  3HZL A;  1KDG A;  2ZZ0 A;  1PBF A;  1GTE A;  4EIP A;  3ATQ A;  3GMB A;  3GYX A;  3NYF A;  1FEC A;  1JOA A;  3V3O A;  3AE9 A;  3GYJ A;  1QLB A;  2JB1 A;  5CQF A;  3AD9 B;  4K22 A;  1CJC A;  1V59 A;  2APG A;  1JNZ A;  4H4S A;  4EQS A;  3VR9 A;  2OLN A;  1YQ3 A;  3LOV A;  2E1M A;  4I59 A;  4OPI A;  3DK8 A;  1ONF A;  5FS9 A;  3DK9 A;  4K8D A;  1DJQ A;  1RSG A;  1IUT A;  3EPT A;  3NN0 X;  2FJA A;  3UOY A;  2EQ7 A;  3GWD A;  1TRB A;  4APN A;  2C70 A;  1Y56 B;  2YR6 A;  4XWR A;  4AT2 A;  2BC1 A;  2NPX A;  3BHF A;  1JEH A;  4OPU A;  1IUU A;  1DOC A;  2X3N A;  1K0J A;  4YXD A;  4H4Q A;  1LQT A;  1BGJ A;  2BS2 A;  1IJH A;  3SFD A;  4C3Y A;  4E0V A;  5BRT A;  1E1L A;  1NHR A;  1VG0 A;  4U8I A;  1CJ3 A;  3K7M X;  3UKA A;  3CPJ G;  1ZP0 A;  2V3B A;  1H84 A;  4Z25 A;  2BXS A;  4GR1 A;  2BCP A;  4BJZ A;  2GR0 A;  3V3N A;  4A65 A;  3EAN A;  1ZOY A;  1DNC A;  3GSI A;  1IUS A;  3IC9 A;  3GRS A;  4J36 A;  2QAE A;  1KFY A;  2WPE A;  3ICT A;  1NDA A;  2R4J A;  3KU9 A;  2WU2 A;  5U63 A;  2R0G A;  2R0P A;  4UDR A;  3KKJ A;  5EOW A;  1H82 A;  2H88 A;  2Q0L A;  1NHQ A;  1Y56 A;  2WS3 A;  4A79 A;  3UCL A;  1F8S A;  4OPG A;  2R46 A;  4C5O A;  3CGD A;  3GYI A;  1OJA A;  1S2Y A;  3NG7 X;  4A5L A;  2WES A;  4GF7 A;  1B5Q A;  1B8S A;  5JCL A;  2BS3 A;  2RGO A;  3NLC A;  1GES A;  1OJC A;  2C65 A;  4NZH A;  1TDE A;  2FJB A;  3UOX A;  3IF9 A;  1ZK7 A;  3AXB A;  5C3J A;  3QSM A;  2A87 A;  2WU5 A;  1PJ5 A;  4C74 A;  4X4J A;  1O95 A;  1O94 A;  2TMD A;  2YR5 A;  3AYJ A;  3H4K A;  2XVJ A;  3KD9 A;  4USR A;  4ZCD A;  4D04 A;  1BWC A;  2WOV A;  2R9Z A;  3VQR A;  4H2N A;  1TYP A;  1FEA A;  2PHH A;  1L9E A;  2WDQ A;  3AEA A;  3GD4 A;  1S2Q A;  2QA1 A;  2GB0 A;  3AEC A;  5IPY A;  2V6O A;  1GAL A;  3NN6 X;  4REK A;  1H83 A;  3P4Q A;  1GET A;  3OC4 A;  4TLZ A;  2X8H A;  3KLJ A;  3CNT A;  3RP8 A;  1LTX R;  1TYT A;  3GMC A;  2DKI A;  2YG4 A;  2WP9 A;  3II4 A;  1LPF A;  2R45 A;  3DGH A;  4NTE A;  3LJP A;  3O0H A;  4Y4M A;  3DA1 A;  2H89 A;  4XWZ A;  3UTF A;  3V76 A;  3CPH G;  4DSG A;  1H7W A;  3QJ4 A;  3S5W A;  2EQ9 A;  1AOG A;  3WE0 A;  4DGK A;  4YTN A;  2YLX A;  4EM4 A;  1CC4 A;  1GRA A;  4RG4 A;  1VQW A;  1GT8 A;  1L9C A;  1COY A;  2BXR A;  2ZZC A;  3AEF A;  1JNR A;  2JK6 A;  2FJE A;  2V61 A;  3P9U A;  2YM2 A;  4FK1 A;  2A89 A;  4AP3 A;  1H81 A;  4O5Q A;  3NYE A;  4A99 A;  4ADW A;  1N4W A;  4JY3 A;  1S3E A;  3AEE A;  3AD8 B;  2GQW A;  4Z44 A;  2GAG B;  2OAM A;  1LJ1 A;  1LVL A;  4Z24 A;  3IHM A;  3M12 A;  2XLU A;  2YG7 A;  2YG6 A;  2WDV A;  3ITJ A;  3NIX A;  2NVK X;  4B63 A;  3UKK A;  2WET A;  1YY5 A;  4UDQ A;  4N9X A;  1NHS A;  1GRT A;  1B37 A;  1XAN A;  3M0O A;  3BNM A;  5KRQ A;  3DJD A;  3PVC A;  1D5T A;  1F8W A;  4JQ9 A;  2Q7V A;  2CDU A;  2XCG A;  2GF3 A;  4BK3 A;  4J34 A;  2YG5 A;  3D8X A;  3NYC A;  3UP4 A;  3UOZ A;  2XLT A;  1O5W A;  3K7T A;  1DOB A;  4HB9 A;  4K7Z A;  4DSH A;  2VVM A;  3BI2 A;  2YVF A;  4H2P A;  1VDC A;  2V3A A;  2QA2 A;  2Q6U A;  1N4V A;  3VRB A;  4Z2U A;  1MXT A;  1NAA A;  2Q0K A;  2OAL A;  2R4E A;  1MOK A;  1YKJ A;  2YVG A;  4ZCC A;  3T37 A;  3F8R A;  1CJ4 A;  5FS8 A;  3C4A A;  4AT0 A;  4BK1 A;  4ZN0 A;  3SM8 A;  2GMJ A;  4H7U A;  1TDK A;  2A8X A;  4X9N A;  1FCD A;  3AE2 A;  2B9W A;  1D4E A;  3QSE A;  3KA7 A;  1FOH A;  1KNR A;  3UKL A;  4TM1 A;  2YVJ A;  1YQ4 A;  2OLO A;  4FDC B;  1PBB A;  4LII A;  5DBJ A;  4FK1 C;  1DOD A;  3P4S A;  5JCI A;  1GPE A;  1CJ2 A;  3FMW A;  1E1N A;  2X50 A;  1BGN A;  2Z5Y A;  4U2L A;  3UKP A;  2Y6Q A;  4U8M A;  2BYB A;  4B67 A;  3BHK A;  3DH9 A;  1GSN A;  1PJ7 A;  5IQ1 A;  2VRL A;  1FL2 A;  1F3P A;  1REO A;  3AE1 A;  3G5Q A;  3DME A;  1LQU A;  3QVP A;  5EBK A;  3LB8 A;  1GER A;  1ZX9 A;  3BI4 A;  4JNQ A;  4C3X A;  2GR3 A;  1SEZ A;  1PS9 A;  3PO7 A;  2WEU A;  5GSN A;  1QJD A;  2OA1 A;  4B65 A;  4B68 A;  1HYU A;  4CNK A;  4H4X A;  4YKG A;  2TPR A;  3RNM A;  1EL8 A;  3CPI G;  2C72 A;  3LZX A;  1BKW A;  1JRY A;  1PXA A;  4YKF A;  1YQZ A;  2YWL A;  5JCN A;  5FS7 A;  3NGC X;  4JY2 A;  4EMW A;  1OJ9 A;  1PDH A;  4U8P A;  1M64 A;  4I58 A;  3ADA B;  4OVI A;  3QVR A;  3ISH A;  1GOS A;  4IVO B;  4JDR A;  5BUK A;  1JRX A;  4CY8 A;  1PBC A;  1FEB A;  2B9X A;  4J56 A;  4TM3 A;  3FBS A;  3CGB A;  2C66 A;  3URH A;  5IQ4 A;  2BCG G;  3ABV A;  1EBD A;  2GV8 A;  2JBV A;  2JKC A;  1CHU A;  1RYI A;  4JN9 A;  3RED A;  5KWF A;  3BNU A;  2WHD A;  1Q9I A;  1S3B A;  1K0L A;  2WPC A;  1TDN A;  3NNE A;  4WX1 A;  1E6E A;  1ZY8 A;  2DKH A;  3ZDN A;  2XVI A;  3M13 A;  1VRQ B;  3GDN A;  2R0C A;  3AEB A;  2WOW A;  2F5Z A;  2WP6 A;  2E5V A;  3AYI A;  2LFC A;  4YSH A;  4BK2 A;  1GRH A;  1NEK A;  2FJD A;  1BF3 A;  2X8C A;  3UOV A;  1NG3 A;  3F8P A;  5HY5 A;  1D4D A;  2JB3 A;  3P1W A;  4U8J A;  1IUW A;  2YR4 A;  3DK4 A;  3EF6 A;  1OJD A;  2YLS A;  1DJN A;  4Y4L A;  3DJG X;  2C75 A;  5U1O A;  1Z6L A;  3GRT A;  2B9Y A;  1KF6 A;  4YSY A;  5BVA A;  5J60 A;  3AED A;  3NRN A;  4U8O A;  1KSS A;  4H4R A;  3GWF A;  4GDP A;  1CL0 A;  1X31 B;  5HHF A;  3RP7 A;  4CY6 A;  1JRZ A;  1PJ6 A;  1ELI A;  1ZKQ A;  1GV4 A;  4YTM A;  3K7Q X;  3B6D A;  4NEW A;  2EQ6 A;  2WQY A;  4DNA A;  5KVH A;  2BK5 A;  2VRM A;  5BUL A; 
#chains in the Genus database with same CATH topology
 3AWI A;  1GTH A;  4YTP A;  2BK4 A;  5EB5 A;  2GR1 A;  3AYL A;  4NWZ A;  4X9M A;  3VR8 A;  5GRT A;  1EL5 A;  2ZZB A;  2XFN A;  3I6D A;  2XVH A;  3Q9T A;  4J33 A;  3EAO A;  1BZL A;  2GH5 A;  4Z2T A;  5HXI A;  3CNJ A;  4GCM A;  4NTC A;  1W4X A;  3KPF A;  1EL9 A;  3OZ2 A;  4PAA A;  4B66 A;  3H8L A;  3Q6J A;  2YLR A;  2W0H A;  3I3L A;  1Q1R A;  1TDF A;  1ZOV A;  4TLX A;  3UKQ A;  1NHP A;  4J2W A;  3FG2 P;  3GD3 A;  2Z5X A;  4FX9 A;  5M0Z A;  4U8K A;  5KXJ A;  4IA6 A;  2XLS A;  1OJT A;  1E1K A;  2VQB A;  3PS9 A;  2VZ2 A;  4EMJ A;  1PHH A;  3G5S A;  3ALL A;  2YM1 A;  4H4W A;  3ZYX A;  1PBD A;  1F6M A;  2BC0 A;  4JNA A;  1XHC A;  4OPL A;  4C77 A;  3JSK A;  4B64 A;  1ZDL A;  2CUL A;  2XVE A;  1H86 A;  4EQX A;  3AE4 A;  4XXG A;  1QO8 A;  1D4C A;  4H2R A;  1PN0 A;  4YT0 A;  1NEN A;  4H4T A;  4G74 A;  1GXF A;  3S61 A;  4Z43 A;  4U2T A;  1KNP A;  4EM3 A;  2C3D A;  1L9D A;  3AE5 A;  4GRT A;  4BJY A;  4A7A A;  2QCU A;  2BAB A;  2CFY A;  2VVL A;  3NK2 X;  2Y6R A;  2RGH A;  3SFE A;  5JCM A;  1UKV G;  1GRF A;  2X8G A;  1EL7 A;  1CC6 A;  3AE8 A;  3SGL A;  1TDO A;  4H4V A;  3IWA A;  3CTY A;  3QFA A;  2YG3 A;  4H50 A;  4Z2R A;  3AE6 A;  3NT6 A;  4OPD A;  4CNJ A;  2BAC A;  4U2S A;  5KMR A;  3F8D A;  4O5U A;  4CCQ A;  1N1P A;  3QFB A;  3C4N A;  3T2Z A;  2C67 A;  5CKU A;  3RHA A;  3UKF A;  3L8K A;  3LAD A;  4NEV A;  4H4Z A;  4K5S A;  1E1M A;  2GAH B;  3ATR A;  1NG4 A;  1ZMC A;  2XFO A;  2C3C A;  3VRA A;  3K30 A;  2GQF A;  3NTD A;  3AD7 B;  2BRY A;  4J57 A;  2XFP A;  1H6V A;  4BUR A;  4CCR A;  2C76 A;  2YLW A;  3H8I A;  1CC2 A;  5EB4 A;  3BI5 A;  2IID A;  1PXB A;  2PYX A;  2AAQ A;  2WDR A;  1XPQ A;  1F8R A;  2IVD A;  2B7R A;  3NK0 X;  2X99 A;  3ALM A;  3NKS A;  3CNS A;  3T2Y A;  2VVL G;  2YQU A;  4TM0 A;  2GR2 A;  3VRD B;  2V60 A;  4P9S A;  3E1T A;  3UP5 A;  1B4V A;  4TM4 A;  4EIQ A;  3T31 A;  2YLT A;  5ER0 A;  2WOI A;  4OPT A;  5FS6 A;  1D7Y A;  1P2H A;  2B7S A;  4RSL A;  5FMH A;  2GRT A;  3AE3 A;  1GRB A;  4A6N B;  4AOS A;  1NPX A;  2VOU A;  3DGZ A;  2EQ8 A;  2FBW A;  2GMH A;  4EQR A;  3HYX A;  1H7X A;  1PXC A;  2E4G A;  4PAB A;  3UTH A;  2C64 A;  4K2X A;  4YSZ A;  3UTG A;  4GDE A;  4Z26 A;  4B1B A;  4OCG A;  4YSX A;  5KVI A;  4H4P A;  2BK3 A;  2IVE A;  3UKH A;  1GRG A;  1CBO A;  1CF3 A;  2ZBW A;  1RP0 A;  3HYW A;  1IUX A;  4NTD A;  3B3R A;  4EMI A;  4OPC A;  4G6G A;  4USQ A;  3P4P A;  4IV9 A;  5KOX A;  4H4Y A;  1XDI A;  4LU6 A;  3DJJ A;  3NHO X;  2C73 A;  1P2E A;  2JAE A;  4ECH A;  2XVF A;  2RGJ A;  2RAB A;  4A6N A;  4IVM B;  3AB1 A;  3FIM B;  3ICS A;  3AE7 A;  3R9U A;  4CRT A;  4MJW A;  1E7P A;  3L1R A;  2WPF A;  3ALJ A;  3GDP A;  4G73 A;  3SXI A;  2GVC A;  5KOW A;  3T14 A;  3CIR A;  3COX A;  3SZF A;  2O9Z A;  1E39 A;  5U25 A;  3KVE A;  4UP3 A;  2V5Z A;  3IHG A;  3LZW A;  4M52 A;  1PBE A;  3C96 A;  2YLZ A;  1GND A;  3UTE A;  1ZMD A;  3AEG A;  4K5R A;  2XLP A;  4GUV A;  4B69 A;  4UDP A;  5C2T A;  3RP6 A;  5M10 A;  2J3N A;  4U8L A;  1N4U A;  2AR8 A;  2JB2 A;  2B76 A;  5TR3 A;  4A9W A;  1MO9 A;  4AP1 A;  2BS4 A;  3CGC A;  2BA9 A;  4ICY A;  4YWO A;  1Y0P A;  4NNJ A;  1K0I A;  1IUV A;  4H2Q A;  2YAU A;  2ACZ A;  4U8N A;  1GEU A;  3NK1 X;  3CND A;  4HA6 A;  4EQW A;  2ARD A;  2XYO A;  4Y4N A;  5LV9 A;  4G9K A;  2HQM A;  1DXL A;  1Q1W A;  3D1C A;  4IA5 A;  1VG9 A;  3NH3 X;  1L0V A;  5L46 A;  4KX6 A;  3ICR A;  3NTA A;  2UZZ A;  3SQP A;  3LXD A;  3QSS A;  2WP5 A;  2I0Z A;  2C7G A;  4G6H A;  4H4U A;  2VQ7 A;  2CVJ A;  4KPR A;  1K4Q A;  4CBQ A;  1M6I A;  3DJE A;  2GEW A;  4LA1 A;  4WCT A;  4BV6 A;  5HYM A;  2XFQ A;  3CNP A;  1JU2 A;  3P4R A;  1DOE A;  3CN8 A;  4D03 A;  3G5R A;  1LV0 A;  5J7X A;  1GRE A;  2WBA A;  5JCK A;  2XDO A;  4AOX A;  3FPZ A;  1KSU A;  2XLR A;  4J31 A;  2AQJ A;  3CGE A;  2XFU A;  1D7L A;  4RG3 A;  3HZL A;  1KDG A;  2ZZ0 A;  1PBF A;  1GTE A;  4EIP A;  3ATQ A;  3GMB A;  3GYX A;  3NYF A;  1FEC A;  1JOA A;  3SYI A;  3V3O A;  3AE9 A;  3GYJ A;  1QLB A;  2JB1 A;  5CQF A;  3AD9 B;  4K22 A;  1CJC A;  2BRA A;  1V59 A;  1JNZ A;  2APG A;  4H4S A;  4EQS A;  3VR9 A;  2OLN A;  1YQ3 A;  3LOV A;  2E1M A;  4II2 A;  4I59 A;  4OPI A;  3DK8 A;  1ONF A;  5FS9 A;  3DK9 A;  4K8D A;  1DJQ A;  1RSG A;  1IUT A;  3EPT A;  3NN0 X;  2FJA A;  3UOY A;  2EQ7 A;  3GWD A;  1TRB A;  4APN A;  2C70 A;  1Y56 B;  2YR6 A;  4XWR A;  4AT2 A;  2BC1 A;  2NPX A;  3BHF A;  1JEH A;  4OPU A;  1IUU A;  1DOC A;  2X3N A;  1K0J A;  4YXD A;  4H4Q A;  1LQT A;  1BGJ A;  2BS2 A;  1IJH A;  4II3 A;  3SFD A;  4C3Y A;  4E0V A;  5BRT A;  1E1L A;  1NHR A;  1VG0 A;  4U8I A;  1CJ3 A;  3K7M X;  3UKA A;  3CPJ G;  1ZP0 A;  2V3B A;  1H84 A;  4Z25 A;  2BXS A;  4GR1 A;  2BCP A;  4BJZ A;  2GR0 A;  3V3N A;  4A65 A;  3EAN A;  1ZOY A;  1DNC A;  3GSI A;  1IUS A;  3IC9 A;  3GRS A;  4J36 A;  2QAE A;  1KFY A;  2WPE A;  3ICT A;  1NDA A;  2R4J A;  3KU9 A;  2WU2 A;  5U63 A;  2R0G A;  2R0P A;  4GAV A;  4UDR A;  3KKJ A;  5EOW A;  1H82 A;  2H88 A;  2Q0L A;  1NHQ A;  1Y56 A;  2WS3 A;  4A79 A;  3UCL A;  1F8S A;  4OPG A;  2R46 A;  4C5O A;  3CGD A;  3GYI A;  1OJA A;  1S2Y A;  3NG7 X;  4A5L A;  2WES A;  4GF7 A;  1B5Q A;  1B8S A;  5JCL A;  2BS3 A;  2RGO A;  3NLC A;  1GES A;  1OJC A;  2C65 A;  4NZH A;  1TDE A;  2FJB A;  3UOX A;  3IF9 A;  1ZK7 A;  3AXB A;  5C3J A;  3QSM A;  2A87 A;  2WU5 A;  1PJ5 A;  4C74 A;  4X4J A;  1O95 A;  1O94 A;  2TMD A;  2YR5 A;  3AYJ A;  3H4K A;  2XVJ A;  3KD9 A;  4USR A;  4ZCD A;  4D04 A;  1BWC A;  2WOV A;  2R9Z A;  3VQR A;  4H2N A;  1TYP A;  1FEA A;  2PHH A;  1L9E A;  2WDQ A;  3AEA A;  3GD4 A;  1S2Q A;  3CMM A;  2QA1 A;  2GB0 A;  3AEC A;  5IPY A;  2V6O A;  1GAL A;  3NN6 X;  4REK A;  1H83 A;  3P4Q A;  1GET A;  3OC4 A;  4TLZ A;  2X8H A;  3KLJ A;  3CNT A;  3RP8 A;  1LTX R;  1TYT A;  3GMC A;  2DKI A;  2YG4 A;  2WP9 A;  3II4 A;  1LPF A;  2R45 A;  3DGH A;  4NTE A;  3LJP A;  3T2K A;  3O0H A;  4Y4M A;  3DA1 A;  2H89 A;  4XWZ A;  3UTF A;  3V76 A;  3CPH G;  4DSG A;  1H7W A;  3QJ4 A;  3S5W A;  2EQ9 A;  1AOG A;  3WE0 A;  4DGK A;  4GAP A;  4YTN A;  2YLX A;  4EM4 A;  1CC4 A;  1GRA A;  4RG4 A;  1VQW A;  1GT8 A;  1L9C A;  1COY A;  2BXR A;  2ZZC A;  3AEF A;  1JNR A;  2JK6 A;  2FJE A;  2V61 A;  3P9U A;  2YM2 A;  4FK1 A;  2A89 A;  4AP3 A;  1H81 A;  4O5Q A;  3NYE A;  5KMS A;  4A99 A;  4ADW A;  1N4W A;  4JY3 A;  1S3E A;  3AEE A;  3AD8 B;  2GQW A;  4Z44 A;  2GAG B;  2OAM A;  1LJ1 A;  5KMP A;  1LVL A;  4Z24 A;  3IHM A;  3M12 A;  2XLU A;  2YG7 A;  2YG6 A;  2WDV A;  3ITJ A;  3KPK A;  2NVK X;  3NIX A;  3UKK A;  2WET A;  1YY5 A;  4B63 A;  4UDQ A;  4N9X A;  1NHS A;  1GRT A;  1B37 A;  1XAN A;  3M0O A;  3BNM A;  5KRQ A;  3DJD A;  3PVC A;  1D5T A;  1F8W A;  4JQ9 A;  2Q7V A;  2CDU A;  2XCG A;  2GF3 A;  4BK3 A;  4J34 A;  2YG5 A;  3D8X A;  3NYC A;  3UP4 A;  3UOZ A;  2XLT A;  1O5W A;  3K7T A;  1DOB A;  4HB9 A;  4K7Z A;  4DSH A;  2VVM A;  3BI2 A;  2YVF A;  4H2P A;  1VDC A;  2V3A A;  2QA2 A;  2Q6U A;  1N4V A;  3VRB A;  4Z2U A;  1MXT A;  1NAA A;  2Q0K A;  2OAL A;  2R4E A;  1MOK A;  1YKJ A;  2YVG A;  4ZCC A;  3T37 A;  3F8R A;  1CJ4 A;  5FS8 A;  3C4A A;  4AT0 A;  4BK1 A;  4ZN0 A;  3SM8 A;  2GMJ A;  4H7U A;  1TDK A;  2A8X A;  4X9N A;  3HYV A;  1FCD A;  3AE2 A;  2B9W A;  1D4E A;  3QSE A;  3SY4 A;  3KA7 A;  1FOH A;  1KNR A;  3UKL A;  4TM1 A;  2YVJ A;  1YQ4 A;  2OLO A;  2C4C A;  1PBB A;  4FDC B;  4LII A;  4FK1 C;  1DOD A;  3P4S A;  5DBJ A;  1GPE A;  5JCI A;  1CJ2 A;  3FMW A;  1E1N A;  2X50 A;  1BGN A;  2Z5Y A;  4U2L A;  3UKP A;  2Y6Q A;  4U8M A;  2BYB A;  4B67 A;  3BHK A;  3DH9 A;  1GSN A;  1PJ7 A;  5IQ1 A;  2VRL A;  1FL2 A;  1F3P A;  1REO A;  3AE1 A;  3T0K A;  3G5Q A;  3DME A;  1LQU A;  3QVP A;  5EBK A;  3LB8 A;  1GER A;  1ZX9 A;  3BI4 A;  4JNQ A;  4C3X A;  3SZW A;  2GR3 A;  1SEZ A;  1PS9 A;  3PO7 A;  2WEU A;  5GSN A;  1QJD A;  2OA1 A;  4B65 A;  4B68 A;  1HYU A;  4CNK A;  3SZ0 A;  4H4X A;  4YKG A;  2TPR A;  3RNM A;  1EL8 A;  3CPI G;  2C72 A;  3LZX A;  1BKW A;  1JRY A;  1PXA A;  4YKF A;  1YQZ A;  2YWL A;  5KMQ A;  3SZC A;  5JCN A;  5FS7 A;  3NGC X;  4JY2 A;  4EMW A;  1OJ9 A;  1PDH A;  4U8P A;  1M64 A;  4I58 A;  3ADA B;  4OVI A;  3QVR A;  3ISH A;  1GOS A;  5KNL A;  4IVO B;  4JDR A;  5BUK A;  1JRX A;  4CY8 A;  1PBC A;  1FEB A;  2B9X A;  4J56 A;  4TM3 A;  3SX6 A;  3FBS A;  3CGB A;  2C66 A;  3URH A;  5IQ4 A;  2BCG G;  3ABV A;  1EBD A;  2GV8 A;  2JBV A;  2JKC A;  1CHU A;  1RYI A;  4JN9 A;  3RED A;  5KWF A;  3BNU A;  2WHD A;  1Q9I A;  1S3B A;  1K0L A;  2WPC A;  1TDN A;  3NNE A;  4WX1 A;  1E6E A;  1ZY8 A;  2DKH A;  3ZDN A;  2XVI A;  3M13 A;  1VRQ B;  3GDN A;  2R0C A;  3AEB A;  2WOW A;  2F5Z A;  2WP6 A;  2E5V A;  3AYI A;  2LFC A;  4YSH A;  4BK2 A;  1GRH A;  1NEK A;  2FJD A;  1BF3 A;  2X8C A;  3UOV A;  1NG3 A;  3F8P A;  5HY5 A;  1D4D A;  2JB3 A;  3P1W A;  4U8J A;  1IUW A;  2YR4 A;  3DK4 A;  3EF6 A;  1OJD A;  2YLS A;  1DJN A;  4Y4L A;  3DJG X;  2C75 A;  5U1O A;  1Z6L A;  3GRT A;  2B9Y A;  1KF6 A;  4YSY A;  5BVA A;  5J60 A;  3AED A;  3NRN A;  4U8O A;  1KSS A;  4H4R A;  3GWF A;  4GDP A;  1CL0 A;  1X31 B;  5HHF A;  3RP7 A;  4CY6 A;  1JRZ A;  1PJ6 A;  1ELI A;  1ZKQ A;  1GV4 A;  4YTM A;  3K7Q X;  3B6D A;  4NEW A;  2EQ6 A;  2WQY A;  4DNA A;  5KVH A;  2BK5 A;  2VRM A;  5BUL A; 
#chains in the Genus database with same CATH homology
 3AWI A;  1GTH A;  4YTP A;  2BK4 A;  5EB5 A;  2GR1 A;  3AYL A;  4NWZ A;  4X9M A;  3VR8 A;  5GRT A;  1EL5 A;  2ZZB A;  2XFN A;  3I6D A;  2XVH A;  3Q9T A;  4J33 A;  3EAO A;  1BZL A;  2GH5 A;  4Z2T A;  5HXI A;  3CNJ A;  4GCM A;  4NTC A;  1W4X A;  3KPF A;  1EL9 A;  3OZ2 A;  4PAA A;  4B66 A;  3H8L A;  3Q6J A;  2YLR A;  2W0H A;  3I3L A;  1Q1R A;  1TDF A;  1ZOV A;  4TLX A;  3UKQ A;  1NHP A;  4J2W A;  3FG2 P;  3GD3 A;  2Z5X A;  4FX9 A;  5M0Z A;  4U8K A;  5KXJ A;  4IA6 A;  2XLS A;  1OJT A;  1E1K A;  2VQB A;  3PS9 A;  2VZ2 A;  4EMJ A;  1PHH A;  3G5S A;  3ALL A;  2YM1 A;  4H4W A;  3ZYX A;  1PBD A;  1F6M A;  2BC0 A;  4JNA A;  1XHC A;  4OPL A;  4C77 A;  3JSK A;  4B64 A;  1ZDL A;  2CUL A;  2XVE A;  1H86 A;  4EQX A;  3AE4 A;  4XXG A;  1QO8 A;  1D4C A;  4H2R A;  1PN0 A;  4YT0 A;  1NEN A;  4H4T A;  4G74 A;  1GXF A;  3S61 A;  4Z43 A;  4U2T A;  1KNP A;  4EM3 A;  2C3D A;  1L9D A;  3AE5 A;  4GRT A;  4BJY A;  4A7A A;  2QCU A;  2BAB A;  2CFY A;  2VVL A;  3NK2 X;  2Y6R A;  2RGH A;  3SFE A;  5JCM A;  1UKV G;  1GRF A;  2X8G A;  1EL7 A;  1CC6 A;  3AE8 A;  3SGL A;  1TDO A;  4H4V A;  3IWA A;  3CTY A;  3QFA A;  2YG3 A;  4H50 A;  4Z2R A;  3AE6 A;  3NT6 A;  4OPD A;  4CNJ A;  2BAC A;  4U2S A;  5KMR A;  3F8D A;  4O5U A;  4CCQ A;  1N1P A;  3QFB A;  3C4N A;  3T2Z A;  2C67 A;  5CKU A;  3RHA A;  3UKF A;  3L8K A;  3LAD A;  4NEV A;  4H4Z A;  4K5S A;  1E1M A;  2GAH B;  3ATR A;  1NG4 A;  1ZMC A;  2XFO A;  2C3C A;  3VRA A;  3K30 A;  2GQF A;  3NTD A;  3AD7 B;  2BRY A;  4J57 A;  2XFP A;  1H6V A;  4BUR A;  4CCR A;  2C76 A;  2YLW A;  3H8I A;  1CC2 A;  5EB4 A;  3BI5 A;  2IID A;  1PXB A;  2PYX A;  2AAQ A;  2WDR A;  1XPQ A;  1F8R A;  2IVD A;  2B7R A;  3NK0 X;  2X99 A;  3ALM A;  3NKS A;  3CNS A;  3T2Y A;  2VVL G;  2YQU A;  4TM0 A;  2GR2 A;  3VRD B;  2V60 A;  4P9S A;  3E1T A;  3UP5 A;  1B4V A;  4TM4 A;  4EIQ A;  3T31 A;  2YLT A;  5ER0 A;  2WOI A;  4OPT A;  5FS6 A;  1D7Y A;  1P2H A;  2B7S A;  4RSL A;  5FMH A;  2GRT A;  3AE3 A;  1GRB A;  4A6N B;  4AOS A;  1NPX A;  2VOU A;  3DGZ A;  2EQ8 A;  2FBW A;  2GMH A;  4EQR A;  3HYX A;  1H7X A;  1PXC A;  2E4G A;  4PAB A;  3UTH A;  2C64 A;  4K2X A;  4YSZ A;  3UTG A;  4GDE A;  4Z26 A;  4B1B A;  4OCG A;  4YSX A;  5KVI A;  4H4P A;  2BK3 A;  2IVE A;  3UKH A;  1GRG A;  1CBO A;  1CF3 A;  2ZBW A;  1RP0 A;  3HYW A;  1IUX A;  4NTD A;  3B3R A;  4EMI A;  4OPC A;  4G6G A;  4USQ A;  3P4P A;  4IV9 A;  5KOX A;  4H4Y A;  1XDI A;  4LU6 A;  3DJJ A;  3NHO X;  2C73 A;  1P2E A;  2JAE A;  4ECH A;  2XVF A;  2RGJ A;  2RAB A;  4A6N A;  4IVM B;  3AB1 A;  3FIM B;  3ICS A;  3AE7 A;  3R9U A;  4CRT A;  4MJW A;  1E7P A;  3L1R A;  2WPF A;  3ALJ A;  3GDP A;  4G73 A;  3SXI A;  2GVC A;  5KOW A;  3T14 A;  3CIR A;  3COX A;  3SZF A;  2O9Z A;  1E39 A;  5U25 A;  3KVE A;  4UP3 A;  2V5Z A;  3IHG A;  3LZW A;  4M52 A;  1PBE A;  3C96 A;  2YLZ A;  1GND A;  3UTE A;  1ZMD A;  3AEG A;  4K5R A;  2XLP A;  4GUV A;  4B69 A;  4UDP A;  5C2T A;  3RP6 A;  5M10 A;  2J3N A;  4U8L A;  1N4U A;  2AR8 A;  2JB2 A;  2B76 A;  5TR3 A;  4A9W A;  1MO9 A;  4AP1 A;  2BS4 A;  3CGC A;  2BA9 A;  4ICY A;  4YWO A;  1Y0P A;  4NNJ A;  1K0I A;  1IUV A;  4H2Q A;  2YAU A;  2ACZ A;  4U8N A;  1GEU A;  3NK1 X;  3CND A;  4HA6 A;  4EQW A;  2ARD A;  2XYO A;  4Y4N A;  5LV9 A;  4G9K A;  2HQM A;  1DXL A;  1Q1W A;  3D1C A;  4IA5 A;  1VG9 A;  3NH3 X;  1L0V A;  5L46 A;  4KX6 A;  3ICR A;  3NTA A;  2UZZ A;  3SQP A;  3LXD A;  3QSS A;  2WP5 A;  2I0Z A;  2C7G A;  4G6H A;  4H4U A;  2VQ7 A;  2CVJ A;  4KPR A;  1K4Q A;  4CBQ A;  1M6I A;  3DJE A;  2GEW A;  4LA1 A;  4WCT A;  4BV6 A;  5HYM A;  2XFQ A;  3CNP A;  1JU2 A;  3P4R A;  1DOE A;  3CN8 A;  4D03 A;  3G5R A;  1LV0 A;  5J7X A;  1GRE A;  2WBA A;  5JCK A;  2XDO A;  4AOX A;  3FPZ A;  1KSU A;  2XLR A;  4J31 A;  2AQJ A;  3CGE A;  2XFU A;  1D7L A;  4RG3 A;  3HZL A;  1KDG A;  2ZZ0 A;  1PBF A;  1GTE A;  4EIP A;  3ATQ A;  3GMB A;  3GYX A;  3NYF A;  1FEC A;  1JOA A;  3SYI A;  3V3O A;  3AE9 A;  3GYJ A;  1QLB A;  2JB1 A;  5CQF A;  3AD9 B;  4K22 A;  1CJC A;  2BRA A;  1V59 A;  1JNZ A;  2APG A;  4H4S A;  4EQS A;  3VR9 A;  2OLN A;  1YQ3 A;  3LOV A;  2E1M A;  4II2 A;  4I59 A;  4OPI A;  3DK8 A;  1ONF A;  5FS9 A;  3DK9 A;  4K8D A;  1DJQ A;  1RSG A;  1IUT A;  3EPT A;  3NN0 X;  2FJA A;  3UOY A;  2EQ7 A;  3GWD A;  1TRB A;  4APN A;  2C70 A;  1Y56 B;  2YR6 A;  4XWR A;  4AT2 A;  2BC1 A;  2NPX A;  3BHF A;  1JEH A;  4OPU A;  1IUU A;  1DOC A;  2X3N A;  1K0J A;  4YXD A;  4H4Q A;  1LQT A;  1BGJ A;  2BS2 A;  1IJH A;  4II3 A;  3SFD A;  4C3Y A;  4E0V A;  5BRT A;  1E1L A;  1NHR A;  1VG0 A;  4U8I A;  1CJ3 A;  3K7M X;  3UKA A;  3CPJ G;  1ZP0 A;  2V3B A;  1H84 A;  4Z25 A;  2BXS A;  4GR1 A;  2BCP A;  4BJZ A;  2GR0 A;  3V3N A;  4A65 A;  3EAN A;  1ZOY A;  1DNC A;  3GSI A;  1IUS A;  3IC9 A;  3GRS A;  4J36 A;  2QAE A;  1KFY A;  2WPE A;  3ICT A;  1NDA A;  2R4J A;  3KU9 A;  2WU2 A;  5U63 A;  2R0G A;  2R0P A;  4GAV A;  4UDR A;  3KKJ A;  5EOW A;  1H82 A;  2H88 A;  2Q0L A;  1NHQ A;  1Y56 A;  2WS3 A;  4A79 A;  3UCL A;  1F8S A;  4OPG A;  2R46 A;  4C5O A;  3CGD A;  3GYI A;  1OJA A;  1S2Y A;  3NG7 X;  4A5L A;  2WES A;  4GF7 A;  1B5Q A;  1B8S A;  5JCL A;  2BS3 A;  2RGO A;  3NLC A;  1GES A;  1OJC A;  2C65 A;  4NZH A;  1TDE A;  2FJB A;  3UOX A;  3IF9 A;  1ZK7 A;  3AXB A;  5C3J A;  3QSM A;  2A87 A;  2WU5 A;  1PJ5 A;  4C74 A;  4X4J A;  1O95 A;  1O94 A;  2TMD A;  2YR5 A;  3AYJ A;  3H4K A;  2XVJ A;  3KD9 A;  4USR A;  4ZCD A;  4D04 A;  1BWC A;  2WOV A;  2R9Z A;  3VQR A;  4H2N A;  1TYP A;  1FEA A;  2PHH A;  1L9E A;  2WDQ A;  3AEA A;  3GD4 A;  1S2Q A;  3CMM A;  2QA1 A;  2GB0 A;  3AEC A;  5IPY A;  2V6O A;  1GAL A;  3NN6 X;  4REK A;  1H83 A;  3P4Q A;  1GET A;  3OC4 A;  4TLZ A;  2X8H A;  3KLJ A;  3CNT A;  3RP8 A;  1LTX R;  1TYT A;  3GMC A;  2DKI A;  2YG4 A;  2WP9 A;  3II4 A;  1LPF A;  2R45 A;  3DGH A;  4NTE A;  3LJP A;  3T2K A;  3O0H A;  4Y4M A;  3DA1 A;  2H89 A;  4XWZ A;  3UTF A;  3V76 A;  3CPH G;  4DSG A;  1H7W A;  3QJ4 A;  3S5W A;  2EQ9 A;  1AOG A;  3WE0 A;  4DGK A;  4GAP A;  4YTN A;  2YLX A;  4EM4 A;  1CC4 A;  1GRA A;  4RG4 A;  1VQW A;  1GT8 A;  1L9C A;  1COY A;  2BXR A;  2ZZC A;  3AEF A;  1JNR A;  2JK6 A;  2FJE A;  2V61 A;  3P9U A;  2YM2 A;  4FK1 A;  2A89 A;  4AP3 A;  1H81 A;  4O5Q A;  3NYE A;  5KMS A;  4A99 A;  4ADW A;  1N4W A;  4JY3 A;  1S3E A;  3AEE A;  3AD8 B;  2GQW A;  4Z44 A;  2GAG B;  2OAM A;  1LJ1 A;  5KMP A;  1LVL A;  4Z24 A;  3IHM A;  3M12 A;  2XLU A;  2YG7 A;  2YG6 A;  2WDV A;  3ITJ A;  3KPK A;  2NVK X;  3NIX A;  3UKK A;  2WET A;  1YY5 A;  4B63 A;  4UDQ A;  4N9X A;  1NHS A;  1GRT A;  1B37 A;  1XAN A;  3M0O A;  3BNM A;  5KRQ A;  3DJD A;  3PVC A;  1D5T A;  1F8W A;  4JQ9 A;  2Q7V A;  2CDU A;  2XCG A;  2GF3 A;  4BK3 A;  4J34 A;  2YG5 A;  3D8X A;  3NYC A;  3UP4 A;  3UOZ A;  2XLT A;  1O5W A;  3K7T A;  1DOB A;  4HB9 A;  4K7Z A;  4DSH A;  2VVM A;  3BI2 A;  2YVF A;  4H2P A;  1VDC A;  2V3A A;  2QA2 A;  2Q6U A;  1N4V A;  3VRB A;  4Z2U A;  1MXT A;  1NAA A;  2Q0K A;  2OAL A;  2R4E A;  1MOK A;  1YKJ A;  2YVG A;  4ZCC A;  3T37 A;  3F8R A;  1CJ4 A;  5FS8 A;  3C4A A;  4AT0 A;  4BK1 A;  4ZN0 A;  3SM8 A;  2GMJ A;  4H7U A;  1TDK A;  2A8X A;  4X9N A;  3HYV A;  1FCD A;  3AE2 A;  2B9W A;  1D4E A;  3QSE A;  3SY4 A;  3KA7 A;  1FOH A;  1KNR A;  3UKL A;  4TM1 A;  2YVJ A;  1YQ4 A;  2OLO A;  2C4C A;  1PBB A;  4FDC B;  4LII A;  4FK1 C;  1DOD A;  3P4S A;  5DBJ A;  1GPE A;  5JCI A;  1CJ2 A;  3FMW A;  1E1N A;  2X50 A;  1BGN A;  2Z5Y A;  4U2L A;  3UKP A;  2Y6Q A;  4U8M A;  2BYB A;  4B67 A;  3BHK A;  3DH9 A;  1GSN A;  1PJ7 A;  5IQ1 A;  2VRL A;  1FL2 A;  1F3P A;  1REO A;  3AE1 A;  3T0K A;  3G5Q A;  3DME A;  1LQU A;  3QVP A;  5EBK A;  3LB8 A;  1GER A;  1ZX9 A;  3BI4 A;  4JNQ A;  4C3X A;  3SZW A;  2GR3 A;  1SEZ A;  1PS9 A;  3PO7 A;  2WEU A;  5GSN A;  1QJD A;  2OA1 A;  4B65 A;  4B68 A;  1HYU A;  4CNK A;  3SZ0 A;  4H4X A;  4YKG A;  2TPR A;  3RNM A;  1EL8 A;  3CPI G;  2C72 A;  3LZX A;  1BKW A;  1JRY A;  1PXA A;  4YKF A;  1YQZ A;  2YWL A;  5KMQ A;  3SZC A;  5JCN A;  5FS7 A;  3NGC X;  4JY2 A;  4EMW A;  1OJ9 A;  1PDH A;  4U8P A;  1M64 A;  4I58 A;  3ADA B;  4OVI A;  3QVR A;  3ISH A;  1GOS A;  5KNL A;  4IVO B;  4JDR A;  5BUK A;  1JRX A;  4CY8 A;  1PBC A;  1FEB A;  2B9X A;  4J56 A;  4TM3 A;  3SX6 A;  3FBS A;  3CGB A;  2C66 A;  3URH A;  5IQ4 A;  2BCG G;  3ABV A;  1EBD A;  2GV8 A;  2JBV A;  2JKC A;  1CHU A;  1RYI A;  4JN9 A;  3RED A;  5KWF A;  3BNU A;  2WHD A;  1Q9I A;  1S3B A;  1K0L A;  2WPC A;  1TDN A;  3NNE A;  4WX1 A;  1E6E A;  1ZY8 A;  2DKH A;  3ZDN A;  2XVI A;  3M13 A;  1VRQ B;  3GDN A;  2R0C A;  3AEB A;  2WOW A;  2F5Z A;  2WP6 A;  2E5V A;  3AYI A;  2LFC A;  4YSH A;  4BK2 A;  1GRH A;  1NEK A;  2FJD A;  1BF3 A;  2X8C A;  3UOV A;  1NG3 A;  3F8P A;  5HY5 A;  1D4D A;  2JB3 A;  3P1W A;  4U8J A;  1IUW A;  2YR4 A;  3DK4 A;  3EF6 A;  1OJD A;  2YLS A;  1DJN A;  4Y4L A;  3DJG X;  2C75 A;  5U1O A;  1Z6L A;  3GRT A;  2B9Y A;  1KF6 A;  4YSY A;  5BVA A;  5J60 A;  3AED A;  3NRN A;  4U8O A;  1KSS A;  4H4R A;  3GWF A;  4GDP A;  1CL0 A;  1X31 B;  5HHF A;  3RP7 A;  4CY6 A;  1JRZ A;  1PJ6 A;  1ELI A;  1ZKQ A;  1GV4 A;  4YTM A;  3K7Q X;  3B6D A;  4NEW A;  2EQ6 A;  2WQY A;  4DNA A;  5KVH A;  2BK5 A;  2VRM A;  5BUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...