4AT0A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
483
structure length
483
Chain Sequence
IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
total genus 164
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at0A02
1PXBA 5GRTA 4NTCA 4U8JA 3FBSA 3Q6JA 3UTHA 3ALMA 2DKIA 2YR4A 4OPDA 5J60A 2GR2A 1PBFA 2V3AA 3AE1A 4BJZA 4OPIA 3UTFA 5JCKA 2JAEA 4A6NB 2R45A 4OPUA 2Q0LA 3IWAA 4H2RA 5KVHA 3EANA 1AOGA 4H2NA 1CC4A 4U8MA 2WHDA 1CJCA 2WBAA 4Z26A 2VQBA 4JNAA 4EM3A 1H7XA 4JN9A 2GR3A 3DGZA 4A6NA 2I0ZA 2J3NA 1IUVA 1YY5A 2UZZA 1B37A 3AXBA 1NHQA 3COXA 3ICTA 4J2WA 4IVMB 2O9ZA 3CN8A 3LZXA 4BV6A 4IVOB 1L0VA 1UKVG 4H4SA 3L8KA 2YLRA 3RP6A 2BA9A 2BXSA 3H8IA 4BK3A 2XLUA 2EQ7A 3NIXA 3NTDA 5IPYA 5J7XA 2FJDA 1JRXA 1D7LA 2C67A 1BGJA 1XHCA 1YKJA 2XFUA 2ZBWA 3GDNA 3IHMA 3QFBA 5U63A 3NHOX 3ZYXA 5IQ4A 2E5VA 1EL9A 1GNDA 3KPFA 2WOWA 1L9EA 1XPQA 4OPLA 2V61A 1DOCA 4UP3A 2XLRA 2C64A 1GRFA 3CNJA 1FOHA 4K8DA 1YQ4A 4YTMA 4EQRA 1PDHA 2B9YA 2R0PA 4J36A 3D8XA 4JY3A 4GR1A 3AEBA 5IQ1A 5EB4A 4ZN0A 2A87A 2C70A 3UP4A 1BZLA 1VDCA 5KWFA 4ZCDA 4TM0A 2BK4A 2CULA 3GD3A 1PXAA 1CC6A 1JEHA 3CPHG 3KD9A 1PBCA 2XVFA 1GXFA 5KOXA 4AP1A 4CCQA 4A7AA 3AEDA 1LPFA 2GQWA 4K22A 3GWDA 1JRZA 1GSNA 4O5UA 2AQJA 4EIQA 1O94A 4A79A 4OVIA 2WOVA 3CPJG 3NK1X 4A9WA 2GB0A 1D5TA 2CVJA 4PABA 3UKAA 3O0HA 3AYLA 3URHA 1CBOA 5L46A 2GAGB 3ATRA 1RYIA 4Z44A 3RP8A 1H84A 5JCLA 4Y4NA 1NAAA 3CGDA 4UDRA 3CGCA 1EL8A 1KSSA 2JB2A 2Q7VA 3GWFA 4H7UA 3QSMA 4NTDA 4N9XA 2X8CA 1PN0A 3KVEA 4GUVA 3AYJA 3JSKA 4X9MA 4K2XA 2R4JA 4MJWA 4WCTA 5U25A 1D4CA 2XLPA 3SM8A 1PXCA 1IUWA 3UKPA 2ARDA 3AE5A 2WPCA 4CNKA 2V60A 1KNPA 1O95A 5C2TA 3EAOA 1K0IA 2QCUA 3H8LA 1B5QA 4GDPA 4ADWA 4NTEA 3UKKA 4ICYA 3V76A 4K5RA 4WX1A 2IVDA 4KPRA 2FJAA 2WOIA 4YTPA 3II4A 3AE3A 4H4QA 3DJEA 4IV9A 4RSLA 1KSUA 1NG3A 3BI4A 4X4JA 2YVJA 2X99A 2BS4A 1NHRA 3DJJA 4HA6A 4BURA 2VRMA 3NN0X 4IA5A 1JOAA 4AT0A 2YG4A 3CNTA 1EL7A 2YVFA 3VR9A 3F8DA 4JNQA 4YKGA 2BXRA 3E1TA 3NH3X 2DKHA 4J56A 2BCGG 3LOVA 4B63A 2YVGA 3S5WA 3NYCA 4CNJA 2F5ZA 2FBWA 1PS9A 1E1MA 1PJ6A 1PHHA 2YQUA 3GMBA 3K7TA 3VRBA 2ZZ0A 1GRHA 1FECA 3AE4A 4BK1A 3HZLA 1TDKA 4M52A 1NHPA 3UP5A 3DJGX 4U2LA 4YKFA 2XLTA 4YWOA 4ZCCA 4DNAA 1CC2A 2JK6A 1ZMDA 2NVKX 1LVLA 2WPEA 4KX6A 4REKA 3QSSA 2YLSA 1E7PA 1VRQB 2WS3A 3P9UA 2QA1A 3FMWA 3SQPA 3Q9TA 2PHHA 4J34A 4YSZA 1CJ4A 5HY5A 5BVAA 2OLNA 4H4VA 2YM2A 3DH9A 2WPFA 3PVCA 4NEWA 3ISHA 4A65A 1FEAA 2OA1A 4O5QA 5FS8A 1ZP0A 3AEEA 4C77A 1JNRA 1IUSA 3GYJA 1ONFA 2FJBA 1NHSA 2A89A 4C3YA 1B4VA 2H89A 3NRNA 4GDEA 1DJQA 1OJTA 1PBBA 3DMEA 3AE2A 1CF3A 2YLXA 2X8GA 4H4PA 2GEWA 3ICSA 4PAAA 4XWZA 1CHUA 3RNMA 4YT0A 3CTYA 4B69A 4YSYA 1MXTA 4K7ZA 1E1KA 4B67A 1Y0PA 2R9ZA 1GV4A 3GRSA 3IHGA 2XDOA 3UKHA 4FDCB 1L9DA 4K5SA 3F8RA 3GD4A 3QVRA 5GSNA 4D03A 1F6MA 3DK9A 1IUTA 1VG9A 3BI2A 2XVHA 3QSEA 3ICRA 1REOA 2C7GA 2RGOA 1IJHA 4H4RA 1PJ7A 1LTXR 1VQWA 2FJEA 3V3OA 5JCNA 2YLTA 3LXDA 4RG3A 1GPEA 2C72A 1MO9A 4CRTA 5KVIA 1LJ1A 3B3RA 3LJPA 5KRQA 1H6VA 1GREA 3C4AA 1S3EA 4DGKA 1IUUA 2HQMA 3ITJA 2BC1A 1N4VA 4EMJA 3NT6A 5DBJA 1NENA 1O5WA 2EQ6A 2XVEA 1ZOYA 1OJAA 4LIIA 3SFDA 2V3BA 3AECA 4CY8A 4U8KA 1XDIA 3PS9A 3NLCA 1TDNA 1NEKA 3QJ4A 1S2YA 1CL0A 4JQ9A 3WE0A 4EIPA 1GESA 2GAHB 2WDQA 5TR3A 1H86A 2LFCA 3DK4A 4J33A 1QLBA 1EL5A 3P4SA 2YG3A 4TM1A 5JCMA 1ZKQA 2R46A 1BGNA 1PJ5A 4H2PA 1DOEA 2YLWA 3LB8A 5CQFA 3ADAB 3CIRA 4AT2A 3S61A 2R4EA 3BNUA 2BCPA 3RHAA 2CDUA 1FEBA 1BKWA 2B7SA 1GRBA 2C76A 2W0HA 2XCGA 3DA1A 1YQ3A 3NGCX 4UDPA 4C5OA 1ZY8A 4TLXA 4IA6A 2GQFA 2C3DA 2VQ7A 2WESA 2BABA 3DJDA 1H82A 1GEUA 2AR8A 2Y6QA 3AWIA 4APNA 4RG4A 2E1MA 4Z2TA 4U2SA 3OC4A 1TRBA 1S3BA 2GF3A 1OJ9A 3H4KA 5M0ZA 1LV0A 3P4RA 5BRTA 2WDRA 2OLOA 2CFYA 2EQ9A 3FIMB 4U8NA 3DGHA 3P1WA 3AE6A 4Z43A 2JBVA 3VR8A 1FL2A 2YAUA 1COYA 1GOSA 1D7YA 1TYTA 2YR5A 1GTEA 3GRTA 3ZDNA 2BS2A 2GMJA 3D1CA 4B64A 1JU2A 2JKCA 3ABVA 3VRDB 2C75A 1ZX9A 1JRYA 1N4WA 2X3NA 1GERA 1IUXA 2YWLA 1GTHA 1Q1WA 3NTAA 4U8PA 4BK2A 3ALLA 1P2EA 2XVJA 1M64A 3AE7A 4LU6A 1GT8A 2V6OA 4FK1A 4CBQA 3I6DA 3T37A 1ELIA 2Z5YA 1GALA 5LV9A 1DOBA 1B8SA 2GR0A 1LQUA 2IVEA 3NK2X 4GCMA 3GDPA 1DXLA 1YQZA 1QO8A 1E6EA 4A99A 1QJDA 5FS6A 2APGA 4AOXA 4U8LA 4TLZA 3F8PA 2GVCA 2VRLA 1TDFA 1NPXA 1Y56B 3FG2P 3NYFA 1TDOA 1HYUA 4Y4MA 1N1PA 4Z24A 4EMWA 1FCDA 1Z6LA 3ALJA 3NNEA 5EBKA 1Y56A 4H2QA 1S2QA 2XFPA 1D4DA 1H81A 1KNRA 2EQ8A 2Y6RA 2JB3A 1NDAA 4J31A 3EF6A 1F3PA 1N4UA 2YG7A 2VVMA 2ACZA 3KLJA 1GRGA 5U1OA 1MOKA 5KOWA 3UKLA 4H4ZA 4EQSA 4AOSA 3BHKA 2WU2A 4I59A 5EB5A 2C66A 3NK0X 2WDVA 2AAQA 3GYIA 2C65A 1GRTA 4I58A 1H7WA 3DK8A 3UKFA 2B9XA 4FX9A 2GRTA 4P9SA 4BJYA 3CNDA 4EMIA 2Z5XA 3OZ2A 1H83A 1GETA 4JY2A 1TDEA 2RABA 2V5ZA 3G5QA 5HHFA 2C3CA 3UCLA 4C74A 1F8SA 4EQXA 1E1LA 3KA7A 1L9CA 2GR1A 1PBEA 2XLSA 3QVPA 2B76A 1E39A 2WP9A 3IC9A 3NYEA 3R9UA 2QA2A 5CKUA 3KKJA 3UOVA 4Z2UA 1XANA 1KF6A 3CPIG 2WEUA 4UDQA 1RP0A 2GMHA 1KDGA 2YLZA 3AEGA 3SFEA 2WP5A 1CJ3A 3QFAA 5BUKA 4ECHA 2X50A 4H4XA 4Z25A 5C3JA 1K4QA 3C4NA 4H50A 4OPGA 2YG6A 4TM4A 4U2TA 3AB1A 4USRA 2JB1A 4XWRA 4FK1C 4GF7A 2XFOA 3BNMA 5BULA 3NKSA 2H88A 1F8RA 3M12A 1Q9IA 3BHFA 1K0LA 1GRAA 3C96A 2Q6UA 2BK3A 3AD8B 4YTNA 3GMCA 2B7RA 2IIDA 2C73A 2ZZCA 5KXJA 2BS3A 3UTEA 3IF9A 4DSGA 1M6IA 4C3XA 4B65A 4YXDA 4H4TA 2WETA 3K7QX 4XXGA 1BF3A 2XYOA 2BACA 2GH5A 2YG5A 5JCIA 3LZWA 4U8IA 5FS9A 5HXIA 5M10A 4OPTA 3I3LA 2X8HA 4USQA 5FMHA 3AE9A 3V3NA 3L1RA 1OJDA 4Y4LA 3UOYA 3B6DA 2OAMA 4AP3A 1NG4A 2WU5A 4Z2RA 3REDA 2GV8A 2XFNA 1VG0A 2R0GA 2BC0A 1LQTA 3VQRA 3AD9B 5ER0A 2YM1A 4J57A 4TM3A 3CGEA 5FS7A 2PYXA 3CNPA 3BI5A 1CJ2A 1ZMCA 3M13A 2OALA 3GSIA 4X9NA 1BWCA 4NEVA 1D4EA 4H4WA 3RP7A 4U8OA 2ZZBA 3SGLA 4HB9A 1OJCA 1E1NA 2WP6A 2VVLA 3AD7B 3AYIA 4YSHA 4DSHA 4H4UA 3UOXA 1P2HA 3P4PA 4B68A 4E0VA 4YSXA 1PBDA 3AEFA 3AEAA 1W4XA 2TPRA 4A5LA 3P4QA 1X31B 2BYBA 4EM4A 4NZHA 2RGHA 1JNZA 3CGBA 3K7MX 3PO7A 4D04A 2XVIA 1ZOVA 2WQYA 3EPTA 2B9WA 2TMDA 3KU9A 1V59A 3G5SA 1KFYA 1TYPA 4EQWA 4CY6A 3AE8A 3ATQA 2XFQA 2VZ2A 4OCGA 3UKQA 2A8XA 1K0JA 5HYMA 3CNSA 3NG7X 2Q0KA 3FPZA 2VVLG 3UOZA 2VOUA 3UTGA 4OPCA 1F8WA 3NN6X 1ZDLA 3GYXA 2R0CA 4B1BA 2RGJA 1Q1RA 1RSGA 2E4GA 4H4YA 4JDRA 1EBDA 4LA1A 1DNCA 4CCRA 3M0OA 1ZK7A 2YR6A 1SEZA 1DJNA 1DODA 2NPXA 2QAEA 3G5RA 2BK5A 4GRTA 3VRAA 4B66A 3LADA 3K30A 5EOWA
chains in the Genus database with same CATH superfamily
1PXBA 5GRTA 4NTCA 4U8JA 3FBSA 3Q6JA 3UTHA 3ALMA 2DKIA 2YR4A 4OPDA 5J60A 2GR2A 1PBFA 2V3AA 3AE1A 4BJZA 3HYVA 4OPIA 3UTFA 5JCKA 2JAEA 4A6NB 2R45A 4OPUA 3SY4A 2Q0LA 3IWAA 4H2RA 5KVHA 3EANA 1AOGA 4H2NA 1CC4A 4U8MA 2WHDA 1CJCA 2WBAA 4Z26A 2VQBA 4JNAA 4EM3A 1H7XA 4JN9A 2GR3A 3DGZA 4A6NA 2I0ZA 2J3NA 1IUVA 1YY5A 2UZZA 1B37A 3AXBA 1NHQA 3COXA 3ICTA 4J2WA 4IVMB 2O9ZA 3CN8A 3LZXA 4BV6A 4IVOB 1L0VA 1UKVG 4H4SA 3L8KA 2YLRA 5KMQA 3RP6A 2BA9A 2BXSA 3H8IA 4BK3A 2XLUA 2EQ7A 3NIXA 3NTDA 5IPYA 5J7XA 2FJDA 1JRXA 4G6HA 1D7LA 2C67A 1BGJA 1XHCA 1YKJA 2XFUA 2ZBWA 3GDNA 3IHMA 3QFBA 5U63A 3NHOX 3ZYXA 5IQ4A 2E5VA 1EL9A 1GNDA 3KPFA 2WOWA 1L9EA 1XPQA 4OPLA 2V61A 1DOCA 4UP3A 2XLRA 2C64A 1GRFA 3CNJA 1FOHA 4G9KA 1YQ4A 4K8DA 4YTMA 4EQRA 5KMSA 1PDHA 2B9YA 2R0PA 4G6GA 4J36A 3D8XA 4JY3A 4GR1A 3AEBA 5IQ1A 5EB4A 4ZN0A 2A87A 2C70A 4NNJA 3UP4A 1BZLA 1VDCA 5KWFA 4ZCDA 4TM0A 2BK4A 2CULA 3T2ZA 3GD3A 1PXAA 1CC6A 1JEHA 3CPHG 3KD9A 1PBCA 2XVFA 1GXFA 5KOXA 4AP1A 4CCQA 4A7AA 3AEDA 3SYIA 1LPFA 2GQWA 4K22A 3GWDA 1JRZA 1GSNA 4O5UA 2AQJA 4EIQA 1O94A 4A79A 4OVIA 2WOVA 3CPJG 3NK1X 4A9WA 2GB0A 1D5TA 2CVJA 4PABA 3UKAA 3O0HA 3AYLA 3URHA 1CBOA 5L46A 2GAGB 3ATRA 1RYIA 4Z44A 3RP8A 1H84A 5JCLA 4Y4NA 1NAAA 3CGDA 4UDRA 3CGCA 1EL8A 1KSSA 2JB2A 2Q7VA 3GWFA 4H7UA 3QSMA 4NTDA 4N9XA 2X8CA 1PN0A 3KVEA 4GUVA 3AYJA 3JSKA 4X9MA 4K2XA 2R4JA 4MJWA 4WCTA 5U25A 1D4CA 2XLPA 3SM8A 1PXCA 1IUWA 3UKPA 2ARDA 3AE5A 2WPCA 4CNKA 2V60A 1KNPA 1O95A 5C2TA 3EAOA 1K0IA 2QCUA 3H8LA 1B5QA 4GDPA 4ADWA 5KNLA 4NTEA 3UKKA 4ICYA 3V76A 4K5RA 4WX1A 4NWZA 2IVDA 4KPRA 2FJAA 2WOIA 3HYWA 4YTPA 3II4A 3AE3A 4H4QA 3DJEA 4IV9A 4RSLA 1KSUA 1NG3A 3BI4A 4X4JA 2YVJA 2X99A 2BS4A 1NHRA 3DJJA 4HA6A 4BURA 2VRMA 3NN0X 4IA5A 1JOAA 4AT0A 2YG4A 3CNTA 3HYXA 1EL7A 2YVFA 3VR9A 3F8DA 4JNQA 4YKGA 2BXRA 3E1TA 3NH3X 2DKHA 4J56A 2BCGG 3LOVA 4B63A 2YVGA 3S5WA 3NYCA 4CNJA 2F5ZA 2FBWA 1PS9A 1E1MA 1PJ6A 1PHHA 2YQUA 3GMBA 3K7TA 3VRBA 2ZZ0A 1GRHA 1FECA 3AE4A 4BK1A 3HZLA 1TDKA 4M52A 1NHPA 3UP5A 3DJGX 4U2LA 4YKFA 2XLTA 4YWOA 4ZCCA 4DNAA 1CC2A 2JK6A 1ZMDA 2NVKX 1LVLA 3SX6A 3T2YA 2WPEA 4KX6A 2C4CA 4REKA 3QSSA 2YLSA 3SZFA 1E7PA 1VRQB 2WS3A 3P9UA 3SZ0A 2QA1A 3FMWA 3SQPA 3Q9TA 2PHHA 4J34A 4YSZA 1CJ4A 5HY5A 5BVAA 2OLNA 4H4VA 2YM2A 3DH9A 2WPFA 3PVCA 4NEWA 3ISHA 4A65A 1FEAA 2OA1A 4O5QA 5FS8A 1ZP0A 3AEEA 4C77A 1JNRA 1IUSA 3GYJA 1ONFA 2FJBA 1NHSA 2A89A 4C3YA 1B4VA 2H89A 3NRNA 4GDEA 1DJQA 1OJTA 1PBBA 3DMEA 3AE2A 1CF3A 2YLXA 2X8GA 4H4PA 2GEWA 3ICSA 4PAAA 4XWZA 1CHUA 3RNMA 4YT0A 3CTYA 4B69A 4YSYA 1MXTA 4K7ZA 1E1KA 4B67A 4G73A 1Y0PA 2R9ZA 1GV4A 3GRSA 3IHGA 2XDOA 3UKHA 4FDCB 1L9DA 4K5SA 3F8RA 3GD4A 3QVRA 5GSNA 4D03A 1F6MA 3DK9A 1IUTA 1VG9A 3BI2A 2XVHA 3QSEA 3ICRA 1REOA 2C7GA 2RGOA 1IJHA 4H4RA 1PJ7A 1LTXR 1VQWA 2FJEA 3V3OA 5JCNA 2YLTA 3LXDA 4RG3A 1GPEA 2C72A 1MO9A 4CRTA 5KVIA 1LJ1A 3B3RA 3LJPA 5KRQA 1H6VA 1GREA 3C4AA 1S3EA 4DGKA 1IUUA 2HQMA 3ITJA 2BC1A 1N4VA 4EMJA 3NT6A 5DBJA 1NENA 1O5WA 2EQ6A 2XVEA 1ZOYA 1OJAA 4LIIA 3SFDA 2V3BA 3AECA 4CY8A 4U8KA 1XDIA 3PS9A 3NLCA 1TDNA 1NEKA 3QJ4A 1S2YA 1CL0A 4JQ9A 3CMMA 3WE0A 4EIPA 1GESA 2GAHB 2WDQA 5TR3A 1H86A 2LFCA 3DK4A 4J33A 1QLBA 1EL5A 3P4SA 2YG3A 4TM1A 5JCMA 1ZKQA 2R46A 1BGNA 1PJ5A 4H2PA 1DOEA 2YLWA 3LB8A 5CQFA 3ADAB 3CIRA 4AT2A 3S61A 2R4EA 3BNUA 2BCPA 3RHAA 2CDUA 1FEBA 1BKWA 2B7SA 1GRBA 2C76A 2W0HA 2XCGA 3DA1A 1YQ3A 3NGCX 4GAPA 4UDPA 4C5OA 1ZY8A 4TLXA 4IA6A 2GQFA 2C3DA 2VQ7A 2WESA 2BABA 3DJDA 1H82A 1GEUA 2AR8A 2Y6QA 3AWIA 4APNA 4RG4A 2E1MA 4Z2TA 4U2SA 3OC4A 1TRBA 1S3BA 2GF3A 1OJ9A 3H4KA 5M0ZA 1LV0A 3P4RA 5BRTA 2WDRA 2OLOA 2CFYA 2EQ9A 3FIMB 4U8NA 3DGHA 3P1WA 3AE6A 4Z43A 2JBVA 3VR8A 1FL2A 2YAUA 1COYA 1GOSA 1D7YA 1TYTA 2YR5A 1GTEA 3GRTA 3ZDNA 2BS2A 2GMJA 3D1CA 4B64A 1JU2A 2JKCA 3ABVA 3VRDB 2C75A 1ZX9A 1JRYA 1N4WA 2BRAA 1GERA 1IUXA 2X3NA 2YWLA 1GTHA 1Q1WA 3NTAA 4U8PA 4BK2A 3ALLA 1P2EA 2XVJA 1M64A 3AE7A 4LU6A 1GT8A 2V6OA 4FK1A 4CBQA 3I6DA 3T37A 1ELIA 2Z5YA 1GALA 5LV9A 1DOBA 1B8SA 2GR0A 1LQUA 2IVEA 3NK2X 4GCMA 3SZCA 3GDPA 1DXLA 1YQZA 1QO8A 1E6EA 4A99A 1QJDA 5FS6A 2APGA 4AOXA 3T14A 4U8LA 3SZWA 4TLZA 3F8PA 2GVCA 2VRLA 1TDFA 1NPXA 1Y56B 3FG2P 3NYFA 4II3A 1TDOA 1HYUA 4Y4MA 1N1PA 4Z24A 4EMWA 1FCDA 1Z6LA 3ALJA 3NNEA 5EBKA 1Y56A 4H2QA 1S2QA 2XFPA 1D4DA 1H81A 1KNRA 2EQ8A 2Y6RA 2JB3A 1NDAA 4J31A 3EF6A 1F3PA 1N4UA 2YG7A 2VVMA 2ACZA 3KLJA 1GRGA 5U1OA 1MOKA 5KOWA 3UKLA 4H4ZA 4EQSA 4AOSA 3BHKA 2WU2A 4I59A 5EB5A 2C66A 3NK0X 4G74A 2WDVA 2AAQA 3GYIA 2C65A 1GRTA 4I58A 1H7WA 3DK8A 3UKFA 2B9XA 4FX9A 2GRTA 4P9SA 4BJYA 3CNDA 4EMIA 2Z5XA 3OZ2A 1H83A 1GETA 4JY2A 1TDEA 2RABA 2V5ZA 3G5QA 5HHFA 2C3CA 3UCLA 4C74A 1F8SA 4EQXA 1E1LA 3KA7A 1L9CA 3SXIA 3T31A 2GR1A 1PBEA 2XLSA 3QVPA 2B76A 1E39A 2WP9A 3IC9A 3NYEA 3R9UA 2QA2A 5CKUA 3KKJA 3UOVA 4Z2UA 1XANA 1KF6A 3CPIG 2WEUA 4UDQA 1RP0A 2GMHA 1KDGA 2YLZA 3AEGA 3SFEA 2WP5A 1CJ3A 3QFAA 5BUKA 4ECHA 2X50A 4H4XA 4Z25A 5C3JA 1K4QA 3C4NA 4H50A 4OPGA 2YG6A 4TM4A 4U2TA 3AB1A 4USRA 2JB1A 4XWRA 4FK1C 4GF7A 2XFOA 3BNMA 5BULA 3NKSA 2H88A 1F8RA 3M12A 1Q9IA 3BHFA 4II2A 1K0LA 1GRAA 3C96A 2Q6UA 2BK3A 3AD8B 4YTNA 3GMCA 2B7RA 2IIDA 2C73A 2ZZCA 5KXJA 2BS3A 3UTEA 3IF9A 4DSGA 1M6IA 3KPKA 4C3XA 4B65A 4YXDA 4H4TA 2WETA 3K7QX 4XXGA 1BF3A 2XYOA 2BACA 2GH5A 2YG5A 5JCIA 3LZWA 4U8IA 5FS9A 5HXIA 5M10A 4OPTA 3I3LA 2X8HA 4USQA 5FMHA 3AE9A 3V3NA 3L1RA 1OJDA 3T0KA 4Y4LA 3UOYA 3B6DA 2OAMA 4AP3A 1NG4A 2WU5A 4Z2RA 3REDA 2GV8A 2XFNA 1VG0A 2R0GA 2BC0A 3T2KA 1LQTA 3VQRA 3AD9B 5ER0A 2YM1A 4J57A 4TM3A 3CGEA 5FS7A 2PYXA 3CNPA 3BI5A 1CJ2A 1ZMCA 3M13A 2BRYA 2OALA 3GSIA 4X9NA 1BWCA 4NEVA 5KMPA 1D4EA 4H4WA 3RP7A 4U8OA 2ZZBA 3SGLA 4HB9A 1OJCA 1E1NA 2WP6A 2VVLA 3AD7B 3AYIA 4YSHA 4DSHA 4H4UA 3UOXA 1P2HA 3P4PA 4B68A 4E0VA 4YSXA 1PBDA 3AEFA 3AEAA 1W4XA 2TPRA 4A5LA 3P4QA 1X31B 2BYBA 4EM4A 4NZHA 2RGHA 1JNZA 3CGBA 3K7MX 3PO7A 4D04A 2XVIA 1ZOVA 2WQYA 3EPTA 2B9WA 2TMDA 3KU9A 1V59A 3G5SA 1KFYA 1TYPA 4EQWA 4CY6A 3AE8A 3ATQA 2XFQA 2VZ2A 4GAVA 4OCGA 2A8XA 1K0JA 3UKQA 3CNSA 3NG7X 5HYMA 5KMRA 2Q0KA 3FPZA 2VVLG 3UOZA 2VOUA 3UTGA 4OPCA 1F8WA 3GYXA 1ZDLA 3NN6X 2R0CA 4B1BA 2RGJA 1Q1RA 1RSGA 2E4GA 4H4YA 4JDRA 1EBDA 4LA1A 1DNCA 4CCRA 3M0OA 1ZK7A 2YR6A 1SEZA 1DJNA 1DODA 2NPXA 2QAEA 3G5RA 2BK5A 4GRTA 3VRAA 4B66A 3LADA 3K30A 5EOWA
chains in the Genus database with same CATH topology
1PXBA 5GRTA 4NTCA 4U8JA 3FBSA 3Q6JA 3UTHA 3ALMA 2DKIA 2YR4A 4OPDA 5J60A 2GR2A 1PBFA 2V3AA 3AE1A 4BJZA 3HYVA 4OPIA 3UTFA 5JCKA 2JAEA 4A6NB 2R45A 4OPUA 3SY4A 2Q0LA 3IWAA 4H2RA 5KVHA 3EANA 1AOGA 4H2NA 1CC4A 4U8MA 2WHDA 1CJCA 2WBAA 4Z26A 2VQBA 4JNAA 4EM3A 1H7XA 4JN9A 2GR3A 3DGZA 4A6NA 2I0ZA 2J3NA 1IUVA 1YY5A 2UZZA 1B37A 3AXBA 1NHQA 3COXA 3ICTA 4J2WA 4IVMB 2O9ZA 3CN8A 3LZXA 4BV6A 4IVOB 1L0VA 1UKVG 4H4SA 3L8KA 2YLRA 5KMQA 3RP6A 2BA9A 2BXSA 3H8IA 4BK3A 2XLUA 2EQ7A 3NIXA 3NTDA 5IPYA 5J7XA 2FJDA 1JRXA 4G6HA 1D7LA 2C67A 1BGJA 1XHCA 1YKJA 2XFUA 2ZBWA 3GDNA 3IHMA 3QFBA 5U63A 3NHOX 3ZYXA 5IQ4A 2E5VA 1EL9A 1GNDA 3KPFA 2WOWA 1L9EA 1XPQA 4OPLA 2V61A 1DOCA 4UP3A 2XLRA 2C64A 1GRFA 3CNJA 1FOHA 4G9KA 1YQ4A 4K8DA 4YTMA 4EQRA 5KMSA 1PDHA 2B9YA 2R0PA 4G6GA 4J36A 3D8XA 4JY3A 4GR1A 3AEBA 5IQ1A 5EB4A 4ZN0A 2A87A 2C70A 4NNJA 3UP4A 1BZLA 1VDCA 5KWFA 4ZCDA 4TM0A 2BK4A 2CULA 3T2ZA 3GD3A 1PXAA 1CC6A 1JEHA 3CPHG 3KD9A 1PBCA 2XVFA 1GXFA 5KOXA 4AP1A 4CCQA 4A7AA 3AEDA 3SYIA 1LPFA 2GQWA 4K22A 3GWDA 1JRZA 1GSNA 4O5UA 2AQJA 4EIQA 1O94A 4A79A 4OVIA 2WOVA 3CPJG 3NK1X 4A9WA 2GB0A 1D5TA 2CVJA 4PABA 3UKAA 3O0HA 3AYLA 3URHA 1CBOA 5L46A 2GAGB 3ATRA 1RYIA 4Z44A 3RP8A 1H84A 5JCLA 4Y4NA 1NAAA 3CGDA 4UDRA 3CGCA 1EL8A 1KSSA 2JB2A 2Q7VA 3GWFA 4H7UA 3QSMA 4NTDA 4N9XA 2X8CA 1PN0A 3KVEA 4GUVA 3AYJA 3JSKA 4X9MA 4K2XA 2R4JA 4MJWA 4WCTA 5U25A 1D4CA 2XLPA 3SM8A 1PXCA 1IUWA 3UKPA 2ARDA 3AE5A 2WPCA 4CNKA 2V60A 1KNPA 1O95A 5C2TA 3EAOA 1K0IA 2QCUA 3H8LA 1B5QA 4GDPA 4ADWA 5KNLA 4NTEA 3UKKA 4ICYA 3V76A 4K5RA 4WX1A 4NWZA 2IVDA 4KPRA 2FJAA 2WOIA 3HYWA 4YTPA 3II4A 3AE3A 4H4QA 3DJEA 4IV9A 4RSLA 1KSUA 1NG3A 3BI4A 4X4JA 2YVJA 2X99A 2BS4A 1NHRA 3DJJA 4HA6A 4BURA 2VRMA 3NN0X 4IA5A 1JOAA 4AT0A 2YG4A 3CNTA 3HYXA 1EL7A 2YVFA 3VR9A 3F8DA 4JNQA 4YKGA 2BXRA 3E1TA 3NH3X 2DKHA 4J56A 2BCGG 3LOVA 4B63A 2YVGA 3S5WA 3NYCA 4CNJA 2F5ZA 2FBWA 1PS9A 1E1MA 1PJ6A 1PHHA 2YQUA 3GMBA 3K7TA 3VRBA 2ZZ0A 1GRHA 1FECA 3AE4A 4BK1A 3HZLA 1TDKA 4M52A 1NHPA 3UP5A 3DJGX 4U2LA 4YKFA 2XLTA 4YWOA 4ZCCA 4DNAA 1CC2A 2JK6A 1ZMDA 2NVKX 1LVLA 3SX6A 3T2YA 2WPEA 4KX6A 2C4CA 4REKA 3QSSA 2YLSA 3SZFA 1E7PA 1VRQB 2WS3A 3P9UA 3SZ0A 2QA1A 3FMWA 3SQPA 3Q9TA 2PHHA 4J34A 4YSZA 1CJ4A 5HY5A 5BVAA 2OLNA 4H4VA 2YM2A 3DH9A 2WPFA 3PVCA 4NEWA 3ISHA 4A65A 1FEAA 2OA1A 4O5QA 5FS8A 1ZP0A 3AEEA 4C77A 1JNRA 1IUSA 3GYJA 1ONFA 2FJBA 1NHSA 2A89A 4C3YA 1B4VA 2H89A 3NRNA 4GDEA 1DJQA 1OJTA 1PBBA 3DMEA 3AE2A 1CF3A 2YLXA 2X8GA 4H4PA 2GEWA 3ICSA 4PAAA 4XWZA 1CHUA 3RNMA 4YT0A 3CTYA 4B69A 4YSYA 1MXTA 4K7ZA 1E1KA 4B67A 4G73A 1Y0PA 2R9ZA 1GV4A 3GRSA 3IHGA 2XDOA 3UKHA 4FDCB 1L9DA 4K5SA 3F8RA 3GD4A 3QVRA 5GSNA 4D03A 1F6MA 3DK9A 1IUTA 1VG9A 3BI2A 2XVHA 3QSEA 3ICRA 1REOA 2C7GA 2RGOA 1IJHA 4H4RA 1PJ7A 1LTXR 1VQWA 2FJEA 3V3OA 5JCNA 2YLTA 3LXDA 4RG3A 1GPEA 2C72A 1MO9A 4CRTA 5KVIA 1LJ1A 3B3RA 3LJPA 5KRQA 1H6VA 1GREA 3C4AA 1S3EA 4DGKA 1IUUA 2HQMA 3ITJA 2BC1A 1N4VA 4EMJA 3NT6A 5DBJA 1NENA 1O5WA 2EQ6A 2XVEA 1ZOYA 1OJAA 4LIIA 3SFDA 2V3BA 3AECA 4CY8A 4U8KA 1XDIA 3PS9A 3NLCA 1TDNA 1NEKA 3QJ4A 1S2YA 1CL0A 4JQ9A 3CMMA 3WE0A 4EIPA 1GESA 2GAHB 2WDQA 5TR3A 1H86A 2LFCA 3DK4A 4J33A 1QLBA 1EL5A 3P4SA 2YG3A 4TM1A 5JCMA 1ZKQA 2R46A 1BGNA 1PJ5A 4H2PA 1DOEA 2YLWA 3LB8A 5CQFA 3ADAB 3CIRA 4AT2A 3S61A 2R4EA 3BNUA 2BCPA 3RHAA 2CDUA 1FEBA 1BKWA 2B7SA 1GRBA 2C76A 2W0HA 2XCGA 3DA1A 1YQ3A 3NGCX 4GAPA 4UDPA 4C5OA 1ZY8A 4TLXA 4IA6A 2GQFA 2C3DA 2VQ7A 2WESA 2BABA 3DJDA 1H82A 1GEUA 2AR8A 2Y6QA 3AWIA 4APNA 4RG4A 2E1MA 4Z2TA 4U2SA 3OC4A 1TRBA 1S3BA 2GF3A 1OJ9A 3H4KA 5M0ZA 1LV0A 3P4RA 5BRTA 2WDRA 2OLOA 2CFYA 2EQ9A 3FIMB 4U8NA 3DGHA 3P1WA 3AE6A 4Z43A 2JBVA 3VR8A 1FL2A 2YAUA 1COYA 1GOSA 1D7YA 1TYTA 2YR5A 1GTEA 3GRTA 3ZDNA 2BS2A 2GMJA 3D1CA 4B64A 1JU2A 2JKCA 3ABVA 3VRDB 2C75A 1ZX9A 1JRYA 1N4WA 2BRAA 1GERA 1IUXA 2X3NA 2YWLA 1GTHA 1Q1WA 3NTAA 4U8PA 4BK2A 3ALLA 1P2EA 2XVJA 1M64A 3AE7A 4LU6A 1GT8A 2V6OA 4FK1A 4CBQA 3I6DA 3T37A 1ELIA 2Z5YA 1GALA 5LV9A 1DOBA 1B8SA 2GR0A 1LQUA 2IVEA 3NK2X 4GCMA 3SZCA 3GDPA 1DXLA 1YQZA 1QO8A 1E6EA 4A99A 1QJDA 5FS6A 2APGA 4AOXA 3T14A 4U8LA 3SZWA 4TLZA 3F8PA 2GVCA 2VRLA 1TDFA 1NPXA 1Y56B 3FG2P 3NYFA 4II3A 1TDOA 1HYUA 4Y4MA 1N1PA 4Z24A 4EMWA 1FCDA 1Z6LA 3ALJA 3NNEA 5EBKA 1Y56A 4H2QA 1S2QA 2XFPA 1D4DA 1H81A 1KNRA 2EQ8A 2Y6RA 2JB3A 1NDAA 4J31A 3EF6A 1F3PA 1N4UA 2YG7A 2VVMA 2ACZA 3KLJA 1GRGA 5U1OA 1MOKA 5KOWA 3UKLA 4H4ZA 4EQSA 4AOSA 3BHKA 2WU2A 4I59A 5EB5A 2C66A 3NK0X 4G74A 2WDVA 2AAQA 3GYIA 2C65A 1GRTA 4I58A 1H7WA 3DK8A 3UKFA 2B9XA 4FX9A 2GRTA 4P9SA 4BJYA 3CNDA 4EMIA 2Z5XA 3OZ2A 1H83A 1GETA 4JY2A 1TDEA 2RABA 2V5ZA 3G5QA 5HHFA 2C3CA 3UCLA 4C74A 1F8SA 4EQXA 1E1LA 3KA7A 1L9CA 3SXIA 3T31A 2GR1A 1PBEA 2XLSA 3QVPA 2B76A 1E39A 2WP9A 3IC9A 3NYEA 3R9UA 2QA2A 5CKUA 3KKJA 3UOVA 4Z2UA 1XANA 1KF6A 3CPIG 2WEUA 4UDQA 1RP0A 2GMHA 1KDGA 2YLZA 3AEGA 3SFEA 2WP5A 1CJ3A 3QFAA 5BUKA 4ECHA 2X50A 4H4XA 4Z25A 5C3JA 1K4QA 3C4NA 4H50A 4OPGA 2YG6A 4TM4A 4U2TA 3AB1A 4USRA 2JB1A 4XWRA 4FK1C 4GF7A 2XFOA 3BNMA 5BULA 3NKSA 2H88A 1F8RA 3M12A 1Q9IA 3BHFA 4II2A 1K0LA 1GRAA 3C96A 2Q6UA 2BK3A 3AD8B 4YTNA 3GMCA 2B7RA 2IIDA 2C73A 2ZZCA 5KXJA 2BS3A 3UTEA 3IF9A 4DSGA 1M6IA 3KPKA 4C3XA 4B65A 4YXDA 4H4TA 2WETA 3K7QX 4XXGA 1BF3A 2XYOA 2BACA 2GH5A 2YG5A 5JCIA 3LZWA 4U8IA 5FS9A 5HXIA 5M10A 4OPTA 3I3LA 2X8HA 4USQA 5FMHA 3AE9A 3V3NA 3L1RA 1OJDA 3T0KA 4Y4LA 3UOYA 3B6DA 2OAMA 4AP3A 1NG4A 2WU5A 4Z2RA 3REDA 2GV8A 2XFNA 1VG0A 2R0GA 2BC0A 3T2KA 1LQTA 3VQRA 3AD9B 5ER0A 2YM1A 4J57A 4TM3A 3CGEA 5FS7A 2PYXA 3CNPA 3BI5A 1CJ2A 1ZMCA 3M13A 2BRYA 2OALA 3GSIA 4X9NA 1BWCA 4NEVA 5KMPA 1D4EA 4H4WA 3RP7A 4U8OA 2ZZBA 3SGLA 4HB9A 1OJCA 1E1NA 2WP6A 2VVLA 3AD7B 3AYIA 4YSHA 4DSHA 4H4UA 3UOXA 1P2HA 3P4PA 4B68A 4E0VA 4YSXA 1PBDA 3AEFA 3AEAA 1W4XA 2TPRA 4A5LA 3P4QA 1X31B 2BYBA 4EM4A 4NZHA 2RGHA 1JNZA 3CGBA 3K7MX 3PO7A 4D04A 2XVIA 1ZOVA 2WQYA 3EPTA 2B9WA 2TMDA 3KU9A 1V59A 3G5SA 1KFYA 1TYPA 4EQWA 4CY6A 3AE8A 3ATQA 2XFQA 2VZ2A 4GAVA 4OCGA 2A8XA 1K0JA 3UKQA 3CNSA 3NG7X 5HYMA 5KMRA 2Q0KA 3FPZA 2VVLG 3UOZA 2VOUA 3UTGA 4OPCA 1F8WA 3GYXA 1ZDLA 3NN6X 2R0CA 4B1BA 2RGJA 1Q1RA 1RSGA 2E4GA 4H4YA 4JDRA 1EBDA 4LA1A 1DNCA 4CCRA 3M0OA 1ZK7A 2YR6A 1SEZA 1DJNA 1DODA 2NPXA 2QAEA 3G5RA 2BK5A 4GRTA 3VRAA 4B66A 3LADA 3K30A 5EOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXB A;  5GRT A;  4NTC A;  4U8J A;  3FBS A;  3Q6J A;  3UTH A;  3ALM A;  2DKI A;  2YR4 A;  4OPD A;  5J60 A;  2GR2 A;  1PBF A;  2V3A A;  3AE1 A;  4BJZ A;  4OPI A;  3UTF A;  5JCK A;  2JAE A;  4A6N B;  2R45 A;  4OPU A;  2Q0L A;  3IWA A;  4H2R A;  5KVH A;  3EAN A;  1AOG A;  4H2N A;  1CC4 A;  4U8M A;  2WHD A;  1CJC A;  2WBA A;  4Z26 A;  2VQB A;  4JNA A;  4EM3 A;  1H7X A;  4JN9 A;  2GR3 A;  3DGZ A;  4A6N A;  2I0Z A;  2J3N A;  1IUV A;  1YY5 A;  2UZZ A;  1B37 A;  3AXB A;  1NHQ A;  3COX A;  3ICT A;  4J2W A;  4IVM B;  2O9Z A;  3CN8 A;  3LZX A;  4BV6 A;  4IVO B;  1L0V A;  1UKV G;  4H4S A;  3L8K A;  2YLR A;  3RP6 A;  2BA9 A;  2BXS A;  3H8I A;  4BK3 A;  2XLU A;  2EQ7 A;  3NIX A;  3NTD A;  5IPY A;  5J7X A;  2FJD A;  1JRX A;  1D7L A;  2C67 A;  1BGJ A;  1XHC A;  1YKJ A;  2XFU A;  2ZBW A;  3GDN A;  3IHM A;  3QFB A;  5U63 A;  3NHO X;  3ZYX A;  5IQ4 A;  2E5V A;  1EL9 A;  1GND A;  3KPF A;  2WOW A;  1L9E A;  1XPQ A;  4OPL A;  2V61 A;  1DOC A;  4UP3 A;  2XLR A;  2C64 A;  1GRF A;  3CNJ A;  1FOH A;  4K8D A;  1YQ4 A;  4YTM A;  4EQR A;  1PDH A;  2B9Y A;  2R0P A;  4J36 A;  3D8X A;  4JY3 A;  4GR1 A;  3AEB A;  5IQ1 A;  5EB4 A;  4ZN0 A;  2A87 A;  2C70 A;  3UP4 A;  1BZL A;  1VDC A;  5KWF A;  4ZCD A;  4TM0 A;  2BK4 A;  2CUL A;  3GD3 A;  1PXA A;  1CC6 A;  1JEH A;  3CPH G;  3KD9 A;  1PBC A;  2XVF A;  1GXF A;  5KOX A;  4AP1 A;  4CCQ A;  4A7A A;  3AED A;  1LPF A;  2GQW A;  4K22 A;  3GWD A;  1JRZ A;  1GSN A;  4O5U A;  2AQJ A;  4EIQ A;  1O94 A;  4A79 A;  4OVI A;  2WOV A;  3CPJ G;  3NK1 X;  4A9W A;  2GB0 A;  1D5T A;  2CVJ A;  4PAB A;  3UKA A;  3O0H A;  3AYL A;  3URH A;  1CBO A;  5L46 A;  2GAG B;  3ATR A;  1RYI A;  4Z44 A;  3RP8 A;  1H84 A;  5JCL A;  4Y4N A;  1NAA A;  3CGD A;  4UDR A;  3CGC A;  1EL8 A;  1KSS A;  2JB2 A;  2Q7V A;  3GWF A;  4H7U A;  3QSM A;  4NTD A;  4N9X A;  2X8C A;  1PN0 A;  3KVE A;  4GUV A;  3AYJ A;  3JSK A;  4X9M A;  4K2X A;  2R4J A;  4MJW A;  4WCT A;  5U25 A;  1D4C A;  2XLP A;  3SM8 A;  1PXC A;  1IUW A;  3UKP A;  2ARD A;  3AE5 A;  2WPC A;  4CNK A;  2V60 A;  1KNP A;  1O95 A;  5C2T A;  3EAO A;  1K0I A;  2QCU A;  3H8L A;  1B5Q A;  4GDP A;  4ADW A;  4NTE A;  3UKK A;  4ICY A;  3V76 A;  4K5R A;  4WX1 A;  2IVD A;  4KPR A;  2FJA A;  2WOI A;  4YTP A;  3II4 A;  3AE3 A;  4H4Q A;  3DJE A;  4IV9 A;  4RSL A;  1KSU A;  1NG3 A;  3BI4 A;  4X4J A;  2YVJ A;  2X99 A;  2BS4 A;  1NHR A;  3DJJ A;  4HA6 A;  4BUR A;  2VRM A;  3NN0 X;  4IA5 A;  1JOA A;  4AT0 A;  2YG4 A;  3CNT A;  1EL7 A;  2YVF A;  3VR9 A;  3F8D A;  4JNQ A;  4YKG A;  2BXR A;  3E1T A;  3NH3 X;  2DKH A;  4J56 A;  2BCG G;  3LOV A;  4B63 A;  2YVG A;  3S5W A;  3NYC A;  4CNJ A;  2F5Z A;  2FBW A;  1PS9 A;  1E1M A;  1PJ6 A;  1PHH A;  2YQU A;  3GMB A;  3K7T A;  3VRB A;  2ZZ0 A;  1GRH A;  1FEC A;  3AE4 A;  4BK1 A;  3HZL A;  1TDK A;  4M52 A;  1NHP A;  3UP5 A;  3DJG X;  4U2L A;  4YKF A;  2XLT A;  4YWO A;  4ZCC A;  4DNA A;  1CC2 A;  2JK6 A;  1ZMD A;  2NVK X;  1LVL A;  2WPE A;  4KX6 A;  4REK A;  3QSS A;  2YLS A;  1E7P A;  1VRQ B;  2WS3 A;  3P9U A;  2QA1 A;  3FMW A;  3SQP A;  3Q9T A;  2PHH A;  4J34 A;  4YSZ A;  1CJ4 A;  5HY5 A;  5BVA A;  2OLN A;  4H4V A;  2YM2 A;  3DH9 A;  2WPF A;  3PVC A;  4NEW A;  3ISH A;  4A65 A;  1FEA A;  2OA1 A;  4O5Q A;  5FS8 A;  1ZP0 A;  3AEE A;  4C77 A;  1JNR A;  1IUS A;  3GYJ A;  1ONF A;  2FJB A;  1NHS A;  2A89 A;  4C3Y A;  1B4V A;  2H89 A;  3NRN A;  4GDE A;  1DJQ A;  1OJT A;  1PBB A;  3DME A;  3AE2 A;  1CF3 A;  2YLX A;  2X8G A;  4H4P A;  2GEW A;  3ICS A;  4PAA A;  4XWZ A;  1CHU A;  3RNM A;  4YT0 A;  3CTY A;  4B69 A;  4YSY A;  1MXT A;  4K7Z A;  1E1K A;  4B67 A;  1Y0P A;  2R9Z A;  1GV4 A;  3GRS A;  3IHG A;  2XDO A;  3UKH A;  4FDC B;  1L9D A;  4K5S A;  3F8R A;  3GD4 A;  3QVR A;  5GSN A;  4D03 A;  1F6M A;  3DK9 A;  1IUT A;  1VG9 A;  3BI2 A;  2XVH A;  3QSE A;  3ICR A;  1REO A;  2C7G A;  2RGO A;  1IJH A;  4H4R A;  1PJ7 A;  1LTX R;  1VQW A;  2FJE A;  3V3O A;  5JCN A;  2YLT A;  3LXD A;  4RG3 A;  1GPE A;  2C72 A;  1MO9 A;  4CRT A;  5KVI A;  1LJ1 A;  3B3R A;  3LJP A;  5KRQ A;  1H6V A;  1GRE A;  3C4A A;  1S3E A;  4DGK A;  1IUU A;  2HQM A;  3ITJ A;  2BC1 A;  1N4V A;  4EMJ A;  3NT6 A;  5DBJ A;  1NEN A;  1O5W A;  2EQ6 A;  2XVE A;  1ZOY A;  1OJA A;  4LII A;  3SFD A;  2V3B A;  3AEC A;  4CY8 A;  4U8K A;  1XDI A;  3PS9 A;  3NLC A;  1TDN A;  1NEK A;  3QJ4 A;  1S2Y A;  1CL0 A;  4JQ9 A;  3WE0 A;  4EIP A;  1GES A;  2GAH B;  2WDQ A;  5TR3 A;  1H86 A;  2LFC A;  3DK4 A;  4J33 A;  1QLB A;  1EL5 A;  3P4S A;  2YG3 A;  4TM1 A;  5JCM A;  1ZKQ A;  2R46 A;  1BGN A;  1PJ5 A;  4H2P A;  1DOE A;  2YLW A;  3LB8 A;  5CQF A;  3ADA B;  3CIR A;  4AT2 A;  3S61 A;  2R4E A;  3BNU A;  2BCP A;  3RHA A;  2CDU A;  1FEB A;  1BKW A;  2B7S A;  1GRB A;  2C76 A;  2W0H A;  2XCG A;  3DA1 A;  1YQ3 A;  3NGC X;  4UDP A;  4C5O A;  1ZY8 A;  4TLX A;  4IA6 A;  2GQF A;  2C3D A;  2VQ7 A;  2WES A;  2BAB A;  3DJD A;  1H82 A;  1GEU A;  2AR8 A;  2Y6Q A;  3AWI A;  4APN A;  4RG4 A;  2E1M A;  4Z2T A;  4U2S A;  3OC4 A;  1TRB A;  1S3B A;  2GF3 A;  1OJ9 A;  3H4K A;  5M0Z A;  1LV0 A;  3P4R A;  5BRT A;  2WDR A;  2OLO A;  2CFY A;  2EQ9 A;  3FIM B;  4U8N A;  3DGH A;  3P1W A;  3AE6 A;  4Z43 A;  2JBV A;  3VR8 A;  1FL2 A;  2YAU A;  1COY A;  1GOS A;  1D7Y A;  1TYT A;  2YR5 A;  1GTE A;  3GRT A;  3ZDN A;  2BS2 A;  2GMJ A;  3D1C A;  4B64 A;  1JU2 A;  2JKC A;  3ABV A;  3VRD B;  2C75 A;  1ZX9 A;  1JRY A;  1N4W A;  2X3N A;  1GER A;  1IUX A;  2YWL A;  1GTH A;  1Q1W A;  3NTA A;  4U8P A;  4BK2 A;  3ALL A;  1P2E A;  2XVJ A;  1M64 A;  3AE7 A;  4LU6 A;  1GT8 A;  2V6O A;  4FK1 A;  4CBQ A;  3I6D A;  3T37 A;  1ELI A;  2Z5Y A;  1GAL A;  5LV9 A;  1DOB A;  1B8S A;  2GR0 A;  1LQU A;  2IVE A;  3NK2 X;  4GCM A;  3GDP A;  1DXL A;  1YQZ A;  1QO8 A;  1E6E A;  4A99 A;  1QJD A;  5FS6 A;  2APG A;  4AOX A;  4U8L A;  4TLZ A;  3F8P A;  2GVC A;  2VRL A;  1TDF A;  1NPX A;  1Y56 B;  3FG2 P;  3NYF A;  1TDO A;  1HYU A;  4Y4M A;  1N1P A;  4Z24 A;  4EMW A;  1FCD A;  1Z6L A;  3ALJ A;  3NNE A;  5EBK A;  1Y56 A;  4H2Q A;  1S2Q A;  2XFP A;  1D4D A;  1H81 A;  1KNR A;  2EQ8 A;  2Y6R A;  2JB3 A;  1NDA A;  4J31 A;  3EF6 A;  1F3P A;  1N4U A;  2YG7 A;  2VVM A;  2ACZ A;  3KLJ A;  1GRG A;  5U1O A;  1MOK A;  5KOW A;  3UKL A;  4H4Z A;  4EQS A;  4AOS A;  3BHK A;  2WU2 A;  4I59 A;  5EB5 A;  2C66 A;  3NK0 X;  2WDV A;  2AAQ A;  3GYI A;  2C65 A;  1GRT A;  4I58 A;  1H7W A;  3DK8 A;  3UKF A;  2B9X A;  4FX9 A;  2GRT A;  4P9S A;  4BJY A;  3CND A;  4EMI A;  2Z5X A;  3OZ2 A;  1H83 A;  1GET A;  4JY2 A;  1TDE A;  2RAB A;  2V5Z A;  3G5Q A;  5HHF A;  2C3C A;  3UCL A;  4C74 A;  1F8S A;  4EQX A;  1E1L A;  3KA7 A;  1L9C A;  2GR1 A;  1PBE A;  2XLS A;  3QVP A;  2B76 A;  1E39 A;  2WP9 A;  3IC9 A;  3NYE A;  3R9U A;  2QA2 A;  5CKU A;  3KKJ A;  3UOV A;  4Z2U A;  1XAN A;  1KF6 A;  3CPI G;  2WEU A;  4UDQ A;  1RP0 A;  2GMH A;  1KDG A;  2YLZ A;  3AEG A;  3SFE A;  2WP5 A;  1CJ3 A;  3QFA A;  5BUK A;  4ECH A;  2X50 A;  4H4X A;  4Z25 A;  5C3J A;  1K4Q A;  3C4N A;  4H50 A;  4OPG A;  2YG6 A;  4TM4 A;  4U2T A;  3AB1 A;  4USR A;  2JB1 A;  4XWR A;  4FK1 C;  4GF7 A;  2XFO A;  3BNM A;  5BUL A;  3NKS A;  2H88 A;  1F8R A;  3M12 A;  1Q9I A;  3BHF A;  1K0L A;  1GRA A;  3C96 A;  2Q6U A;  2BK3 A;  3AD8 B;  4YTN A;  3GMC A;  2B7R A;  2IID A;  2C73 A;  2ZZC A;  5KXJ A;  2BS3 A;  3UTE A;  3IF9 A;  4DSG A;  1M6I A;  4C3X A;  4B65 A;  4YXD A;  4H4T A;  2WET A;  3K7Q X;  4XXG A;  1BF3 A;  2XYO A;  2BAC A;  2GH5 A;  2YG5 A;  5JCI A;  3LZW A;  4U8I A;  5FS9 A;  5HXI A;  5M10 A;  4OPT A;  3I3L A;  2X8H A;  4USQ A;  5FMH A;  3AE9 A;  3V3N A;  3L1R A;  1OJD A;  4Y4L A;  3UOY A;  3B6D A;  2OAM A;  4AP3 A;  1NG4 A;  2WU5 A;  4Z2R A;  3RED A;  2GV8 A;  2XFN A;  1VG0 A;  2R0G A;  2BC0 A;  1LQT A;  3VQR A;  3AD9 B;  5ER0 A;  2YM1 A;  4J57 A;  4TM3 A;  3CGE A;  5FS7 A;  2PYX A;  3CNP A;  3BI5 A;  1CJ2 A;  1ZMC A;  3M13 A;  2OAL A;  3GSI A;  4X9N A;  1BWC A;  4NEV A;  1D4E A;  4H4W A;  3RP7 A;  4U8O A;  2ZZB A;  3SGL A;  4HB9 A;  1OJC A;  1E1N A;  2WP6 A;  2VVL A;  3AD7 B;  3AYI A;  4YSH A;  4DSH A;  4H4U A;  3UOX A;  1P2H A;  3P4P A;  4B68 A;  4E0V A;  4YSX A;  1PBD A;  3AEF A;  3AEA A;  1W4X A;  2TPR A;  4A5L A;  3P4Q A;  1X31 B;  2BYB A;  4EM4 A;  4NZH A;  2RGH A;  1JNZ A;  3CGB A;  3K7M X;  3PO7 A;  4D04 A;  2XVI A;  1ZOV A;  2WQY A;  3EPT A;  2B9W A;  2TMD A;  3KU9 A;  1V59 A;  3G5S A;  1KFY A;  1TYP A;  4EQW A;  4CY6 A;  3AE8 A;  3ATQ A;  2XFQ A;  2VZ2 A;  4OCG A;  3UKQ A;  2A8X A;  1K0J A;  5HYM A;  3CNS A;  3NG7 X;  2Q0K A;  3FPZ A;  2VVL G;  3UOZ A;  2VOU A;  3UTG A;  4OPC A;  1F8W A;  3NN6 X;  1ZDL A;  3GYX A;  2R0C A;  4B1B A;  2RGJ A;  1Q1R A;  1RSG A;  2E4G A;  4H4Y A;  4JDR A;  1EBD A;  4LA1 A;  1DNC A;  4CCR A;  3M0O A;  1ZK7 A;  2YR6 A;  1SEZ A;  1DJN A;  1DOD A;  2NPX A;  2QAE A;  3G5R A;  2BK5 A;  4GRT A;  3VRA A;  4B66 A;  3LAD A;  3K30 A;  5EOW A; 
#chains in the Genus database with same CATH topology
 1PXB A;  5GRT A;  4NTC A;  4U8J A;  3FBS A;  3Q6J A;  3UTH A;  3ALM A;  2DKI A;  2YR4 A;  4OPD A;  5J60 A;  2GR2 A;  1PBF A;  2V3A A;  3AE1 A;  4BJZ A;  3HYV A;  4OPI A;  3UTF A;  5JCK A;  2JAE A;  4A6N B;  2R45 A;  4OPU A;  3SY4 A;  2Q0L A;  3IWA A;  4H2R A;  5KVH A;  3EAN A;  1AOG A;  4H2N A;  1CC4 A;  4U8M A;  2WHD A;  1CJC A;  2WBA A;  4Z26 A;  2VQB A;  4JNA A;  4EM3 A;  1H7X A;  4JN9 A;  2GR3 A;  3DGZ A;  4A6N A;  2I0Z A;  2J3N A;  1IUV A;  1YY5 A;  2UZZ A;  1B37 A;  3AXB A;  1NHQ A;  3COX A;  3ICT A;  4J2W A;  4IVM B;  2O9Z A;  3CN8 A;  3LZX A;  4BV6 A;  4IVO B;  1L0V A;  1UKV G;  4H4S A;  3L8K A;  2YLR A;  5KMQ A;  3RP6 A;  2BA9 A;  2BXS A;  3H8I A;  4BK3 A;  2XLU A;  2EQ7 A;  3NIX A;  3NTD A;  5IPY A;  5J7X A;  2FJD A;  1JRX A;  4G6H A;  1D7L A;  2C67 A;  1BGJ A;  1XHC A;  1YKJ A;  2XFU A;  2ZBW A;  3GDN A;  3IHM A;  3QFB A;  5U63 A;  3NHO X;  3ZYX A;  5IQ4 A;  2E5V A;  1EL9 A;  1GND A;  3KPF A;  2WOW A;  1L9E A;  1XPQ A;  4OPL A;  2V61 A;  1DOC A;  4UP3 A;  2XLR A;  2C64 A;  1GRF A;  3CNJ A;  1FOH A;  4G9K A;  1YQ4 A;  4K8D A;  4YTM A;  4EQR A;  5KMS A;  1PDH A;  2B9Y A;  2R0P A;  4G6G A;  4J36 A;  3D8X A;  4JY3 A;  4GR1 A;  3AEB A;  5IQ1 A;  5EB4 A;  4ZN0 A;  2A87 A;  2C70 A;  4NNJ A;  3UP4 A;  1BZL A;  1VDC A;  5KWF A;  4ZCD A;  4TM0 A;  2BK4 A;  2CUL A;  3T2Z A;  3GD3 A;  1PXA A;  1CC6 A;  1JEH A;  3CPH G;  3KD9 A;  1PBC A;  2XVF A;  1GXF A;  5KOX A;  4AP1 A;  4CCQ A;  4A7A A;  3AED A;  3SYI A;  1LPF A;  2GQW A;  4K22 A;  3GWD A;  1JRZ A;  1GSN A;  4O5U A;  2AQJ A;  4EIQ A;  1O94 A;  4A79 A;  4OVI A;  2WOV A;  3CPJ G;  3NK1 X;  4A9W A;  2GB0 A;  1D5T A;  2CVJ A;  4PAB A;  3UKA A;  3O0H A;  3AYL A;  3URH A;  1CBO A;  5L46 A;  2GAG B;  3ATR A;  1RYI A;  4Z44 A;  3RP8 A;  1H84 A;  5JCL A;  4Y4N A;  1NAA A;  3CGD A;  4UDR A;  3CGC A;  1EL8 A;  1KSS A;  2JB2 A;  2Q7V A;  3GWF A;  4H7U A;  3QSM A;  4NTD A;  4N9X A;  2X8C A;  1PN0 A;  3KVE A;  4GUV A;  3AYJ A;  3JSK A;  4X9M A;  4K2X A;  2R4J A;  4MJW A;  4WCT A;  5U25 A;  1D4C A;  2XLP A;  3SM8 A;  1PXC A;  1IUW A;  3UKP A;  2ARD A;  3AE5 A;  2WPC A;  4CNK A;  2V60 A;  1KNP A;  1O95 A;  5C2T A;  3EAO A;  1K0I A;  2QCU A;  3H8L A;  1B5Q A;  4GDP A;  4ADW A;  5KNL A;  4NTE A;  3UKK A;  4ICY A;  3V76 A;  4K5R A;  4WX1 A;  4NWZ A;  2IVD A;  4KPR A;  2FJA A;  2WOI A;  3HYW A;  4YTP A;  3II4 A;  3AE3 A;  4H4Q A;  3DJE A;  4IV9 A;  4RSL A;  1KSU A;  1NG3 A;  3BI4 A;  4X4J A;  2YVJ A;  2X99 A;  2BS4 A;  1NHR A;  3DJJ A;  4HA6 A;  4BUR A;  2VRM A;  3NN0 X;  4IA5 A;  1JOA A;  4AT0 A;  2YG4 A;  3CNT A;  3HYX A;  1EL7 A;  2YVF A;  3VR9 A;  3F8D A;  4JNQ A;  4YKG A;  2BXR A;  3E1T A;  3NH3 X;  2DKH A;  4J56 A;  2BCG G;  3LOV A;  4B63 A;  2YVG A;  3S5W A;  3NYC A;  4CNJ A;  2F5Z A;  2FBW A;  1PS9 A;  1E1M A;  1PJ6 A;  1PHH A;  2YQU A;  3GMB A;  3K7T A;  3VRB A;  2ZZ0 A;  1GRH A;  1FEC A;  3AE4 A;  4BK1 A;  3HZL A;  1TDK A;  4M52 A;  1NHP A;  3UP5 A;  3DJG X;  4U2L A;  4YKF A;  2XLT A;  4YWO A;  4ZCC A;  4DNA A;  1CC2 A;  2JK6 A;  1ZMD A;  2NVK X;  1LVL A;  3SX6 A;  3T2Y A;  2WPE A;  4KX6 A;  2C4C A;  4REK A;  3QSS A;  2YLS A;  3SZF A;  1E7P A;  1VRQ B;  2WS3 A;  3P9U A;  3SZ0 A;  2QA1 A;  3FMW A;  3SQP A;  3Q9T A;  2PHH A;  4J34 A;  4YSZ A;  1CJ4 A;  5HY5 A;  5BVA A;  2OLN A;  4H4V A;  2YM2 A;  3DH9 A;  2WPF A;  3PVC A;  4NEW A;  3ISH A;  4A65 A;  1FEA A;  2OA1 A;  4O5Q A;  5FS8 A;  1ZP0 A;  3AEE A;  4C77 A;  1JNR A;  1IUS A;  3GYJ A;  1ONF A;  2FJB A;  1NHS A;  2A89 A;  4C3Y A;  1B4V A;  2H89 A;  3NRN A;  4GDE A;  1DJQ A;  1OJT A;  1PBB A;  3DME A;  3AE2 A;  1CF3 A;  2YLX A;  2X8G A;  4H4P A;  2GEW A;  3ICS A;  4PAA A;  4XWZ A;  1CHU A;  3RNM A;  4YT0 A;  3CTY A;  4B69 A;  4YSY A;  1MXT A;  4K7Z A;  1E1K A;  4B67 A;  4G73 A;  1Y0P A;  2R9Z A;  1GV4 A;  3GRS A;  3IHG A;  2XDO A;  3UKH A;  4FDC B;  1L9D A;  4K5S A;  3F8R A;  3GD4 A;  3QVR A;  5GSN A;  4D03 A;  1F6M A;  3DK9 A;  1IUT A;  1VG9 A;  3BI2 A;  2XVH A;  3QSE A;  3ICR A;  1REO A;  2C7G A;  2RGO A;  1IJH A;  4H4R A;  1PJ7 A;  1LTX R;  1VQW A;  2FJE A;  3V3O A;  5JCN A;  2YLT A;  3LXD A;  4RG3 A;  1GPE A;  2C72 A;  1MO9 A;  4CRT A;  5KVI A;  1LJ1 A;  3B3R A;  3LJP A;  5KRQ A;  1H6V A;  1GRE A;  3C4A A;  1S3E A;  4DGK A;  1IUU A;  2HQM A;  3ITJ A;  2BC1 A;  1N4V A;  4EMJ A;  3NT6 A;  5DBJ A;  1NEN A;  1O5W A;  2EQ6 A;  2XVE A;  1ZOY A;  1OJA A;  4LII A;  3SFD A;  2V3B A;  3AEC A;  4CY8 A;  4U8K A;  1XDI A;  3PS9 A;  3NLC A;  1TDN A;  1NEK A;  3QJ4 A;  1S2Y A;  1CL0 A;  4JQ9 A;  3CMM A;  3WE0 A;  4EIP A;  1GES A;  2GAH B;  2WDQ A;  5TR3 A;  1H86 A;  2LFC A;  3DK4 A;  4J33 A;  1QLB A;  1EL5 A;  3P4S A;  2YG3 A;  4TM1 A;  5JCM A;  1ZKQ A;  2R46 A;  1BGN A;  1PJ5 A;  4H2P A;  1DOE A;  2YLW A;  3LB8 A;  5CQF A;  3ADA B;  3CIR A;  4AT2 A;  3S61 A;  2R4E A;  3BNU A;  2BCP A;  3RHA A;  2CDU A;  1FEB A;  1BKW A;  2B7S A;  1GRB A;  2C76 A;  2W0H A;  2XCG A;  3DA1 A;  1YQ3 A;  3NGC X;  4GAP A;  4UDP A;  4C5O A;  1ZY8 A;  4TLX A;  4IA6 A;  2GQF A;  2C3D A;  2VQ7 A;  2WES A;  2BAB A;  3DJD A;  1H82 A;  1GEU A;  2AR8 A;  2Y6Q A;  3AWI A;  4APN A;  4RG4 A;  2E1M A;  4Z2T A;  4U2S A;  3OC4 A;  1TRB A;  1S3B A;  2GF3 A;  1OJ9 A;  3H4K A;  5M0Z A;  1LV0 A;  3P4R A;  5BRT A;  2WDR A;  2OLO A;  2CFY A;  2EQ9 A;  3FIM B;  4U8N A;  3DGH A;  3P1W A;  3AE6 A;  4Z43 A;  2JBV A;  3VR8 A;  1FL2 A;  2YAU A;  1COY A;  1GOS A;  1D7Y A;  1TYT A;  2YR5 A;  1GTE A;  3GRT A;  3ZDN A;  2BS2 A;  2GMJ A;  3D1C A;  4B64 A;  1JU2 A;  2JKC A;  3ABV A;  3VRD B;  2C75 A;  1ZX9 A;  1JRY A;  1N4W A;  2BRA A;  1GER A;  1IUX A;  2X3N A;  2YWL A;  1GTH A;  1Q1W A;  3NTA A;  4U8P A;  4BK2 A;  3ALL A;  1P2E A;  2XVJ A;  1M64 A;  3AE7 A;  4LU6 A;  1GT8 A;  2V6O A;  4FK1 A;  4CBQ A;  3I6D A;  3T37 A;  1ELI A;  2Z5Y A;  1GAL A;  5LV9 A;  1DOB A;  1B8S A;  2GR0 A;  1LQU A;  2IVE A;  3NK2 X;  4GCM A;  3SZC A;  3GDP A;  1DXL A;  1YQZ A;  1QO8 A;  1E6E A;  4A99 A;  1QJD A;  5FS6 A;  2APG A;  4AOX A;  3T14 A;  4U8L A;  3SZW A;  4TLZ A;  3F8P A;  2GVC A;  2VRL A;  1TDF A;  1NPX A;  1Y56 B;  3FG2 P;  3NYF A;  4II3 A;  1TDO A;  1HYU A;  4Y4M A;  1N1P A;  4Z24 A;  4EMW A;  1FCD A;  1Z6L A;  3ALJ A;  3NNE A;  5EBK A;  1Y56 A;  4H2Q A;  1S2Q A;  2XFP A;  1D4D A;  1H81 A;  1KNR A;  2EQ8 A;  2Y6R A;  2JB3 A;  1NDA A;  4J31 A;  3EF6 A;  1F3P A;  1N4U A;  2YG7 A;  2VVM A;  2ACZ A;  3KLJ A;  1GRG A;  5U1O A;  1MOK A;  5KOW A;  3UKL A;  4H4Z A;  4EQS A;  4AOS A;  3BHK A;  2WU2 A;  4I59 A;  5EB5 A;  2C66 A;  3NK0 X;  4G74 A;  2WDV A;  2AAQ A;  3GYI A;  2C65 A;  1GRT A;  4I58 A;  1H7W A;  3DK8 A;  3UKF A;  2B9X A;  4FX9 A;  2GRT A;  4P9S A;  4BJY A;  3CND A;  4EMI A;  2Z5X A;  3OZ2 A;  1H83 A;  1GET A;  4JY2 A;  1TDE A;  2RAB A;  2V5Z A;  3G5Q A;  5HHF A;  2C3C A;  3UCL A;  4C74 A;  1F8S A;  4EQX A;  1E1L A;  3KA7 A;  1L9C A;  3SXI A;  3T31 A;  2GR1 A;  1PBE A;  2XLS A;  3QVP A;  2B76 A;  1E39 A;  2WP9 A;  3IC9 A;  3NYE A;  3R9U A;  2QA2 A;  5CKU A;  3KKJ A;  3UOV A;  4Z2U A;  1XAN A;  1KF6 A;  3CPI G;  2WEU A;  4UDQ A;  1RP0 A;  2GMH A;  1KDG A;  2YLZ A;  3AEG A;  3SFE A;  2WP5 A;  1CJ3 A;  3QFA A;  5BUK A;  4ECH A;  2X50 A;  4H4X A;  4Z25 A;  5C3J A;  1K4Q A;  3C4N A;  4H50 A;  4OPG A;  2YG6 A;  4TM4 A;  4U2T A;  3AB1 A;  4USR A;  2JB1 A;  4XWR A;  4FK1 C;  4GF7 A;  2XFO A;  3BNM A;  5BUL A;  3NKS A;  2H88 A;  1F8R A;  3M12 A;  1Q9I A;  3BHF A;  4II2 A;  1K0L A;  1GRA A;  3C96 A;  2Q6U A;  2BK3 A;  3AD8 B;  4YTN A;  3GMC A;  2B7R A;  2IID A;  2C73 A;  2ZZC A;  5KXJ A;  2BS3 A;  3UTE A;  3IF9 A;  4DSG A;  1M6I A;  3KPK A;  4C3X A;  4B65 A;  4YXD A;  4H4T A;  2WET A;  3K7Q X;  4XXG A;  1BF3 A;  2XYO A;  2BAC A;  2GH5 A;  2YG5 A;  5JCI A;  3LZW A;  4U8I A;  5FS9 A;  5HXI A;  5M10 A;  4OPT A;  3I3L A;  2X8H A;  4USQ A;  5FMH A;  3AE9 A;  3V3N A;  3L1R A;  1OJD A;  3T0K A;  4Y4L A;  3UOY A;  3B6D A;  2OAM A;  4AP3 A;  1NG4 A;  2WU5 A;  4Z2R A;  3RED A;  2GV8 A;  2XFN A;  1VG0 A;  2R0G A;  2BC0 A;  3T2K A;  1LQT A;  3VQR A;  3AD9 B;  5ER0 A;  2YM1 A;  4J57 A;  4TM3 A;  3CGE A;  5FS7 A;  2PYX A;  3CNP A;  3BI5 A;  1CJ2 A;  1ZMC A;  3M13 A;  2BRY A;  2OAL A;  3GSI A;  4X9N A;  1BWC A;  4NEV A;  5KMP A;  1D4E A;  4H4W A;  3RP7 A;  4U8O A;  2ZZB A;  3SGL A;  4HB9 A;  1OJC A;  1E1N A;  2WP6 A;  2VVL A;  3AD7 B;  3AYI A;  4YSH A;  4DSH A;  4H4U A;  3UOX A;  1P2H A;  3P4P A;  4B68 A;  4E0V A;  4YSX A;  1PBD A;  3AEF A;  3AEA A;  1W4X A;  2TPR A;  4A5L A;  3P4Q A;  1X31 B;  2BYB A;  4EM4 A;  4NZH A;  2RGH A;  1JNZ A;  3CGB A;  3K7M X;  3PO7 A;  4D04 A;  2XVI A;  1ZOV A;  2WQY A;  3EPT A;  2B9W A;  2TMD A;  3KU9 A;  1V59 A;  3G5S A;  1KFY A;  1TYP A;  4EQW A;  4CY6 A;  3AE8 A;  3ATQ A;  2XFQ A;  2VZ2 A;  4GAV A;  4OCG A;  2A8X A;  1K0J A;  3UKQ A;  3CNS A;  3NG7 X;  5HYM A;  5KMR A;  2Q0K A;  3FPZ A;  2VVL G;  3UOZ A;  2VOU A;  3UTG A;  4OPC A;  1F8W A;  3GYX A;  1ZDL A;  3NN6 X;  2R0C A;  4B1B A;  2RGJ A;  1Q1R A;  1RSG A;  2E4G A;  4H4Y A;  4JDR A;  1EBD A;  4LA1 A;  1DNC A;  4CCR A;  3M0O A;  1ZK7 A;  2YR6 A;  1SEZ A;  1DJN A;  1DOD A;  2NPX A;  2QAE A;  3G5R A;  2BK5 A;  4GRT A;  3VRA A;  4B66 A;  3LAD A;  3K30 A;  5EOW A; 
#chains in the Genus database with same CATH homology
 1PXB A;  5GRT A;  4NTC A;  4U8J A;  3FBS A;  3Q6J A;  3UTH A;  3ALM A;  2DKI A;  2YR4 A;  4OPD A;  5J60 A;  2GR2 A;  1PBF A;  2V3A A;  3AE1 A;  4BJZ A;  3HYV A;  4OPI A;  3UTF A;  5JCK A;  2JAE A;  4A6N B;  2R45 A;  4OPU A;  3SY4 A;  2Q0L A;  3IWA A;  4H2R A;  5KVH A;  3EAN A;  1AOG A;  4H2N A;  1CC4 A;  4U8M A;  2WHD A;  1CJC A;  2WBA A;  4Z26 A;  2VQB A;  4JNA A;  4EM3 A;  1H7X A;  4JN9 A;  2GR3 A;  3DGZ A;  4A6N A;  2I0Z A;  2J3N A;  1IUV A;  1YY5 A;  2UZZ A;  1B37 A;  3AXB A;  1NHQ A;  3COX A;  3ICT A;  4J2W A;  4IVM B;  2O9Z A;  3CN8 A;  3LZX A;  4BV6 A;  4IVO B;  1L0V A;  1UKV G;  4H4S A;  3L8K A;  2YLR A;  5KMQ A;  3RP6 A;  2BA9 A;  2BXS A;  3H8I A;  4BK3 A;  2XLU A;  2EQ7 A;  3NIX A;  3NTD A;  5IPY A;  5J7X A;  2FJD A;  1JRX A;  4G6H A;  1D7L A;  2C67 A;  1BGJ A;  1XHC A;  1YKJ A;  2XFU A;  2ZBW A;  3GDN A;  3IHM A;  3QFB A;  5U63 A;  3NHO X;  3ZYX A;  5IQ4 A;  2E5V A;  1EL9 A;  1GND A;  3KPF A;  2WOW A;  1L9E A;  1XPQ A;  4OPL A;  2V61 A;  1DOC A;  4UP3 A;  2XLR A;  2C64 A;  1GRF A;  3CNJ A;  1FOH A;  4G9K A;  1YQ4 A;  4K8D A;  4YTM A;  4EQR A;  5KMS A;  1PDH A;  2B9Y A;  2R0P A;  4G6G A;  4J36 A;  3D8X A;  4JY3 A;  4GR1 A;  3AEB A;  5IQ1 A;  5EB4 A;  4ZN0 A;  2A87 A;  2C70 A;  4NNJ A;  3UP4 A;  1BZL A;  1VDC A;  5KWF A;  4ZCD A;  4TM0 A;  2BK4 A;  2CUL A;  3T2Z A;  3GD3 A;  1PXA A;  1CC6 A;  1JEH A;  3CPH G;  3KD9 A;  1PBC A;  2XVF A;  1GXF A;  5KOX A;  4AP1 A;  4CCQ A;  4A7A A;  3AED A;  3SYI A;  1LPF A;  2GQW A;  4K22 A;  3GWD A;  1JRZ A;  1GSN A;  4O5U A;  2AQJ A;  4EIQ A;  1O94 A;  4A79 A;  4OVI A;  2WOV A;  3CPJ G;  3NK1 X;  4A9W A;  2GB0 A;  1D5T A;  2CVJ A;  4PAB A;  3UKA A;  3O0H A;  3AYL A;  3URH A;  1CBO A;  5L46 A;  2GAG B;  3ATR A;  1RYI A;  4Z44 A;  3RP8 A;  1H84 A;  5JCL A;  4Y4N A;  1NAA A;  3CGD A;  4UDR A;  3CGC A;  1EL8 A;  1KSS A;  2JB2 A;  2Q7V A;  3GWF A;  4H7U A;  3QSM A;  4NTD A;  4N9X A;  2X8C A;  1PN0 A;  3KVE A;  4GUV A;  3AYJ A;  3JSK A;  4X9M A;  4K2X A;  2R4J A;  4MJW A;  4WCT A;  5U25 A;  1D4C A;  2XLP A;  3SM8 A;  1PXC A;  1IUW A;  3UKP A;  2ARD A;  3AE5 A;  2WPC A;  4CNK A;  2V60 A;  1KNP A;  1O95 A;  5C2T A;  3EAO A;  1K0I A;  2QCU A;  3H8L A;  1B5Q A;  4GDP A;  4ADW A;  5KNL A;  4NTE A;  3UKK A;  4ICY A;  3V76 A;  4K5R A;  4WX1 A;  4NWZ A;  2IVD A;  4KPR A;  2FJA A;  2WOI A;  3HYW A;  4YTP A;  3II4 A;  3AE3 A;  4H4Q A;  3DJE A;  4IV9 A;  4RSL A;  1KSU A;  1NG3 A;  3BI4 A;  4X4J A;  2YVJ A;  2X99 A;  2BS4 A;  1NHR A;  3DJJ A;  4HA6 A;  4BUR A;  2VRM A;  3NN0 X;  4IA5 A;  1JOA A;  4AT0 A;  2YG4 A;  3CNT A;  3HYX A;  1EL7 A;  2YVF A;  3VR9 A;  3F8D A;  4JNQ A;  4YKG A;  2BXR A;  3E1T A;  3NH3 X;  2DKH A;  4J56 A;  2BCG G;  3LOV A;  4B63 A;  2YVG A;  3S5W A;  3NYC A;  4CNJ A;  2F5Z A;  2FBW A;  1PS9 A;  1E1M A;  1PJ6 A;  1PHH A;  2YQU A;  3GMB A;  3K7T A;  3VRB A;  2ZZ0 A;  1GRH A;  1FEC A;  3AE4 A;  4BK1 A;  3HZL A;  1TDK A;  4M52 A;  1NHP A;  3UP5 A;  3DJG X;  4U2L A;  4YKF A;  2XLT A;  4YWO A;  4ZCC A;  4DNA A;  1CC2 A;  2JK6 A;  1ZMD A;  2NVK X;  1LVL A;  3SX6 A;  3T2Y A;  2WPE A;  4KX6 A;  2C4C A;  4REK A;  3QSS A;  2YLS A;  3SZF A;  1E7P A;  1VRQ B;  2WS3 A;  3P9U A;  3SZ0 A;  2QA1 A;  3FMW A;  3SQP A;  3Q9T A;  2PHH A;  4J34 A;  4YSZ A;  1CJ4 A;  5HY5 A;  5BVA A;  2OLN A;  4H4V A;  2YM2 A;  3DH9 A;  2WPF A;  3PVC A;  4NEW A;  3ISH A;  4A65 A;  1FEA A;  2OA1 A;  4O5Q A;  5FS8 A;  1ZP0 A;  3AEE A;  4C77 A;  1JNR A;  1IUS A;  3GYJ A;  1ONF A;  2FJB A;  1NHS A;  2A89 A;  4C3Y A;  1B4V A;  2H89 A;  3NRN A;  4GDE A;  1DJQ A;  1OJT A;  1PBB A;  3DME A;  3AE2 A;  1CF3 A;  2YLX A;  2X8G A;  4H4P A;  2GEW A;  3ICS A;  4PAA A;  4XWZ A;  1CHU A;  3RNM A;  4YT0 A;  3CTY A;  4B69 A;  4YSY A;  1MXT A;  4K7Z A;  1E1K A;  4B67 A;  4G73 A;  1Y0P A;  2R9Z A;  1GV4 A;  3GRS A;  3IHG A;  2XDO A;  3UKH A;  4FDC B;  1L9D A;  4K5S A;  3F8R A;  3GD4 A;  3QVR A;  5GSN A;  4D03 A;  1F6M A;  3DK9 A;  1IUT A;  1VG9 A;  3BI2 A;  2XVH A;  3QSE A;  3ICR A;  1REO A;  2C7G A;  2RGO A;  1IJH A;  4H4R A;  1PJ7 A;  1LTX R;  1VQW A;  2FJE A;  3V3O A;  5JCN A;  2YLT A;  3LXD A;  4RG3 A;  1GPE A;  2C72 A;  1MO9 A;  4CRT A;  5KVI A;  1LJ1 A;  3B3R A;  3LJP A;  5KRQ A;  1H6V A;  1GRE A;  3C4A A;  1S3E A;  4DGK A;  1IUU A;  2HQM A;  3ITJ A;  2BC1 A;  1N4V A;  4EMJ A;  3NT6 A;  5DBJ A;  1NEN A;  1O5W A;  2EQ6 A;  2XVE A;  1ZOY A;  1OJA A;  4LII A;  3SFD A;  2V3B A;  3AEC A;  4CY8 A;  4U8K A;  1XDI A;  3PS9 A;  3NLC A;  1TDN A;  1NEK A;  3QJ4 A;  1S2Y A;  1CL0 A;  4JQ9 A;  3CMM A;  3WE0 A;  4EIP A;  1GES A;  2GAH B;  2WDQ A;  5TR3 A;  1H86 A;  2LFC A;  3DK4 A;  4J33 A;  1QLB A;  1EL5 A;  3P4S A;  2YG3 A;  4TM1 A;  5JCM A;  1ZKQ A;  2R46 A;  1BGN A;  1PJ5 A;  4H2P A;  1DOE A;  2YLW A;  3LB8 A;  5CQF A;  3ADA B;  3CIR A;  4AT2 A;  3S61 A;  2R4E A;  3BNU A;  2BCP A;  3RHA A;  2CDU A;  1FEB A;  1BKW A;  2B7S A;  1GRB A;  2C76 A;  2W0H A;  2XCG A;  3DA1 A;  1YQ3 A;  3NGC X;  4GAP A;  4UDP A;  4C5O A;  1ZY8 A;  4TLX A;  4IA6 A;  2GQF A;  2C3D A;  2VQ7 A;  2WES A;  2BAB A;  3DJD A;  1H82 A;  1GEU A;  2AR8 A;  2Y6Q A;  3AWI A;  4APN A;  4RG4 A;  2E1M A;  4Z2T A;  4U2S A;  3OC4 A;  1TRB A;  1S3B A;  2GF3 A;  1OJ9 A;  3H4K A;  5M0Z A;  1LV0 A;  3P4R A;  5BRT A;  2WDR A;  2OLO A;  2CFY A;  2EQ9 A;  3FIM B;  4U8N A;  3DGH A;  3P1W A;  3AE6 A;  4Z43 A;  2JBV A;  3VR8 A;  1FL2 A;  2YAU A;  1COY A;  1GOS A;  1D7Y A;  1TYT A;  2YR5 A;  1GTE A;  3GRT A;  3ZDN A;  2BS2 A;  2GMJ A;  3D1C A;  4B64 A;  1JU2 A;  2JKC A;  3ABV A;  3VRD B;  2C75 A;  1ZX9 A;  1JRY A;  1N4W A;  2BRA A;  1GER A;  1IUX A;  2X3N A;  2YWL A;  1GTH A;  1Q1W A;  3NTA A;  4U8P A;  4BK2 A;  3ALL A;  1P2E A;  2XVJ A;  1M64 A;  3AE7 A;  4LU6 A;  1GT8 A;  2V6O A;  4FK1 A;  4CBQ A;  3I6D A;  3T37 A;  1ELI A;  2Z5Y A;  1GAL A;  5LV9 A;  1DOB A;  1B8S A;  2GR0 A;  1LQU A;  2IVE A;  3NK2 X;  4GCM A;  3SZC A;  3GDP A;  1DXL A;  1YQZ A;  1QO8 A;  1E6E A;  4A99 A;  1QJD A;  5FS6 A;  2APG A;  4AOX A;  3T14 A;  4U8L A;  3SZW A;  4TLZ A;  3F8P A;  2GVC A;  2VRL A;  1TDF A;  1NPX A;  1Y56 B;  3FG2 P;  3NYF A;  4II3 A;  1TDO A;  1HYU A;  4Y4M A;  1N1P A;  4Z24 A;  4EMW A;  1FCD A;  1Z6L A;  3ALJ A;  3NNE A;  5EBK A;  1Y56 A;  4H2Q A;  1S2Q A;  2XFP A;  1D4D A;  1H81 A;  1KNR A;  2EQ8 A;  2Y6R A;  2JB3 A;  1NDA A;  4J31 A;  3EF6 A;  1F3P A;  1N4U A;  2YG7 A;  2VVM A;  2ACZ A;  3KLJ A;  1GRG A;  5U1O A;  1MOK A;  5KOW A;  3UKL A;  4H4Z A;  4EQS A;  4AOS A;  3BHK A;  2WU2 A;  4I59 A;  5EB5 A;  2C66 A;  3NK0 X;  4G74 A;  2WDV A;  2AAQ A;  3GYI A;  2C65 A;  1GRT A;  4I58 A;  1H7W A;  3DK8 A;  3UKF A;  2B9X A;  4FX9 A;  2GRT A;  4P9S A;  4BJY A;  3CND A;  4EMI A;  2Z5X A;  3OZ2 A;  1H83 A;  1GET A;  4JY2 A;  1TDE A;  2RAB A;  2V5Z A;  3G5Q A;  5HHF A;  2C3C A;  3UCL A;  4C74 A;  1F8S A;  4EQX A;  1E1L A;  3KA7 A;  1L9C A;  3SXI A;  3T31 A;  2GR1 A;  1PBE A;  2XLS A;  3QVP A;  2B76 A;  1E39 A;  2WP9 A;  3IC9 A;  3NYE A;  3R9U A;  2QA2 A;  5CKU A;  3KKJ A;  3UOV A;  4Z2U A;  1XAN A;  1KF6 A;  3CPI G;  2WEU A;  4UDQ A;  1RP0 A;  2GMH A;  1KDG A;  2YLZ A;  3AEG A;  3SFE A;  2WP5 A;  1CJ3 A;  3QFA A;  5BUK A;  4ECH A;  2X50 A;  4H4X A;  4Z25 A;  5C3J A;  1K4Q A;  3C4N A;  4H50 A;  4OPG A;  2YG6 A;  4TM4 A;  4U2T A;  3AB1 A;  4USR A;  2JB1 A;  4XWR A;  4FK1 C;  4GF7 A;  2XFO A;  3BNM A;  5BUL A;  3NKS A;  2H88 A;  1F8R A;  3M12 A;  1Q9I A;  3BHF A;  4II2 A;  1K0L A;  1GRA A;  3C96 A;  2Q6U A;  2BK3 A;  3AD8 B;  4YTN A;  3GMC A;  2B7R A;  2IID A;  2C73 A;  2ZZC A;  5KXJ A;  2BS3 A;  3UTE A;  3IF9 A;  4DSG A;  1M6I A;  3KPK A;  4C3X A;  4B65 A;  4YXD A;  4H4T A;  2WET A;  3K7Q X;  4XXG A;  1BF3 A;  2XYO A;  2BAC A;  2GH5 A;  2YG5 A;  5JCI A;  3LZW A;  4U8I A;  5FS9 A;  5HXI A;  5M10 A;  4OPT A;  3I3L A;  2X8H A;  4USQ A;  5FMH A;  3AE9 A;  3V3N A;  3L1R A;  1OJD A;  3T0K A;  4Y4L A;  3UOY A;  3B6D A;  2OAM A;  4AP3 A;  1NG4 A;  2WU5 A;  4Z2R A;  3RED A;  2GV8 A;  2XFN A;  1VG0 A;  2R0G A;  2BC0 A;  3T2K A;  1LQT A;  3VQR A;  3AD9 B;  5ER0 A;  2YM1 A;  4J57 A;  4TM3 A;  3CGE A;  5FS7 A;  2PYX A;  3CNP A;  3BI5 A;  1CJ2 A;  1ZMC A;  3M13 A;  2BRY A;  2OAL A;  3GSI A;  4X9N A;  1BWC A;  4NEV A;  5KMP A;  1D4E A;  4H4W A;  3RP7 A;  4U8O A;  2ZZB A;  3SGL A;  4HB9 A;  1OJC A;  1E1N A;  2WP6 A;  2VVL A;  3AD7 B;  3AYI A;  4YSH A;  4DSH A;  4H4U A;  3UOX A;  1P2H A;  3P4P A;  4B68 A;  4E0V A;  4YSX A;  1PBD A;  3AEF A;  3AEA A;  1W4X A;  2TPR A;  4A5L A;  3P4Q A;  1X31 B;  2BYB A;  4EM4 A;  4NZH A;  2RGH A;  1JNZ A;  3CGB A;  3K7M X;  3PO7 A;  4D04 A;  2XVI A;  1ZOV A;  2WQY A;  3EPT A;  2B9W A;  2TMD A;  3KU9 A;  1V59 A;  3G5S A;  1KFY A;  1TYP A;  4EQW A;  4CY6 A;  3AE8 A;  3ATQ A;  2XFQ A;  2VZ2 A;  4GAV A;  4OCG A;  2A8X A;  1K0J A;  3UKQ A;  3CNS A;  3NG7 X;  5HYM A;  5KMR A;  2Q0K A;  3FPZ A;  2VVL G;  3UOZ A;  2VOU A;  3UTG A;  4OPC A;  1F8W A;  3GYX A;  1ZDL A;  3NN6 X;  2R0C A;  4B1B A;  2RGJ A;  1Q1R A;  1RSG A;  2E4G A;  4H4Y A;  4JDR A;  1EBD A;  4LA1 A;  1DNC A;  4CCR A;  3M0O A;  1ZK7 A;  2YR6 A;  1SEZ A;  1DJN A;  1DOD A;  2NPX A;  2QAE A;  3G5R A;  2BK5 A;  4GRT A;  3VRA A;  4B66 A;  3LAD A;  3K30 A;  5EOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...