4AT0A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
483
structure length
483
Chain Sequence
IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
molecule tags Oxidoreductase
total genus 164
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at0A02
4EQXA 1B37A 2JK6A 3CPHG 5J7XA 3ITJA 1GESA 4NTEA 3WE0A 5KVHA 1GETA 1FEBA 4O5QA 4EMIA 1PN0A 1GRFA 1OJAA 4YKFA 5JCLA 1H82A 4M52A 4APNA 1CJ4A 1TYTA 1N4WA 3BHKA 3FBSA 1REOA 1NPXA 1FOHA 3OZ2A 3GYXA 4C5OA 2X99A 1PBCA 2X8CA 1GT8A 3ALLA 3DJGX 4PAAA 3FMWA 1CJ3A 2YR5A 3QJ4A 4ZCDA 2GR3A 1NHRA 2GMHA 4USRA 1GTEA 5U25A 1EBDA 1BZLA 3M12A 4CNKA 3NNEA 4NEVA 4EM3A 3AYLA 1TDOA 3OC4A 1E1LA 3KA7A 4YKGA 4Y4MA 1Q1RA 3AE3A 2R9ZA 1K0JA 3NN6X 1D4EA 4TLXA 2YLZA 4BJZA 3AE2A 4YSZA 2BCGG 2YLTA 3KPFA 2B7SA 3GMCA 2C66A 4H2QA 4Z43A 5JCNA 4BJYA 4DSHA 4N9XA 2NPXA 2WQYA 2VRMA 3UKHA 1CJCA 5EB4A 4DGKA 4XWRA 4E0VA 3LZXA 2AAQA 1XDIA 3E1TA 4JNAA 1JNZA 3G5SA 3K7QX 3V3NA 1NHPA 2XFUA 3S61A 1COYA 5TR3A 4GF7A 3K7TA 4Z24A 2V3BA 5JCIA 1GSNA 1E7PA 3DK9A 2BACA 3G5RA 4B1BA 1CC2A 1JRYA 4H50A 1K4QA 3LZWA 1ZDLA 3KU9A 1IUVA 1GV4A 3DGHA 4FDCB 4X4JA 1EL9A 3AWIA 3CNJA 3PO7A 4TM0A 2IVDA 4YTMA 1D4DA 2BK5A 2GB0A 2GRTA 3P4RA 3EANA 4WCTA 2BC0A 3LOVA 2YQUA 3SGLA 1FL2A 4B64A 4B63A 1PXAA 3AE1A 3UKAA 3BNUA 3UKLA 5BVAA 3NLCA 1ONFA 3BI5A 4C77A 2Q7VA 5KWFA 2Y6QA 1DODA 2X3NA 2JB1A 2V5ZA 3KD9A 4A6NA 3AXBA 3AD9B 1PBEA 1F6MA 3SM8A 4U2TA 4UDQA 2YVFA 3NYCA 1PJ7A 3S5WA 1Z6LA 3BHFA 1S3EA 3H8LA 4D03A 1LJ1A 2GF3A 4GR1A 1TDKA 2OA1A 1PXBA 4OCGA 1NG3A 2CVJA 3BNMA 3CNDA 3GRTA 4A9WA 1D7YA 2FJAA 1S3BA 1Y0PA 1ZMCA 2C65A 2V6OA 2XLSA 4D04A 2WOVA 4P9SA 4ADWA 1Q9IA 1ZX9A 1O5WA 3AB1A 3AEAA 5FS8A 1H84A 2WS3A 3K7MX 1KSUA 1VDCA 3DJJA 4MJWA 1EL5A 4C3XA 1NHSA 3PS9A 4Y4LA 4BK2A 1L9DA 3KVEA 5EB5A 4GDEA 2QA2A 3NIXA 2BYBA 3ZYXA 4BV6A 4DNAA 1L0VA 4X9MA 3L1RA 1CHUA 3NKSA 2R0PA 4JY3A 1DNCA 3FPZA 3ICRA 5U63A 4CY8A 1GPEA 1M6IA 2WEUA 1BF3A 1ZOVA 2R0GA 4UDPA 3RP7A 1PDHA 1K0IA 2GAGB 4BK1A 3QSEA 3VR8A 4OPUA 3UOVA 5JCMA 3NH3X 1B8SA 2BC1A 4YWOA 2VOUA 2XVJA 4J36A 2B9YA 3UKPA 3UOYA 4H2RA 2E1MA 2BABA 2WU5A 2WP9A 2XVEA 5HHFA 3V3OA 4H4TA 2X8HA 2B9WA 2JAEA 1E1KA 1TYPA 1JOAA 3UOZA 4H4YA 4KPRA 2VVLG 3QFAA 3QFBA 1N4VA 1NENA 2XFOA 3GD3A 1RP0A 1ZP0A 1NEKA 1XPQA 4ZN0A 3CIRA 2R45A 4H7UA 4H4SA 2YG5A 1ELIA 4IVMB 1W4XA 1FECA 2Z5YA 4J57A 1F8WA 5BULA 3ALMA 1LPFA 2XVIA 3REDA 5EOWA 4K8DA 4UDRA 3C4NA 2WPEA 1KF6A 1MOKA 2XVFA 4ECHA 2GQFA 1N4UA 1JNRA 4ZCCA 4KX6A 3CNPA 1Y56B 3NRNA 3VR9A 1YY5A 1NAAA 3DJDA 1E1NA 1ZK7A 1LQUA 1YKJA 2O9ZA 3GSIA 5CQFA 1OJDA 3O0HA 1F8RA 4REKA 3B3RA 1BWCA 4BURA 1KNPA 2GV8A 3V76A 1OJTA 4H2PA 4ICYA 3NTAA 1GEUA 3AEGA 4WX1A 4OPIA 2ZZBA 1LVLA 3AYIA 4BK3A 2GH5A 3JSKA 4J56A 3AYJA 2OLNA 1GNDA 3NGCX 2EQ6A 4H4XA 3AE9A 3P4QA 2BS3A 1CJ2A 1KNRA 1PJ5A 3ATQA 2HQMA 4LA1A 1ZOYA 4RSLA 2ARDA 2ZZCA 3CPJG 3LJPA 3NYEA 4JNQA 2Q0LA 4YSYA 2WOWA 1PBFA 2C3DA 4U8IA 2XLRA 4AP3A 1NDAA 5KVIA 3K30A 4CNJA 1GALA 1GRBA 1BKWA 3P4PA 3F8RA 4GUVA 1S2QA 3CNSA 2WDVA 3VRDB 1V59A 2WBAA 1H7WA 1IUXA 2V61A 2B76A 2GR1A 1GXFA 3GWDA 4Y4NA 2R4EA 1E39A 2F5ZA 4JDRA 4B66A 3DH9A 4B67A 2GMJA 3AECA 4YXDA 2AQJA 2IIDA 3AE5A 1H7XA 2EQ9A 3BI4A 3FIMB 4YTNA 4TM3A 2C75A 1PJ6A 5C2TA 1GRHA 2VQBA 2WP5A 1D5TA 5GSNA 3RHAA 1PS9A 2WDRA 2R0CA 3VRAA 1IUUA 2YM2A 1DJQA 3DK4A 1H81A 3KKJA 4K22A 2BK4A 4AT0A 1KSSA 2PYXA 4Z25A 2BXRA 5EBKA 3EPTA 1IUWA 4XXGA 1O95A 2WPFA 1JU2A 4U8OA 4EMJA 4TLZA 4RG4A 4I58A 4RG3A 1TDEA 3UCLA 3AE6A 3COXA 3IHMA 2XFQA 1GREA 2YR4A 3GYJA 2X50A 2VZ2A 2Z5XA 4C74A 2AR8A 4U8LA 2H89A 2A89A 1E6EA 2A87A 1YQZA 4HA6A 4FK1A 3UTGA 1F3PA 4H4QA 1FEAA 2ZBWA 4C3YA 2WHDA 3CTYA 2C73A 4OPTA 4FX9A 3D1CA 2YG3A 4EQSA 3DK8A 3BI2A 3AEFA 4EM4A 2FJBA 4EQRA 4H4UA 5ER0A 2E4GA 2C76A 4U8PA 4DSGA 2I0ZA 2V3AA 5M10A 1PXCA 2R46A 1GOSA 1QJDA 3NK2X 4U8KA 5BRTA 3NTDA 1RSGA 1LTXR 1E1MA 4AOXA 2TPRA 3P4SA 2APGA 2XLPA 4K7ZA 5FMHA 4B65A 1SEZA 2ZZ0A 3CGEA 1D7LA 3CGDA 1L9CA 4OPCA 4K5RA 4OPDA 4YTPA 2OALA 2Q6UA 2XCGA 3QSSA 3UTHA 2QCUA 2YLSA 2IVEA 3IHGA 3NT6A 3GMBA 2YLRA 3UKFA 4A65A 1F8SA 2R4JA 2RGOA 2GQWA 1DOEA 3IC9A 3RNMA 4GDPA 5HXIA 1NHQA 2FJEA 3SFDA 4A5LA 4YSXA 1H6VA 2PHHA 5FS9A 4LIIA 1M64A 4OVIA 1GERA 1B5QA 1DJNA 1VG0A 4UP3A 3GRSA 4Z44A 1JRXA 2TMDA 4H4RA 4J34A 5U1OA 2X8GA 2VVMA 2B9XA 4YSHA 2C72A 1H83A 3VQRA 2OAMA 1H86A 1Q1WA 3GDPA 4CCQA 4CCRA 2C7GA 1YQ3A 2XDOA 4AP1A 2BS2A 4J31A 4OPLA 5HY5A 4NTDA 4NEWA 3NN0X 2OLOA 1EL8A 3L8KA 1KDGA 3AE7A 3II4A 4OPGA 2CFYA 1FCDA 5J60A 2VQ7A 3UTFA 3B6DA 3CPIG 1OJCA 1QLBA 2V60A 2GAHB 4H4WA 1TDNA 1JEHA 3R9UA 4CRTA 1CF3A 1GRGA 3EAOA 4U8JA 1N1PA 2DKIA 2VVLA 1NG4A 1UKVG 5IQ4A 3F8PA 4FK1C 4JQ9A 1LQTA 4JN9A 5BUKA 2YG7A 3AD8B 1Y56A 5KOXA 3NK0X 2JBVA 3UP4A 4NTCA 4Z2RA 1ZY8A 1BGNA 2XYOA 3ALJA 4I59A 3UP5A 1TDFA 1DOBA 2GR0A 4EQWA 2GEWA 3CGBA 5KOWA 2BXSA 4NZHA 1BGJA 2C64A 2YWLA 4J33A 2WESA 2B7RA 3Q9TA 4X9NA 1L9EA 4A79A 3ABVA 4A7AA 4IVOB 2XFNA 1GRAA 4Z2TA 4EIQA 3RP6A 2WETA 1B4VA 2YG6A 3URHA 1MXTA 4B69A 1HYUA 3M13A 2QA1A 2WP6A 4CBQA 3P1WA 5KRQA 3UOXA 2VRLA 3IF9A 3M0OA 4PABA 2EQ7A 2XFPA 4U2LA 4U8MA 2C70A 1CC6A 1XANA 3T37A 1VG9A 3GYIA 2CULA 3H8IA 1DXLA 1LV0A 4EMWA 5JCKA 2JB2A 3DA1A 3AEEA 1IJHA 2FBWA 2YLXA 4USQA 3DMEA 3D8XA 2W0HA 4GRTA 4A6NB 3QSMA 4CY6A 5CKUA 1PHHA 1PBDA 3SQPA 2JB3A 3CGCA 4O5UA 1PBBA 3DGZA 3ICTA 3LXDA 3PVCA 3CNTA 4LU6A 4XWZA 5IQ1A 3UTEA 1AOGA 4H4PA 3AEDA 2YVJA 1QO8A 1XHCA 2XLUA 3CN8A 2YAUA 2XVHA 3NG7X 4YT0A 3GD4A 4IV9A 2EQ8A 2WOIA 5LV9A 3LB8A 1RYIA 1CL0A 3AE8A 4TM1A 4IA6A 2WPCA 1OJ9A 3ISHA 4K2XA 2RGHA 2H88A 2E5VA 2BS4A 5KXJA 4K5SA 5L46A 3C4AA 3GWFA 3ICSA 4EIPA 1D4CA 3GDNA 2GR2A 3C96A 2WDQA 3ATRA 2YLWA 2XLTA 2CDUA 2LFCA 3SFEA 4Z2UA 2UZZA 4GCMA 2Q0KA 3I6DA 4TM4A 3NHOX 1EL7A 1TRBA 2Y6RA 4U2SA 1IUSA 4AOSA 3G5QA 2DKHA 1P2EA 1O94A 2YM1A 3AEBA 3HZLA 2RABA 5FS6A 5HYMA 2A8XA 3IWAA 1CBOA 2BA9A 3Q6JA 3F8DA 5C3JA 1IUTA 2GVCA 1KFYA 1ZKQA 3FG2P 4HB9A 2YVGA 5DBJA 3NYFA 4H4VA 1VQWA 2J3NA 1X31B 3UKKA 1DOCA 5IPYA 2QAEA 1P2HA 2YG4A 3NK1X 2JKCA 3KLJA 5GRTA 4H4ZA 5M0ZA 2FJDA 2RGJA 3RP8A 3QVRA 4A99A 2YR6A 3AD7B 1MO9A 1CC4A 3LADA 3I3LA 4B68A 4H2NA 3ZDNA 5FS7A 1ZMDA 4Z26A 3H4KA 2BK3A 4AT2A 1GTHA 1S2YA 3EF6A 2ACZA 3UKQA 1GRTA 4JY2A 2C67A 2WU2A 2C3CA 1JRZA 1YQ4A 3ADAB 3VRBA 4U8NA 3QVPA 4IA5A 3P9UA 3DJEA 2NVKX 1VRQB 1K0LA 3AE4A 2BCPA 4J2WA
chains in the Genus database with same CATH superfamily
4EQXA 1B37A 2JK6A 3CPHG 5J7XA 3ITJA 1GESA 4NTEA 3WE0A 5KVHA 1GETA 1FEBA 4O5QA 4EMIA 1PN0A 1GRFA 1OJAA 4YKFA 5JCLA 1H82A 4M52A 4APNA 5KMSA 1CJ4A 1TYTA 1N4WA 3BHKA 3FBSA 1REOA 1NPXA 1FOHA 3GYXA 3OZ2A 4C5OA 2X99A 1PBCA 2X8CA 1GT8A 3ALLA 3DJGX 4PAAA 3FMWA 1CJ3A 2YR5A 3QJ4A 4ZCDA 2GR3A 1NHRA 2GMHA 4USRA 1GTEA 5U25A 1EBDA 1BZLA 3M12A 4CNKA 3NNEA 4NEVA 4EM3A 3AYLA 1TDOA 3OC4A 1E1LA 3KA7A 4YKGA 4Y4MA 3T0KA 1Q1RA 3AE3A 2R9ZA 1K0JA 3NN6X 1D4EA 4TLXA 2YLZA 4BJZA 3AE2A 4YSZA 2BCGG 2YLTA 3KPFA 2B7SA 3GMCA 2C66A 4G74A 4H2QA 4Z43A 5JCNA 4BJYA 4DSHA 4N9XA 2NPXA 2WQYA 2VRMA 3UKHA 1CJCA 5EB4A 4DGKA 4XWRA 4E0VA 3LZXA 2AAQA 1XDIA 3E1TA 4JNAA 1JNZA 3G5SA 3K7QX 3V3NA 1NHPA 2XFUA 3S61A 1COYA 5TR3A 4GF7A 3K7TA 4Z24A 2V3BA 5JCIA 1GSNA 1E7PA 3DK9A 2BACA 3G5RA 4B1BA 1CC2A 1JRYA 4H50A 1K4QA 3LZWA 1ZDLA 3KU9A 1IUVA 1GV4A 3DGHA 4FDCB 4X4JA 1EL9A 2BRYA 3AWIA 3CNJA 3PO7A 4TM0A 2IVDA 4YTMA 1D4DA 2BK5A 2GB0A 2GRTA 3P4RA 3EANA 4WCTA 2BC0A 3LOVA 2YQUA 3SGLA 1FL2A 4B64A 4B63A 1PXAA 3AE1A 3UKAA 3BNUA 3UKLA 3SZ0A 3NLCA 1ONFA 3BI5A 4C77A 2Q7VA 5BVAA 5KWFA 2Y6QA 1DODA 2X3NA 2JB1A 2V5ZA 3KD9A 4A6NA 3AXBA 3AD9B 1PBEA 1F6MA 3SM8A 4U2TA 4UDQA 2YVFA 3NYCA 1PJ7A 3S5WA 1Z6LA 3BHFA 1S3EA 3H8LA 4D03A 1LJ1A 2GF3A 4GR1A 1TDKA 2OA1A 1PXBA 4OCGA 1NG3A 2CVJA 3BNMA 3CNDA 3GRTA 4A9WA 1D7YA 2FJAA 1S3BA 1Y0PA 1ZMCA 2C65A 2V6OA 2XLSA 4D04A 2WOVA 4P9SA 4ADWA 1Q9IA 1ZX9A 1O5WA 3AB1A 3AEAA 5FS8A 1H84A 2WS3A 3K7MX 1KSUA 1VDCA 3DJJA 4MJWA 1EL5A 4C3XA 5KNLA 1NHSA 3PS9A 4Y4LA 4BK2A 1L9DA 3KVEA 5EB5A 4GDEA 2QA2A 3NIXA 2BYBA 3ZYXA 4BV6A 4DNAA 3KPKA 5KMPA 1L0VA 4X9MA 3L1RA 1CHUA 3NKSA 2R0PA 4JY3A 1DNCA 3FPZA 3ICRA 5U63A 4CY8A 1GPEA 1M6IA 2WEUA 1BF3A 1ZOVA 2R0GA 4UDPA 3RP7A 1PDHA 1K0IA 2GAGB 4BK1A 3QSEA 3VR8A 4OPUA 3UOVA 5JCMA 3NH3X 1B8SA 2BC1A 4YWOA 2VOUA 2XVJA 4J36A 2B9YA 3UKPA 3UOYA 4H2RA 2E1MA 2BABA 2WU5A 2WP9A 2XVEA 5HHFA 3V3OA 4H4TA 2X8HA 2B9WA 2JAEA 3SXIA 1E1KA 1TYPA 1JOAA 3UOZA 4H4YA 4KPRA 2VVLG 3QFAA 3SZWA 3QFBA 1N4VA 1NENA 2XFOA 3GD3A 1RP0A 1ZP0A 1NEKA 1XPQA 4ZN0A 3CIRA 2R45A 4H7UA 4H4SA 2YG5A 1ELIA 4IVMB 1W4XA 1FECA 2Z5YA 4J57A 3SY4A 1F8WA 5BULA 3ALMA 1LPFA 2XVIA 3REDA 5EOWA 4K8DA 4UDRA 3C4NA 2WPEA 1KF6A 1MOKA 2XVFA 4ECHA 2GQFA 1N4UA 1JNRA 4ZCCA 4KX6A 3CNPA 1Y56B 3NRNA 3VR9A 1YY5A 1NAAA 3DJDA 1E1NA 1ZK7A 1LQUA 1YKJA 2O9ZA 3GSIA 5CQFA 1OJDA 3O0HA 1F8RA 4REKA 3B3RA 3T31A 1BWCA 4BURA 1KNPA 2GV8A 3V76A 1OJTA 4H2PA 4ICYA 3NTAA 1GEUA 3AEGA 4WX1A 4OPIA 2ZZBA 1LVLA 3AYIA 4BK3A 2GH5A 3JSKA 4J56A 3AYJA 2OLNA 1GNDA 3CMMA 3NGCX 2EQ6A 4H4XA 3AE9A 3P4QA 2BS3A 4NWZA 1CJ2A 1KNRA 4GAPA 1PJ5A 3ATQA 2HQMA 3HYVA 4LA1A 1ZOYA 4RSLA 2ARDA 2ZZCA 3CPJG 3LJPA 3NYEA 4JNQA 2Q0LA 4YSYA 2WOWA 1PBFA 2C3DA 4U8IA 2XLRA 4AP3A 1NDAA 5KVIA 3K30A 4CNJA 1GALA 1GRBA 1BKWA 3P4PA 3F8RA 4GUVA 1S2QA 3CNSA 2WDVA 3VRDB 1V59A 2WBAA 1H7WA 1IUXA 2V61A 2B76A 2GR1A 1GXFA 3GWDA 4Y4NA 2R4EA 1E39A 2F5ZA 4JDRA 4B66A 3DH9A 4B67A 2GMJA 3AECA 4YXDA 2AQJA 2IIDA 3AE5A 1H7XA 2EQ9A 3BI4A 3FIMB 4NNJA 4TM3A 4YTNA 2C75A 1PJ6A 5C2TA 1GRHA 2VQBA 2WP5A 1D5TA 5GSNA 3RHAA 1PS9A 2WDRA 2R0CA 4G9KA 3VRAA 1IUUA 2YM2A 1DJQA 3DK4A 1H81A 3KKJA 4K22A 2BK4A 4AT0A 1KSSA 2PYXA 4Z25A 2BXRA 5EBKA 3EPTA 1IUWA 4XXGA 1O95A 2WPFA 1JU2A 4U8OA 4EMJA 4TLZA 4RG4A 4I58A 4RG3A 1TDEA 3UCLA 3AE6A 3COXA 3IHMA 2XFQA 1GREA 2YR4A 3GYJA 2X50A 2VZ2A 2Z5XA 4C74A 2AR8A 4U8LA 2H89A 2A89A 1E6EA 2A87A 1YQZA 4G73A 4FK1A 4HA6A 1F3PA 4H4QA 1FEAA 2ZBWA 3UTGA 4C3YA 2WHDA 3CTYA 3T2ZA 2C73A 4OPTA 4FX9A 3D1CA 2YG3A 5KMQA 4EQSA 3DK8A 3BI2A 3AEFA 4EM4A 2FJBA 4EQRA 4H4UA 5ER0A 2E4GA 2C76A 4U8PA 4DSGA 2I0ZA 2V3AA 5M10A 1PXCA 2R46A 1GOSA 1QJDA 3NK2X 4U8KA 5BRTA 3NTDA 1RSGA 1LTXR 1E1MA 4AOXA 2TPRA 3P4SA 3T2YA 2APGA 2XLPA 4K7ZA 5FMHA 4B65A 1SEZA 2ZZ0A 3CGEA 4II3A 1D7LA 3CGDA 1L9CA 4OPCA 4K5RA 4OPDA 4YTPA 2OALA 2Q6UA 2XCGA 3QSSA 3UTHA 2QCUA 2YLSA 2IVEA 3IHGA 3NT6A 3GMBA 2YLRA 4G6HA 3UKFA 4A65A 1F8SA 2R4JA 2RGOA 2GQWA 1DOEA 3IC9A 3RNMA 4GDPA 5HXIA 1NHQA 2FJEA 3SFDA 4A5LA 4YSXA 1H6VA 2PHHA 5FS9A 4LIIA 1M64A 2BRAA 4OVIA 1GERA 1B5QA 1DJNA 4II2A 1VG0A 4UP3A 3GRSA 4Z44A 1JRXA 2TMDA 4H4RA 4J34A 5U1OA 2X8GA 2VVMA 2B9XA 4YSHA 2C72A 1H83A 3VQRA 2OAMA 1H86A 1Q1WA 3GDPA 3SX6A 4CCQA 4CCRA 2C7GA 1YQ3A 2XDOA 4AP1A 2BS2A 4J31A 4OPLA 5HY5A 4NTDA 4NEWA 3NN0X 2OLOA 1EL8A 3L8KA 1KDGA 3AE7A 3II4A 4OPGA 2CFYA 1FCDA 5J60A 2VQ7A 2C4CA 3UTFA 3B6DA 3CPIG 1OJCA 1QLBA 2V60A 2GAHB 4H4WA 1TDNA 1JEHA 3R9UA 4CRTA 1CF3A 1GRGA 3EAOA 4U8JA 1N1PA 2DKIA 2VVLA 3SYIA 1NG4A 1UKVG 5IQ4A 3F8PA 4FK1C 4JQ9A 1LQTA 4JN9A 5BUKA 3SZFA 2YG7A 3AD8B 1Y56A 5KOXA 3NK0X 2JBVA 3UP4A 4NTCA 4Z2RA 1ZY8A 1BGNA 2XYOA 3ALJA 4I59A 3UP5A 1TDFA 1DOBA 2GR0A 4EQWA 2GEWA 3CGBA 5KOWA 2BXSA 4NZHA 1BGJA 2C64A 2YWLA 4J33A 2WESA 2B7RA 3Q9TA 4X9NA 1L9EA 4A79A 3ABVA 4A7AA 4IVOB 2XFNA 1GRAA 4Z2TA 4EIQA 3RP6A 2WETA 1B4VA 2YG6A 3URHA 1MXTA 4B69A 3HYXA 1HYUA 3M13A 2QA1A 2WP6A 4CBQA 3P1WA 5KRQA 3UOXA 2VRLA 3IF9A 3M0OA 4PABA 2EQ7A 2XFPA 4U2LA 4U8MA 2C70A 1CC6A 1XANA 3T37A 1VG9A 3GYIA 2CULA 3H8IA 1DXLA 1LV0A 4EMWA 3T14A 2JB2A 3DA1A 5JCKA 3AEEA 3T2KA 1IJHA 2FBWA 2YLXA 4USQA 3DMEA 3D8XA 2W0HA 4GRTA 4A6NB 3QSMA 4CY6A 3SZCA 5CKUA 1PHHA 1PBDA 3SQPA 2JB3A 3CGCA 4O5UA 1PBBA 3DGZA 3ICTA 3LXDA 3PVCA 3CNTA 4LU6A 4XWZA 5IQ1A 3UTEA 1AOGA 4H4PA 3AEDA 2YVJA 1QO8A 1XHCA 2XLUA 3CN8A 2YAUA 2XVHA 3NG7X 3HYWA 3GD4A 4IV9A 4YT0A 2EQ8A 2WOIA 5LV9A 5KMRA 3LB8A 1RYIA 1CL0A 3AE8A 4TM1A 4IA6A 2WPCA 1OJ9A 3ISHA 4K2XA 2RGHA 2H88A 2E5VA 2BS4A 5KXJA 4K5SA 5L46A 3C4AA 3GWFA 3ICSA 4EIPA 1D4CA 3GDNA 2GR2A 3C96A 2WDQA 3ATRA 2YLWA 2XLTA 2CDUA 4G6GA 2LFCA 3SFEA 4Z2UA 2UZZA 4GCMA 2Q0KA 3I6DA 4TM4A 3NHOX 1EL7A 1TRBA 2Y6RA 4U2SA 1IUSA 4AOSA 3G5QA 2DKHA 1P2EA 1O94A 2YM1A 3AEBA 3HZLA 2RABA 5FS6A 5HYMA 2A8XA 3IWAA 1CBOA 2BA9A 3Q6JA 3F8DA 5C3JA 1IUTA 2GVCA 1KFYA 1ZKQA 3FG2P 4HB9A 2YVGA 5DBJA 3NYFA 4H4VA 1VQWA 2J3NA 1X31B 3UKKA 1DOCA 5IPYA 2QAEA 1P2HA 2YG4A 3NK1X 2JKCA 3KLJA 5GRTA 4H4ZA 5M0ZA 2FJDA 2RGJA 3RP8A 3QVRA 4A99A 2YR6A 3AD7B 1MO9A 1CC4A 3LADA 3I3LA 4GAVA 4B68A 4H2NA 3ZDNA 5FS7A 1ZMDA 4Z26A 3H4KA 2BK3A 4AT2A 1GTHA 1S2YA 3EF6A 2ACZA 3UKQA 1GRTA 4JY2A 2C67A 2WU2A 2C3CA 1JRZA 1YQ4A 3ADAB 3VRBA 4U8NA 3QVPA 4IA5A 3P9UA 3DJEA 2NVKX 1VRQB 1K0LA 3AE4A 2BCPA 4J2WA
chains in the Genus database with same CATH topology
4EQXA 1B37A 2JK6A 3CPHG 5J7XA 3ITJA 1GESA 4NTEA 3WE0A 5KVHA 1GETA 1FEBA 4O5QA 4EMIA 1PN0A 1GRFA 1OJAA 4YKFA 5JCLA 1H82A 4M52A 4APNA 5KMSA 1CJ4A 1TYTA 1N4WA 3BHKA 3FBSA 1REOA 1NPXA 1FOHA 3GYXA 3OZ2A 4C5OA 2X99A 1PBCA 2X8CA 1GT8A 3ALLA 3DJGX 4PAAA 3FMWA 1CJ3A 2YR5A 3QJ4A 4ZCDA 2GR3A 1NHRA 2GMHA 4USRA 1GTEA 5U25A 1EBDA 1BZLA 3M12A 4CNKA 3NNEA 4NEVA 4EM3A 3AYLA 1TDOA 3OC4A 1E1LA 3KA7A 4YKGA 4Y4MA 3T0KA 1Q1RA 3AE3A 2R9ZA 1K0JA 3NN6X 1D4EA 4TLXA 2YLZA 4BJZA 3AE2A 4YSZA 2BCGG 2YLTA 3KPFA 2B7SA 3GMCA 2C66A 4G74A 4H2QA 4Z43A 5JCNA 4BJYA 4DSHA 4N9XA 2NPXA 2WQYA 2VRMA 3UKHA 1CJCA 5EB4A 4DGKA 4XWRA 4E0VA 3LZXA 2AAQA 1XDIA 3E1TA 4JNAA 1JNZA 3G5SA 3K7QX 3V3NA 1NHPA 2XFUA 3S61A 1COYA 5TR3A 4GF7A 3K7TA 4Z24A 2V3BA 5JCIA 1GSNA 1E7PA 3DK9A 2BACA 3G5RA 4B1BA 1CC2A 1JRYA 4H50A 1K4QA 3LZWA 1ZDLA 3KU9A 1IUVA 1GV4A 3DGHA 4FDCB 4X4JA 1EL9A 2BRYA 3AWIA 3CNJA 3PO7A 4TM0A 2IVDA 4YTMA 1D4DA 2BK5A 2GB0A 2GRTA 3P4RA 3EANA 4WCTA 2BC0A 3LOVA 2YQUA 3SGLA 1FL2A 4B64A 4B63A 1PXAA 3AE1A 3UKAA 3BNUA 3UKLA 3SZ0A 3NLCA 1ONFA 3BI5A 4C77A 2Q7VA 5BVAA 5KWFA 2Y6QA 1DODA 2X3NA 2JB1A 2V5ZA 3KD9A 4A6NA 3AXBA 3AD9B 1PBEA 1F6MA 3SM8A 4U2TA 4UDQA 2YVFA 3NYCA 1PJ7A 3S5WA 1Z6LA 3BHFA 1S3EA 3H8LA 4D03A 1LJ1A 2GF3A 4GR1A 1TDKA 2OA1A 1PXBA 4OCGA 1NG3A 2CVJA 3BNMA 3CNDA 3GRTA 4A9WA 1D7YA 2FJAA 1S3BA 1Y0PA 1ZMCA 2C65A 2V6OA 2XLSA 4D04A 2WOVA 4P9SA 4ADWA 1Q9IA 1ZX9A 1O5WA 3AB1A 3AEAA 5FS8A 1H84A 2WS3A 3K7MX 1KSUA 1VDCA 3DJJA 4MJWA 1EL5A 4C3XA 5KNLA 1NHSA 3PS9A 4Y4LA 4BK2A 1L9DA 3KVEA 5EB5A 4GDEA 2QA2A 3NIXA 2BYBA 3ZYXA 4BV6A 4DNAA 3KPKA 5KMPA 1L0VA 4X9MA 3L1RA 1CHUA 3NKSA 2R0PA 4JY3A 1DNCA 3FPZA 3ICRA 5U63A 4CY8A 1GPEA 1M6IA 2WEUA 1BF3A 1ZOVA 2R0GA 4UDPA 3RP7A 1PDHA 1K0IA 2GAGB 4BK1A 3QSEA 3VR8A 4OPUA 3UOVA 5JCMA 3NH3X 1B8SA 2BC1A 4YWOA 2VOUA 2XVJA 4J36A 2B9YA 3UKPA 3UOYA 4H2RA 2E1MA 2BABA 2WU5A 2WP9A 2XVEA 5HHFA 3V3OA 4H4TA 2X8HA 2B9WA 2JAEA 3SXIA 1E1KA 1TYPA 1JOAA 3UOZA 4H4YA 4KPRA 2VVLG 3QFAA 3SZWA 3QFBA 1N4VA 1NENA 2XFOA 3GD3A 1RP0A 1ZP0A 1NEKA 1XPQA 4ZN0A 3CIRA 2R45A 4H7UA 4H4SA 2YG5A 1ELIA 4IVMB 1W4XA 1FECA 2Z5YA 4J57A 3SY4A 1F8WA 5BULA 3ALMA 1LPFA 2XVIA 3REDA 5EOWA 4K8DA 4UDRA 3C4NA 2WPEA 1KF6A 1MOKA 2XVFA 4ECHA 2GQFA 1N4UA 1JNRA 4ZCCA 4KX6A 3CNPA 1Y56B 3NRNA 3VR9A 1YY5A 1NAAA 3DJDA 1E1NA 1ZK7A 1LQUA 1YKJA 2O9ZA 3GSIA 5CQFA 1OJDA 3O0HA 1F8RA 4REKA 3B3RA 3T31A 1BWCA 4BURA 1KNPA 2GV8A 3V76A 1OJTA 4H2PA 4ICYA 3NTAA 1GEUA 3AEGA 4WX1A 4OPIA 2ZZBA 1LVLA 3AYIA 4BK3A 2GH5A 3JSKA 4J56A 3AYJA 2OLNA 1GNDA 3CMMA 3NGCX 2EQ6A 4H4XA 3AE9A 3P4QA 2BS3A 4NWZA 1CJ2A 1KNRA 4GAPA 1PJ5A 3ATQA 2HQMA 3HYVA 4LA1A 1ZOYA 4RSLA 2ARDA 2ZZCA 3CPJG 3LJPA 3NYEA 4JNQA 2Q0LA 4YSYA 2WOWA 1PBFA 2C3DA 4U8IA 2XLRA 4AP3A 1NDAA 5KVIA 3K30A 4CNJA 1GALA 1GRBA 1BKWA 3P4PA 3F8RA 4GUVA 1S2QA 3CNSA 2WDVA 3VRDB 1V59A 2WBAA 1H7WA 1IUXA 2V61A 2B76A 2GR1A 1GXFA 3GWDA 4Y4NA 2R4EA 1E39A 2F5ZA 4JDRA 4B66A 3DH9A 4B67A 2GMJA 3AECA 4YXDA 2AQJA 2IIDA 3AE5A 1H7XA 2EQ9A 3BI4A 3FIMB 4NNJA 4TM3A 4YTNA 2C75A 1PJ6A 5C2TA 1GRHA 2VQBA 2WP5A 1D5TA 5GSNA 3RHAA 1PS9A 2WDRA 2R0CA 4G9KA 3VRAA 1IUUA 2YM2A 1DJQA 3DK4A 1H81A 3KKJA 4K22A 2BK4A 4AT0A 1KSSA 2PYXA 4Z25A 2BXRA 5EBKA 3EPTA 1IUWA 4XXGA 1O95A 2WPFA 1JU2A 4U8OA 4EMJA 4TLZA 4RG4A 4I58A 4RG3A 1TDEA 3UCLA 3AE6A 3COXA 3IHMA 2XFQA 1GREA 2YR4A 3GYJA 2X50A 2VZ2A 2Z5XA 4C74A 2AR8A 4U8LA 2H89A 2A89A 1E6EA 2A87A 1YQZA 4G73A 4FK1A 4HA6A 1F3PA 4H4QA 1FEAA 2ZBWA 3UTGA 4C3YA 2WHDA 3CTYA 3T2ZA 2C73A 4OPTA 4FX9A 3D1CA 2YG3A 5KMQA 4EQSA 3DK8A 3BI2A 3AEFA 4EM4A 2FJBA 4EQRA 4H4UA 5ER0A 2E4GA 2C76A 4U8PA 4DSGA 2I0ZA 2V3AA 5M10A 1PXCA 2R46A 1GOSA 1QJDA 3NK2X 4U8KA 5BRTA 3NTDA 1RSGA 1LTXR 1E1MA 4AOXA 2TPRA 3P4SA 3T2YA 2APGA 2XLPA 4K7ZA 5FMHA 4B65A 1SEZA 2ZZ0A 3CGEA 4II3A 1D7LA 3CGDA 1L9CA 4OPCA 4K5RA 4OPDA 4YTPA 2OALA 2Q6UA 2XCGA 3QSSA 3UTHA 2QCUA 2YLSA 2IVEA 3IHGA 3NT6A 3GMBA 2YLRA 4G6HA 3UKFA 4A65A 1F8SA 2R4JA 2RGOA 2GQWA 1DOEA 3IC9A 3RNMA 4GDPA 5HXIA 1NHQA 2FJEA 3SFDA 4A5LA 4YSXA 1H6VA 2PHHA 5FS9A 4LIIA 1M64A 2BRAA 4OVIA 1GERA 1B5QA 1DJNA 4II2A 1VG0A 4UP3A 3GRSA 4Z44A 1JRXA 2TMDA 4H4RA 4J34A 5U1OA 2X8GA 2VVMA 2B9XA 4YSHA 2C72A 1H83A 3VQRA 2OAMA 1H86A 1Q1WA 3GDPA 3SX6A 4CCQA 4CCRA 2C7GA 1YQ3A 2XDOA 4AP1A 2BS2A 4J31A 4OPLA 5HY5A 4NTDA 4NEWA 3NN0X 2OLOA 1EL8A 3L8KA 1KDGA 3AE7A 3II4A 4OPGA 2CFYA 1FCDA 5J60A 2VQ7A 2C4CA 3UTFA 3B6DA 3CPIG 1OJCA 1QLBA 2V60A 2GAHB 4H4WA 1TDNA 1JEHA 3R9UA 4CRTA 1CF3A 1GRGA 3EAOA 4U8JA 1N1PA 2DKIA 2VVLA 3SYIA 1NG4A 1UKVG 5IQ4A 3F8PA 4FK1C 4JQ9A 1LQTA 4JN9A 5BUKA 3SZFA 2YG7A 3AD8B 1Y56A 5KOXA 3NK0X 2JBVA 3UP4A 4NTCA 4Z2RA 1ZY8A 1BGNA 2XYOA 3ALJA 4I59A 3UP5A 1TDFA 1DOBA 2GR0A 4EQWA 2GEWA 3CGBA 5KOWA 2BXSA 4NZHA 1BGJA 2C64A 2YWLA 4J33A 2WESA 2B7RA 3Q9TA 4X9NA 1L9EA 4A79A 3ABVA 4A7AA 4IVOB 2XFNA 1GRAA 4Z2TA 4EIQA 3RP6A 2WETA 1B4VA 2YG6A 3URHA 1MXTA 4B69A 3HYXA 1HYUA 3M13A 2QA1A 2WP6A 4CBQA 3P1WA 5KRQA 3UOXA 2VRLA 3IF9A 3M0OA 4PABA 2EQ7A 2XFPA 4U2LA 4U8MA 2C70A 1CC6A 1XANA 3T37A 1VG9A 3GYIA 2CULA 3H8IA 1DXLA 1LV0A 4EMWA 3T14A 2JB2A 3DA1A 5JCKA 3AEEA 3T2KA 1IJHA 2FBWA 2YLXA 4USQA 3DMEA 3D8XA 2W0HA 4GRTA 4A6NB 3QSMA 4CY6A 3SZCA 5CKUA 1PHHA 1PBDA 3SQPA 2JB3A 3CGCA 4O5UA 1PBBA 3DGZA 3ICTA 3LXDA 3PVCA 3CNTA 4LU6A 4XWZA 5IQ1A 3UTEA 1AOGA 4H4PA 3AEDA 2YVJA 1QO8A 1XHCA 2XLUA 3CN8A 2YAUA 2XVHA 3NG7X 3HYWA 3GD4A 4IV9A 4YT0A 2EQ8A 2WOIA 5LV9A 5KMRA 3LB8A 1RYIA 1CL0A 3AE8A 4TM1A 4IA6A 2WPCA 1OJ9A 3ISHA 4K2XA 2RGHA 2H88A 2E5VA 2BS4A 5KXJA 4K5SA 5L46A 3C4AA 3GWFA 3ICSA 4EIPA 1D4CA 3GDNA 2GR2A 3C96A 2WDQA 3ATRA 2YLWA 2XLTA 2CDUA 4G6GA 2LFCA 3SFEA 4Z2UA 2UZZA 4GCMA 2Q0KA 3I6DA 4TM4A 3NHOX 1EL7A 1TRBA 2Y6RA 4U2SA 1IUSA 4AOSA 3G5QA 2DKHA 1P2EA 1O94A 2YM1A 3AEBA 3HZLA 2RABA 5FS6A 5HYMA 2A8XA 3IWAA 1CBOA 2BA9A 3Q6JA 3F8DA 5C3JA 1IUTA 2GVCA 1KFYA 1ZKQA 3FG2P 4HB9A 2YVGA 5DBJA 3NYFA 4H4VA 1VQWA 2J3NA 1X31B 3UKKA 1DOCA 5IPYA 2QAEA 1P2HA 2YG4A 3NK1X 2JKCA 3KLJA 5GRTA 4H4ZA 5M0ZA 2FJDA 2RGJA 3RP8A 3QVRA 4A99A 2YR6A 3AD7B 1MO9A 1CC4A 3LADA 3I3LA 4GAVA 4B68A 4H2NA 3ZDNA 5FS7A 1ZMDA 4Z26A 3H4KA 2BK3A 4AT2A 1GTHA 1S2YA 3EF6A 2ACZA 3UKQA 1GRTA 4JY2A 2C67A 2WU2A 2C3CA 1JRZA 1YQ4A 3ADAB 3VRBA 4U8NA 3QVPA 4IA5A 3P9UA 3DJEA 2NVKX 1VRQB 1K0LA 3AE4A 2BCPA 4J2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQX A;  1B37 A;  2JK6 A;  3CPH G;  5J7X A;  3ITJ A;  1GES A;  4NTE A;  3WE0 A;  5KVH A;  1GET A;  1FEB A;  4O5Q A;  4EMI A;  1PN0 A;  1GRF A;  1OJA A;  4YKF A;  5JCL A;  1H82 A;  4M52 A;  4APN A;  1CJ4 A;  1TYT A;  1N4W A;  3BHK A;  3FBS A;  1REO A;  1NPX A;  1FOH A;  3OZ2 A;  3GYX A;  4C5O A;  2X99 A;  1PBC A;  2X8C A;  1GT8 A;  3ALL A;  3DJG X;  4PAA A;  3FMW A;  1CJ3 A;  2YR5 A;  3QJ4 A;  4ZCD A;  2GR3 A;  1NHR A;  2GMH A;  4USR A;  1GTE A;  5U25 A;  1EBD A;  1BZL A;  3M12 A;  4CNK A;  3NNE A;  4NEV A;  4EM3 A;  3AYL A;  1TDO A;  3OC4 A;  1E1L A;  3KA7 A;  4YKG A;  4Y4M A;  1Q1R A;  3AE3 A;  2R9Z A;  1K0J A;  3NN6 X;  1D4E A;  4TLX A;  2YLZ A;  4BJZ A;  3AE2 A;  4YSZ A;  2BCG G;  2YLT A;  3KPF A;  2B7S A;  3GMC A;  2C66 A;  4H2Q A;  4Z43 A;  5JCN A;  4BJY A;  4DSH A;  4N9X A;  2NPX A;  2WQY A;  2VRM A;  3UKH A;  1CJC A;  5EB4 A;  4DGK A;  4XWR A;  4E0V A;  3LZX A;  2AAQ A;  1XDI A;  3E1T A;  4JNA A;  1JNZ A;  3G5S A;  3K7Q X;  3V3N A;  1NHP A;  2XFU A;  3S61 A;  1COY A;  5TR3 A;  4GF7 A;  3K7T A;  4Z24 A;  2V3B A;  5JCI A;  1GSN A;  1E7P A;  3DK9 A;  2BAC A;  3G5R A;  4B1B A;  1CC2 A;  1JRY A;  4H50 A;  1K4Q A;  3LZW A;  1ZDL A;  3KU9 A;  1IUV A;  1GV4 A;  3DGH A;  4FDC B;  4X4J A;  1EL9 A;  3AWI A;  3CNJ A;  3PO7 A;  4TM0 A;  2IVD A;  4YTM A;  1D4D A;  2BK5 A;  2GB0 A;  2GRT A;  3P4R A;  3EAN A;  4WCT A;  2BC0 A;  3LOV A;  2YQU A;  3SGL A;  1FL2 A;  4B64 A;  4B63 A;  1PXA A;  3AE1 A;  3UKA A;  3BNU A;  3UKL A;  5BVA A;  3NLC A;  1ONF A;  3BI5 A;  4C77 A;  2Q7V A;  5KWF A;  2Y6Q A;  1DOD A;  2X3N A;  2JB1 A;  2V5Z A;  3KD9 A;  4A6N A;  3AXB A;  3AD9 B;  1PBE A;  1F6M A;  3SM8 A;  4U2T A;  4UDQ A;  2YVF A;  3NYC A;  1PJ7 A;  3S5W A;  1Z6L A;  3BHF A;  1S3E A;  3H8L A;  4D03 A;  1LJ1 A;  2GF3 A;  4GR1 A;  1TDK A;  2OA1 A;  1PXB A;  4OCG A;  1NG3 A;  2CVJ A;  3BNM A;  3CND A;  3GRT A;  4A9W A;  1D7Y A;  2FJA A;  1S3B A;  1Y0P A;  1ZMC A;  2C65 A;  2V6O A;  2XLS A;  4D04 A;  2WOV A;  4P9S A;  4ADW A;  1Q9I A;  1ZX9 A;  1O5W A;  3AB1 A;  3AEA A;  5FS8 A;  1H84 A;  2WS3 A;  3K7M X;  1KSU A;  1VDC A;  3DJJ A;  4MJW A;  1EL5 A;  4C3X A;  1NHS A;  3PS9 A;  4Y4L A;  4BK2 A;  1L9D A;  3KVE A;  5EB5 A;  4GDE A;  2QA2 A;  3NIX A;  2BYB A;  3ZYX A;  4BV6 A;  4DNA A;  1L0V A;  4X9M A;  3L1R A;  1CHU A;  3NKS A;  2R0P A;  4JY3 A;  1DNC A;  3FPZ A;  3ICR A;  5U63 A;  4CY8 A;  1GPE A;  1M6I A;  2WEU A;  1BF3 A;  1ZOV A;  2R0G A;  4UDP A;  3RP7 A;  1PDH A;  1K0I A;  2GAG B;  4BK1 A;  3QSE A;  3VR8 A;  4OPU A;  3UOV A;  5JCM A;  3NH3 X;  1B8S A;  2BC1 A;  4YWO A;  2VOU A;  2XVJ A;  4J36 A;  2B9Y A;  3UKP A;  3UOY A;  4H2R A;  2E1M A;  2BAB A;  2WU5 A;  2WP9 A;  2XVE A;  5HHF A;  3V3O A;  4H4T A;  2X8H A;  2B9W A;  2JAE A;  1E1K A;  1TYP A;  1JOA A;  3UOZ A;  4H4Y A;  4KPR A;  2VVL G;  3QFA A;  3QFB A;  1N4V A;  1NEN A;  2XFO A;  3GD3 A;  1RP0 A;  1ZP0 A;  1NEK A;  1XPQ A;  4ZN0 A;  3CIR A;  2R45 A;  4H7U A;  4H4S A;  2YG5 A;  1ELI A;  4IVM B;  1W4X A;  1FEC A;  2Z5Y A;  4J57 A;  1F8W A;  5BUL A;  3ALM A;  1LPF A;  2XVI A;  3RED A;  5EOW A;  4K8D A;  4UDR A;  3C4N A;  2WPE A;  1KF6 A;  1MOK A;  2XVF A;  4ECH A;  2GQF A;  1N4U A;  1JNR A;  4ZCC A;  4KX6 A;  3CNP A;  1Y56 B;  3NRN A;  3VR9 A;  1YY5 A;  1NAA A;  3DJD A;  1E1N A;  1ZK7 A;  1LQU A;  1YKJ A;  2O9Z A;  3GSI A;  5CQF A;  1OJD A;  3O0H A;  1F8R A;  4REK A;  3B3R A;  1BWC A;  4BUR A;  1KNP A;  2GV8 A;  3V76 A;  1OJT A;  4H2P A;  4ICY A;  3NTA A;  1GEU A;  3AEG A;  4WX1 A;  4OPI A;  2ZZB A;  1LVL A;  3AYI A;  4BK3 A;  2GH5 A;  3JSK A;  4J56 A;  3AYJ A;  2OLN A;  1GND A;  3NGC X;  2EQ6 A;  4H4X A;  3AE9 A;  3P4Q A;  2BS3 A;  1CJ2 A;  1KNR A;  1PJ5 A;  3ATQ A;  2HQM A;  4LA1 A;  1ZOY A;  4RSL A;  2ARD A;  2ZZC A;  3CPJ G;  3LJP A;  3NYE A;  4JNQ A;  2Q0L A;  4YSY A;  2WOW A;  1PBF A;  2C3D A;  4U8I A;  2XLR A;  4AP3 A;  1NDA A;  5KVI A;  3K30 A;  4CNJ A;  1GAL A;  1GRB A;  1BKW A;  3P4P A;  3F8R A;  4GUV A;  1S2Q A;  3CNS A;  2WDV A;  3VRD B;  1V59 A;  2WBA A;  1H7W A;  1IUX A;  2V61 A;  2B76 A;  2GR1 A;  1GXF A;  3GWD A;  4Y4N A;  2R4E A;  1E39 A;  2F5Z A;  4JDR A;  4B66 A;  3DH9 A;  4B67 A;  2GMJ A;  3AEC A;  4YXD A;  2AQJ A;  2IID A;  3AE5 A;  1H7X A;  2EQ9 A;  3BI4 A;  3FIM B;  4YTN A;  4TM3 A;  2C75 A;  1PJ6 A;  5C2T A;  1GRH A;  2VQB A;  2WP5 A;  1D5T A;  5GSN A;  3RHA A;  1PS9 A;  2WDR A;  2R0C A;  3VRA A;  1IUU A;  2YM2 A;  1DJQ A;  3DK4 A;  1H81 A;  3KKJ A;  4K22 A;  2BK4 A;  4AT0 A;  1KSS A;  2PYX A;  4Z25 A;  2BXR A;  5EBK A;  3EPT A;  1IUW A;  4XXG A;  1O95 A;  2WPF A;  1JU2 A;  4U8O A;  4EMJ A;  4TLZ A;  4RG4 A;  4I58 A;  4RG3 A;  1TDE A;  3UCL A;  3AE6 A;  3COX A;  3IHM A;  2XFQ A;  1GRE A;  2YR4 A;  3GYJ A;  2X50 A;  2VZ2 A;  2Z5X A;  4C74 A;  2AR8 A;  4U8L A;  2H89 A;  2A89 A;  1E6E A;  2A87 A;  1YQZ A;  4HA6 A;  4FK1 A;  3UTG A;  1F3P A;  4H4Q A;  1FEA A;  2ZBW A;  4C3Y A;  2WHD A;  3CTY A;  2C73 A;  4OPT A;  4FX9 A;  3D1C A;  2YG3 A;  4EQS A;  3DK8 A;  3BI2 A;  3AEF A;  4EM4 A;  2FJB A;  4EQR A;  4H4U A;  5ER0 A;  2E4G A;  2C76 A;  4U8P A;  4DSG A;  2I0Z A;  2V3A A;  5M10 A;  1PXC A;  2R46 A;  1GOS A;  1QJD A;  3NK2 X;  4U8K A;  5BRT A;  3NTD A;  1RSG A;  1LTX R;  1E1M A;  4AOX A;  2TPR A;  3P4S A;  2APG A;  2XLP A;  4K7Z A;  5FMH A;  4B65 A;  1SEZ A;  2ZZ0 A;  3CGE A;  1D7L A;  3CGD A;  1L9C A;  4OPC A;  4K5R A;  4OPD A;  4YTP A;  2OAL A;  2Q6U A;  2XCG A;  3QSS A;  3UTH A;  2QCU A;  2YLS A;  2IVE A;  3IHG A;  3NT6 A;  3GMB A;  2YLR A;  3UKF A;  4A65 A;  1F8S A;  2R4J A;  2RGO A;  2GQW A;  1DOE A;  3IC9 A;  3RNM A;  4GDP A;  5HXI A;  1NHQ A;  2FJE A;  3SFD A;  4A5L A;  4YSX A;  1H6V A;  2PHH A;  5FS9 A;  4LII A;  1M64 A;  4OVI A;  1GER A;  1B5Q A;  1DJN A;  1VG0 A;  4UP3 A;  3GRS A;  4Z44 A;  1JRX A;  2TMD A;  4H4R A;  4J34 A;  5U1O A;  2X8G A;  2VVM A;  2B9X A;  4YSH A;  2C72 A;  1H83 A;  3VQR A;  2OAM A;  1H86 A;  1Q1W A;  3GDP A;  4CCQ A;  4CCR A;  2C7G A;  1YQ3 A;  2XDO A;  4AP1 A;  2BS2 A;  4J31 A;  4OPL A;  5HY5 A;  4NTD A;  4NEW A;  3NN0 X;  2OLO A;  1EL8 A;  3L8K A;  1KDG A;  3AE7 A;  3II4 A;  4OPG A;  2CFY A;  1FCD A;  5J60 A;  2VQ7 A;  3UTF A;  3B6D A;  3CPI G;  1OJC A;  1QLB A;  2V60 A;  2GAH B;  4H4W A;  1TDN A;  1JEH A;  3R9U A;  4CRT A;  1CF3 A;  1GRG A;  3EAO A;  4U8J A;  1N1P A;  2DKI A;  2VVL A;  1NG4 A;  1UKV G;  5IQ4 A;  3F8P A;  4FK1 C;  4JQ9 A;  1LQT A;  4JN9 A;  5BUK A;  2YG7 A;  3AD8 B;  1Y56 A;  5KOX A;  3NK0 X;  2JBV A;  3UP4 A;  4NTC A;  4Z2R A;  1ZY8 A;  1BGN A;  2XYO A;  3ALJ A;  4I59 A;  3UP5 A;  1TDF A;  1DOB A;  2GR0 A;  4EQW A;  2GEW A;  3CGB A;  5KOW A;  2BXS A;  4NZH A;  1BGJ A;  2C64 A;  2YWL A;  4J33 A;  2WES A;  2B7R A;  3Q9T A;  4X9N A;  1L9E A;  4A79 A;  3ABV A;  4A7A A;  4IVO B;  2XFN A;  1GRA A;  4Z2T A;  4EIQ A;  3RP6 A;  2WET A;  1B4V A;  2YG6 A;  3URH A;  1MXT A;  4B69 A;  1HYU A;  3M13 A;  2QA1 A;  2WP6 A;  4CBQ A;  3P1W A;  5KRQ A;  3UOX A;  2VRL A;  3IF9 A;  3M0O A;  4PAB A;  2EQ7 A;  2XFP A;  4U2L A;  4U8M A;  2C70 A;  1CC6 A;  1XAN A;  3T37 A;  1VG9 A;  3GYI A;  2CUL A;  3H8I A;  1DXL A;  1LV0 A;  4EMW A;  5JCK A;  2JB2 A;  3DA1 A;  3AEE A;  1IJH A;  2FBW A;  2YLX A;  4USQ A;  3DME A;  3D8X A;  2W0H A;  4GRT A;  4A6N B;  3QSM A;  4CY6 A;  5CKU A;  1PHH A;  1PBD A;  3SQP A;  2JB3 A;  3CGC A;  4O5U A;  1PBB A;  3DGZ A;  3ICT A;  3LXD A;  3PVC A;  3CNT A;  4LU6 A;  4XWZ A;  5IQ1 A;  3UTE A;  1AOG A;  4H4P A;  3AED A;  2YVJ A;  1QO8 A;  1XHC A;  2XLU A;  3CN8 A;  2YAU A;  2XVH A;  3NG7 X;  4YT0 A;  3GD4 A;  4IV9 A;  2EQ8 A;  2WOI A;  5LV9 A;  3LB8 A;  1RYI A;  1CL0 A;  3AE8 A;  4TM1 A;  4IA6 A;  2WPC A;  1OJ9 A;  3ISH A;  4K2X A;  2RGH A;  2H88 A;  2E5V A;  2BS4 A;  5KXJ A;  4K5S A;  5L46 A;  3C4A A;  3GWF A;  3ICS A;  4EIP A;  1D4C A;  3GDN A;  2GR2 A;  3C96 A;  2WDQ A;  3ATR A;  2YLW A;  2XLT A;  2CDU A;  2LFC A;  3SFE A;  4Z2U A;  2UZZ A;  4GCM A;  2Q0K A;  3I6D A;  4TM4 A;  3NHO X;  1EL7 A;  1TRB A;  2Y6R A;  4U2S A;  1IUS A;  4AOS A;  3G5Q A;  2DKH A;  1P2E A;  1O94 A;  2YM1 A;  3AEB A;  3HZL A;  2RAB A;  5FS6 A;  5HYM A;  2A8X A;  3IWA A;  1CBO A;  2BA9 A;  3Q6J A;  3F8D A;  5C3J A;  1IUT A;  2GVC A;  1KFY A;  1ZKQ A;  3FG2 P;  4HB9 A;  2YVG A;  5DBJ A;  3NYF A;  4H4V A;  1VQW A;  2J3N A;  1X31 B;  3UKK A;  1DOC A;  5IPY A;  2QAE A;  1P2H A;  2YG4 A;  3NK1 X;  2JKC A;  3KLJ A;  5GRT A;  4H4Z A;  5M0Z A;  2FJD A;  2RGJ A;  3RP8 A;  3QVR A;  4A99 A;  2YR6 A;  3AD7 B;  1MO9 A;  1CC4 A;  3LAD A;  3I3L A;  4B68 A;  4H2N A;  3ZDN A;  5FS7 A;  1ZMD A;  4Z26 A;  3H4K A;  2BK3 A;  4AT2 A;  1GTH A;  1S2Y A;  3EF6 A;  2ACZ A;  3UKQ A;  1GRT A;  4JY2 A;  2C67 A;  2WU2 A;  2C3C A;  1JRZ A;  1YQ4 A;  3ADA B;  3VRB A;  4U8N A;  3QVP A;  4IA5 A;  3P9U A;  3DJE A;  2NVK X;  1VRQ B;  1K0L A;  3AE4 A;  2BCP A;  4J2W A; 
#chains in the Genus database with same CATH topology
 4EQX A;  1B37 A;  2JK6 A;  3CPH G;  5J7X A;  3ITJ A;  1GES A;  4NTE A;  3WE0 A;  5KVH A;  1GET A;  1FEB A;  4O5Q A;  4EMI A;  1PN0 A;  1GRF A;  1OJA A;  4YKF A;  5JCL A;  1H82 A;  4M52 A;  4APN A;  5KMS A;  1CJ4 A;  1TYT A;  1N4W A;  3BHK A;  3FBS A;  1REO A;  1NPX A;  1FOH A;  3GYX A;  3OZ2 A;  4C5O A;  2X99 A;  1PBC A;  2X8C A;  1GT8 A;  3ALL A;  3DJG X;  4PAA A;  3FMW A;  1CJ3 A;  2YR5 A;  3QJ4 A;  4ZCD A;  2GR3 A;  1NHR A;  2GMH A;  4USR A;  1GTE A;  5U25 A;  1EBD A;  1BZL A;  3M12 A;  4CNK A;  3NNE A;  4NEV A;  4EM3 A;  3AYL A;  1TDO A;  3OC4 A;  1E1L A;  3KA7 A;  4YKG A;  4Y4M A;  3T0K A;  1Q1R A;  3AE3 A;  2R9Z A;  1K0J A;  3NN6 X;  1D4E A;  4TLX A;  2YLZ A;  4BJZ A;  3AE2 A;  4YSZ A;  2BCG G;  2YLT A;  3KPF A;  2B7S A;  3GMC A;  2C66 A;  4G74 A;  4H2Q A;  4Z43 A;  5JCN A;  4BJY A;  4DSH A;  4N9X A;  2NPX A;  2WQY A;  2VRM A;  3UKH A;  1CJC A;  5EB4 A;  4DGK A;  4XWR A;  4E0V A;  3LZX A;  2AAQ A;  1XDI A;  3E1T A;  4JNA A;  1JNZ A;  3G5S A;  3K7Q X;  3V3N A;  1NHP A;  2XFU A;  3S61 A;  1COY A;  5TR3 A;  4GF7 A;  3K7T A;  4Z24 A;  2V3B A;  5JCI A;  1GSN A;  1E7P A;  3DK9 A;  2BAC A;  3G5R A;  4B1B A;  1CC2 A;  1JRY A;  4H50 A;  1K4Q A;  3LZW A;  1ZDL A;  3KU9 A;  1IUV A;  1GV4 A;  3DGH A;  4FDC B;  4X4J A;  1EL9 A;  2BRY A;  3AWI A;  3CNJ A;  3PO7 A;  4TM0 A;  2IVD A;  4YTM A;  1D4D A;  2BK5 A;  2GB0 A;  2GRT A;  3P4R A;  3EAN A;  4WCT A;  2BC0 A;  3LOV A;  2YQU A;  3SGL A;  1FL2 A;  4B64 A;  4B63 A;  1PXA A;  3AE1 A;  3UKA A;  3BNU A;  3UKL A;  3SZ0 A;  3NLC A;  1ONF A;  3BI5 A;  4C77 A;  2Q7V A;  5BVA A;  5KWF A;  2Y6Q A;  1DOD A;  2X3N A;  2JB1 A;  2V5Z A;  3KD9 A;  4A6N A;  3AXB A;  3AD9 B;  1PBE A;  1F6M A;  3SM8 A;  4U2T A;  4UDQ A;  2YVF A;  3NYC A;  1PJ7 A;  3S5W A;  1Z6L A;  3BHF A;  1S3E A;  3H8L A;  4D03 A;  1LJ1 A;  2GF3 A;  4GR1 A;  1TDK A;  2OA1 A;  1PXB A;  4OCG A;  1NG3 A;  2CVJ A;  3BNM A;  3CND A;  3GRT A;  4A9W A;  1D7Y A;  2FJA A;  1S3B A;  1Y0P A;  1ZMC A;  2C65 A;  2V6O A;  2XLS A;  4D04 A;  2WOV A;  4P9S A;  4ADW A;  1Q9I A;  1ZX9 A;  1O5W A;  3AB1 A;  3AEA A;  5FS8 A;  1H84 A;  2WS3 A;  3K7M X;  1KSU A;  1VDC A;  3DJJ A;  4MJW A;  1EL5 A;  4C3X A;  5KNL A;  1NHS A;  3PS9 A;  4Y4L A;  4BK2 A;  1L9D A;  3KVE A;  5EB5 A;  4GDE A;  2QA2 A;  3NIX A;  2BYB A;  3ZYX A;  4BV6 A;  4DNA A;  3KPK A;  5KMP A;  1L0V A;  4X9M A;  3L1R A;  1CHU A;  3NKS A;  2R0P A;  4JY3 A;  1DNC A;  3FPZ A;  3ICR A;  5U63 A;  4CY8 A;  1GPE A;  1M6I A;  2WEU A;  1BF3 A;  1ZOV A;  2R0G A;  4UDP A;  3RP7 A;  1PDH A;  1K0I A;  2GAG B;  4BK1 A;  3QSE A;  3VR8 A;  4OPU A;  3UOV A;  5JCM A;  3NH3 X;  1B8S A;  2BC1 A;  4YWO A;  2VOU A;  2XVJ A;  4J36 A;  2B9Y A;  3UKP A;  3UOY A;  4H2R A;  2E1M A;  2BAB A;  2WU5 A;  2WP9 A;  2XVE A;  5HHF A;  3V3O A;  4H4T A;  2X8H A;  2B9W A;  2JAE A;  3SXI A;  1E1K A;  1TYP A;  1JOA A;  3UOZ A;  4H4Y A;  4KPR A;  2VVL G;  3QFA A;  3SZW A;  3QFB A;  1N4V A;  1NEN A;  2XFO A;  3GD3 A;  1RP0 A;  1ZP0 A;  1NEK A;  1XPQ A;  4ZN0 A;  3CIR A;  2R45 A;  4H7U A;  4H4S A;  2YG5 A;  1ELI A;  4IVM B;  1W4X A;  1FEC A;  2Z5Y A;  4J57 A;  3SY4 A;  1F8W A;  5BUL A;  3ALM A;  1LPF A;  2XVI A;  3RED A;  5EOW A;  4K8D A;  4UDR A;  3C4N A;  2WPE A;  1KF6 A;  1MOK A;  2XVF A;  4ECH A;  2GQF A;  1N4U A;  1JNR A;  4ZCC A;  4KX6 A;  3CNP A;  1Y56 B;  3NRN A;  3VR9 A;  1YY5 A;  1NAA A;  3DJD A;  1E1N A;  1ZK7 A;  1LQU A;  1YKJ A;  2O9Z A;  3GSI A;  5CQF A;  1OJD A;  3O0H A;  1F8R A;  4REK A;  3B3R A;  3T31 A;  1BWC A;  4BUR A;  1KNP A;  2GV8 A;  3V76 A;  1OJT A;  4H2P A;  4ICY A;  3NTA A;  1GEU A;  3AEG A;  4WX1 A;  4OPI A;  2ZZB A;  1LVL A;  3AYI A;  4BK3 A;  2GH5 A;  3JSK A;  4J56 A;  3AYJ A;  2OLN A;  1GND A;  3CMM A;  3NGC X;  2EQ6 A;  4H4X A;  3AE9 A;  3P4Q A;  2BS3 A;  4NWZ A;  1CJ2 A;  1KNR A;  4GAP A;  1PJ5 A;  3ATQ A;  2HQM A;  3HYV A;  4LA1 A;  1ZOY A;  4RSL A;  2ARD A;  2ZZC A;  3CPJ G;  3LJP A;  3NYE A;  4JNQ A;  2Q0L A;  4YSY A;  2WOW A;  1PBF A;  2C3D A;  4U8I A;  2XLR A;  4AP3 A;  1NDA A;  5KVI A;  3K30 A;  4CNJ A;  1GAL A;  1GRB A;  1BKW A;  3P4P A;  3F8R A;  4GUV A;  1S2Q A;  3CNS A;  2WDV A;  3VRD B;  1V59 A;  2WBA A;  1H7W A;  1IUX A;  2V61 A;  2B76 A;  2GR1 A;  1GXF A;  3GWD A;  4Y4N A;  2R4E A;  1E39 A;  2F5Z A;  4JDR A;  4B66 A;  3DH9 A;  4B67 A;  2GMJ A;  3AEC A;  4YXD A;  2AQJ A;  2IID A;  3AE5 A;  1H7X A;  2EQ9 A;  3BI4 A;  3FIM B;  4NNJ A;  4TM3 A;  4YTN A;  2C75 A;  1PJ6 A;  5C2T A;  1GRH A;  2VQB A;  2WP5 A;  1D5T A;  5GSN A;  3RHA A;  1PS9 A;  2WDR A;  2R0C A;  4G9K A;  3VRA A;  1IUU A;  2YM2 A;  1DJQ A;  3DK4 A;  1H81 A;  3KKJ A;  4K22 A;  2BK4 A;  4AT0 A;  1KSS A;  2PYX A;  4Z25 A;  2BXR A;  5EBK A;  3EPT A;  1IUW A;  4XXG A;  1O95 A;  2WPF A;  1JU2 A;  4U8O A;  4EMJ A;  4TLZ A;  4RG4 A;  4I58 A;  4RG3 A;  1TDE A;  3UCL A;  3AE6 A;  3COX A;  3IHM A;  2XFQ A;  1GRE A;  2YR4 A;  3GYJ A;  2X50 A;  2VZ2 A;  2Z5X A;  4C74 A;  2AR8 A;  4U8L A;  2H89 A;  2A89 A;  1E6E A;  2A87 A;  1YQZ A;  4G73 A;  4FK1 A;  4HA6 A;  1F3P A;  4H4Q A;  1FEA A;  2ZBW A;  3UTG A;  4C3Y A;  2WHD A;  3CTY A;  3T2Z A;  2C73 A;  4OPT A;  4FX9 A;  3D1C A;  2YG3 A;  5KMQ A;  4EQS A;  3DK8 A;  3BI2 A;  3AEF A;  4EM4 A;  2FJB A;  4EQR A;  4H4U A;  5ER0 A;  2E4G A;  2C76 A;  4U8P A;  4DSG A;  2I0Z A;  2V3A A;  5M10 A;  1PXC A;  2R46 A;  1GOS A;  1QJD A;  3NK2 X;  4U8K A;  5BRT A;  3NTD A;  1RSG A;  1LTX R;  1E1M A;  4AOX A;  2TPR A;  3P4S A;  3T2Y A;  2APG A;  2XLP A;  4K7Z A;  5FMH A;  4B65 A;  1SEZ A;  2ZZ0 A;  3CGE A;  4II3 A;  1D7L A;  3CGD A;  1L9C A;  4OPC A;  4K5R A;  4OPD A;  4YTP A;  2OAL A;  2Q6U A;  2XCG A;  3QSS A;  3UTH A;  2QCU A;  2YLS A;  2IVE A;  3IHG A;  3NT6 A;  3GMB A;  2YLR A;  4G6H A;  3UKF A;  4A65 A;  1F8S A;  2R4J A;  2RGO A;  2GQW A;  1DOE A;  3IC9 A;  3RNM A;  4GDP A;  5HXI A;  1NHQ A;  2FJE A;  3SFD A;  4A5L A;  4YSX A;  1H6V A;  2PHH A;  5FS9 A;  4LII A;  1M64 A;  2BRA A;  4OVI A;  1GER A;  1B5Q A;  1DJN A;  4II2 A;  1VG0 A;  4UP3 A;  3GRS A;  4Z44 A;  1JRX A;  2TMD A;  4H4R A;  4J34 A;  5U1O A;  2X8G A;  2VVM A;  2B9X A;  4YSH A;  2C72 A;  1H83 A;  3VQR A;  2OAM A;  1H86 A;  1Q1W A;  3GDP A;  3SX6 A;  4CCQ A;  4CCR A;  2C7G A;  1YQ3 A;  2XDO A;  4AP1 A;  2BS2 A;  4J31 A;  4OPL A;  5HY5 A;  4NTD A;  4NEW A;  3NN0 X;  2OLO A;  1EL8 A;  3L8K A;  1KDG A;  3AE7 A;  3II4 A;  4OPG A;  2CFY A;  1FCD A;  5J60 A;  2VQ7 A;  2C4C A;  3UTF A;  3B6D A;  3CPI G;  1OJC A;  1QLB A;  2V60 A;  2GAH B;  4H4W A;  1TDN A;  1JEH A;  3R9U A;  4CRT A;  1CF3 A;  1GRG A;  3EAO A;  4U8J A;  1N1P A;  2DKI A;  2VVL A;  3SYI A;  1NG4 A;  1UKV G;  5IQ4 A;  3F8P A;  4FK1 C;  4JQ9 A;  1LQT A;  4JN9 A;  5BUK A;  3SZF A;  2YG7 A;  3AD8 B;  1Y56 A;  5KOX A;  3NK0 X;  2JBV A;  3UP4 A;  4NTC A;  4Z2R A;  1ZY8 A;  1BGN A;  2XYO A;  3ALJ A;  4I59 A;  3UP5 A;  1TDF A;  1DOB A;  2GR0 A;  4EQW A;  2GEW A;  3CGB A;  5KOW A;  2BXS A;  4NZH A;  1BGJ A;  2C64 A;  2YWL A;  4J33 A;  2WES A;  2B7R A;  3Q9T A;  4X9N A;  1L9E A;  4A79 A;  3ABV A;  4A7A A;  4IVO B;  2XFN A;  1GRA A;  4Z2T A;  4EIQ A;  3RP6 A;  2WET A;  1B4V A;  2YG6 A;  3URH A;  1MXT A;  4B69 A;  3HYX A;  1HYU A;  3M13 A;  2QA1 A;  2WP6 A;  4CBQ A;  3P1W A;  5KRQ A;  3UOX A;  2VRL A;  3IF9 A;  3M0O A;  4PAB A;  2EQ7 A;  2XFP A;  4U2L A;  4U8M A;  2C70 A;  1CC6 A;  1XAN A;  3T37 A;  1VG9 A;  3GYI A;  2CUL A;  3H8I A;  1DXL A;  1LV0 A;  4EMW A;  3T14 A;  2JB2 A;  3DA1 A;  5JCK A;  3AEE A;  3T2K A;  1IJH A;  2FBW A;  2YLX A;  4USQ A;  3DME A;  3D8X A;  2W0H A;  4GRT A;  4A6N B;  3QSM A;  4CY6 A;  3SZC A;  5CKU A;  1PHH A;  1PBD A;  3SQP A;  2JB3 A;  3CGC A;  4O5U A;  1PBB A;  3DGZ A;  3ICT A;  3LXD A;  3PVC A;  3CNT A;  4LU6 A;  4XWZ A;  5IQ1 A;  3UTE A;  1AOG A;  4H4P A;  3AED A;  2YVJ A;  1QO8 A;  1XHC A;  2XLU A;  3CN8 A;  2YAU A;  2XVH A;  3NG7 X;  3HYW A;  3GD4 A;  4IV9 A;  4YT0 A;  2EQ8 A;  2WOI A;  5LV9 A;  5KMR A;  3LB8 A;  1RYI A;  1CL0 A;  3AE8 A;  4TM1 A;  4IA6 A;  2WPC A;  1OJ9 A;  3ISH A;  4K2X A;  2RGH A;  2H88 A;  2E5V A;  2BS4 A;  5KXJ A;  4K5S A;  5L46 A;  3C4A A;  3GWF A;  3ICS A;  4EIP A;  1D4C A;  3GDN A;  2GR2 A;  3C96 A;  2WDQ A;  3ATR A;  2YLW A;  2XLT A;  2CDU A;  4G6G A;  2LFC A;  3SFE A;  4Z2U A;  2UZZ A;  4GCM A;  2Q0K A;  3I6D A;  4TM4 A;  3NHO X;  1EL7 A;  1TRB A;  2Y6R A;  4U2S A;  1IUS A;  4AOS A;  3G5Q A;  2DKH A;  1P2E A;  1O94 A;  2YM1 A;  3AEB A;  3HZL A;  2RAB A;  5FS6 A;  5HYM A;  2A8X A;  3IWA A;  1CBO A;  2BA9 A;  3Q6J A;  3F8D A;  5C3J A;  1IUT A;  2GVC A;  1KFY A;  1ZKQ A;  3FG2 P;  4HB9 A;  2YVG A;  5DBJ A;  3NYF A;  4H4V A;  1VQW A;  2J3N A;  1X31 B;  3UKK A;  1DOC A;  5IPY A;  2QAE A;  1P2H A;  2YG4 A;  3NK1 X;  2JKC A;  3KLJ A;  5GRT A;  4H4Z A;  5M0Z A;  2FJD A;  2RGJ A;  3RP8 A;  3QVR A;  4A99 A;  2YR6 A;  3AD7 B;  1MO9 A;  1CC4 A;  3LAD A;  3I3L A;  4GAV A;  4B68 A;  4H2N A;  3ZDN A;  5FS7 A;  1ZMD A;  4Z26 A;  3H4K A;  2BK3 A;  4AT2 A;  1GTH A;  1S2Y A;  3EF6 A;  2ACZ A;  3UKQ A;  1GRT A;  4JY2 A;  2C67 A;  2WU2 A;  2C3C A;  1JRZ A;  1YQ4 A;  3ADA B;  3VRB A;  4U8N A;  3QVP A;  4IA5 A;  3P9U A;  3DJE A;  2NVK X;  1VRQ B;  1K0L A;  3AE4 A;  2BCP A;  4J2W A; 
#chains in the Genus database with same CATH homology
 4EQX A;  1B37 A;  2JK6 A;  3CPH G;  5J7X A;  3ITJ A;  1GES A;  4NTE A;  3WE0 A;  5KVH A;  1GET A;  1FEB A;  4O5Q A;  4EMI A;  1PN0 A;  1GRF A;  1OJA A;  4YKF A;  5JCL A;  1H82 A;  4M52 A;  4APN A;  5KMS A;  1CJ4 A;  1TYT A;  1N4W A;  3BHK A;  3FBS A;  1REO A;  1NPX A;  1FOH A;  3GYX A;  3OZ2 A;  4C5O A;  2X99 A;  1PBC A;  2X8C A;  1GT8 A;  3ALL A;  3DJG X;  4PAA A;  3FMW A;  1CJ3 A;  2YR5 A;  3QJ4 A;  4ZCD A;  2GR3 A;  1NHR A;  2GMH A;  4USR A;  1GTE A;  5U25 A;  1EBD A;  1BZL A;  3M12 A;  4CNK A;  3NNE A;  4NEV A;  4EM3 A;  3AYL A;  1TDO A;  3OC4 A;  1E1L A;  3KA7 A;  4YKG A;  4Y4M A;  3T0K A;  1Q1R A;  3AE3 A;  2R9Z A;  1K0J A;  3NN6 X;  1D4E A;  4TLX A;  2YLZ A;  4BJZ A;  3AE2 A;  4YSZ A;  2BCG G;  2YLT A;  3KPF A;  2B7S A;  3GMC A;  2C66 A;  4G74 A;  4H2Q A;  4Z43 A;  5JCN A;  4BJY A;  4DSH A;  4N9X A;  2NPX A;  2WQY A;  2VRM A;  3UKH A;  1CJC A;  5EB4 A;  4DGK A;  4XWR A;  4E0V A;  3LZX A;  2AAQ A;  1XDI A;  3E1T A;  4JNA A;  1JNZ A;  3G5S A;  3K7Q X;  3V3N A;  1NHP A;  2XFU A;  3S61 A;  1COY A;  5TR3 A;  4GF7 A;  3K7T A;  4Z24 A;  2V3B A;  5JCI A;  1GSN A;  1E7P A;  3DK9 A;  2BAC A;  3G5R A;  4B1B A;  1CC2 A;  1JRY A;  4H50 A;  1K4Q A;  3LZW A;  1ZDL A;  3KU9 A;  1IUV A;  1GV4 A;  3DGH A;  4FDC B;  4X4J A;  1EL9 A;  2BRY A;  3AWI A;  3CNJ A;  3PO7 A;  4TM0 A;  2IVD A;  4YTM A;  1D4D A;  2BK5 A;  2GB0 A;  2GRT A;  3P4R A;  3EAN A;  4WCT A;  2BC0 A;  3LOV A;  2YQU A;  3SGL A;  1FL2 A;  4B64 A;  4B63 A;  1PXA A;  3AE1 A;  3UKA A;  3BNU A;  3UKL A;  3SZ0 A;  3NLC A;  1ONF A;  3BI5 A;  4C77 A;  2Q7V A;  5BVA A;  5KWF A;  2Y6Q A;  1DOD A;  2X3N A;  2JB1 A;  2V5Z A;  3KD9 A;  4A6N A;  3AXB A;  3AD9 B;  1PBE A;  1F6M A;  3SM8 A;  4U2T A;  4UDQ A;  2YVF A;  3NYC A;  1PJ7 A;  3S5W A;  1Z6L A;  3BHF A;  1S3E A;  3H8L A;  4D03 A;  1LJ1 A;  2GF3 A;  4GR1 A;  1TDK A;  2OA1 A;  1PXB A;  4OCG A;  1NG3 A;  2CVJ A;  3BNM A;  3CND A;  3GRT A;  4A9W A;  1D7Y A;  2FJA A;  1S3B A;  1Y0P A;  1ZMC A;  2C65 A;  2V6O A;  2XLS A;  4D04 A;  2WOV A;  4P9S A;  4ADW A;  1Q9I A;  1ZX9 A;  1O5W A;  3AB1 A;  3AEA A;  5FS8 A;  1H84 A;  2WS3 A;  3K7M X;  1KSU A;  1VDC A;  3DJJ A;  4MJW A;  1EL5 A;  4C3X A;  5KNL A;  1NHS A;  3PS9 A;  4Y4L A;  4BK2 A;  1L9D A;  3KVE A;  5EB5 A;  4GDE A;  2QA2 A;  3NIX A;  2BYB A;  3ZYX A;  4BV6 A;  4DNA A;  3KPK A;  5KMP A;  1L0V A;  4X9M A;  3L1R A;  1CHU A;  3NKS A;  2R0P A;  4JY3 A;  1DNC A;  3FPZ A;  3ICR A;  5U63 A;  4CY8 A;  1GPE A;  1M6I A;  2WEU A;  1BF3 A;  1ZOV A;  2R0G A;  4UDP A;  3RP7 A;  1PDH A;  1K0I A;  2GAG B;  4BK1 A;  3QSE A;  3VR8 A;  4OPU A;  3UOV A;  5JCM A;  3NH3 X;  1B8S A;  2BC1 A;  4YWO A;  2VOU A;  2XVJ A;  4J36 A;  2B9Y A;  3UKP A;  3UOY A;  4H2R A;  2E1M A;  2BAB A;  2WU5 A;  2WP9 A;  2XVE A;  5HHF A;  3V3O A;  4H4T A;  2X8H A;  2B9W A;  2JAE A;  3SXI A;  1E1K A;  1TYP A;  1JOA A;  3UOZ A;  4H4Y A;  4KPR A;  2VVL G;  3QFA A;  3SZW A;  3QFB A;  1N4V A;  1NEN A;  2XFO A;  3GD3 A;  1RP0 A;  1ZP0 A;  1NEK A;  1XPQ A;  4ZN0 A;  3CIR A;  2R45 A;  4H7U A;  4H4S A;  2YG5 A;  1ELI A;  4IVM B;  1W4X A;  1FEC A;  2Z5Y A;  4J57 A;  3SY4 A;  1F8W A;  5BUL A;  3ALM A;  1LPF A;  2XVI A;  3RED A;  5EOW A;  4K8D A;  4UDR A;  3C4N A;  2WPE A;  1KF6 A;  1MOK A;  2XVF A;  4ECH A;  2GQF A;  1N4U A;  1JNR A;  4ZCC A;  4KX6 A;  3CNP A;  1Y56 B;  3NRN A;  3VR9 A;  1YY5 A;  1NAA A;  3DJD A;  1E1N A;  1ZK7 A;  1LQU A;  1YKJ A;  2O9Z A;  3GSI A;  5CQF A;  1OJD A;  3O0H A;  1F8R A;  4REK A;  3B3R A;  3T31 A;  1BWC A;  4BUR A;  1KNP A;  2GV8 A;  3V76 A;  1OJT A;  4H2P A;  4ICY A;  3NTA A;  1GEU A;  3AEG A;  4WX1 A;  4OPI A;  2ZZB A;  1LVL A;  3AYI A;  4BK3 A;  2GH5 A;  3JSK A;  4J56 A;  3AYJ A;  2OLN A;  1GND A;  3CMM A;  3NGC X;  2EQ6 A;  4H4X A;  3AE9 A;  3P4Q A;  2BS3 A;  4NWZ A;  1CJ2 A;  1KNR A;  4GAP A;  1PJ5 A;  3ATQ A;  2HQM A;  3HYV A;  4LA1 A;  1ZOY A;  4RSL A;  2ARD A;  2ZZC A;  3CPJ G;  3LJP A;  3NYE A;  4JNQ A;  2Q0L A;  4YSY A;  2WOW A;  1PBF A;  2C3D A;  4U8I A;  2XLR A;  4AP3 A;  1NDA A;  5KVI A;  3K30 A;  4CNJ A;  1GAL A;  1GRB A;  1BKW A;  3P4P A;  3F8R A;  4GUV A;  1S2Q A;  3CNS A;  2WDV A;  3VRD B;  1V59 A;  2WBA A;  1H7W A;  1IUX A;  2V61 A;  2B76 A;  2GR1 A;  1GXF A;  3GWD A;  4Y4N A;  2R4E A;  1E39 A;  2F5Z A;  4JDR A;  4B66 A;  3DH9 A;  4B67 A;  2GMJ A;  3AEC A;  4YXD A;  2AQJ A;  2IID A;  3AE5 A;  1H7X A;  2EQ9 A;  3BI4 A;  3FIM B;  4NNJ A;  4TM3 A;  4YTN A;  2C75 A;  1PJ6 A;  5C2T A;  1GRH A;  2VQB A;  2WP5 A;  1D5T A;  5GSN A;  3RHA A;  1PS9 A;  2WDR A;  2R0C A;  4G9K A;  3VRA A;  1IUU A;  2YM2 A;  1DJQ A;  3DK4 A;  1H81 A;  3KKJ A;  4K22 A;  2BK4 A;  4AT0 A;  1KSS A;  2PYX A;  4Z25 A;  2BXR A;  5EBK A;  3EPT A;  1IUW A;  4XXG A;  1O95 A;  2WPF A;  1JU2 A;  4U8O A;  4EMJ A;  4TLZ A;  4RG4 A;  4I58 A;  4RG3 A;  1TDE A;  3UCL A;  3AE6 A;  3COX A;  3IHM A;  2XFQ A;  1GRE A;  2YR4 A;  3GYJ A;  2X50 A;  2VZ2 A;  2Z5X A;  4C74 A;  2AR8 A;  4U8L A;  2H89 A;  2A89 A;  1E6E A;  2A87 A;  1YQZ A;  4G73 A;  4FK1 A;  4HA6 A;  1F3P A;  4H4Q A;  1FEA A;  2ZBW A;  3UTG A;  4C3Y A;  2WHD A;  3CTY A;  3T2Z A;  2C73 A;  4OPT A;  4FX9 A;  3D1C A;  2YG3 A;  5KMQ A;  4EQS A;  3DK8 A;  3BI2 A;  3AEF A;  4EM4 A;  2FJB A;  4EQR A;  4H4U A;  5ER0 A;  2E4G A;  2C76 A;  4U8P A;  4DSG A;  2I0Z A;  2V3A A;  5M10 A;  1PXC A;  2R46 A;  1GOS A;  1QJD A;  3NK2 X;  4U8K A;  5BRT A;  3NTD A;  1RSG A;  1LTX R;  1E1M A;  4AOX A;  2TPR A;  3P4S A;  3T2Y A;  2APG A;  2XLP A;  4K7Z A;  5FMH A;  4B65 A;  1SEZ A;  2ZZ0 A;  3CGE A;  4II3 A;  1D7L A;  3CGD A;  1L9C A;  4OPC A;  4K5R A;  4OPD A;  4YTP A;  2OAL A;  2Q6U A;  2XCG A;  3QSS A;  3UTH A;  2QCU A;  2YLS A;  2IVE A;  3IHG A;  3NT6 A;  3GMB A;  2YLR A;  4G6H A;  3UKF A;  4A65 A;  1F8S A;  2R4J A;  2RGO A;  2GQW A;  1DOE A;  3IC9 A;  3RNM A;  4GDP A;  5HXI A;  1NHQ A;  2FJE A;  3SFD A;  4A5L A;  4YSX A;  1H6V A;  2PHH A;  5FS9 A;  4LII A;  1M64 A;  2BRA A;  4OVI A;  1GER A;  1B5Q A;  1DJN A;  4II2 A;  1VG0 A;  4UP3 A;  3GRS A;  4Z44 A;  1JRX A;  2TMD A;  4H4R A;  4J34 A;  5U1O A;  2X8G A;  2VVM A;  2B9X A;  4YSH A;  2C72 A;  1H83 A;  3VQR A;  2OAM A;  1H86 A;  1Q1W A;  3GDP A;  3SX6 A;  4CCQ A;  4CCR A;  2C7G A;  1YQ3 A;  2XDO A;  4AP1 A;  2BS2 A;  4J31 A;  4OPL A;  5HY5 A;  4NTD A;  4NEW A;  3NN0 X;  2OLO A;  1EL8 A;  3L8K A;  1KDG A;  3AE7 A;  3II4 A;  4OPG A;  2CFY A;  1FCD A;  5J60 A;  2VQ7 A;  2C4C A;  3UTF A;  3B6D A;  3CPI G;  1OJC A;  1QLB A;  2V60 A;  2GAH B;  4H4W A;  1TDN A;  1JEH A;  3R9U A;  4CRT A;  1CF3 A;  1GRG A;  3EAO A;  4U8J A;  1N1P A;  2DKI A;  2VVL A;  3SYI A;  1NG4 A;  1UKV G;  5IQ4 A;  3F8P A;  4FK1 C;  4JQ9 A;  1LQT A;  4JN9 A;  5BUK A;  3SZF A;  2YG7 A;  3AD8 B;  1Y56 A;  5KOX A;  3NK0 X;  2JBV A;  3UP4 A;  4NTC A;  4Z2R A;  1ZY8 A;  1BGN A;  2XYO A;  3ALJ A;  4I59 A;  3UP5 A;  1TDF A;  1DOB A;  2GR0 A;  4EQW A;  2GEW A;  3CGB A;  5KOW A;  2BXS A;  4NZH A;  1BGJ A;  2C64 A;  2YWL A;  4J33 A;  2WES A;  2B7R A;  3Q9T A;  4X9N A;  1L9E A;  4A79 A;  3ABV A;  4A7A A;  4IVO B;  2XFN A;  1GRA A;  4Z2T A;  4EIQ A;  3RP6 A;  2WET A;  1B4V A;  2YG6 A;  3URH A;  1MXT A;  4B69 A;  3HYX A;  1HYU A;  3M13 A;  2QA1 A;  2WP6 A;  4CBQ A;  3P1W A;  5KRQ A;  3UOX A;  2VRL A;  3IF9 A;  3M0O A;  4PAB A;  2EQ7 A;  2XFP A;  4U2L A;  4U8M A;  2C70 A;  1CC6 A;  1XAN A;  3T37 A;  1VG9 A;  3GYI A;  2CUL A;  3H8I A;  1DXL A;  1LV0 A;  4EMW A;  3T14 A;  2JB2 A;  3DA1 A;  5JCK A;  3AEE A;  3T2K A;  1IJH A;  2FBW A;  2YLX A;  4USQ A;  3DME A;  3D8X A;  2W0H A;  4GRT A;  4A6N B;  3QSM A;  4CY6 A;  3SZC A;  5CKU A;  1PHH A;  1PBD A;  3SQP A;  2JB3 A;  3CGC A;  4O5U A;  1PBB A;  3DGZ A;  3ICT A;  3LXD A;  3PVC A;  3CNT A;  4LU6 A;  4XWZ A;  5IQ1 A;  3UTE A;  1AOG A;  4H4P A;  3AED A;  2YVJ A;  1QO8 A;  1XHC A;  2XLU A;  3CN8 A;  2YAU A;  2XVH A;  3NG7 X;  3HYW A;  3GD4 A;  4IV9 A;  4YT0 A;  2EQ8 A;  2WOI A;  5LV9 A;  5KMR A;  3LB8 A;  1RYI A;  1CL0 A;  3AE8 A;  4TM1 A;  4IA6 A;  2WPC A;  1OJ9 A;  3ISH A;  4K2X A;  2RGH A;  2H88 A;  2E5V A;  2BS4 A;  5KXJ A;  4K5S A;  5L46 A;  3C4A A;  3GWF A;  3ICS A;  4EIP A;  1D4C A;  3GDN A;  2GR2 A;  3C96 A;  2WDQ A;  3ATR A;  2YLW A;  2XLT A;  2CDU A;  4G6G A;  2LFC A;  3SFE A;  4Z2U A;  2UZZ A;  4GCM A;  2Q0K A;  3I6D A;  4TM4 A;  3NHO X;  1EL7 A;  1TRB A;  2Y6R A;  4U2S A;  1IUS A;  4AOS A;  3G5Q A;  2DKH A;  1P2E A;  1O94 A;  2YM1 A;  3AEB A;  3HZL A;  2RAB A;  5FS6 A;  5HYM A;  2A8X A;  3IWA A;  1CBO A;  2BA9 A;  3Q6J A;  3F8D A;  5C3J A;  1IUT A;  2GVC A;  1KFY A;  1ZKQ A;  3FG2 P;  4HB9 A;  2YVG A;  5DBJ A;  3NYF A;  4H4V A;  1VQW A;  2J3N A;  1X31 B;  3UKK A;  1DOC A;  5IPY A;  2QAE A;  1P2H A;  2YG4 A;  3NK1 X;  2JKC A;  3KLJ A;  5GRT A;  4H4Z A;  5M0Z A;  2FJD A;  2RGJ A;  3RP8 A;  3QVR A;  4A99 A;  2YR6 A;  3AD7 B;  1MO9 A;  1CC4 A;  3LAD A;  3I3L A;  4GAV A;  4B68 A;  4H2N A;  3ZDN A;  5FS7 A;  1ZMD A;  4Z26 A;  3H4K A;  2BK3 A;  4AT2 A;  1GTH A;  1S2Y A;  3EF6 A;  2ACZ A;  3UKQ A;  1GRT A;  4JY2 A;  2C67 A;  2WU2 A;  2C3C A;  1JRZ A;  1YQ4 A;  3ADA B;  3VRB A;  4U8N A;  3QVP A;  4IA5 A;  3P9U A;  3DJE A;  2NVK X;  1VRQ B;  1K0L A;  3AE4 A;  2BCP A;  4J2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...