4AT0A

The crystal structure of 3-ketosteroid-delta4-(5alpha)-dehydrogenase from rhodococcus jostii rha1
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
483
structure length
483
Chain Sequence
IRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGATALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLVDCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIAAPAPRGHVPQMDGKRTGEKGGGYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLATGSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLIVRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQPKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDLRGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGRRAGISAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Catalytic Mechanism of 3-Ketosteroid-{Delta}4-(5Alpha)-Dehydrogenase from Rhodococcus Jostii Rha1 Genome.
pubmed doi rcsb
source organism Rhodococcus jostii
molecule tags Oxidoreductase
molecule keywords 3-KETOSTEROID-DELTA4-5ALPHA-DEHYDROGENASE
total genus 164
structure length 483
sequence length 483
ec nomenclature ec 1.3.99.5: 3-oxo-5-alpha-steroid 4-dehydrogenase (acceptor).
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4at0A01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4at0A02
3ITJA 2E5VA 5HHFA 4B66A 2GF3A 3NLCA 5HXIA 2EQ8A 3CGDA 2BABA 1ZY8A 4B68A 4J36A 3SFDA 4A6NB 4BURA 1P2EA 2C67A 2OA1A 2BK4A 3CGEA 5FS8A 3AD7B 3DJGX 4LA1A 4CBQA 2VZ2A 4CY8A 2WDVA 4EMIA 1TRBA 1CL0A 4OPDA 4JN9A 3NN6X 5JCIA 3CNTA 3EPTA 4YTMA 3GMBA 2XVEA 4X4JA 3UTGA 1E7PA 3H8LA 3DJEA 2GAGB 1NPXA 4IVMB 5EB5A 4YXDA 5CQFA 1BGNA 2YM1A 4JDRA 4H2RA 4IVOB 5TR3A 3V76A 2YVFA 3AE2A 4H4QA 2C64A 3AB1A 5FMHA 3BI4A 2QA2A 4C77A 3NNEA 1RYIA 3KU9A 4IA6A 2A8XA 4GDEA 4A79A 3C4NA 5FS6A 4J33A 1VDCA 1PJ5A 2WDQA 3NYCA 4J56A 3UTEA 3QVRA 3AYLA 3UKKA 1GNDA 4U8PA 1GRAA 4XXGA 2IVDA 2YG6A 2YLXA 4E0VA 2V3AA 1PDHA 5J60A 3GYXA 1GESA 1CHUA 1DXLA 1V59A 2WQYA 3P4PA 1ZK7A 2A89A 3NGCX 3FIMB 1TDOA 4H2NA 1VRQB 2GH5A 4I58A 3UCLA 4DGKA 5KOWA 2YWLA 1PN0A 3AE9A 4ICYA 1KFYA 2BA9A 2V61A 3ATRA 2PHHA 3ICSA 4AT0A 3OZ2A 5BUKA 2XLTA 3FMWA 4CCQA 4EIPA 4A65A 3ICRA 2C66A 4TLXA 1GRGA 2V60A 4ZCDA 1XPQA 1K0IA 3M13A 1W4XA 4NTCA 3URHA 1B5QA 1YQZA 3ALLA 4EQWA 3AEGA 1X31B 3QSSA 1LQUA 1PS9A 2H88A 2WOVA 3DK8A 3RP7A 2QAEA 4OPCA 2VOUA 1GV4A 4UDQA 1Y0PA 1Y56B 3ZDNA 3LZWA 2XVJA 3NN0X 1PHHA 2YR4A 3NTAA 3B6DA 3NRNA 2X3NA 1K0LA 1YQ4A 4UP3A 1KNRA 1JNRA 3KLJA 4PABA 1H6VA 5GSNA 1ZOYA 2JB3A 1IUUA 1IJHA 3L8KA 2Z5XA 1EL5A 1IUXA 4Z2TA 3LOVA 4U8JA 1TDKA 2NVKX 1L9EA 3FG2P 2JAEA 3G5RA 3GRTA 2XVFA 2GVCA 1MXTA 4USQA 4GRTA 4P9SA 2IVEA 3COXA 4J2WA 3UKHA 3AXBA 1LVLA 1K4QA 1D5TA 4Y4LA 3P1WA 4U2TA 1BGJA 1KDGA 1E6EA 1D4EA 2YM2A 3HZLA 3I6DA 3RP6A 1P2HA 2IIDA 2BACA 1NEKA 4AP3A 1TDFA 2FJAA 3PVCA 1PJ6A 2GB0A 1JRYA 3IF9A 1ZX9A 3GWFA 3D8XA 2BC1A 4K5SA 4HA6A 3QFBA 1DJNA 4OPGA 2R4JA 3VR8A 3EF6A 1CJ4A 4Z2UA 2BK5A 3RHAA 5U63A 2EQ7A 3E1TA 2YR6A 5C2TA 1CJ2A 2VRLA 1KSSA 3NTDA 5IQ4A 2WP6A 5LV9A 1JNZA 4Y4NA 4JQ9A 1QO8A 3LADA 2YVJA 4BJYA 3P4RA 3CGCA 5FS7A 2WPCA 2RABA 3LB8A 4H4RA 1OJCA 4CNKA 1XANA 3AECA 4YSHA 2YR5A 4Y4MA 4Z43A 3CPIG 2XFQA 1EBDA 1OJ9A 2ZZCA 4K5RA 1QLBA 4GCMA 4EQSA 5CKUA 1EL8A 1O5WA 1GOSA 4YTPA 3P4SA 1K0JA 2RGHA 2XLUA 2GQFA 4H2QA 3CIRA 4YKGA 1N4VA 2WHDA 4RG3A 1B8SA 2XFOA 3QSMA 1H81A 3CN8A 1N4WA 3DK9A 1GRTA 2R0PA 2VQ7A 2FJBA 1PJ7A 4EIQA 1NHQA 3UOYA 1NDAA 4D04A 4REKA 4Z44A 3G5QA 5DBJA 2VVMA 3AEDA 4JY3A 4ECHA 2WP9A 3UKLA 3UP5A 3VRDB 1SEZA 1LV0A 2DKHA 4BJZA 4Z2RA 3BHFA 1OJAA 3GRSA 2C65A 3CNPA 2R9ZA 4EM4A 1E1KA 4TM0A 5BULA 1LPFA 3GMCA 3BHKA 2AQJA 2Y6QA 1DNCA 2FJEA 2B7SA 2WS3A 3AEAA 4XWRA 2V5ZA 1FEAA 3L1RA 4YWOA 1GXFA 3O0HA 1H83A 3QFAA 4EQXA 3BNMA 3S61A 2FBWA 3NT6A 3DGZA 3NHOX 4U8LA 4Z25A 4Z24A 2GR2A 3D1CA 3ISHA 3NYEA 2WOIA 4JNAA 1IUVA 3AD9B 2YAUA 1KSUA 2WPFA 3LXDA 4KX6A 4B65A 1IUWA 2O9ZA 2XVIA 4HB9A 4OPLA 2C3DA 2R46A 1NG4A 2GR0A 3CPJG 4APNA 2ACZA 2E4GA 4BK2A 4K7ZA 2Q6UA 3K7TA 2LFCA 3CPHG 5JCKA 4NZHA 1KF6A 1PXCA 3RP8A 1B37A 1N4UA 1S2QA 3NH3X 2GR1A 3F8DA 3Q6JA 4TM4A 2X99A 2BCPA 3QJ4A 5EB4A 4WX1A 1CJCA 3NK2X 1D7YA 3UKFA 3GDPA 2EQ6A 2XVHA 1IUTA 1GSNA 1VQWA 2R0CA 1PBDA 2JKCA 3KD9A 1RSGA 2GAHB 5KVHA 3UOVA 2XFNA 4FK1A 2W0HA 3KPFA 1L9DA 4RSLA 2X8GA 3B3RA 2X8HA 1E1MA 4JY2A 2AAQA 2BS3A 4NEWA 4OVIA 1REOA 4XWZA 3AD8B 5KVIA 3UKAA 2XLRA 2C73A 2YLWA 1S3BA 3KVEA 1GRHA 4B63A 5U1OA 2R0GA 1O94A 3IWAA 1HYUA 2Z5YA 4UDRA 1H7WA 1Y56A 2XLPA 5J7XA 1E39A 4A6NA 2C3CA 4OPTA 5JCNA 1MOKA 1S3EA 1ZP0A 1GT8A 3ATQA 1Z6LA 4DSGA 3S5WA 2GRTA 2XFPA 1GALA 3ABVA 3K30A 4H4PA 3P9UA 1ONFA 3NKSA 4ADWA 3DJDA 2GR3A 3BNUA 3AE6A 2WBAA 3VRBA 4EM3A 5KXJA 1CC4A 2ZZ0A 1F8RA 1L9CA 2VVLA 1VG9A 3DJJA 3P4QA 3VQRA 3UP4A 1DOEA 1GERA 1PBFA 1F8SA 4C74A 4UDPA 1GETA 3AYJA 2ZBWA 3CNJA 3NK0X 4RG4A 2C75A 3EAOA 3M12A 1AOGA 1H82A 3T37A 2A87A 5C3JA 1E1NA 1PBCA 2FJDA 4B67A 3Q9TA 5U25A 4YTNA 1Q9IA 2JB2A 5BVAA 1H84A 3F8PA 3AE5A 1L0VA 4U8NA 2GEWA 1DJQA 3CGBA 1OJTA 4EMJA 4YSXA 3NG7X 1YQ3A 2J3NA 4TM3A 2X50A 1GTEA 1VG0A 2XCGA 4BK3A 4GUVA 2APGA 5ER0A 2BS4A 1B4VA 1GEUA 3F8RA 2GV8A 4KPRA 1F8WA 2CVJA 3CNSA 5JCMA 4NTEA 4M52A 2B9XA 2WU2A 2YG3A 3AYIA 2WESA 2I0ZA 4PAAA 5M0ZA 4O5UA 4H7UA 1YY5A 5EBKA 2AR8A 1FECA 3IHGA 1M64A 5KOXA 1FOHA 4LIIA 2CFYA 3DGHA 3AE4A 1TYTA 2WETA 4J31A 1ZMDA 4NTDA 1F3PA 3QVPA 4CCRA 2XLSA 3GWDA 4U8KA 3QSEA 1LTXR 3UOXA 4X9NA 5BRTA 1N1PA 4H4ZA 2CULA 4OPUA 5EOWA 1M6IA 1CC2A 3AEEA 1JOAA 4H50A 1ZKQA 1ZMCA 1E1LA 4H4YA 4K2XA 4A9WA 4AT2A 3GYIA 2B9YA 2OAMA 3DH9A 3VR9A 4CNJA 2XYOA 3JSKA 1NHPA 1FEBA 4JNQA 4CY6A 3SQPA 1MO9A 3WE0A 3IHMA 1GRBA 1FL2A 1O95A 1UKVG 1Q1WA 3UKPA 1OJDA 1TDEA 2XFUA 1CBOA 4C3XA 2BCGG 2EQ9A 2Q7VA 4GF7A 4OCGA 4B69A 3NK1X 2GMJA 1GPEA 4U2LA 3AWIA 3BI2A 3SGLA 3GYJA 3PS9A 4MJWA 4N9XA 3AE7A 3KA7A 3REDA 4B64A 2WP5A 2BS2A 3OC4A 4IV9A 4A99A 1EL9A 2VRMA 1CC6A 2HQMA 3UTHA 1D4DA 3H8IA 1DOCA 1KNPA 2OLNA 1ELIA 2YG5A 5FS9A 3FBSA 4H4SA 2TMDA 2Y6RA 3DMEA 4H4UA 4DNAA 2RGOA 2YLRA 4H4TA 3V3OA 3UKQA 2E1MA 1TYPA 3ZYXA 1JRXA 4ZN0A 4EMWA 2B76A 2JB1A 1D4CA 2C70A 2YG4A 3H4KA 4X9MA 3FPZA 4ZCCA 3SFEA 1EL7A 3SM8A 3UOZA 3V3NA 3I3LA 1CF3A 2R45A 4LU6A 2WDRA 4YT0A 3CTYA 2VVLG 5IQ1A 2ARDA 4USRA 2WOWA 3UTFA 4GR1A 2V6OA 5HYMA 3VRAA 4A7AA 1CJ3A 3CNDA 3GDNA 1JU2A 1H7XA 1H86A 2F5ZA 3K7QX 4AOXA 2UZZA 1NG3A 2Q0LA 1ZDLA 1PXBA 5GRTA 2BXSA 4WCTA 1ZOVA 4J34A 2WPEA 2WEUA 1QJDA 2PYXA 1Q1RA 2JBVA 2V3BA 2YVGA 3PO7A 4BV6A 2B9WA 1NHRA 3ICTA 1D7LA 4U2SA 1LJ1A 3LZXA 2YQUA 4C5OA 4O5QA 5JCLA 4TM1A 1TDNA 2RGJA 2YLTA 4NEVA 1F6MA 4BK1A 4H4VA 3AE8A 2C7GA 4H2PA 4U8OA 3KKJA 1PBEA 1LQTA 1YKJA 2VQBA 1PBBA 3BI5A 5HY5A 2YG7A 4TLZA 3C4AA 4FDCB 2BK3A 1IUSA 2TPRA 4I59A 1FCDA 1JEHA 4AP1A 1COYA 4B1BA 2YLZA 3ALMA 2BXRA 2BC0A 2H89A 2XDOA 3GSIA 1NHSA 1JRZA 4EQRA 3K7MX 5M10A 5L46A 1XDIA 4FX9A 5KRQA 5KWFA 1BZLA 1DODA 1GREA 1GRFA 2OLOA 2C76A 3DA1A 3LJPA 2Q0KA 3R9UA 4YKFA 3M0OA 1RP0A 1DOBA 2BYBA 3AE3A 4K8DA 2CDUA 2JK6A 2NPXA 4CRTA 4YSYA 1NENA 2DKIA 4AOSA 3IC9A 2YLSA 3DK4A 4IA5A 4U8IA 3ALJA 3NYFA 4GDPA 1NAAA 4FK1C 3C96A 3AEFA 3ADAB 1BF3A 3II4A 5IPYA 2B7RA 2QCUA 2X8CA 4H4WA 4C3YA 2ZZBA 4DSHA 2QA1A 2C72A 3EANA 4J57A 3GD3A 3G5SA 1XHCA 2GMHA 3RNMA 3NIXA 4D03A 4Z26A 2GQWA 2OALA 3AEBA 1BWCA 3GD4A 4H4XA 1GTHA 3AE1A 4K22A 2R4EA 4OPIA 4YSZA 1S2YA 1BKWA 4U8MA 4A5LA 1PXAA 2WU5A
chains in the Genus database with same CATH superfamily
3ITJA 2E5VA 5HHFA 4NWZA 4B66A 2GF3A 3NLCA 5HXIA 2EQ8A 3CGDA 2BABA 1ZY8A 4B68A 4J36A 3SFDA 4A6NB 4BURA 1P2EA 2C67A 2OA1A 2BK4A 3CGEA 5FS8A 3AD7B 3DJGX 4LA1A 4CBQA 2VZ2A 4CY8A 2WDVA 4EMIA 1TRBA 1CL0A 4OPDA 4JN9A 3NN6X 5JCIA 3CNTA 3EPTA 4YTMA 3GMBA 2XVEA 4X4JA 3UTGA 3SY4A 1E7PA 3H8LA 3DJEA 2GAGB 1NPXA 4IVMB 4G73A 5EB5A 4YXDA 5CQFA 1BGNA 2YM1A 4JDRA 4H2RA 4IVOB 5TR3A 3V76A 2YVFA 3AE2A 4H4QA 2C64A 3AB1A 5FMHA 3BI4A 2QA2A 4C77A 3NNEA 1RYIA 3KU9A 4IA6A 2A8XA 4GDEA 4A79A 3C4NA 5FS6A 4J33A 1VDCA 1PJ5A 2WDQA 3NYCA 4J56A 3UTEA 3QVRA 3AYLA 3UKKA 1GNDA 4U8PA 1GRAA 4XXGA 2IVDA 2YG6A 2YLXA 4E0VA 2V3AA 1PDHA 5J60A 3GYXA 1GESA 1CHUA 1DXLA 1V59A 2WQYA 3P4PA 1ZK7A 2A89A 3NGCX 3FIMB 1TDOA 3SZ0A 4H2NA 1VRQB 2GH5A 4I58A 3UCLA 4DGKA 5KOWA 2YWLA 1PN0A 3AE9A 4ICYA 1KFYA 2BA9A 2V61A 3ATRA 2PHHA 3ICSA 4AT0A 3OZ2A 5BUKA 2XLTA 3FMWA 4CCQA 4EIPA 4A65A 3ICRA 2C66A 4TLXA 1GRGA 2V60A 4ZCDA 1XPQA 1K0IA 3M13A 1W4XA 4NTCA 3URHA 1B5QA 1YQZA 3ALLA 4EQWA 3AEGA 1X31B 3QSSA 1LQUA 1PS9A 2H88A 2WOVA 3DK8A 3KPKA 3RP7A 2QAEA 4OPCA 2VOUA 1GV4A 4UDQA 1Y0PA 1Y56B 3ZDNA 3LZWA 2XVJA 3NN0X 1PHHA 2YR4A 3NTAA 3B6DA 3NRNA 2X3NA 1K0LA 1YQ4A 4UP3A 1KNRA 1JNRA 3KLJA 4PABA 1H6VA 5GSNA 1ZOYA 2JB3A 1IUUA 1IJHA 3L8KA 2Z5XA 1EL5A 1IUXA 4Z2TA 3LOVA 4U8JA 1TDKA 2NVKX 1L9EA 3FG2P 2JAEA 3G5RA 3GRTA 2XVFA 2GVCA 1MXTA 4USQA 4GRTA 4P9SA 2IVEA 3COXA 4J2WA 3UKHA 3AXBA 1LVLA 1K4QA 1D5TA 4Y4LA 3P1WA 4NNJA 4U2TA 1BGJA 1KDGA 1E6EA 1D4EA 2YM2A 3HZLA 3I6DA 3RP6A 1P2HA 2IIDA 2BACA 1NEKA 4AP3A 1TDFA 2FJAA 3PVCA 3SZCA 1PJ6A 2GB0A 1JRYA 3IF9A 1ZX9A 3GWFA 3D8XA 2BC1A 4K5SA 4HA6A 3QFBA 1DJNA 4OPGA 2R4JA 3VR8A 3EF6A 2BRAA 1CJ4A 4Z2UA 2BK5A 3RHAA 5U63A 2EQ7A 3E1TA 2YR6A 5C2TA 1CJ2A 2VRLA 1KSSA 3NTDA 5IQ4A 2WP6A 3T31A 1JNZA 4Y4NA 5LV9A 4JQ9A 1QO8A 3LADA 2YVJA 4BJYA 3P4RA 3CGCA 3CMMA 2WPCA 2RABA 3LB8A 4H4RA 1OJCA 4GAVA 5FS7A 1XANA 3AECA 4CNKA 2YR5A 4Y4MA 4YSHA 3CPIG 4Z43A 2XFQA 1EBDA 1OJ9A 2ZZCA 4K5RA 1QLBA 4GCMA 4EQSA 5CKUA 1EL8A 1O5WA 1GOSA 4YTPA 3P4SA 1K0JA 2RGHA 2XLUA 4II2A 2GQFA 4H2QA 3CIRA 4YKGA 1N4VA 2WHDA 4RG3A 1B8SA 2XFOA 3QSMA 1H81A 3CN8A 1N4WA 3DK9A 1GRTA 2R0PA 2VQ7A 2FJBA 1PJ7A 4EIQA 1NHQA 3UOYA 1NDAA 4D04A 4REKA 4Z44A 3G5QA 5DBJA 2VVMA 3AEDA 4JY3A 4ECHA 2WP9A 3UKLA 3UP5A 3VRDB 1SEZA 1LV0A 2DKHA 4BJZA 4Z2RA 3BHFA 1OJAA 3GRSA 2C65A 3CNPA 2R9ZA 4EM4A 1E1KA 4TM0A 5BULA 1LPFA 3GMCA 3BHKA 2AQJA 2Y6QA 1DNCA 2FJEA 5KMQA 2B7SA 2WS3A 3AEAA 4XWRA 2V5ZA 1FEAA 3L1RA 4YWOA 1GXFA 3O0HA 2BRYA 1H83A 3QFAA 4EQXA 3BNMA 3S61A 2FBWA 3NT6A 3DGZA 3NHOX 4U8LA 3SX6A 4Z25A 4Z24A 2GR2A 3D1CA 3ISHA 3NYEA 2WOIA 4JNAA 1IUVA 3AD9B 2YAUA 1KSUA 2WPFA 3LXDA 4KX6A 4B65A 1IUWA 2O9ZA 2XVIA 4HB9A 4OPLA 2C3DA 2R46A 1NG4A 2GR0A 3CPJG 4APNA 2ACZA 2E4GA 4BK2A 4K7ZA 2Q6UA 3K7TA 2LFCA 3CPHG 5JCKA 4NZHA 1KF6A 1PXCA 3RP8A 1B37A 1N4UA 1S2QA 4G6HA 3HYXA 2GR1A 3F8DA 3NH3X 3Q6JA 4TM4A 2X99A 2BCPA 3QJ4A 5EB4A 4WX1A 1CJCA 3NK2X 1D7YA 3UKFA 3GDPA 2EQ6A 2XVHA 1IUTA 1GSNA 1VQWA 1PBDA 2JKCA 2R0CA 3KD9A 1RSGA 2GAHB 5KVHA 3UOVA 2XFNA 4FK1A 2W0HA 3KPFA 1L9DA 4RSLA 5KMSA 2X8GA 3B3RA 2X8HA 1E1MA 4JY2A 2AAQA 2BS3A 4NEWA 4OVIA 1REOA 4XWZA 3AD8B 5KVIA 3UKAA 2XLRA 2C73A 2YLWA 1S3BA 3KVEA 1GRHA 4B63A 5U1OA 2R0GA 1O94A 3IWAA 3SYIA 1HYUA 2Z5YA 4UDRA 1H7WA 1Y56A 2XLPA 5J7XA 1E39A 4A6NA 2C3CA 4OPTA 5JCNA 1MOKA 1S3EA 1ZP0A 1GT8A 3ATQA 1Z6LA 4DSGA 3S5WA 2GRTA 2XFPA 1GALA 3ABVA 3K30A 4H4PA 3P9UA 1ONFA 3NKSA 4ADWA 3DJDA 2GR3A 3BNUA 3AE6A 2WBAA 3VRBA 4EM3A 5KXJA 1CC4A 2ZZ0A 1F8RA 1L9CA 2VVLA 1VG9A 3DJJA 3P4QA 3VQRA 3UP4A 1DOEA 1GERA 1PBFA 1F8SA 4C74A 4UDPA 1GETA 3AYJA 2ZBWA 3SXIA 3CNJA 4G74A 3NK0X 4RG4A 3T0KA 2C75A 3EAOA 3M12A 1AOGA 1H82A 3T37A 2A87A 5C3JA 1E1NA 1PBCA 2FJDA 4B67A 3Q9TA 5U25A 4YTNA 1Q9IA 2JB2A 5BVAA 1H84A 3F8PA 3AE5A 1L0VA 4U8NA 2GEWA 1DJQA 3CGBA 1OJTA 4EMJA 4YSXA 3NG7X 1YQ3A 2J3NA 4TM3A 2X50A 1GTEA 1VG0A 2XCGA 4BK3A 4GUVA 2APGA 5ER0A 3HYWA 2BS4A 1B4VA 1GEUA 3F8RA 3SZWA 2GV8A 4KPRA 1F8WA 2CVJA 3CNSA 5JCMA 4NTEA 4M52A 3T2ZA 2B9XA 2WU2A 2YG3A 3AYIA 2WESA 2I0ZA 4PAAA 5M0ZA 4O5UA 4H7UA 1YY5A 5EBKA 2AR8A 1FECA 3IHGA 1M64A 5KOXA 1FOHA 4LIIA 2CFYA 3DGHA 3AE4A 1TYTA 2WETA 4J31A 1ZMDA 4NTDA 1F3PA 3QVPA 4CCRA 2XLSA 3GWDA 4U8KA 3QSEA 1LTXR 3UOXA 4X9NA 5BRTA 1N1PA 4H4ZA 3HYVA 2CULA 4OPUA 5EOWA 1M6IA 1CC2A 3AEEA 1JOAA 4H50A 1ZKQA 1ZMCA 1E1LA 4H4YA 4K2XA 4A9WA 4AT2A 3GYIA 4G9KA 2B9YA 2OAMA 3DH9A 3VR9A 4CNJA 2XYOA 3JSKA 1NHPA 1FEBA 4JNQA 4CY6A 3SQPA 1MO9A 3WE0A 3IHMA 1GRBA 1FL2A 1O95A 1UKVG 1Q1WA 3UKPA 1OJDA 1TDEA 2XFUA 1CBOA 4C3XA 2C4CA 2BCGG 2EQ9A 2Q7VA 4GF7A 4OCGA 4B69A 3NK1X 2GMJA 1GPEA 4U2LA 3AWIA 3BI2A 3SGLA 3GYJA 3PS9A 4MJWA 4N9XA 3AE7A 3KA7A 3REDA 4B64A 2WP5A 2BS2A 3OC4A 4IV9A 4A99A 1EL9A 2VRMA 1CC6A 2HQMA 3UTHA 1D4DA 3H8IA 1DOCA 1KNPA 2OLNA 1ELIA 2YG5A 5FS9A 3FBSA 4H4SA 2TMDA 2Y6RA 3DMEA 4H4UA 4DNAA 2RGOA 2YLRA 4H4TA 3V3OA 3UKQA 2E1MA 1TYPA 3ZYXA 1JRXA 4ZN0A 4EMWA 2B76A 2JB1A 1D4CA 2C70A 2YG4A 3H4KA 4X9MA 3FPZA 4ZCCA 3SFEA 1EL7A 3SM8A 3UOZA 3V3NA 3I3LA 1CF3A 2R45A 4LU6A 2WDRA 4YT0A 3CTYA 2VVLG 5IQ1A 2ARDA 5KMRA 4USRA 2WOWA 3UTFA 4GR1A 3T2YA 2V6OA 5HYMA 3VRAA 4A7AA 1CJ3A 3CNDA 3GDNA 1JU2A 1H7XA 1H86A 2F5ZA 3K7QX 4AOXA 2UZZA 1NG3A 2Q0LA 1ZDLA 1PXBA 5GRTA 2BXSA 4WCTA 1ZOVA 4J34A 2WPEA 2WEUA 1QJDA 4GAPA 2PYXA 1Q1RA 2JBVA 2V3BA 2YVGA 3PO7A 4BV6A 2B9WA 1NHRA 3ICTA 1D7LA 4U2SA 1LJ1A 3LZXA 2YQUA 4C5OA 4O5QA 5JCLA 4TM1A 1TDNA 2RGJA 2YLTA 4NEVA 1F6MA 4BK1A 4H4VA 5KMPA 3AE8A 2C7GA 4H2PA 4U8OA 3KKJA 1PBEA 1LQTA 1YKJA 2VQBA 1PBBA 3BI5A 5HY5A 2YG7A 4TLZA 3C4AA 5KNLA 4FDCB 2BK3A 1IUSA 2TPRA 4I59A 1FCDA 1JEHA 4AP1A 1COYA 4B1BA 2YLZA 3ALMA 2BXRA 2BC0A 2H89A 2XDOA 3GSIA 1NHSA 1JRZA 4EQRA 3K7MX 5M10A 5L46A 1XDIA 4FX9A 5KRQA 5KWFA 1BZLA 1DODA 1GREA 1GRFA 2OLOA 2C76A 3DA1A 3LJPA 2Q0KA 3R9UA 4YKFA 3M0OA 3T14A 1RP0A 1DOBA 2BYBA 3AE3A 4K8DA 2CDUA 2JK6A 2NPXA 3T2KA 4CRTA 4YSYA 1NENA 2DKIA 4AOSA 3IC9A 2YLSA 3DK4A 4IA5A 4U8IA 3ALJA 3NYFA 4GDPA 1NAAA 4FK1C 3C96A 3AEFA 3ADAB 1BF3A 3II4A 5IPYA 2B7RA 2QCUA 2X8CA 4H4WA 4C3YA 2ZZBA 4G6GA 2QA1A 4DSHA 3SZFA 2C72A 3EANA 4J57A 3GD3A 3G5SA 1XHCA 2GMHA 3RNMA 3NIXA 4D03A 4Z26A 2GQWA 2OALA 3AEBA 1BWCA 3GD4A 4H4XA 4II3A 1GTHA 3AE1A 4K22A 2R4EA 4OPIA 4YSZA 1S2YA 1BKWA 4U8MA 4A5LA 1PXAA 2WU5A
chains in the Genus database with same CATH topology
3ITJA 2E5VA 5HHFA 4NWZA 4B66A 2GF3A 3NLCA 5HXIA 2EQ8A 3CGDA 2BABA 1ZY8A 4B68A 4J36A 3SFDA 4A6NB 4BURA 1P2EA 2C67A 2OA1A 2BK4A 3CGEA 5FS8A 3AD7B 3DJGX 4LA1A 4CBQA 2VZ2A 4CY8A 2WDVA 4EMIA 1TRBA 1CL0A 4OPDA 4JN9A 3NN6X 5JCIA 3CNTA 3EPTA 4YTMA 3GMBA 2XVEA 4X4JA 3UTGA 3SY4A 1E7PA 3H8LA 3DJEA 2GAGB 1NPXA 4IVMB 4G73A 5EB5A 4YXDA 5CQFA 1BGNA 2YM1A 4JDRA 4H2RA 4IVOB 5TR3A 3V76A 2YVFA 3AE2A 4H4QA 2C64A 3AB1A 5FMHA 3BI4A 2QA2A 4C77A 3NNEA 1RYIA 3KU9A 4IA6A 2A8XA 4GDEA 4A79A 3C4NA 5FS6A 4J33A 1VDCA 1PJ5A 2WDQA 3NYCA 4J56A 3UTEA 3QVRA 3AYLA 3UKKA 1GNDA 4U8PA 1GRAA 4XXGA 2IVDA 2YG6A 2YLXA 4E0VA 2V3AA 1PDHA 5J60A 3GYXA 1GESA 1CHUA 1DXLA 1V59A 2WQYA 3P4PA 1ZK7A 2A89A 3NGCX 3FIMB 1TDOA 3SZ0A 4H2NA 1VRQB 2GH5A 4I58A 3UCLA 4DGKA 5KOWA 2YWLA 1PN0A 3AE9A 4ICYA 1KFYA 2BA9A 2V61A 3ATRA 2PHHA 3ICSA 4AT0A 3OZ2A 5BUKA 2XLTA 3FMWA 4CCQA 4EIPA 4A65A 3ICRA 2C66A 4TLXA 1GRGA 2V60A 4ZCDA 1XPQA 1K0IA 3M13A 1W4XA 4NTCA 3URHA 1B5QA 1YQZA 3ALLA 4EQWA 3AEGA 1X31B 3QSSA 1LQUA 1PS9A 2H88A 2WOVA 3DK8A 3KPKA 3RP7A 2QAEA 4OPCA 2VOUA 1GV4A 4UDQA 1Y0PA 1Y56B 3ZDNA 3LZWA 2XVJA 3NN0X 1PHHA 2YR4A 3NTAA 3B6DA 3NRNA 2X3NA 1K0LA 1YQ4A 4UP3A 1KNRA 1JNRA 3KLJA 4PABA 1H6VA 5GSNA 1ZOYA 2JB3A 1IUUA 1IJHA 3L8KA 2Z5XA 1EL5A 1IUXA 4Z2TA 3LOVA 4U8JA 1TDKA 2NVKX 1L9EA 3FG2P 2JAEA 3G5RA 3GRTA 2XVFA 2GVCA 1MXTA 4USQA 4GRTA 4P9SA 2IVEA 3COXA 4J2WA 3UKHA 3AXBA 1LVLA 1K4QA 1D5TA 4Y4LA 3P1WA 4NNJA 4U2TA 1BGJA 1KDGA 1E6EA 1D4EA 2YM2A 3HZLA 3I6DA 3RP6A 1P2HA 2IIDA 2BACA 1NEKA 4AP3A 1TDFA 2FJAA 3PVCA 3SZCA 1PJ6A 2GB0A 1JRYA 3IF9A 1ZX9A 3GWFA 3D8XA 2BC1A 4K5SA 4HA6A 3QFBA 1DJNA 4OPGA 2R4JA 3VR8A 3EF6A 2BRAA 1CJ4A 4Z2UA 2BK5A 3RHAA 5U63A 2EQ7A 3E1TA 2YR6A 5C2TA 1CJ2A 2VRLA 1KSSA 3NTDA 5IQ4A 2WP6A 3T31A 1JNZA 4Y4NA 5LV9A 4JQ9A 1QO8A 3LADA 2YVJA 4BJYA 3P4RA 3CGCA 3CMMA 2WPCA 2RABA 3LB8A 4H4RA 1OJCA 4GAVA 5FS7A 1XANA 3AECA 4CNKA 2YR5A 4Y4MA 4YSHA 3CPIG 4Z43A 2XFQA 1EBDA 1OJ9A 2ZZCA 4K5RA 1QLBA 4GCMA 4EQSA 5CKUA 1EL8A 1O5WA 1GOSA 4YTPA 3P4SA 1K0JA 2RGHA 2XLUA 4II2A 2GQFA 4H2QA 3CIRA 4YKGA 1N4VA 2WHDA 4RG3A 1B8SA 2XFOA 3QSMA 1H81A 3CN8A 1N4WA 3DK9A 1GRTA 2R0PA 2VQ7A 2FJBA 1PJ7A 4EIQA 1NHQA 3UOYA 1NDAA 4D04A 4REKA 4Z44A 3G5QA 5DBJA 2VVMA 3AEDA 4JY3A 4ECHA 2WP9A 3UKLA 3UP5A 3VRDB 1SEZA 1LV0A 2DKHA 4BJZA 4Z2RA 3BHFA 1OJAA 3GRSA 2C65A 3CNPA 2R9ZA 4EM4A 1E1KA 4TM0A 5BULA 1LPFA 3GMCA 3BHKA 2AQJA 2Y6QA 1DNCA 2FJEA 5KMQA 2B7SA 2WS3A 3AEAA 4XWRA 2V5ZA 1FEAA 3L1RA 4YWOA 1GXFA 3O0HA 2BRYA 1H83A 3QFAA 4EQXA 3BNMA 3S61A 2FBWA 3NT6A 3DGZA 3NHOX 4U8LA 3SX6A 4Z25A 4Z24A 2GR2A 3D1CA 3ISHA 3NYEA 2WOIA 4JNAA 1IUVA 3AD9B 2YAUA 1KSUA 2WPFA 3LXDA 4KX6A 4B65A 1IUWA 2O9ZA 2XVIA 4HB9A 4OPLA 2C3DA 2R46A 1NG4A 2GR0A 3CPJG 4APNA 2ACZA 2E4GA 4BK2A 4K7ZA 2Q6UA 3K7TA 2LFCA 3CPHG 5JCKA 4NZHA 1KF6A 1PXCA 3RP8A 1B37A 1N4UA 1S2QA 4G6HA 3HYXA 2GR1A 3F8DA 3NH3X 3Q6JA 4TM4A 2X99A 2BCPA 3QJ4A 5EB4A 4WX1A 1CJCA 3NK2X 1D7YA 3UKFA 3GDPA 2EQ6A 2XVHA 1IUTA 1GSNA 1VQWA 1PBDA 2JKCA 2R0CA 3KD9A 1RSGA 2GAHB 5KVHA 3UOVA 2XFNA 4FK1A 2W0HA 3KPFA 1L9DA 4RSLA 5KMSA 2X8GA 3B3RA 2X8HA 1E1MA 4JY2A 2AAQA 2BS3A 4NEWA 4OVIA 1REOA 4XWZA 3AD8B 5KVIA 3UKAA 2XLRA 2C73A 2YLWA 1S3BA 3KVEA 1GRHA 4B63A 5U1OA 2R0GA 1O94A 3IWAA 3SYIA 1HYUA 2Z5YA 4UDRA 1H7WA 1Y56A 2XLPA 5J7XA 1E39A 4A6NA 2C3CA 4OPTA 5JCNA 1MOKA 1S3EA 1ZP0A 1GT8A 3ATQA 1Z6LA 4DSGA 3S5WA 2GRTA 2XFPA 1GALA 3ABVA 3K30A 4H4PA 3P9UA 1ONFA 3NKSA 4ADWA 3DJDA 2GR3A 3BNUA 3AE6A 2WBAA 3VRBA 4EM3A 5KXJA 1CC4A 2ZZ0A 1F8RA 1L9CA 2VVLA 1VG9A 3DJJA 3P4QA 3VQRA 3UP4A 1DOEA 1GERA 1PBFA 1F8SA 4C74A 4UDPA 1GETA 3AYJA 2ZBWA 3SXIA 3CNJA 4G74A 3NK0X 4RG4A 3T0KA 2C75A 3EAOA 3M12A 1AOGA 1H82A 3T37A 2A87A 5C3JA 1E1NA 1PBCA 2FJDA 4B67A 3Q9TA 5U25A 4YTNA 1Q9IA 2JB2A 5BVAA 1H84A 3F8PA 3AE5A 1L0VA 4U8NA 2GEWA 1DJQA 3CGBA 1OJTA 4EMJA 4YSXA 3NG7X 1YQ3A 2J3NA 4TM3A 2X50A 1GTEA 1VG0A 2XCGA 4BK3A 4GUVA 2APGA 5ER0A 3HYWA 2BS4A 1B4VA 1GEUA 3F8RA 3SZWA 2GV8A 4KPRA 1F8WA 2CVJA 3CNSA 5JCMA 4NTEA 4M52A 3T2ZA 2B9XA 2WU2A 2YG3A 3AYIA 2WESA 2I0ZA 4PAAA 5M0ZA 4O5UA 4H7UA 1YY5A 5EBKA 2AR8A 1FECA 3IHGA 1M64A 5KOXA 1FOHA 4LIIA 2CFYA 3DGHA 3AE4A 1TYTA 2WETA 4J31A 1ZMDA 4NTDA 1F3PA 3QVPA 4CCRA 2XLSA 3GWDA 4U8KA 3QSEA 1LTXR 3UOXA 4X9NA 5BRTA 1N1PA 4H4ZA 3HYVA 2CULA 4OPUA 5EOWA 1M6IA 1CC2A 3AEEA 1JOAA 4H50A 1ZKQA 1ZMCA 1E1LA 4H4YA 4K2XA 4A9WA 4AT2A 3GYIA 4G9KA 2B9YA 2OAMA 3DH9A 3VR9A 4CNJA 2XYOA 3JSKA 1NHPA 1FEBA 4JNQA 4CY6A 3SQPA 1MO9A 3WE0A 3IHMA 1GRBA 1FL2A 1O95A 1UKVG 1Q1WA 3UKPA 1OJDA 1TDEA 2XFUA 1CBOA 4C3XA 2C4CA 2BCGG 2EQ9A 2Q7VA 4GF7A 4OCGA 4B69A 3NK1X 2GMJA 1GPEA 4U2LA 3AWIA 3BI2A 3SGLA 3GYJA 3PS9A 4MJWA 4N9XA 3AE7A 3KA7A 3REDA 4B64A 2WP5A 2BS2A 3OC4A 4IV9A 4A99A 1EL9A 2VRMA 1CC6A 2HQMA 3UTHA 1D4DA 3H8IA 1DOCA 1KNPA 2OLNA 1ELIA 2YG5A 5FS9A 3FBSA 4H4SA 2TMDA 2Y6RA 3DMEA 4H4UA 4DNAA 2RGOA 2YLRA 4H4TA 3V3OA 3UKQA 2E1MA 1TYPA 3ZYXA 1JRXA 4ZN0A 4EMWA 2B76A 2JB1A 1D4CA 2C70A 2YG4A 3H4KA 4X9MA 3FPZA 4ZCCA 3SFEA 1EL7A 3SM8A 3UOZA 3V3NA 3I3LA 1CF3A 2R45A 4LU6A 2WDRA 4YT0A 3CTYA 2VVLG 5IQ1A 2ARDA 5KMRA 4USRA 2WOWA 3UTFA 4GR1A 3T2YA 2V6OA 5HYMA 3VRAA 4A7AA 1CJ3A 3CNDA 3GDNA 1JU2A 1H7XA 1H86A 2F5ZA 3K7QX 4AOXA 2UZZA 1NG3A 2Q0LA 1ZDLA 1PXBA 5GRTA 2BXSA 4WCTA 1ZOVA 4J34A 2WPEA 2WEUA 1QJDA 4GAPA 2PYXA 1Q1RA 2JBVA 2V3BA 2YVGA 3PO7A 4BV6A 2B9WA 1NHRA 3ICTA 1D7LA 4U2SA 1LJ1A 3LZXA 2YQUA 4C5OA 4O5QA 5JCLA 4TM1A 1TDNA 2RGJA 2YLTA 4NEVA 1F6MA 4BK1A 4H4VA 5KMPA 3AE8A 2C7GA 4H2PA 4U8OA 3KKJA 1PBEA 1LQTA 1YKJA 2VQBA 1PBBA 3BI5A 5HY5A 2YG7A 4TLZA 3C4AA 5KNLA 4FDCB 2BK3A 1IUSA 2TPRA 4I59A 1FCDA 1JEHA 4AP1A 1COYA 4B1BA 2YLZA 3ALMA 2BXRA 2BC0A 2H89A 2XDOA 3GSIA 1NHSA 1JRZA 4EQRA 3K7MX 5M10A 5L46A 1XDIA 4FX9A 5KRQA 5KWFA 1BZLA 1DODA 1GREA 1GRFA 2OLOA 2C76A 3DA1A 3LJPA 2Q0KA 3R9UA 4YKFA 3M0OA 3T14A 1RP0A 1DOBA 2BYBA 3AE3A 4K8DA 2CDUA 2JK6A 2NPXA 3T2KA 4CRTA 4YSYA 1NENA 2DKIA 4AOSA 3IC9A 2YLSA 3DK4A 4IA5A 4U8IA 3ALJA 3NYFA 4GDPA 1NAAA 4FK1C 3C96A 3AEFA 3ADAB 1BF3A 3II4A 5IPYA 2B7RA 2QCUA 2X8CA 4H4WA 4C3YA 2ZZBA 4G6GA 2QA1A 4DSHA 3SZFA 2C72A 3EANA 4J57A 3GD3A 3G5SA 1XHCA 2GMHA 3RNMA 3NIXA 4D03A 4Z26A 2GQWA 2OALA 3AEBA 1BWCA 3GD4A 4H4XA 4II3A 1GTHA 3AE1A 4K22A 2R4EA 4OPIA 4YSZA 1S2YA 1BKWA 4U8MA 4A5LA 1PXAA 2WU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITJ A;  2E5V A;  5HHF A;  4B66 A;  2GF3 A;  3NLC A;  5HXI A;  2EQ8 A;  3CGD A;  2BAB A;  1ZY8 A;  4B68 A;  4J36 A;  3SFD A;  4A6N B;  4BUR A;  1P2E A;  2C67 A;  2OA1 A;  2BK4 A;  3CGE A;  5FS8 A;  3AD7 B;  3DJG X;  4LA1 A;  4CBQ A;  2VZ2 A;  4CY8 A;  2WDV A;  4EMI A;  1TRB A;  1CL0 A;  4OPD A;  4JN9 A;  3NN6 X;  5JCI A;  3CNT A;  3EPT A;  4YTM A;  3GMB A;  2XVE A;  4X4J A;  3UTG A;  1E7P A;  3H8L A;  3DJE A;  2GAG B;  1NPX A;  4IVM B;  5EB5 A;  4YXD A;  5CQF A;  1BGN A;  2YM1 A;  4JDR A;  4H2R A;  4IVO B;  5TR3 A;  3V76 A;  2YVF A;  3AE2 A;  4H4Q A;  2C64 A;  3AB1 A;  5FMH A;  3BI4 A;  2QA2 A;  4C77 A;  3NNE A;  1RYI A;  3KU9 A;  4IA6 A;  2A8X A;  4GDE A;  4A79 A;  3C4N A;  5FS6 A;  4J33 A;  1VDC A;  1PJ5 A;  2WDQ A;  3NYC A;  4J56 A;  3UTE A;  3QVR A;  3AYL A;  3UKK A;  1GND A;  4U8P A;  1GRA A;  4XXG A;  2IVD A;  2YG6 A;  2YLX A;  4E0V A;  2V3A A;  1PDH A;  5J60 A;  3GYX A;  1GES A;  1CHU A;  1DXL A;  1V59 A;  2WQY A;  3P4P A;  1ZK7 A;  2A89 A;  3NGC X;  3FIM B;  1TDO A;  4H2N A;  1VRQ B;  2GH5 A;  4I58 A;  3UCL A;  4DGK A;  5KOW A;  2YWL A;  1PN0 A;  3AE9 A;  4ICY A;  1KFY A;  2BA9 A;  2V61 A;  3ATR A;  2PHH A;  3ICS A;  4AT0 A;  3OZ2 A;  5BUK A;  2XLT A;  3FMW A;  4CCQ A;  4EIP A;  4A65 A;  3ICR A;  2C66 A;  4TLX A;  1GRG A;  2V60 A;  4ZCD A;  1XPQ A;  1K0I A;  3M13 A;  1W4X A;  4NTC A;  3URH A;  1B5Q A;  1YQZ A;  3ALL A;  4EQW A;  3AEG A;  1X31 B;  3QSS A;  1LQU A;  1PS9 A;  2H88 A;  2WOV A;  3DK8 A;  3RP7 A;  2QAE A;  4OPC A;  2VOU A;  1GV4 A;  4UDQ A;  1Y0P A;  1Y56 B;  3ZDN A;  3LZW A;  2XVJ A;  3NN0 X;  1PHH A;  2YR4 A;  3NTA A;  3B6D A;  3NRN A;  2X3N A;  1K0L A;  1YQ4 A;  4UP3 A;  1KNR A;  1JNR A;  3KLJ A;  4PAB A;  1H6V A;  5GSN A;  1ZOY A;  2JB3 A;  1IUU A;  1IJH A;  3L8K A;  2Z5X A;  1EL5 A;  1IUX A;  4Z2T A;  3LOV A;  4U8J A;  1TDK A;  2NVK X;  1L9E A;  3FG2 P;  2JAE A;  3G5R A;  3GRT A;  2XVF A;  2GVC A;  1MXT A;  4USQ A;  4GRT A;  4P9S A;  2IVE A;  3COX A;  4J2W A;  3UKH A;  3AXB A;  1LVL A;  1K4Q A;  1D5T A;  4Y4L A;  3P1W A;  4U2T A;  1BGJ A;  1KDG A;  1E6E A;  1D4E A;  2YM2 A;  3HZL A;  3I6D A;  3RP6 A;  1P2H A;  2IID A;  2BAC A;  1NEK A;  4AP3 A;  1TDF A;  2FJA A;  3PVC A;  1PJ6 A;  2GB0 A;  1JRY A;  3IF9 A;  1ZX9 A;  3GWF A;  3D8X A;  2BC1 A;  4K5S A;  4HA6 A;  3QFB A;  1DJN A;  4OPG A;  2R4J A;  3VR8 A;  3EF6 A;  1CJ4 A;  4Z2U A;  2BK5 A;  3RHA A;  5U63 A;  2EQ7 A;  3E1T A;  2YR6 A;  5C2T A;  1CJ2 A;  2VRL A;  1KSS A;  3NTD A;  5IQ4 A;  2WP6 A;  5LV9 A;  1JNZ A;  4Y4N A;  4JQ9 A;  1QO8 A;  3LAD A;  2YVJ A;  4BJY A;  3P4R A;  3CGC A;  5FS7 A;  2WPC A;  2RAB A;  3LB8 A;  4H4R A;  1OJC A;  4CNK A;  1XAN A;  3AEC A;  4YSH A;  2YR5 A;  4Y4M A;  4Z43 A;  3CPI G;  2XFQ A;  1EBD A;  1OJ9 A;  2ZZC A;  4K5R A;  1QLB A;  4GCM A;  4EQS A;  5CKU A;  1EL8 A;  1O5W A;  1GOS A;  4YTP A;  3P4S A;  1K0J A;  2RGH A;  2XLU A;  2GQF A;  4H2Q A;  3CIR A;  4YKG A;  1N4V A;  2WHD A;  4RG3 A;  1B8S A;  2XFO A;  3QSM A;  1H81 A;  3CN8 A;  1N4W A;  3DK9 A;  1GRT A;  2R0P A;  2VQ7 A;  2FJB A;  1PJ7 A;  4EIQ A;  1NHQ A;  3UOY A;  1NDA A;  4D04 A;  4REK A;  4Z44 A;  3G5Q A;  5DBJ A;  2VVM A;  3AED A;  4JY3 A;  4ECH A;  2WP9 A;  3UKL A;  3UP5 A;  3VRD B;  1SEZ A;  1LV0 A;  2DKH A;  4BJZ A;  4Z2R A;  3BHF A;  1OJA A;  3GRS A;  2C65 A;  3CNP A;  2R9Z A;  4EM4 A;  1E1K A;  4TM0 A;  5BUL A;  1LPF A;  3GMC A;  3BHK A;  2AQJ A;  2Y6Q A;  1DNC A;  2FJE A;  2B7S A;  2WS3 A;  3AEA A;  4XWR A;  2V5Z A;  1FEA A;  3L1R A;  4YWO A;  1GXF A;  3O0H A;  1H83 A;  3QFA A;  4EQX A;  3BNM A;  3S61 A;  2FBW A;  3NT6 A;  3DGZ A;  3NHO X;  4U8L A;  4Z25 A;  4Z24 A;  2GR2 A;  3D1C A;  3ISH A;  3NYE A;  2WOI A;  4JNA A;  1IUV A;  3AD9 B;  2YAU A;  1KSU A;  2WPF A;  3LXD A;  4KX6 A;  4B65 A;  1IUW A;  2O9Z A;  2XVI A;  4HB9 A;  4OPL A;  2C3D A;  2R46 A;  1NG4 A;  2GR0 A;  3CPJ G;  4APN A;  2ACZ A;  2E4G A;  4BK2 A;  4K7Z A;  2Q6U A;  3K7T A;  2LFC A;  3CPH G;  5JCK A;  4NZH A;  1KF6 A;  1PXC A;  3RP8 A;  1B37 A;  1N4U A;  1S2Q A;  3NH3 X;  2GR1 A;  3F8D A;  3Q6J A;  4TM4 A;  2X99 A;  2BCP A;  3QJ4 A;  5EB4 A;  4WX1 A;  1CJC A;  3NK2 X;  1D7Y A;  3UKF A;  3GDP A;  2EQ6 A;  2XVH A;  1IUT A;  1GSN A;  1VQW A;  2R0C A;  1PBD A;  2JKC A;  3KD9 A;  1RSG A;  2GAH B;  5KVH A;  3UOV A;  2XFN A;  4FK1 A;  2W0H A;  3KPF A;  1L9D A;  4RSL A;  2X8G A;  3B3R A;  2X8H A;  1E1M A;  4JY2 A;  2AAQ A;  2BS3 A;  4NEW A;  4OVI A;  1REO A;  4XWZ A;  3AD8 B;  5KVI A;  3UKA A;  2XLR A;  2C73 A;  2YLW A;  1S3B A;  3KVE A;  1GRH A;  4B63 A;  5U1O A;  2R0G A;  1O94 A;  3IWA A;  1HYU A;  2Z5Y A;  4UDR A;  1H7W A;  1Y56 A;  2XLP A;  5J7X A;  1E39 A;  4A6N A;  2C3C A;  4OPT A;  5JCN A;  1MOK A;  1S3E A;  1ZP0 A;  1GT8 A;  3ATQ A;  1Z6L A;  4DSG A;  3S5W A;  2GRT A;  2XFP A;  1GAL A;  3ABV A;  3K30 A;  4H4P A;  3P9U A;  1ONF A;  3NKS A;  4ADW A;  3DJD A;  2GR3 A;  3BNU A;  3AE6 A;  2WBA A;  3VRB A;  4EM3 A;  5KXJ A;  1CC4 A;  2ZZ0 A;  1F8R A;  1L9C A;  2VVL A;  1VG9 A;  3DJJ A;  3P4Q A;  3VQR A;  3UP4 A;  1DOE A;  1GER A;  1PBF A;  1F8S A;  4C74 A;  4UDP A;  1GET A;  3AYJ A;  2ZBW A;  3CNJ A;  3NK0 X;  4RG4 A;  2C75 A;  3EAO A;  3M12 A;  1AOG A;  1H82 A;  3T37 A;  2A87 A;  5C3J A;  1E1N A;  1PBC A;  2FJD A;  4B67 A;  3Q9T A;  5U25 A;  4YTN A;  1Q9I A;  2JB2 A;  5BVA A;  1H84 A;  3F8P A;  3AE5 A;  1L0V A;  4U8N A;  2GEW A;  1DJQ A;  3CGB A;  1OJT A;  4EMJ A;  4YSX A;  3NG7 X;  1YQ3 A;  2J3N A;  4TM3 A;  2X50 A;  1GTE A;  1VG0 A;  2XCG A;  4BK3 A;  4GUV A;  2APG A;  5ER0 A;  2BS4 A;  1B4V A;  1GEU A;  3F8R A;  2GV8 A;  4KPR A;  1F8W A;  2CVJ A;  3CNS A;  5JCM A;  4NTE A;  4M52 A;  2B9X A;  2WU2 A;  2YG3 A;  3AYI A;  2WES A;  2I0Z A;  4PAA A;  5M0Z A;  4O5U A;  4H7U A;  1YY5 A;  5EBK A;  2AR8 A;  1FEC A;  3IHG A;  1M64 A;  5KOX A;  1FOH A;  4LII A;  2CFY A;  3DGH A;  3AE4 A;  1TYT A;  2WET A;  4J31 A;  1ZMD A;  4NTD A;  1F3P A;  3QVP A;  4CCR A;  2XLS A;  3GWD A;  4U8K A;  3QSE A;  1LTX R;  3UOX A;  4X9N A;  5BRT A;  1N1P A;  4H4Z A;  2CUL A;  4OPU A;  5EOW A;  1M6I A;  1CC2 A;  3AEE A;  1JOA A;  4H50 A;  1ZKQ A;  1ZMC A;  1E1L A;  4H4Y A;  4K2X A;  4A9W A;  4AT2 A;  3GYI A;  2B9Y A;  2OAM A;  3DH9 A;  3VR9 A;  4CNJ A;  2XYO A;  3JSK A;  1NHP A;  1FEB A;  4JNQ A;  4CY6 A;  3SQP A;  1MO9 A;  3WE0 A;  3IHM A;  1GRB A;  1FL2 A;  1O95 A;  1UKV G;  1Q1W A;  3UKP A;  1OJD A;  1TDE A;  2XFU A;  1CBO A;  4C3X A;  2BCG G;  2EQ9 A;  2Q7V A;  4GF7 A;  4OCG A;  4B69 A;  3NK1 X;  2GMJ A;  1GPE A;  4U2L A;  3AWI A;  3BI2 A;  3SGL A;  3GYJ A;  3PS9 A;  4MJW A;  4N9X A;  3AE7 A;  3KA7 A;  3RED A;  4B64 A;  2WP5 A;  2BS2 A;  3OC4 A;  4IV9 A;  4A99 A;  1EL9 A;  2VRM A;  1CC6 A;  2HQM A;  3UTH A;  1D4D A;  3H8I A;  1DOC A;  1KNP A;  2OLN A;  1ELI A;  2YG5 A;  5FS9 A;  3FBS A;  4H4S A;  2TMD A;  2Y6R A;  3DME A;  4H4U A;  4DNA A;  2RGO A;  2YLR A;  4H4T A;  3V3O A;  3UKQ A;  2E1M A;  1TYP A;  3ZYX A;  1JRX A;  4ZN0 A;  4EMW A;  2B76 A;  2JB1 A;  1D4C A;  2C70 A;  2YG4 A;  3H4K A;  4X9M A;  3FPZ A;  4ZCC A;  3SFE A;  1EL7 A;  3SM8 A;  3UOZ A;  3V3N A;  3I3L A;  1CF3 A;  2R45 A;  4LU6 A;  2WDR A;  4YT0 A;  3CTY A;  2VVL G;  5IQ1 A;  2ARD A;  4USR A;  2WOW A;  3UTF A;  4GR1 A;  2V6O A;  5HYM A;  3VRA A;  4A7A A;  1CJ3 A;  3CND A;  3GDN A;  1JU2 A;  1H7X A;  1H86 A;  2F5Z A;  3K7Q X;  4AOX A;  2UZZ A;  1NG3 A;  2Q0L A;  1ZDL A;  1PXB A;  5GRT A;  2BXS A;  4WCT A;  1ZOV A;  4J34 A;  2WPE A;  2WEU A;  1QJD A;  2PYX A;  1Q1R A;  2JBV A;  2V3B A;  2YVG A;  3PO7 A;  4BV6 A;  2B9W A;  1NHR A;  3ICT A;  1D7L A;  4U2S A;  1LJ1 A;  3LZX A;  2YQU A;  4C5O A;  4O5Q A;  5JCL A;  4TM1 A;  1TDN A;  2RGJ A;  2YLT A;  4NEV A;  1F6M A;  4BK1 A;  4H4V A;  3AE8 A;  2C7G A;  4H2P A;  4U8O A;  3KKJ A;  1PBE A;  1LQT A;  1YKJ A;  2VQB A;  1PBB A;  3BI5 A;  5HY5 A;  2YG7 A;  4TLZ A;  3C4A A;  4FDC B;  2BK3 A;  1IUS A;  2TPR A;  4I59 A;  1FCD A;  1JEH A;  4AP1 A;  1COY A;  4B1B A;  2YLZ A;  3ALM A;  2BXR A;  2BC0 A;  2H89 A;  2XDO A;  3GSI A;  1NHS A;  1JRZ A;  4EQR A;  3K7M X;  5M10 A;  5L46 A;  1XDI A;  4FX9 A;  5KRQ A;  5KWF A;  1BZL A;  1DOD A;  1GRE A;  1GRF A;  2OLO A;  2C76 A;  3DA1 A;  3LJP A;  2Q0K A;  3R9U A;  4YKF A;  3M0O A;  1RP0 A;  1DOB A;  2BYB A;  3AE3 A;  4K8D A;  2CDU A;  2JK6 A;  2NPX A;  4CRT A;  4YSY A;  1NEN A;  2DKI A;  4AOS A;  3IC9 A;  2YLS A;  3DK4 A;  4IA5 A;  4U8I A;  3ALJ A;  3NYF A;  4GDP A;  1NAA A;  4FK1 C;  3C96 A;  3AEF A;  3ADA B;  1BF3 A;  3II4 A;  5IPY A;  2B7R A;  2QCU A;  2X8C A;  4H4W A;  4C3Y A;  2ZZB A;  4DSH A;  2QA1 A;  2C72 A;  3EAN A;  4J57 A;  3GD3 A;  3G5S A;  1XHC A;  2GMH A;  3RNM A;  3NIX A;  4D03 A;  4Z26 A;  2GQW A;  2OAL A;  3AEB A;  1BWC A;  3GD4 A;  4H4X A;  1GTH A;  3AE1 A;  4K22 A;  2R4E A;  4OPI A;  4YSZ A;  1S2Y A;  1BKW A;  4U8M A;  4A5L A;  1PXA A;  2WU5 A; 
#chains in the Genus database with same CATH topology
 3ITJ A;  2E5V A;  5HHF A;  4NWZ A;  4B66 A;  2GF3 A;  3NLC A;  5HXI A;  2EQ8 A;  3CGD A;  2BAB A;  1ZY8 A;  4B68 A;  4J36 A;  3SFD A;  4A6N B;  4BUR A;  1P2E A;  2C67 A;  2OA1 A;  2BK4 A;  3CGE A;  5FS8 A;  3AD7 B;  3DJG X;  4LA1 A;  4CBQ A;  2VZ2 A;  4CY8 A;  2WDV A;  4EMI A;  1TRB A;  1CL0 A;  4OPD A;  4JN9 A;  3NN6 X;  5JCI A;  3CNT A;  3EPT A;  4YTM A;  3GMB A;  2XVE A;  4X4J A;  3UTG A;  3SY4 A;  1E7P A;  3H8L A;  3DJE A;  2GAG B;  1NPX A;  4IVM B;  4G73 A;  5EB5 A;  4YXD A;  5CQF A;  1BGN A;  2YM1 A;  4JDR A;  4H2R A;  4IVO B;  5TR3 A;  3V76 A;  2YVF A;  3AE2 A;  4H4Q A;  2C64 A;  3AB1 A;  5FMH A;  3BI4 A;  2QA2 A;  4C77 A;  3NNE A;  1RYI A;  3KU9 A;  4IA6 A;  2A8X A;  4GDE A;  4A79 A;  3C4N A;  5FS6 A;  4J33 A;  1VDC A;  1PJ5 A;  2WDQ A;  3NYC A;  4J56 A;  3UTE A;  3QVR A;  3AYL A;  3UKK A;  1GND A;  4U8P A;  1GRA A;  4XXG A;  2IVD A;  2YG6 A;  2YLX A;  4E0V A;  2V3A A;  1PDH A;  5J60 A;  3GYX A;  1GES A;  1CHU A;  1DXL A;  1V59 A;  2WQY A;  3P4P A;  1ZK7 A;  2A89 A;  3NGC X;  3FIM B;  1TDO A;  3SZ0 A;  4H2N A;  1VRQ B;  2GH5 A;  4I58 A;  3UCL A;  4DGK A;  5KOW A;  2YWL A;  1PN0 A;  3AE9 A;  4ICY A;  1KFY A;  2BA9 A;  2V61 A;  3ATR A;  2PHH A;  3ICS A;  4AT0 A;  3OZ2 A;  5BUK A;  2XLT A;  3FMW A;  4CCQ A;  4EIP A;  4A65 A;  3ICR A;  2C66 A;  4TLX A;  1GRG A;  2V60 A;  4ZCD A;  1XPQ A;  1K0I A;  3M13 A;  1W4X A;  4NTC A;  3URH A;  1B5Q A;  1YQZ A;  3ALL A;  4EQW A;  3AEG A;  1X31 B;  3QSS A;  1LQU A;  1PS9 A;  2H88 A;  2WOV A;  3DK8 A;  3KPK A;  3RP7 A;  2QAE A;  4OPC A;  2VOU A;  1GV4 A;  4UDQ A;  1Y0P A;  1Y56 B;  3ZDN A;  3LZW A;  2XVJ A;  3NN0 X;  1PHH A;  2YR4 A;  3NTA A;  3B6D A;  3NRN A;  2X3N A;  1K0L A;  1YQ4 A;  4UP3 A;  1KNR A;  1JNR A;  3KLJ A;  4PAB A;  1H6V A;  5GSN A;  1ZOY A;  2JB3 A;  1IUU A;  1IJH A;  3L8K A;  2Z5X A;  1EL5 A;  1IUX A;  4Z2T A;  3LOV A;  4U8J A;  1TDK A;  2NVK X;  1L9E A;  3FG2 P;  2JAE A;  3G5R A;  3GRT A;  2XVF A;  2GVC A;  1MXT A;  4USQ A;  4GRT A;  4P9S A;  2IVE A;  3COX A;  4J2W A;  3UKH A;  3AXB A;  1LVL A;  1K4Q A;  1D5T A;  4Y4L A;  3P1W A;  4NNJ A;  4U2T A;  1BGJ A;  1KDG A;  1E6E A;  1D4E A;  2YM2 A;  3HZL A;  3I6D A;  3RP6 A;  1P2H A;  2IID A;  2BAC A;  1NEK A;  4AP3 A;  1TDF A;  2FJA A;  3PVC A;  3SZC A;  1PJ6 A;  2GB0 A;  1JRY A;  3IF9 A;  1ZX9 A;  3GWF A;  3D8X A;  2BC1 A;  4K5S A;  4HA6 A;  3QFB A;  1DJN A;  4OPG A;  2R4J A;  3VR8 A;  3EF6 A;  2BRA A;  1CJ4 A;  4Z2U A;  2BK5 A;  3RHA A;  5U63 A;  2EQ7 A;  3E1T A;  2YR6 A;  5C2T A;  1CJ2 A;  2VRL A;  1KSS A;  3NTD A;  5IQ4 A;  2WP6 A;  3T31 A;  1JNZ A;  4Y4N A;  5LV9 A;  4JQ9 A;  1QO8 A;  3LAD A;  2YVJ A;  4BJY A;  3P4R A;  3CGC A;  3CMM A;  2WPC A;  2RAB A;  3LB8 A;  4H4R A;  1OJC A;  4GAV A;  5FS7 A;  1XAN A;  3AEC A;  4CNK A;  2YR5 A;  4Y4M A;  4YSH A;  3CPI G;  4Z43 A;  2XFQ A;  1EBD A;  1OJ9 A;  2ZZC A;  4K5R A;  1QLB A;  4GCM A;  4EQS A;  5CKU A;  1EL8 A;  1O5W A;  1GOS A;  4YTP A;  3P4S A;  1K0J A;  2RGH A;  2XLU A;  4II2 A;  2GQF A;  4H2Q A;  3CIR A;  4YKG A;  1N4V A;  2WHD A;  4RG3 A;  1B8S A;  2XFO A;  3QSM A;  1H81 A;  3CN8 A;  1N4W A;  3DK9 A;  1GRT A;  2R0P A;  2VQ7 A;  2FJB A;  1PJ7 A;  4EIQ A;  1NHQ A;  3UOY A;  1NDA A;  4D04 A;  4REK A;  4Z44 A;  3G5Q A;  5DBJ A;  2VVM A;  3AED A;  4JY3 A;  4ECH A;  2WP9 A;  3UKL A;  3UP5 A;  3VRD B;  1SEZ A;  1LV0 A;  2DKH A;  4BJZ A;  4Z2R A;  3BHF A;  1OJA A;  3GRS A;  2C65 A;  3CNP A;  2R9Z A;  4EM4 A;  1E1K A;  4TM0 A;  5BUL A;  1LPF A;  3GMC A;  3BHK A;  2AQJ A;  2Y6Q A;  1DNC A;  2FJE A;  5KMQ A;  2B7S A;  2WS3 A;  3AEA A;  4XWR A;  2V5Z A;  1FEA A;  3L1R A;  4YWO A;  1GXF A;  3O0H A;  2BRY A;  1H83 A;  3QFA A;  4EQX A;  3BNM A;  3S61 A;  2FBW A;  3NT6 A;  3DGZ A;  3NHO X;  4U8L A;  3SX6 A;  4Z25 A;  4Z24 A;  2GR2 A;  3D1C A;  3ISH A;  3NYE A;  2WOI A;  4JNA A;  1IUV A;  3AD9 B;  2YAU A;  1KSU A;  2WPF A;  3LXD A;  4KX6 A;  4B65 A;  1IUW A;  2O9Z A;  2XVI A;  4HB9 A;  4OPL A;  2C3D A;  2R46 A;  1NG4 A;  2GR0 A;  3CPJ G;  4APN A;  2ACZ A;  2E4G A;  4BK2 A;  4K7Z A;  2Q6U A;  3K7T A;  2LFC A;  3CPH G;  5JCK A;  4NZH A;  1KF6 A;  1PXC A;  3RP8 A;  1B37 A;  1N4U A;  1S2Q A;  4G6H A;  3HYX A;  2GR1 A;  3F8D A;  3NH3 X;  3Q6J A;  4TM4 A;  2X99 A;  2BCP A;  3QJ4 A;  5EB4 A;  4WX1 A;  1CJC A;  3NK2 X;  1D7Y A;  3UKF A;  3GDP A;  2EQ6 A;  2XVH A;  1IUT A;  1GSN A;  1VQW A;  1PBD A;  2JKC A;  2R0C A;  3KD9 A;  1RSG A;  2GAH B;  5KVH A;  3UOV A;  2XFN A;  4FK1 A;  2W0H A;  3KPF A;  1L9D A;  4RSL A;  5KMS A;  2X8G A;  3B3R A;  2X8H A;  1E1M A;  4JY2 A;  2AAQ A;  2BS3 A;  4NEW A;  4OVI A;  1REO A;  4XWZ A;  3AD8 B;  5KVI A;  3UKA A;  2XLR A;  2C73 A;  2YLW A;  1S3B A;  3KVE A;  1GRH A;  4B63 A;  5U1O A;  2R0G A;  1O94 A;  3IWA A;  3SYI A;  1HYU A;  2Z5Y A;  4UDR A;  1H7W A;  1Y56 A;  2XLP A;  5J7X A;  1E39 A;  4A6N A;  2C3C A;  4OPT A;  5JCN A;  1MOK A;  1S3E A;  1ZP0 A;  1GT8 A;  3ATQ A;  1Z6L A;  4DSG A;  3S5W A;  2GRT A;  2XFP A;  1GAL A;  3ABV A;  3K30 A;  4H4P A;  3P9U A;  1ONF A;  3NKS A;  4ADW A;  3DJD A;  2GR3 A;  3BNU A;  3AE6 A;  2WBA A;  3VRB A;  4EM3 A;  5KXJ A;  1CC4 A;  2ZZ0 A;  1F8R A;  1L9C A;  2VVL A;  1VG9 A;  3DJJ A;  3P4Q A;  3VQR A;  3UP4 A;  1DOE A;  1GER A;  1PBF A;  1F8S A;  4C74 A;  4UDP A;  1GET A;  3AYJ A;  2ZBW A;  3SXI A;  3CNJ A;  4G74 A;  3NK0 X;  4RG4 A;  3T0K A;  2C75 A;  3EAO A;  3M12 A;  1AOG A;  1H82 A;  3T37 A;  2A87 A;  5C3J A;  1E1N A;  1PBC A;  2FJD A;  4B67 A;  3Q9T A;  5U25 A;  4YTN A;  1Q9I A;  2JB2 A;  5BVA A;  1H84 A;  3F8P A;  3AE5 A;  1L0V A;  4U8N A;  2GEW A;  1DJQ A;  3CGB A;  1OJT A;  4EMJ A;  4YSX A;  3NG7 X;  1YQ3 A;  2J3N A;  4TM3 A;  2X50 A;  1GTE A;  1VG0 A;  2XCG A;  4BK3 A;  4GUV A;  2APG A;  5ER0 A;  3HYW A;  2BS4 A;  1B4V A;  1GEU A;  3F8R A;  3SZW A;  2GV8 A;  4KPR A;  1F8W A;  2CVJ A;  3CNS A;  5JCM A;  4NTE A;  4M52 A;  3T2Z A;  2B9X A;  2WU2 A;  2YG3 A;  3AYI A;  2WES A;  2I0Z A;  4PAA A;  5M0Z A;  4O5U A;  4H7U A;  1YY5 A;  5EBK A;  2AR8 A;  1FEC A;  3IHG A;  1M64 A;  5KOX A;  1FOH A;  4LII A;  2CFY A;  3DGH A;  3AE4 A;  1TYT A;  2WET A;  4J31 A;  1ZMD A;  4NTD A;  1F3P A;  3QVP A;  4CCR A;  2XLS A;  3GWD A;  4U8K A;  3QSE A;  1LTX R;  3UOX A;  4X9N A;  5BRT A;  1N1P A;  4H4Z A;  3HYV A;  2CUL A;  4OPU A;  5EOW A;  1M6I A;  1CC2 A;  3AEE A;  1JOA A;  4H50 A;  1ZKQ A;  1ZMC A;  1E1L A;  4H4Y A;  4K2X A;  4A9W A;  4AT2 A;  3GYI A;  4G9K A;  2B9Y A;  2OAM A;  3DH9 A;  3VR9 A;  4CNJ A;  2XYO A;  3JSK A;  1NHP A;  1FEB A;  4JNQ A;  4CY6 A;  3SQP A;  1MO9 A;  3WE0 A;  3IHM A;  1GRB A;  1FL2 A;  1O95 A;  1UKV G;  1Q1W A;  3UKP A;  1OJD A;  1TDE A;  2XFU A;  1CBO A;  4C3X A;  2C4C A;  2BCG G;  2EQ9 A;  2Q7V A;  4GF7 A;  4OCG A;  4B69 A;  3NK1 X;  2GMJ A;  1GPE A;  4U2L A;  3AWI A;  3BI2 A;  3SGL A;  3GYJ A;  3PS9 A;  4MJW A;  4N9X A;  3AE7 A;  3KA7 A;  3RED A;  4B64 A;  2WP5 A;  2BS2 A;  3OC4 A;  4IV9 A;  4A99 A;  1EL9 A;  2VRM A;  1CC6 A;  2HQM A;  3UTH A;  1D4D A;  3H8I A;  1DOC A;  1KNP A;  2OLN A;  1ELI A;  2YG5 A;  5FS9 A;  3FBS A;  4H4S A;  2TMD A;  2Y6R A;  3DME A;  4H4U A;  4DNA A;  2RGO A;  2YLR A;  4H4T A;  3V3O A;  3UKQ A;  2E1M A;  1TYP A;  3ZYX A;  1JRX A;  4ZN0 A;  4EMW A;  2B76 A;  2JB1 A;  1D4C A;  2C70 A;  2YG4 A;  3H4K A;  4X9M A;  3FPZ A;  4ZCC A;  3SFE A;  1EL7 A;  3SM8 A;  3UOZ A;  3V3N A;  3I3L A;  1CF3 A;  2R45 A;  4LU6 A;  2WDR A;  4YT0 A;  3CTY A;  2VVL G;  5IQ1 A;  2ARD A;  5KMR A;  4USR A;  2WOW A;  3UTF A;  4GR1 A;  3T2Y A;  2V6O A;  5HYM A;  3VRA A;  4A7A A;  1CJ3 A;  3CND A;  3GDN A;  1JU2 A;  1H7X A;  1H86 A;  2F5Z A;  3K7Q X;  4AOX A;  2UZZ A;  1NG3 A;  2Q0L A;  1ZDL A;  1PXB A;  5GRT A;  2BXS A;  4WCT A;  1ZOV A;  4J34 A;  2WPE A;  2WEU A;  1QJD A;  4GAP A;  2PYX A;  1Q1R A;  2JBV A;  2V3B A;  2YVG A;  3PO7 A;  4BV6 A;  2B9W A;  1NHR A;  3ICT A;  1D7L A;  4U2S A;  1LJ1 A;  3LZX A;  2YQU A;  4C5O A;  4O5Q A;  5JCL A;  4TM1 A;  1TDN A;  2RGJ A;  2YLT A;  4NEV A;  1F6M A;  4BK1 A;  4H4V A;  5KMP A;  3AE8 A;  2C7G A;  4H2P A;  4U8O A;  3KKJ A;  1PBE A;  1LQT A;  1YKJ A;  2VQB A;  1PBB A;  3BI5 A;  5HY5 A;  2YG7 A;  4TLZ A;  3C4A A;  5KNL A;  4FDC B;  2BK3 A;  1IUS A;  2TPR A;  4I59 A;  1FCD A;  1JEH A;  4AP1 A;  1COY A;  4B1B A;  2YLZ A;  3ALM A;  2BXR A;  2BC0 A;  2H89 A;  2XDO A;  3GSI A;  1NHS A;  1JRZ A;  4EQR A;  3K7M X;  5M10 A;  5L46 A;  1XDI A;  4FX9 A;  5KRQ A;  5KWF A;  1BZL A;  1DOD A;  1GRE A;  1GRF A;  2OLO A;  2C76 A;  3DA1 A;  3LJP A;  2Q0K A;  3R9U A;  4YKF A;  3M0O A;  3T14 A;  1RP0 A;  1DOB A;  2BYB A;  3AE3 A;  4K8D A;  2CDU A;  2JK6 A;  2NPX A;  3T2K A;  4CRT A;  4YSY A;  1NEN A;  2DKI A;  4AOS A;  3IC9 A;  2YLS A;  3DK4 A;  4IA5 A;  4U8I A;  3ALJ A;  3NYF A;  4GDP A;  1NAA A;  4FK1 C;  3C96 A;  3AEF A;  3ADA B;  1BF3 A;  3II4 A;  5IPY A;  2B7R A;  2QCU A;  2X8C A;  4H4W A;  4C3Y A;  2ZZB A;  4G6G A;  2QA1 A;  4DSH A;  3SZF A;  2C72 A;  3EAN A;  4J57 A;  3GD3 A;  3G5S A;  1XHC A;  2GMH A;  3RNM A;  3NIX A;  4D03 A;  4Z26 A;  2GQW A;  2OAL A;  3AEB A;  1BWC A;  3GD4 A;  4H4X A;  4II3 A;  1GTH A;  3AE1 A;  4K22 A;  2R4E A;  4OPI A;  4YSZ A;  1S2Y A;  1BKW A;  4U8M A;  4A5L A;  1PXA A;  2WU5 A; 
#chains in the Genus database with same CATH homology
 3ITJ A;  2E5V A;  5HHF A;  4NWZ A;  4B66 A;  2GF3 A;  3NLC A;  5HXI A;  2EQ8 A;  3CGD A;  2BAB A;  1ZY8 A;  4B68 A;  4J36 A;  3SFD A;  4A6N B;  4BUR A;  1P2E A;  2C67 A;  2OA1 A;  2BK4 A;  3CGE A;  5FS8 A;  3AD7 B;  3DJG X;  4LA1 A;  4CBQ A;  2VZ2 A;  4CY8 A;  2WDV A;  4EMI A;  1TRB A;  1CL0 A;  4OPD A;  4JN9 A;  3NN6 X;  5JCI A;  3CNT A;  3EPT A;  4YTM A;  3GMB A;  2XVE A;  4X4J A;  3UTG A;  3SY4 A;  1E7P A;  3H8L A;  3DJE A;  2GAG B;  1NPX A;  4IVM B;  4G73 A;  5EB5 A;  4YXD A;  5CQF A;  1BGN A;  2YM1 A;  4JDR A;  4H2R A;  4IVO B;  5TR3 A;  3V76 A;  2YVF A;  3AE2 A;  4H4Q A;  2C64 A;  3AB1 A;  5FMH A;  3BI4 A;  2QA2 A;  4C77 A;  3NNE A;  1RYI A;  3KU9 A;  4IA6 A;  2A8X A;  4GDE A;  4A79 A;  3C4N A;  5FS6 A;  4J33 A;  1VDC A;  1PJ5 A;  2WDQ A;  3NYC A;  4J56 A;  3UTE A;  3QVR A;  3AYL A;  3UKK A;  1GND A;  4U8P A;  1GRA A;  4XXG A;  2IVD A;  2YG6 A;  2YLX A;  4E0V A;  2V3A A;  1PDH A;  5J60 A;  3GYX A;  1GES A;  1CHU A;  1DXL A;  1V59 A;  2WQY A;  3P4P A;  1ZK7 A;  2A89 A;  3NGC X;  3FIM B;  1TDO A;  3SZ0 A;  4H2N A;  1VRQ B;  2GH5 A;  4I58 A;  3UCL A;  4DGK A;  5KOW A;  2YWL A;  1PN0 A;  3AE9 A;  4ICY A;  1KFY A;  2BA9 A;  2V61 A;  3ATR A;  2PHH A;  3ICS A;  4AT0 A;  3OZ2 A;  5BUK A;  2XLT A;  3FMW A;  4CCQ A;  4EIP A;  4A65 A;  3ICR A;  2C66 A;  4TLX A;  1GRG A;  2V60 A;  4ZCD A;  1XPQ A;  1K0I A;  3M13 A;  1W4X A;  4NTC A;  3URH A;  1B5Q A;  1YQZ A;  3ALL A;  4EQW A;  3AEG A;  1X31 B;  3QSS A;  1LQU A;  1PS9 A;  2H88 A;  2WOV A;  3DK8 A;  3KPK A;  3RP7 A;  2QAE A;  4OPC A;  2VOU A;  1GV4 A;  4UDQ A;  1Y0P A;  1Y56 B;  3ZDN A;  3LZW A;  2XVJ A;  3NN0 X;  1PHH A;  2YR4 A;  3NTA A;  3B6D A;  3NRN A;  2X3N A;  1K0L A;  1YQ4 A;  4UP3 A;  1KNR A;  1JNR A;  3KLJ A;  4PAB A;  1H6V A;  5GSN A;  1ZOY A;  2JB3 A;  1IUU A;  1IJH A;  3L8K A;  2Z5X A;  1EL5 A;  1IUX A;  4Z2T A;  3LOV A;  4U8J A;  1TDK A;  2NVK X;  1L9E A;  3FG2 P;  2JAE A;  3G5R A;  3GRT A;  2XVF A;  2GVC A;  1MXT A;  4USQ A;  4GRT A;  4P9S A;  2IVE A;  3COX A;  4J2W A;  3UKH A;  3AXB A;  1LVL A;  1K4Q A;  1D5T A;  4Y4L A;  3P1W A;  4NNJ A;  4U2T A;  1BGJ A;  1KDG A;  1E6E A;  1D4E A;  2YM2 A;  3HZL A;  3I6D A;  3RP6 A;  1P2H A;  2IID A;  2BAC A;  1NEK A;  4AP3 A;  1TDF A;  2FJA A;  3PVC A;  3SZC A;  1PJ6 A;  2GB0 A;  1JRY A;  3IF9 A;  1ZX9 A;  3GWF A;  3D8X A;  2BC1 A;  4K5S A;  4HA6 A;  3QFB A;  1DJN A;  4OPG A;  2R4J A;  3VR8 A;  3EF6 A;  2BRA A;  1CJ4 A;  4Z2U A;  2BK5 A;  3RHA A;  5U63 A;  2EQ7 A;  3E1T A;  2YR6 A;  5C2T A;  1CJ2 A;  2VRL A;  1KSS A;  3NTD A;  5IQ4 A;  2WP6 A;  3T31 A;  1JNZ A;  4Y4N A;  5LV9 A;  4JQ9 A;  1QO8 A;  3LAD A;  2YVJ A;  4BJY A;  3P4R A;  3CGC A;  3CMM A;  2WPC A;  2RAB A;  3LB8 A;  4H4R A;  1OJC A;  4GAV A;  5FS7 A;  1XAN A;  3AEC A;  4CNK A;  2YR5 A;  4Y4M A;  4YSH A;  3CPI G;  4Z43 A;  2XFQ A;  1EBD A;  1OJ9 A;  2ZZC A;  4K5R A;  1QLB A;  4GCM A;  4EQS A;  5CKU A;  1EL8 A;  1O5W A;  1GOS A;  4YTP A;  3P4S A;  1K0J A;  2RGH A;  2XLU A;  4II2 A;  2GQF A;  4H2Q A;  3CIR A;  4YKG A;  1N4V A;  2WHD A;  4RG3 A;  1B8S A;  2XFO A;  3QSM A;  1H81 A;  3CN8 A;  1N4W A;  3DK9 A;  1GRT A;  2R0P A;  2VQ7 A;  2FJB A;  1PJ7 A;  4EIQ A;  1NHQ A;  3UOY A;  1NDA A;  4D04 A;  4REK A;  4Z44 A;  3G5Q A;  5DBJ A;  2VVM A;  3AED A;  4JY3 A;  4ECH A;  2WP9 A;  3UKL A;  3UP5 A;  3VRD B;  1SEZ A;  1LV0 A;  2DKH A;  4BJZ A;  4Z2R A;  3BHF A;  1OJA A;  3GRS A;  2C65 A;  3CNP A;  2R9Z A;  4EM4 A;  1E1K A;  4TM0 A;  5BUL A;  1LPF A;  3GMC A;  3BHK A;  2AQJ A;  2Y6Q A;  1DNC A;  2FJE A;  5KMQ A;  2B7S A;  2WS3 A;  3AEA A;  4XWR A;  2V5Z A;  1FEA A;  3L1R A;  4YWO A;  1GXF A;  3O0H A;  2BRY A;  1H83 A;  3QFA A;  4EQX A;  3BNM A;  3S61 A;  2FBW A;  3NT6 A;  3DGZ A;  3NHO X;  4U8L A;  3SX6 A;  4Z25 A;  4Z24 A;  2GR2 A;  3D1C A;  3ISH A;  3NYE A;  2WOI A;  4JNA A;  1IUV A;  3AD9 B;  2YAU A;  1KSU A;  2WPF A;  3LXD A;  4KX6 A;  4B65 A;  1IUW A;  2O9Z A;  2XVI A;  4HB9 A;  4OPL A;  2C3D A;  2R46 A;  1NG4 A;  2GR0 A;  3CPJ G;  4APN A;  2ACZ A;  2E4G A;  4BK2 A;  4K7Z A;  2Q6U A;  3K7T A;  2LFC A;  3CPH G;  5JCK A;  4NZH A;  1KF6 A;  1PXC A;  3RP8 A;  1B37 A;  1N4U A;  1S2Q A;  4G6H A;  3HYX A;  2GR1 A;  3F8D A;  3NH3 X;  3Q6J A;  4TM4 A;  2X99 A;  2BCP A;  3QJ4 A;  5EB4 A;  4WX1 A;  1CJC A;  3NK2 X;  1D7Y A;  3UKF A;  3GDP A;  2EQ6 A;  2XVH A;  1IUT A;  1GSN A;  1VQW A;  1PBD A;  2JKC A;  2R0C A;  3KD9 A;  1RSG A;  2GAH B;  5KVH A;  3UOV A;  2XFN A;  4FK1 A;  2W0H A;  3KPF A;  1L9D A;  4RSL A;  5KMS A;  2X8G A;  3B3R A;  2X8H A;  1E1M A;  4JY2 A;  2AAQ A;  2BS3 A;  4NEW A;  4OVI A;  1REO A;  4XWZ A;  3AD8 B;  5KVI A;  3UKA A;  2XLR A;  2C73 A;  2YLW A;  1S3B A;  3KVE A;  1GRH A;  4B63 A;  5U1O A;  2R0G A;  1O94 A;  3IWA A;  3SYI A;  1HYU A;  2Z5Y A;  4UDR A;  1H7W A;  1Y56 A;  2XLP A;  5J7X A;  1E39 A;  4A6N A;  2C3C A;  4OPT A;  5JCN A;  1MOK A;  1S3E A;  1ZP0 A;  1GT8 A;  3ATQ A;  1Z6L A;  4DSG A;  3S5W A;  2GRT A;  2XFP A;  1GAL A;  3ABV A;  3K30 A;  4H4P A;  3P9U A;  1ONF A;  3NKS A;  4ADW A;  3DJD A;  2GR3 A;  3BNU A;  3AE6 A;  2WBA A;  3VRB A;  4EM3 A;  5KXJ A;  1CC4 A;  2ZZ0 A;  1F8R A;  1L9C A;  2VVL A;  1VG9 A;  3DJJ A;  3P4Q A;  3VQR A;  3UP4 A;  1DOE A;  1GER A;  1PBF A;  1F8S A;  4C74 A;  4UDP A;  1GET A;  3AYJ A;  2ZBW A;  3SXI A;  3CNJ A;  4G74 A;  3NK0 X;  4RG4 A;  3T0K A;  2C75 A;  3EAO A;  3M12 A;  1AOG A;  1H82 A;  3T37 A;  2A87 A;  5C3J A;  1E1N A;  1PBC A;  2FJD A;  4B67 A;  3Q9T A;  5U25 A;  4YTN A;  1Q9I A;  2JB2 A;  5BVA A;  1H84 A;  3F8P A;  3AE5 A;  1L0V A;  4U8N A;  2GEW A;  1DJQ A;  3CGB A;  1OJT A;  4EMJ A;  4YSX A;  3NG7 X;  1YQ3 A;  2J3N A;  4TM3 A;  2X50 A;  1GTE A;  1VG0 A;  2XCG A;  4BK3 A;  4GUV A;  2APG A;  5ER0 A;  3HYW A;  2BS4 A;  1B4V A;  1GEU A;  3F8R A;  3SZW A;  2GV8 A;  4KPR A;  1F8W A;  2CVJ A;  3CNS A;  5JCM A;  4NTE A;  4M52 A;  3T2Z A;  2B9X A;  2WU2 A;  2YG3 A;  3AYI A;  2WES A;  2I0Z A;  4PAA A;  5M0Z A;  4O5U A;  4H7U A;  1YY5 A;  5EBK A;  2AR8 A;  1FEC A;  3IHG A;  1M64 A;  5KOX A;  1FOH A;  4LII A;  2CFY A;  3DGH A;  3AE4 A;  1TYT A;  2WET A;  4J31 A;  1ZMD A;  4NTD A;  1F3P A;  3QVP A;  4CCR A;  2XLS A;  3GWD A;  4U8K A;  3QSE A;  1LTX R;  3UOX A;  4X9N A;  5BRT A;  1N1P A;  4H4Z A;  3HYV A;  2CUL A;  4OPU A;  5EOW A;  1M6I A;  1CC2 A;  3AEE A;  1JOA A;  4H50 A;  1ZKQ A;  1ZMC A;  1E1L A;  4H4Y A;  4K2X A;  4A9W A;  4AT2 A;  3GYI A;  4G9K A;  2B9Y A;  2OAM A;  3DH9 A;  3VR9 A;  4CNJ A;  2XYO A;  3JSK A;  1NHP A;  1FEB A;  4JNQ A;  4CY6 A;  3SQP A;  1MO9 A;  3WE0 A;  3IHM A;  1GRB A;  1FL2 A;  1O95 A;  1UKV G;  1Q1W A;  3UKP A;  1OJD A;  1TDE A;  2XFU A;  1CBO A;  4C3X A;  2C4C A;  2BCG G;  2EQ9 A;  2Q7V A;  4GF7 A;  4OCG A;  4B69 A;  3NK1 X;  2GMJ A;  1GPE A;  4U2L A;  3AWI A;  3BI2 A;  3SGL A;  3GYJ A;  3PS9 A;  4MJW A;  4N9X A;  3AE7 A;  3KA7 A;  3RED A;  4B64 A;  2WP5 A;  2BS2 A;  3OC4 A;  4IV9 A;  4A99 A;  1EL9 A;  2VRM A;  1CC6 A;  2HQM A;  3UTH A;  1D4D A;  3H8I A;  1DOC A;  1KNP A;  2OLN A;  1ELI A;  2YG5 A;  5FS9 A;  3FBS A;  4H4S A;  2TMD A;  2Y6R A;  3DME A;  4H4U A;  4DNA A;  2RGO A;  2YLR A;  4H4T A;  3V3O A;  3UKQ A;  2E1M A;  1TYP A;  3ZYX A;  1JRX A;  4ZN0 A;  4EMW A;  2B76 A;  2JB1 A;  1D4C A;  2C70 A;  2YG4 A;  3H4K A;  4X9M A;  3FPZ A;  4ZCC A;  3SFE A;  1EL7 A;  3SM8 A;  3UOZ A;  3V3N A;  3I3L A;  1CF3 A;  2R45 A;  4LU6 A;  2WDR A;  4YT0 A;  3CTY A;  2VVL G;  5IQ1 A;  2ARD A;  5KMR A;  4USR A;  2WOW A;  3UTF A;  4GR1 A;  3T2Y A;  2V6O A;  5HYM A;  3VRA A;  4A7A A;  1CJ3 A;  3CND A;  3GDN A;  1JU2 A;  1H7X A;  1H86 A;  2F5Z A;  3K7Q X;  4AOX A;  2UZZ A;  1NG3 A;  2Q0L A;  1ZDL A;  1PXB A;  5GRT A;  2BXS A;  4WCT A;  1ZOV A;  4J34 A;  2WPE A;  2WEU A;  1QJD A;  4GAP A;  2PYX A;  1Q1R A;  2JBV A;  2V3B A;  2YVG A;  3PO7 A;  4BV6 A;  2B9W A;  1NHR A;  3ICT A;  1D7L A;  4U2S A;  1LJ1 A;  3LZX A;  2YQU A;  4C5O A;  4O5Q A;  5JCL A;  4TM1 A;  1TDN A;  2RGJ A;  2YLT A;  4NEV A;  1F6M A;  4BK1 A;  4H4V A;  5KMP A;  3AE8 A;  2C7G A;  4H2P A;  4U8O A;  3KKJ A;  1PBE A;  1LQT A;  1YKJ A;  2VQB A;  1PBB A;  3BI5 A;  5HY5 A;  2YG7 A;  4TLZ A;  3C4A A;  5KNL A;  4FDC B;  2BK3 A;  1IUS A;  2TPR A;  4I59 A;  1FCD A;  1JEH A;  4AP1 A;  1COY A;  4B1B A;  2YLZ A;  3ALM A;  2BXR A;  2BC0 A;  2H89 A;  2XDO A;  3GSI A;  1NHS A;  1JRZ A;  4EQR A;  3K7M X;  5M10 A;  5L46 A;  1XDI A;  4FX9 A;  5KRQ A;  5KWF A;  1BZL A;  1DOD A;  1GRE A;  1GRF A;  2OLO A;  2C76 A;  3DA1 A;  3LJP A;  2Q0K A;  3R9U A;  4YKF A;  3M0O A;  3T14 A;  1RP0 A;  1DOB A;  2BYB A;  3AE3 A;  4K8D A;  2CDU A;  2JK6 A;  2NPX A;  3T2K A;  4CRT A;  4YSY A;  1NEN A;  2DKI A;  4AOS A;  3IC9 A;  2YLS A;  3DK4 A;  4IA5 A;  4U8I A;  3ALJ A;  3NYF A;  4GDP A;  1NAA A;  4FK1 C;  3C96 A;  3AEF A;  3ADA B;  1BF3 A;  3II4 A;  5IPY A;  2B7R A;  2QCU A;  2X8C A;  4H4W A;  4C3Y A;  2ZZB A;  4G6G A;  2QA1 A;  4DSH A;  3SZF A;  2C72 A;  3EAN A;  4J57 A;  3GD3 A;  3G5S A;  1XHC A;  2GMH A;  3RNM A;  3NIX A;  4D03 A;  4Z26 A;  2GQW A;  2OAL A;  3AEB A;  1BWC A;  3GD4 A;  4H4X A;  4II3 A;  1GTH A;  3AE1 A;  4K22 A;  2R4E A;  4OPI A;  4YSZ A;  1S2Y A;  1BKW A;  4U8M A;  4A5L A;  1PXA A;  2WU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...