4YTMA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 206
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytmA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytmA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytmA04
2B9YA 1E6EA 2A89A 2GB0A 5EBKA 3UOXA 2C7GA 3ATQA 4IVOB 1KDGA 1W4XA 2XLRA 1OJTA 3NYCA 1NG4A 1N4WA 4GR1A 4LA1A 3NG7X 3V76A 3GD3A 1MXTA 3UKHA 1Y56A 2VZ2A 3VR9A 3AB1A 2AQJA 4EQRA 1B37A 2GF3A 5U1OA 1CC2A 2IIDA 1PBCA 1KSSA 5BUKA 1NHSA 1GXFA 4BK1A 2V5ZA 1D7LA 1PJ7A 1XHCA 2GR1A 2BYBA 2I0ZA 2XYOA 5EB4A 2YG5A 3UKKA 4Z43A 3OZ2A 3P9UA 4YWOA 1GV4A 4GDEA 3NHOX 1CL0A 1ZKQA 4YSZA 1QJDA 2J3NA 1OJ9A 2BK4A 1CC4A 3GMBA 1TDOA 4GDPA 3K7QX 3URHA 1GRTA 2JAEA 4EQXA 4U8OA 5KXJA 3VR8A 3AEFA 3DMEA 2R9ZA 1DOEA 1GRBA 3AE2A 3PVCA 4OPUA 5HXIA 4YKGA 3ADAB 4P9SA 1AOGA 4JY2A 1E1LA 1FEBA 2BK3A 4GF7A 1DXLA 3DH9A 4KX6A 1H83A 3T37A 2V6OA 3DJEA 3LB8A 1CJCA 3NN0X 1Y0PA 3AD9B 4H4UA 2BXSA 2XVHA 2BACA 2RABA 3C96A 2BC1A 3ALMA 2PYXA 1GESA 2GR3A 4C5OA 2WDQA 4B65A 3NK2X 2PHHA 3AE3A 2NPXA 3AE8A 3P4QA 1B8SA 1GPEA 1O94A 3BHKA 3IHGA 1D5TA 3DK4A 2VQBA 3Q9TA 1LVLA 2TMDA 4H4ZA 3UKAA 1B4VA 2Y6QA 4YKFA 4CRTA 2X8HA 2XLTA 1P2HA 3O0HA 1GNDA 4BJZA 2DKHA 4TM4A 3KU9A 2JB2A 2CFYA 1TDKA 2XLPA 4BK2A 2FJBA 5JCLA 1NHPA 2WP6A 4X4JA 3SFDA 2WPCA 3CPHG 4K5SA 3S61A 2YG3A 2RGJA 3L1RA 4EMIA 3GWDA 3K30A 3GRSA 1JNZA 3CGBA 4Z2RA 1JEHA 5TR3A 2A8XA 3NKSA 2GR0A 2R45A 2AAQA 4EQSA 1GTEA 3VRDB 2YM2A 3DK8A 3AEGA 5IQ4A 4YTPA 1TDFA 2O9ZA 2V61A 2GMHA 3NYFA 5KOXA 3LZXA 4J56A 4FK1C 2YG7A 1M64A 4U8JA 1NHRA 3CNDA 1Z6LA 4H4RA 4A7AA 3AD8B 4IV9A 3UTFA 2BCGG 4U8LA 5FS8A 1S2YA 1ZP0A 2DKIA 1XDIA 4OPTA 2VQ7A 4OPLA 2CULA 2X50A 2YG4A 1N1PA 2GEWA 3AD7B 4KPRA 3GYIA 2FJAA 4B68A 2QA1A 5FS6A 3NN6X 2WPEA 1NHQA 1N4UA 2VRMA 3AWIA 3CTYA 4MJWA 4EIPA 1IUTA 4HB9A 4C3YA 3AYLA 1JU2A 2YLXA 4EM4A 1D4DA 2VVLG 2WBAA 2Q0LA 2ZZCA 2OLOA 2WOVA 2WESA 3SM8A 4J33A 4XXGA 1HYUA 1LTXR 3BI2A 2TPRA 1H7XA 2GVCA 1PHHA 2XVFA 4FDCB 4ZCCA 5CKUA 4K5RA 4BV6A 4UDQA 1E1KA 4OPIA 1IUSA 1ZK7A 1FEAA 3CPJG 4NEVA 2YG6A 2IVDA 3RP8A 1D7YA 5EB5A 1ZOYA 3ZYXA 1ZX9A 3UKQA 3FPZA 3QFBA 1GRHA 2FBWA 4USRA 5DBJA 4DSHA 1NPXA 2B9XA 2Z5XA 2BS4A 3QVPA 1IUUA 1OJDA 2UZZA 4H4WA 4CNJA 4K8DA 1SEZA 1CJ2A 2C73A 4B63A 1LQTA 1PJ5A 1KNRA 2QCUA 1GSNA 4B64A 1K0JA 4AT2A 2WP9A 1Y56B 4TM1A 2NVKX 3EF6A 1GT8A 5FS9A 1H86A 3QVRA 1D4EA 3R9UA 4BJYA 4D04A 5L46A 3ISHA 5FS7A 4I58A 4JN9A 3CNPA 5HY5A 1KNPA 1IUWA 3ALJA 1F8RA 4K2XA 4H4SA 2X99A 1COYA 2GRTA 3QFAA 3QSEA 1FOHA 4H2NA 4OCGA 2C3DA 1DODA 3RHAA 1YKJA 1D4CA 4WX1A 3UKLA 4BURA 2YLWA 3DA1A 4K22A 3P4SA 2LFCA 3K7TA 3UTHA 3GQHA 1EL9A 3SFEA 4D03A 2E5VA 1YY5A 2GQWA 1DJNA 4RG3A 1F8WA 1GEUA 4U2SA 1E39A 1X31B 1VG9A 3BNUA 3UCLA 1F6MA 4NEWA 1S3EA 1O5WA 4Z2UA 2X8GA 4IA5A 2Q6UA 5BVAA 3VRBA 4H4VA 1PS9A 3DGZA 2WU5A 2R0PA 3F8RA 1NENA 1DOCA 1Q1WA 2HQMA 4GCMA 3D8XA 4TLZA 3RP6A 4OPDA 3I3LA 1GRFA 2Z5YA 1LV0A 3G5RA 4H7UA 1REOA 2IVEA 1TRBA 3ITJA 2XVJA 1E1MA 4UP3A 2R4JA 3NK0X 3E1TA 4NTCA 2XVEA 3AE6A 3DJDA 3GDNA 3M12A 3P4PA 2GAHB 3JSKA 4U8PA 1B5QA 4WCTA 2XFUA 4AP3A 4LU6A 5C3JA 4YSYA 1OJAA 3CGCA 4A6NA 4Z24A 4GRTA 5KVIA 4YXDA 4H4YA 2OA1A 1PJ6A 3REDA 4Z25A 1H81A 1IUVA 4C3XA 4EIQA 2C75A 4EMJA 1RYIA 4AOXA 2ZBWA 2C66A 2EQ8A 1JRZA 3C4NA 3LJPA 2EQ9A 3UOYA 1ZOVA 4BK3A 2WDRA 4B66A 5J7XA 3S5WA 1ZMDA 1P2EA 3CPIG 3LADA 1ZDLA 2Q0KA 1TYPA 1K0IA 1NEKA 1FECA 2VRLA 1EL8A 3LOVA 4AT0A 1MO9A 4H4QA 1Q9IA 4JNAA 4CY6A 3EAOA 3BNMA 4YTMA 3F8DA 3BI4A 4Y4MA 3GD4A 1BF3A 4J2WA 4APNA 3K7MX 2R0GA 2RGOA 3G5QA 1H6VA 3BI5A 1F3PA 3AE9A 1CJ3A 1S3BA 3QSMA 3ZDNA 1TDEA 4XWZA 1DOBA 4RG4A 1PXCA 3GMCA 2WOWA 1BGNA 3ICTA 2YR4A 4H50A 4JDRA 2GQFA 2E4GA 2C64A 3CNTA 3NTDA 4Z44A 4H2RA 1TYTA 3VRAA 2OAMA 1BKWA 2XFOA 3CGDA 4Y4NA 2WEUA 4USQA 4AOSA 4A99A 3SUCA 2AR8A 4K7ZA 2VVMA 3ABVA 3H4KA 2YWLA 2YLTA 3GSIA 4J57A 3P4RA 3C4AA 3CIRA 1L9DA 4YT0A 1NAAA 2BCPA 2CVJA 5EOWA 2EQ6A 1GREA 3FG2P 2CDUA 2BABA 3P1WA 5IQ1A 1S2QA 2B7RA 4XWRA 3Q6JA 4TM3A 5U25A 3AE5A 1GALA 1OJCA 2YQUA 3FMWA 4U2TA 5KVHA 2C76A 1TDNA 2ZZ0A 2A87A 2B7SA 4U8MA 1FCDA 1BWCA 1PBBA 2B76A 2GR2A 4A65A 5JCNA 1ONFA 2YLSA 4ZCDA 2FJDA 1KSUA 2WU2A 3NIXA 4EMWA 1ELIA 5JCKA 1EBDA 2WPFA 1MOKA 4UDPA 1KF6A 3VQRA 4REKA 4CBQA 4NTDA 2C70A 1V59A 4X9NA 3UP4A 3NTAA 1F8SA 1VG0A 2ZZBA 3SQPA 3CNSA 4Z26A 4NZHA 4C77A 3NGCX 5LV9A 3DGHA 1RSGA 4H4XA 5CQFA 3AE7A 5IPYA 2WQYA 4LIIA 5HHFA 1PBEA 1KFYA 2V60A 2YLRA 4B1BA 3CNJA 4U8NA 2JKCA 4U8KA 3RP7A 4J34A 4DNAA 1VQWA 2R0CA 2B9WA 1L9EA 3AYIA 3UTEA 2X8CA 3PS9A 4ICYA 4RSLA 4YSHA 3M0OA 4TLXA 5JCIA 3AE1A 4Z2TA 1GOSA 1CC6A 4J36A 2R4EA 1Q1RA 3RNMA 1E7PA 2YVGA 4DSGA 5J60A 2OALA 3KPFA 4PAAA 3SGLA 3DJJA 2WP5A 4FK1A 1DJQA 2APGA 2XVIA 3H8IA 3COXA 1CBOA 3NLCA 4YTNA 1GERA 3AEEA 1DNCA 1L0VA 5JCMA 1JNRA 2C72A 3NNEA 3KA7A 2JB3A 4H4TA 3BHFA 4NTEA 3M13A 1LJ1A 1K0LA 1JOAA 1ZY8A 2WS3A 1K4QA 2GMJA 2XFPA 4H2QA 2VVLA 5GSNA 2XLSA 2XFQA 1PBFA 2QA2A 3KVEA 2W0HA 2X3NA 3NT6A 1JRYA 4O5UA 3EANA 3H8LA 1PBDA 5U63A 2YM1A 3LZWA 4A6NB 1FL2A 2Q7VA 2R46A 4C74A 3GQKA 1IUXA 4PABA 2WDVA 3II4A 1EL7A 4ECHA 1CHUA 2C65A 1E1NA 1GETA 5BULA 1H84A 2EQ7A 3CN8A 4CCQA 3L8KA 1PN0A 1VRQB 4B69A 3G5SA 4U8IA 1YQZA 2XLUA 4IA6A 4AP1A 5KWFA 4TM0A 2BK5A 1LPFA 3D1CA 3QSSA 4A9WA 2E1MA 5HYMA 1JRXA 3AEBA 1NG3A 3B6DA 5C2TA 1UKVG 5M0ZA 4M52A 1GRAA 3UOZA 3NYEA 5M10A 2BXRA 2C67A 3FIMB 3GWFA 2XDOA 3PO7A 4GUVA 3ICSA 3GDPA 2JBVA 2RGHA 1EL5A 3IWAA 3NRNA 2H89A 4OPGA 3UKPA 5BRTA 4U2LA 4EM3A 2WHDA 4H4PA 2C3CA 1GRGA 4FX9A 4UDRA 3B3RA 3ALLA 1IJHA 2F5ZA 1YQ3A 4ADWA 3AXBA 4I59A 4JQ9A 1RP0A 3I6DA 2ARDA 4OVIA 2YVFA 5FMHA 4JNQA 4EQWA 2BC0A 2WOIA 4HA6A 2YVJA 3AE4A 2Y6RA 2YR6A 3GRTA 1LQUA 2JK6A 5ER0A 1M6IA 3ATRA 3FBSA 3IHMA 3UKFA 4J31A 4OPCA 3NH3X 4YSXA 3AEDA 3F8PA 2BA9A 4O5QA 2FJEA 3HZLA 4CY8A 2GAGB 1H82A 1QLBA 1O95A 4A5LA 3AEAA 3WE0A 2BS3A 2VOUA 1NDAA 4A79A 3CGEA 5KRQA 1PXBA 1BGJA 4H2PA 4JY3A 3GYXA 2YAUA 3V3NA 1YQ4A 2YR5A 3UOVA 2H88A 3NK1X 3AECA 2JB1A 3AYJA 3LXDA 1XANA 1CJ4A 4IVMB 4X9MA 3GYJA 2BS2A 5GRTA 3V3OA 2ACZA 3IC9A 1PDHA 1GTHA 2XFNA 2YLZA 1BZLA 1VDCA 2GV8A 3IF9A 4Y4LA 4CCRA 4ZN0A 4DGKA 3KD9A 2GH5A 1H7WA 1L9CA 2OLNA 1PXAA 1QO8A 2XCGA 3EPTA 3OC4A 3DK9A 4CNKA 3ICRA 3QJ4A 4E0VA 4B67A 2V3AA 3KKJA 1ZMCA 5KOWA 1CF3A 1XPQA 2V3BA 3UP5A 3UTGA 3DJGX 1N4VA 2QAEA 2WETA 4N9XA 3KLJA
chains in the Genus database with same CATH superfamily
3LK42 1W0BA 2D0UA 2GB0A 5EBKA 4YLHA 2XQ6A 4IVOB 3UUXB 3RIUC 1NG4A 3V76A 1MXTA 4HTEA 1OWAA 1Y56A 2X51A 1OEDB 1YKHB 3M3ZB 3VR9A 1B37A 2AQJA 3R84B 1WYCA 1RUD4 5U1OA 1CC2A 1T98A 1PBCA 2SPCA 1NHSA 2D9DA 3N2GE 3RYHE 3E22E 4A5XA 5EB4A 2YG5A 1Z7S4 3K3QC 1XZYA 3RIFA 5FL0A 2CM0A 3NHOX 4GDEA 1OXZA 4U33A 4NNJA 2A72A 1OJ9A 2BK4A 4ANJA 3GMBA 2XQ3A 3CK6A 4GDPA 3K7QX 2XAJB 1MNEA 3EABA 4EQXA 3DMEA 5L3GB 3AE2A 4EYUA 2YDRA 3H3MA 2XPKA 1ASJ4 1HG2A 2BK3A 2BG9A 5H6RB 1DU2A 4KX6A 1H83A 5L3EB 5JDQA 1VCTA 3AD9B 2PYLA 4H4UA 2BXSA 2XVHA 5AQOB 4I43B 3C96A 2BC1A 3NWIA 2HWC4 5AQQB 2MBGA 4P09A 5FY7A 1HR0T 4C5OA 2WDQA 2A2FX 2LKGA 2C5IT 1GPEA 4U2YA 3BHKA 3NZPA 1D5TA 1LVLA 2UXXB 1B4VA 4YKFA 4H63V 1GNDA 3PJAA 4KUMB 4I50E 5AQFB 1Z0PA 2WPCA 5EK2A 4K5SA 2YG3A 4EMIA 3GRSA 3RC8A 1XMQT 1JNZA 4U31A 2DI4A 2NP9A 3Q5EA 4CI3B 4WZXA 2GR0A 3UUNA 2PFVA 2YM2A 5IQ4A 3FZKB 4YTPA 2IUBA 1NHRA 4TV8E 4A7AA 3AD8B 3UTFA 2BCGG 1FMWA 2DKIA 5IUXA 4QKNA 4DMWA 5JTGA 1KK7A 2VL0A 1XDIA 1HS7A 2VQ7A 1PVC4 3ZMVB 4GKKT 2YG4A 2GEWA 3AD7B 4KPRA 2BBHA 3NN6X 1XNQT 4HB9A 3UTKA 1D4DA 2VVLG 5HEOA 5HEHA 4LFBT 2WZHA 3OKQA 3ZSTA 3P4WA 4MBQA 2XVFA 1YD8G 5CKUA 4K5RA 1BEV4 5F5WA 1E1KA 1IUSA 2BG9C 1COV4 1ZK7A 1FEAA 3CPJG 4NEVA 2PLV4 1PO24 1WFDA 1I94T 3P7IA 3UKQA 3B5MA 3FPZA 3ZT7A 4DSHA 2QYWA 5DBJA 4IE7A 1IUUA 2UZZA 4KBMB 4MLKA 2XAQB 1S94A 3B13A 3AAEB 3FZHB 2QCUA 4UIGA 5AQJB 2BKOA 3SXIA 2JJ9A 4LF6T 2NVKX 1GT8A 3KVBA 3QVRA 3BK9A 3J9X1 5L46A 2JMKA 2JMHA 2LHRA 3LK2B 3NRYA 1KNPA 5HY5A 1HG5A 3SOLA 4K2XA 2X99A 3RHAA 5LP6E 2PTFA 2C3DA 4MFRA 5DQWA 2YLWA 2XQ4A 4ZI2C 5HXHA 3N2KE 2E5VA 1YY5A 1DJNA 4RG3A 3QC9A 3JD74 3ZJ1A 2HPLA 1VG9A 4ZEYA 4HKAA 4Z2UA 4IA5A 3VRBA 3RYFE 4JI8T 2CE7A 4TLZA 5LBQB 2Z5YA 5FL1A 1TRBA 4GK0E 4ADZA 3DJDA 3AE6A 2GAHB 4LU6A 2DHRA 4A6NA 4WNKA 3ZEFB 4H4YA 4ZS3A 5LGTB 4Z25A 4EIQA 5TAOA 2UUBT 3ONXA 3UOYA 4BA9A 1JRZA 4BK3A 4CQIA 5JDHA 1BR4A 3C4XA 5KX5E 1P2EA 4DR2T 3QNUA 4JUYA 3LOVA 1EV14 5J2UE 3PUGA 4QXHB 1QSDA 5EK3A 1ZHCA 4YTMA 2E2AA 4IDZA 3SZWA 4UELA 3CX6B 5ABGA 3PUAA 2ACXA 5FXXA 2R0GA 2RGOA 3G5QA 1ZKEA 3AE9A 4UVBB 4F6RC 2XQYA 4IL9A 2WOWA 4ISTA 4NIQA 4O2AE 2ODUA 3I0QA 3E0ZA 3QK6A 1TYTA 3VRAA 2XAGB 4AOSA 4QH1A 5AQKB 2BVMA 2JQHA 5ABFB 2YLTA 3GSIA 4J57A 1L9DA 3OBVE 2QA7A 2BCPA 5JH7E 2CVJA 5FXWA 1US7B 3HKDE 5FYMA 4DUZT 4XWRA 1GALA 1UUSA 5KVHA 1YKEB 3AB3B 3T2ZA 1IZNB 5KMQA 2B76A 5AQTB 4A65A 2Q9QA 3A7MA 1ONFA 1Y01A 3PUZF 2FJDA 5JCKA 2V6YB 1KF6A 3VQRA 3IF8B 3UP4A 3NTAA 3CNSA 2F4VT 2MTQA 1WCRA 3U3IA 1RSGA 4PJLA 1PBEA 4A56A 2YLRA 1X9BA 2K9AA 3M65A 4U8NA 3RP7A 4IHJE 4DNAA 2R0CA 3NZQA 2KWHA 2BZBA 2H7OA 2X8CA 3PS9A 4YSHA 3M0OA 4TLXA 3K1SA 4IE0A 4Z2TA 4IDQA 3C4ZA 2XSBA 2CBIA 5HAXA 2K5BB 1PIV4 3OYZA 5J60A 2OALA 3DJJA 1UX4A 2CA5A 4FK1A 2APGA 4UV8B 4EZ4A 1DNCA 5L3DB 2C72A 2ZM2A 3KA7A 3UU4A 3HYXA 1D4M4 2V26A 2WS3A 1ZY8A 4H2QA 2VVLA 3H8LA 3RYCE 2YM1A 3LZWA 3GQKA 3AVRA 3II4A 2C65A 1GETA 4N78D 2DNXA 3ZMSB 1PN0A 3GN5A 3CVRA 3G5SA 3HYWA 2MPKA 5KWFA 1JRXA 4CN1A 4AKRB 1H8TD 1UKVG 5KMRA 3D0TA 4LF7T 5FXVA 2WWVA 2PBIA 4AIUA 3FXEB 3KVAA 2UXDT 3RIAA 2D5UA 2E9XA 1R094 2RS54 3KFWX 5FP3A 3RQWA 2A9UA 1MQTD 4HE8A 1RMU4 3MA9A 1IJHA 2LLYA 3SX6A 3AXBA 4JQ9A 1RP0A 3N5LA 1W09A 4HFIA 3UU5A 4EQWA 2WOIA 2N2NA 3VHLA 5ABEA 1J1JA 3AXJA 5ER0A 3ATRA 3IHMA 5F8PA 3NH3X 3IA3A 2KWIB 1G73A 2PG8A 2DL1A 1KEYA 2XQ9A 4P0AA 2GAGB 3SZ0A 2NW8A 1NDAA 4A79A 2R064 5KRQA 3IEEA 2YAUA 4U2ZA 3UOVA 2JB1A 3AYJA 1XANA 4B3ST 4IVMB 2BS2A 4ZI3C 5GRTA 3CX7B 3V3OA 2B1EA 3ZT6A 4ZN0A 2GV8A 3I9YA 4X1YE 2IDOB 1H7WA 3RPUA 1PXAA 3EPTA 4BJMA 1X79A 2Q9QD 4HWDA 2V3BA 3UTGA 3ETUA 1N4VA 3KLJA 4RHV4 3I9WA 1E6EA 3RQUA 3UOXA 2C7GA 1KDGA 2XLRA 3K8PC 1OJTA 2KMFA 1N4WA 2LSIA 3A5XA 4FJOA 3AB1A 3PUQA 2E5LT 5HXEA 5AFUL 2E9XC 2IIDA 1KSSA 4ZZBA 3JAFA 3SYIA 2RMU4 1D7LA 3FBLA 1MMDA 3HI2A 2I0ZA 2XYOA 3UKKA 1GV4A 1CL0A 1QJDA 2OV9A 4K0KT 4DUYT 4UF0A 4U7IA 2KSRA 3ZN1B 1GRTA 5KXJA 5HYAA 5HXIA 3PVCA 2WBLA 1MMGA 2IHR1 3ADAB 4P9SA 4JY2A 3HA4A 2LM9A 2RPAA 5CA0E 5M4YA 3T37A 1CJCA 3NN0X 4XAXB 4TUYE 4TZ4C 2RABA 4V1Av 2PYXA 4I4TE 3RX6A 2VB6A 1HRI4 1UCUA 3AE8A 3P4QA 1O94A 5C8YE 4P1NA 2TMDA 5EK4A 2Y8DA 4CRTA 4QX8B 2DKHA 2LT3A 5LGUB 1NHPA 1KNZA 2WP6A 4GAPA 2XJ7A 4X4JA 2JIWA 2HPJA 3CPHG 1SE7A 2V1DB 3S61A 3V5SA 3L1RA 3GWDA 3KBUA 1T7SA 3CGBA 3JC6D 3NKSA 5LG3A 3FXDB 2VK9A 3AEGA 1TDFA 4AISA 3NYFA 3LZXA 4J56A 2N1GA 2CWOA 3CPZA 1M64A 4U8JA 4AKHA 2C4CA 3CNDA 3EI0A 1Z6LA 4H4RA 4KI0F 2V5DA 4QXBB 1ZP0A 2H7VC 2VKJA 4OPTA 2X50A 3EAMA 1N1PA 1FMVA 3GYIA 2FJAA 5IYZE 3AWIA 4MJWA 1IUTA 2EHOA 4C3YA 1O3XA 4IE4A 4MALA 2WBAA 2ZZCA 1W9RA 4TN7B 3S4UA 2WESA 3SM8A 4JI6T 2BKPA 4XXGA 3MZKB 1LTXR 3BI2A 4JI2T 1HNZT 4CI1B 2X9HA 4UDQA 1D1BA 2YK0A 3L09A 1D7YA 5EB5A 3ZYXA 3QFBA 2LRLA 1MMAA 2B9XA 3WAKA 2Z5XA 2L9QA 4YFSA 1J5WA 4K8DA 4B63A 3FB2A 1LQTA 3MACA 1PJ5A 1GSNA 4B64A 1K0JA 4AT2A 2WP9A 2VKDA 1Y56B 4H9SE 1H86A 3R9UA 3ISHA 5FXZA 3CMMA 5JRCB 1VBC4 4HWHA 4AKGA 1F8RA 1G8XA 2NTYA 1COYA 3SS1A 4QH5A 1FOHA 4H2NA 4OCGA 4LF5T 1D4CA 3DA1A 4K22A 3P4SA 4G73A 3GQHA 1EL9A 4GB34 3SFEA 3ZYKA 1K5MD 2GQWA 1D1CA 1GEUA 2LE8A 2XM2A 4U2SA 4WW0A 3ZMUB 1OEDA 3UCLA 1F6MA 5HXRA 5HXSA 1RVF4 2BG9B 3GA8A 4H4VA 3DGZA 3ZMZB 3F8RA 2BBJA 1NENA 3U78A 4GCMA 2A3DA 3D8XA 2KLQA 2WY2A 3G5RA 1LV0A 3C50A 4HFDA 4O4IE 3C4WA 3ITJA 2UU9T 3J8F4 3VU7H 1T72A 2XVEA 4WCTA 3P4PA 3JSKA 1ZV4X 1B5QA 4AP3A 4H9NC 4DMVA 4YSYA 1OJAA 4LF9T 3CGCA 4JEUB 4GRTA 3EVYA 2XQ8A 2CXLA 3REDA 4C3XA 1RYIA 2C66A 4AQYT 3S5WA 2V8SV 5J0ZA 3LADA 2BDEA 1ZDLA 2UUCT 1NEKA 1FECA 2X9XA 1MO9A 3V5UA 3UFEA 3ESLA 5DQVA 4Y4MA 3Q5DA 2W61A 5LCYA 2J62A 3TLSA 4APNA 2Y48B 1CJ3A 4EYYR 3QSMA 3ZDNA 1TDEA 1RUJ4 4XWZA 4RG4A 5HCMA 1D0XA 4H50A 4ASKA 1XMOT 1IAPA 3DJBA 2E4GA 4Z44A 3QB5A 1BKWA 2FUPA 3N9LA 2XFOA 3PDYA 4Y4NA 4HFBA 2AR8A 4IDNA 4MHCA 4XZCA 2X5ID 3C4AA 1MIYA 4YT0A 5L4HA 3PV0F 5EOWA 1GQEA 1GREA 2LOSA 4KP3C 2CDUA 2BABA 5IQ1A 1S2QA 2YQUA 1RUF4 2G0UA 2ZZ0A 2BKNA 2EHOD 2R044 4KMCA 2B7SA 2OLTA 1BWCA 2GR2A 3R6NA 1N32T 2YINA 4TWHA 3NIXA 2CLYC 4EMWA 2WPFA 3RI5A 5JDNA 2C70A 4C77A 1F8SA 3SQPA 5LV9A 3DGHA 4G6GA 4H4XA 1PO14 3AE7A 3CQCB 4XBFB 1UK5A 1KFYA 4Q4V4 2J47A 3BQIA 2JQKA 2JKCA 4J34A 3N9NA 2RS14 3UTEA 4Q4W4 1IBKT 5F3JA 1VCSA 4RSLA 5JCIA 2L3LA 3AE1A 4EIWA 1SHZC 4J2CA 4NXNT 1GOSA 4DVDA 1Q1RA 4H9QC 2VQET 3UULA 3RF1A 4JLEA 4PAAA 4PNIA 2ODVA 5DJQC 4K0UA 3C98B 5KMGP 3COXA 2NTXA 2X0HA 3ZCIA 1GERA 1JNRA 4DV6T 5E0OA 2JB3A 4H4TA 3BHFA 4O4HE 3N2OA 2GMJA 1POV0 2XFPA 5GSNA 2XLSA 4G2AA 2W0HA 2X3NA 1JRYA 1RHI4 3EANA 4UVCB 3LG7A 1PBDA 3FZFB 2CHOA 4A6NB 4C74A 4AQGA 3UFGA 3ZC0A 4PABA 4NPPA 1CHUA 2N9DA 4ZS2A 5LOVE 1E1NA 1RUI4 4CCQA 2RM24 3L8KA 4A98A 1VRQB 4B69A 5LA6E 3ZN0B 1WR0A 4TM0A 1LVKA 2BK5A 2WZIA 1LPFA 1U4QA 3D1CA 2C0SA 1NG3A 5C2TA 4M52A 4TV9E 4IE6A 2BXRA 3GWFA 3SWHA 2XDOA 2JBVA 2RGHA 1T8BA 3N9MA 3IWAA 2V7MA 4JBWF 1UX5A 5BRTA 4U2LA 5AQIB 4EM3A 2WHDA 4PW8A 4H4PA 5JR9B 4FX9A 3B3RA 3ALLA 4ZHQE 1YQ3A 3B57A 3SZCA 4F8HA 2YVFA 4DV5T 4JNQA 4HA6A 1HNWT 4ILAA 4JEHB 2KZ7B 3PU3A 5H6QB 2VQFT 3UKFA 4L5GA 3EUHA 3AEDA 3F8PA 1RUH4 4DBRA 4AI6A 5FY0A 4CY8A 1H82A 1O95A 4AKIA 3AEAA 4UEMA 1N33T 2BS3A 2VOUA 4DNDA 4B3RT 3GMIA 4H2PA 1YQ4A 5DABA 2H88A 3NK1X 1R8IA 4PAGA 3CQGB 2D0TA 3F57A 5ABFA 2XY8B 2BRYA 4DR3T 1LRZA 2X66A 1PDHA 1GTHA 2YLZA 1BZLA 1IBLT 4DGKA 4JI1T 3PUVF 4E7ZA 4CNKA 3DK9A 3ICRA 5KOWA 3HYVA 1CF3A 1XPQA 2W00A 3KV6A 4OFZA 2CPTA 3ONLC 2K24A 2WETA 3O1JA 4N9XA 3I1AA 3CWZB 2B9YA 3PUYF 1W4XA 3NYCA 2V6YA 4DV2T 4GR1A 3RKOA 4LA1A 3GD3A 1IJ6A 3UKHA 2WB5A 2VZ2A 4EQRA 4LMKA 5BUKA 4QWNB 5LB7B 2BRAA 4BK1A 2CRBA 1XHCA 1M7KA 2GR1A 3EHZA 4Z43A 3ANWB 3P9UA 1J5ET 4YSZA 2J3NA 1TDOA 4X65T 2VVNA 3URHA 4DR4T 4U8OA 2R9ZA 1DOEA 4OPUA 4YKGA 3HKEE 2XQ5A 1AOGA 4QHOA 3RKGA 4OHFA 3IHRA 2ZM8A 2DCFA 1DXLA 1IBMT 1Z8UA 3DH9A 2V6OA 3DJEA 3LB8A 1Y0PA 2I0MA 2J4GA 2CXDA 2BACA 3ALMA 5LHHB 2X67A 5ABHA 1RUC4 2Q9QC 5BMVE 1GESA 2GR3A 4LF4T 4PK4A 5JQGE 3NKZA 2PHHA 3AE3A 2ES0A 4LF8T 5LYJE 3DK4A 3Q9TA 4H4ZA 2E9XB 4ZOLE 2X8HA 2XLTA 4BJZA 3KU9A 2ZLYA 4HFVA 1TDKA 2CFYA 2RR14 2NWBA 2XLPA 2FJBA 5AQPB 2K3WA 4X1KE 3SFDA 1VBA4 2XTLA 3K30A 4IE5A 4IL4A 2IC6A 3AA0B 1H7CA 4Z2RA 3AXJB 2A8XA 5TR3A 2MOZA 3SRZA 2CHNA 2AAQA 1GTEA 3VRDB 2HN2A 4NWZA 2WWUA 3DK8A 2V61A 2JQ9A 5LBMA 1NA1D 4FK1C 3C64A 2GK9A 5LHIB 2YG7A 4Q4X4 3FI7A 2XUEA 4IV9A 4U8LA 3MKDA 5FS8A 2VURA 5HWXA 4LFCT 2NW7A 4QX7B 4B68A 2QA1A 2XSAA 2WPEA 1NHQA 1N4UA 2VRMA 4O2BE 3CTYA 4EIPA 5JDGA 4EEBA 1JU2A 2YLXA 4EM4A 3FBZA 5FVLA 2BG9E 2WMNA 2LM2A 4J33A 2YDSA 1HYUA 2TPRA 1H7XA 1PHHA 4FDCB 2W0GA 4DR5T 1OOPD 4HFCA 4BV6A 4OPIA 4I0UA 2W2UA 3HKCE 2IVDA 1ZOYA 5HCJA 3C51A 1GRHA 2BS4A 3QVPA 2HHHT 1OJDA 4CNJA 4H4WA 3T31A 4EEDA 1KNRA 3UUBA 3ZYLA 3CQXC 4U74A 3LK3B 4LFAT 4IT4A 5JDLA 3AAIA 3EF6A 1ZEEA 4PK5A 5FS9A 4BJYA 4IREA 4JN9A 4UV9B 1AL24 1IUWA 3ALJA 3QSEA 4EXTA 4OYKA 1DODA 1YKJA 4BURA 2V7JA 4I55E 3HKBE 4ISSA 3O1HA 3K7TA 2RS34 4UF0B 4O4JE 4BAYB 4D03A 5LNKA 1I6ZA 1F8WA 1E39A 4UR9A 3N9OA 1X31B 2KNDA 4DBQA 4NEWA 4ZI7E 3Q5WA 1XHZA 2X8GA 1E1HB 5BVAA 3LBXB 1PS9A 2R0PA 1Q1WA 3RP6A 2YN6A 3I3LA 1GRFA 4YJ2E 3TKLB 1REOA 2XZEA 3RGLA 2R4JA 3NK0X 3E1TA 4NTCA 3GDNA 3PTRB 4U8PA 2WCAA 3ZT5A 5IWAT 3FZMB 1EAH4 2R074 2KINB 3QUJA 5AQGB 1MMNA 5KVIA 4YXDA 4EOZB 2OA1A 5LHGB 5KMSA 1QUUA 5LGNB 1FIOA 1IUVA 5AQHB 3RLFF 2C75A 2ZBWA 3C4NA 1ZOVA 3ZMTB 2CBJA 4L9IA 2WDRA 3J7Yq 3RHWA 3KBTA 5J7XA 4B6XA 5CA1E 4GYSA 1ZMDA 3CPIG 2Q0KA 5AQLB 1TYPA 1K0IA 2DWKA 2VRLA 4AT0A 4H4QA 1VRBA 1Q9IA 4CY6A 3RIUA 3EAOA 3F8DA 3BI4A 3QB5K 4J2WA 1HX1B 4HN9A 3ZYMA 3K7MX 3BI5A 3ZC1A 1F3PA 1S3BA 2IIUA 3ICTA 2YR4A 2C64A 3NTDA 1HF8A 1D0ZA 4H2RA 4HWFA 2OAMA 1CUNA 3TLUA 3CGDA 4ERRA 4ILBA 4A99A 4K7ZA 4DV1T 3ABVA 2VVMA 3H4KA 4TNWA 4FI5A 4LMLA 3Q5XA 5IHYA 2EQ6A 4WBNE 2LRKA 2CCQA 2X9YA 5U25A 2C76A 3PJAJ 1XDPA 1YXRA 4U8MA 1PBBA 4PJJA 4TNVA 2YLSA 1KSUA 2IAKA 2WU2A 4CN6A 2NR4A 1EBDA 4UDPA 2IC9A 1VG0A 2ZZBA 4NZHA 1R084 3OPCA 4O8SA 5IPYA 2WQYA 5HHFA 4GYRA 5AQSB 1VQWA 4TX5A 4U72A 4JV5T 3AYIA 4ICYA 1VBB4 2IW5B 3K3NA 3N9PA 5HXCA 5FNVE 1U5PA 2R4EA 2RP4A 3LSVA 1E7PA 2YU2A 2YVGA 3N9QA 3KPFA 4IDOA 3SGLA 5FY1A 1DJQA 1FEWA 3H8IA 4H9OC 4GIWA 2EX3A 5JRCA 3L8RA 4HEAA 5LMUT 5JCMA 4A97A 1VBE4 4CXYA 1K0LA 4HWIB 4UVAB 4KHPT 4DV3T 2CLYB 2K48A 2LSJA 5FKYA 2PYJA 5U63A 4CZZB 2EHOC 4UXNB 2WDVA 3T1YT 1EL7A 5HEGA 4YY3T 4ECHA 1YW0A 3NRXA 3UU3A 5JREA 2VWAA 1HFAA 2EQ7A 2YDQA 1XHXA 1YQZA 2W4XA 2XLUA 4IA6A 4AP1A 3H37A 2P9BA 3QSSA 4A9WA 2E1MA 1AR64 4CI2B 1GRAA 3A8YC 4ZZCA 2C67A 3FIMB 3PO7A 4GUVA 3ICSA 3OVUA 1VOMA 5JDFA 3ZSSA 2H89A 4X1IE 3UKPA 3X1DA 4JI5T 1GRGA 4H9PC 3EDUA 3JBG4 2XASB 4ADWA 1VBD4 4HFHA 4I59A 3I6DA 4OVIA 3CKDA 2HH7A 4NUUA 1LVFA 3IBPA 1HX8A 2YVJA 3AE4A 4JI4T 3AAAB 5LJNA 5EZYE 3GRTA 2JK6A 2JQQA 1M6IA 2C5JA 4J31A 3SZFA 4YSXA 3WAJA 3UU8A 1OEDC 2HN1A 2BA9A 4O5QA 2FJEA 2VKOA 2QGSA 1QLBA 3OTOT 4A5LA 2M6BA 4HFEA 2XAFB 2BVLA 3AA6B 3PUXF 1PXBA 2LJLA 3GYXA 2CWYA 4JY3A 2NOXA 4PFOA 5GONE 3AECA 4P0BA 5L4EA 2W66A 4X9MA 2ACZA 3IC9A 1VDCA 3IF9A 4CCRA 2JPFA 2Y6XA 3KD9A 2GH5A 1L9CA 2OLNA 2XCGA 2LOPA 4GOUA 4E0VA 2V3AA 3KKJA 4JI0T 5HWYA 3DJGX 4IDPA 5CJ5A 3LJCA 5KDMC 2QAEA 1EZ3A 3PURA 2A89A 4B3MT 3ZLIA 3T1HT 3ATQA 5A1LA 4H9RC 3NG7X 1B7TA 5CFBA 1UGOA 2AE9A 2GF3A 4Z91A 1GXFA 5LG4A 2V5ZA 1PJ7A 2BYBA 4PDWD 4U7YA 3OZ2A 4II2A 2QRXA 4LMJA 2X9WA 4YWOA 4OK0A 5L3BB 1ZKQA 2LSGA 1XI1A 1RUG4 5AQUB 4G9KA 2XQ7A 1CC4A 4CN4A 5KMPA 2E8IA 1AR94 2ZMAA 5L2LA 2KXPB 2JAEA 3VR8A 3AEFA 1NAFA 3OYXA 5AQVB 1GRBA 2VASA 4DR1T 1BR2A 4QXCB 3RRWA 3RYIE 4PJMA 1E1LA 5LJMA 1FEBA 3JADA 4GF7A 2HWB4 2UXCT 2D2SA 4HGAA 1BR1A 3BQKA 4DIDB 1VRH4 2X68A 4B65A 3NK2X 2NPXA 1B8SA 3DP7A 3IHGA 2VQBA 3UKAA 2Y6QA 1P2HA 3O0HA 3HR0A 2CXFA 4TM4A 3O1IA 3MK7C 2JB2A 4X20E 5L3FB 4BK2A 5JCLA 3F31A 4NXMT 4GK5E 2RGJA 4E7SA 3O9XA 1JEHA 1UURA 2PZSA 2R45A 4EQSA 1MNDA 4WYVA 2O9ZA 5KOXA 2GMHA 5HEUA 4JI3T 4ZI2D 1WYBA 5JR9A 1S2YA 2KT9A 4OPLA 1HTJF 3VKHA 2CULA 4L0RA 3NBXX 5JDMA 2Q9QB 5CGMA 5FS6A 2VL8A 5L47A 2W67A 4AQFA 4O4LE 1XDOA 2W63A 3AYLA 3UQ7A 2X0LB 2OA5A 3F2EA 2Q0LA 2OLOA 2WOVA 4TWFA 3KV5A 1D0YA 3RRCA 2UXBT 1AJ3A 2GVCA 4OYJA 4ZCCA 3MXZA 2YEVC 5FVKA 1SUMB 2YG6A 3RP8A 4ZXLA 1ZX9A 2DLRA 2LEHA 2FBWA 4USRA 1NPXA 2V7IA 4G63A 3SY4A 4EAHA 1SEZA 1CJ2A 2C73A 3TLTA 4GAVA 4TM1A 2AXDS 3JAEA 3DTOA 1D4EA 4D04A 4Z8XA 5FS7A 4DR6T 4I58A 4IGUA 5ADXL 3CNPA 4H4SA 2GRTA 3QFAA 1FJGT 4WX1A 3UKLA 3UUMA 3VKGA 4Q4Y4 2WAUA 4ILUA 2LFCA 3UTHA 3ZKRA 2VKHA 1NCQD 3TLVA 4EB6E 3BNUA 3HL6A 1HRV4 1S3EA 3KV4A 1O5WA 4QH4A 2Q6UA 2PW9A 3T2YA 2R6GF 2LKHA 3GN5B 4X64T 2L8KA 2WU5A 5JR9C 1DOCA 2XHEB 2HQMA 4OPDA 1M62A 3ANWA 4H7UA 2LSKA 2IVEA 1MIVA 2XVJA 1E1MA 4UP3A 4EZHA 4AQFC 3M12A 4AKLA 1HCIA 2XFUA 4ILCA 5C3JA 5KNLA 1N36T 4Z24A 1HNXT 3L3PA 3OJAA 1PJ6A 3QOFA 2XM1A 1H81A 4NUVA 4EMJA 4YHHT 4AOXA 2EQ8A 3LJPA 2EQ9A 2C5KT 4B66A 3PE0A 1EL8A 4U3CA 4JNAA 3UT5E 2XAHB 3KV9A 4DO0A 5ETWA 2DWGA 3BNMA 3O4XE 1SA0E 3GD4A 1BF3A 3Q2MA 3T8OA 1H6VA 4X62T 4IIJE 2YKSA 1DOBA 4DR7T 1PXCA 2YU1A 3T2KA 3GMCA 1BGNA 4JDRA 2GQFA 3FHNA 3CNTA 1WLXA 1OEDE 3H3AA 2WEUA 4USQA 5HEJA 3P8CD 3SUCA 3RC3A 2YWLA 3P4RA 3CIRA 4C90A 3P50A 1NAAA 1XWMA 3FG2P 1N34T 2LSYA 3NVOA 3KINB 4WBOA 3P1WA 1D1AA 2B7RA 3Q6JA 4TM3A 3AE5A 1OJCA 4U2TA 3EDVA 3FMWA 4COFA 1TDNA 2PJQA 4II3A 2A87A 1FCDA 4H63H 4G6HA 5JCNA 4B3TT 3KDSE 3CMLA 4ZCDA 5AQMB 1ELIA 2LHNA 1MOKA 4HWCA 4REKA 4CBQA 4NTDA 4X9NA 1V59A 4KHZF 5LMNT 4GKJT 2V6XA 4Z26A 3NGCX 2W62A 2YOEA 1V9DA 5CQFA 4LIIA 2Z6EA 3JC6C 2M6IA 4JI7T 2PY5A 2V60A 3ETVA 4CXWA 4B1BA 3CNJA 4U8KA 3K3OA 4Q25A 2ZM6T 2B9WA 1L9EA 2ZM0A 1E2AA 2M67A 4CXXA 1W0AA 1CC6A 4J36A 3RNMA 5FMNA 4DSGA 2WP5A 4C91A 2WSSV 2XVIA 3TLWA 2MAWA 1CBOA 3ZCJA 5BR8T 1S35A 4YTNA 3NLCA 3AEEA 3ONJA 3MJXA 1L0VA 3KPKA 4X5TA 3NNEA 3AA1B 3JCFA 4PK6A 4JYAT 4NTEA 3M13A 1LJ1A 1JOAA 3Q9DA 1K4QA 3UU6A 2CMRA 3UQ4A 2XFQA 1PBFA 2QA2A 3KVEA 3ZPOA 3NT6A 2I59A 4O5UA 2MYSA 3G06A 3WI3A 4BJNA 4Z90A 1FL2A 2Q7VA 2R46A 4DV7T 3T14A 1IUXA 1MIWA 4EGWA 2WMOA 2UUAT 5BULA 3PU8A 1H84A 4YJ3E 1BR0A 3CN8A 3LBXA 3PUWF 4U8IA 4ZI3D 2JRKA 3T0KA 4EV6A 4DV0T 5HYMA 3AEBA 4PJNA 3B6DA 4G74A 3ZJ2A 4DV4T 5M0ZA 1WRDA 3LDQB 3UOZA 3PUSA 3NYEA 5M10A 3GDPA 2CEAA 3LFMA 1Y64B 5AQRB 1EL5A 3NRNA 4OPGA 5LXTE 5AQNB 5J2TE 2C3CA 2WM9A 4UDRA 4TWDA 2F5ZA 2I6HA 4X66T 4YHJA 2ARDA 2H3RA 2NW9A 1AR74 5FMHA 2QVAA 2BC0A 2Y6RA 3RH3A 2YR6A 2E9XD 5L3CB 2EHOB 1LQUA 3FBSA 2RA1A 4OPCA 3GWHA 3HZLA 3CX8B 1XNRT 3E08A 1IJ5A 2V7LA 1RUE4 5JVDE 3WE0A 2J1DG 4AXPA 3CGEA 1WR6A 1LKXA 1BGJA 3V3NA 2R7FA 2XQAA 2YR5A 3LXDA 2V7KA 1CJ4A 3GYJA 1AR84 2XFNA 2V5CA 4Y4LA 3I0OA 4M1PA 2X0YA 5CB4E 5J1GA 4OX9T 3L39A 3BQLA 2UXNB 1QO8A 3FZLB 3OC4A 3W15B 3QJ4A 4B67A 3AVSA 1ZMCA 3UP5A 2IMLA 4PFPA 1NWMX 2VVSA 1HXS4 3AA7B
chains in the Genus database with same CATH topology
2B9YA 1E6EA 2A89A 2GB0A 5EBKA 3UOXA 2C7GA 3ATQA 4IVOB 1KDGA 1W4XA 2XLRA 1OJTA 3NYCA 1NG4A 1N4WA 4GR1A 4LA1A 3NG7X 3V76A 3GD3A 1MXTA 3UKHA 1Y56A 2VZ2A 3VR9A 3AB1A 2AQJA 4EQRA 1B37A 2GF3A 5U1OA 1CC2A 2IIDA 1PBCA 1KSSA 5BUKA 1NHSA 1GXFA 2BRAA 3SYIA 4BK1A 2V5ZA 1D7LA 1PJ7A 1XHCA 2GR1A 2BYBA 2I0ZA 2XYOA 5EB4A 2YG5A 3UKKA 4Z43A 3OZ2A 3P9UA 4II2A 4YWOA 1GV4A 4GDEA 3NHOX 1CL0A 1ZKQA 4YSZA 1QJDA 2J3NA 4NNJA 1OJ9A 2BK4A 1CC4A 4G9KA 3GMBA 5KMPA 1TDOA 4GDPA 3K7QX 3URHA 1GRTA 2JAEA 4EQXA 4U8OA 5KXJA 3VR8A 3AEFA 3DMEA 2R9ZA 1DOEA 1GRBA 3AE2A 3PVCA 4OPUA 5HXIA 4YKGA 3ADAB 4P9SA 1AOGA 4JY2A 1E1LA 1FEBA 2BK3A 4GF7A 1DXLA 3DH9A 4KX6A 1H83A 3T37A 2V6OA 3DJEA 3LB8A 1CJCA 3NN0X 1Y0PA 3AD9B 4H4UA 2BXSA 2XVHA 2BACA 2RABA 3C96A 2BC1A 3ALMA 2PYXA 1GESA 2GR3A 4C5OA 2WDQA 4B65A 3NK2X 2PHHA 3AE3A 2NPXA 3AE8A 3P4QA 1B8SA 1GPEA 1O94A 3BHKA 3IHGA 1D5TA 3DK4A 2VQBA 3Q9TA 1LVLA 2TMDA 4H4ZA 3UKAA 1B4VA 2Y6QA 4YKFA 4CRTA 2X8HA 2XLTA 1P2HA 3O0HA 1GNDA 4BJZA 2DKHA 4TM4A 3KU9A 2JB2A 2CFYA 1TDKA 2XLPA 4BK2A 2FJBA 5JCLA 1NHPA 2WP6A 4GAPA 4X4JA 3SFDA 2WPCA 3CPHG 4K5SA 3S61A 2YG3A 2RGJA 3L1RA 4EMIA 3GWDA 3K30A 3GRSA 1JNZA 3CGBA 4Z2RA 1JEHA 5TR3A 2A8XA 3NKSA 2GR0A 2R45A 2AAQA 4EQSA 1GTEA 3VRDB 4NWZA 2YM2A 3DK8A 3AEGA 5IQ4A 4YTPA 1TDFA 2O9ZA 2V61A 2GMHA 3NYFA 5KOXA 3LZXA 4J56A 4FK1C 2YG7A 1M64A 4U8JA 2C4CA 1NHRA 3CNDA 1Z6LA 4H4RA 4A7AA 3AD8B 4IV9A 3UTFA 2BCGG 4U8LA 5FS8A 1S2YA 1ZP0A 2DKIA 1XDIA 4OPTA 2VQ7A 4OPLA 2CULA 2X50A 2YG4A 1N1PA 2GEWA 3AD7B 4KPRA 3GYIA 2FJAA 4B68A 2QA1A 5FS6A 3NN6X 2WPEA 1NHQA 1N4UA 2VRMA 3AWIA 3CTYA 4MJWA 4EIPA 1IUTA 4HB9A 4C3YA 3AYLA 1JU2A 2YLXA 4EM4A 1D4DA 2VVLG 2WBAA 2Q0LA 2ZZCA 2OLOA 2WOVA 2WESA 3SM8A 4J33A 4XXGA 1HYUA 1LTXR 3BI2A 2TPRA 1H7XA 2GVCA 1PHHA 2XVFA 4FDCB 4ZCCA 5CKUA 4K5RA 4BV6A 4UDQA 1E1KA 4OPIA 1IUSA 1ZK7A 1FEAA 3CPJG 4NEVA 2YG6A 2IVDA 3RP8A 1D7YA 5EB5A 1ZOYA 3ZYXA 1ZX9A 3UKQA 3FPZA 3QFBA 1GRHA 2FBWA 4USRA 5DBJA 4DSHA 1NPXA 2B9XA 2Z5XA 2BS4A 3QVPA 3SY4A 1IUUA 1OJDA 2UZZA 4H4WA 3T31A 4CNJA 4K8DA 1SEZA 1CJ2A 2C73A 4B63A 1LQTA 1PJ5A 4GAVA 1KNRA 2QCUA 1GSNA 4B64A 1K0JA 3SXIA 2WP9A 4AT2A 1Y56B 4TM1A 2NVKX 3EF6A 1GT8A 5FS9A 1H86A 3QVRA 1D4EA 3R9UA 4BJYA 4D04A 5L46A 3ISHA 3CMMA 5FS7A 4I58A 4JN9A 3CNPA 5HY5A 1KNPA 1IUWA 3ALJA 1F8RA 4K2XA 4H4SA 2X99A 1COYA 2GRTA 3QFAA 3QSEA 1FOHA 4H2NA 4OCGA 2C3DA 1DODA 3RHAA 1YKJA 1D4CA 4WX1A 3UKLA 4BURA 2YLWA 3DA1A 4K22A 3P4SA 2LFCA 3K7TA 4G73A 3UTHA 3GQHA 1EL9A 3SFEA 4D03A 2E5VA 1YY5A 2GQWA 1DJNA 4RG3A 1F8WA 1GEUA 4U2SA 1E39A 1X31B 1VG9A 3BNUA 3UCLA 1F6MA 4NEWA 1S3EA 1O5WA 4Z2UA 2X8GA 4IA5A 2Q6UA 5BVAA 3VRBA 3T2YA 4H4VA 1PS9A 3DGZA 2WU5A 2R0PA 3F8RA 1NENA 1DOCA 1Q1WA 2HQMA 4GCMA 3D8XA 4TLZA 3RP6A 4OPDA 3I3LA 1GRFA 2Z5YA 1LV0A 3G5RA 4H7UA 1REOA 2IVEA 1TRBA 3ITJA 2XVJA 1E1MA 4UP3A 2R4JA 3NK0X 3E1TA 4NTCA 2XVEA 3AE6A 3DJDA 3GDNA 3M12A 3P4PA 2GAHB 3JSKA 4U8PA 1B5QA 4WCTA 2XFUA 4AP3A 4LU6A 5C3JA 5KNLA 4YSYA 1OJAA 3CGCA 4A6NA 4Z24A 4GRTA 5KVIA 4YXDA 4H4YA 2OA1A 1PJ6A 3REDA 5KMSA 4Z25A 1H81A 1IUVA 4C3XA 4EIQA 2C75A 4EMJA 1RYIA 4AOXA 2ZBWA 2C66A 2EQ8A 1JRZA 3C4NA 3LJPA 2EQ9A 3UOYA 1ZOVA 4BK3A 2WDRA 4B66A 5J7XA 3S5WA 1ZMDA 1P2EA 3CPIG 3LADA 1ZDLA 2Q0KA 1TYPA 1K0IA 1NEKA 1FECA 2VRLA 1EL8A 3LOVA 4AT0A 1MO9A 4H4QA 1Q9IA 4JNAA 4CY6A 3EAOA 3BNMA 4YTMA 3F8DA 3BI4A 4Y4MA 3SZWA 3GD4A 1BF3A 4J2WA 4APNA 3K7MX 2R0GA 2RGOA 3G5QA 1H6VA 3BI5A 1F3PA 3AE9A 1CJ3A 1S3BA 3QSMA 3ZDNA 1TDEA 4XWZA 1DOBA 4RG4A 1PXCA 3T2KA 3GMCA 2WOWA 1BGNA 3ICTA 2YR4A 4H50A 4JDRA 2GQFA 2E4GA 2C64A 3CNTA 3NTDA 4Z44A 4H2RA 1TYTA 3VRAA 2OAMA 1BKWA 2XFOA 3CGDA 4Y4NA 2WEUA 4USQA 4AOSA 4A99A 3SUCA 2AR8A 4K7ZA 2VVMA 3ABVA 3H4KA 2YWLA 2YLTA 3GSIA 4J57A 3P4RA 3C4AA 3CIRA 1L9DA 4YT0A 1NAAA 2BCPA 2CVJA 5EOWA 2EQ6A 1GREA 3FG2P 2CDUA 2BABA 3P1WA 5IQ1A 1S2QA 2B7RA 4XWRA 3Q6JA 4TM3A 5U25A 3AE5A 1GALA 1OJCA 2YQUA 3FMWA 4U2TA 5KVHA 2C76A 1TDNA 2ZZ0A 4II3A 3T2ZA 2A87A 2B7SA 4U8MA 1FCDA 1BWCA 5KMQA 1PBBA 2B76A 2GR2A 4G6HA 4A65A 5JCNA 1ONFA 2YLSA 4ZCDA 2FJDA 1KSUA 2WU2A 3NIXA 4EMWA 1ELIA 5JCKA 1EBDA 2WPFA 1MOKA 4UDPA 1KF6A 3VQRA 4REKA 4CBQA 4NTDA 2C70A 1V59A 4X9NA 3UP4A 3NTAA 1F8SA 1VG0A 2ZZBA 3SQPA 3CNSA 4Z26A 4NZHA 4C77A 3NGCX 5LV9A 3DGHA 4G6GA 1RSGA 4H4XA 5CQFA 3AE7A 5IPYA 2WQYA 4LIIA 5HHFA 1PBEA 1KFYA 2V60A 2YLRA 4B1BA 3CNJA 4U8NA 2JKCA 4U8KA 3RP7A 4J34A 4DNAA 1VQWA 2R0CA 2B9WA 1L9EA 3AYIA 3UTEA 2X8CA 3PS9A 4ICYA 4RSLA 4YSHA 3M0OA 4TLXA 5JCIA 3AE1A 4Z2TA 1GOSA 1CC6A 4J36A 2R4EA 1Q1RA 3RNMA 1E7PA 2YVGA 4DSGA 5J60A 2OALA 3KPFA 4PAAA 3SGLA 3DJJA 2WP5A 4FK1A 1DJQA 2APGA 2XVIA 3H8IA 3COXA 1CBOA 3NLCA 4YTNA 1GERA 3AEEA 1DNCA 1L0VA 3KPKA 5JCMA 1JNRA 2C72A 3NNEA 3KA7A 2JB3A 4H4TA 3BHFA 3HYXA 4NTEA 3M13A 1LJ1A 1K0LA 1JOAA 1ZY8A 2WS3A 1K4QA 2GMJA 2XFPA 4H2QA 2VVLA 5GSNA 2XLSA 2XFQA 1PBFA 2QA2A 3KVEA 2W0HA 2X3NA 3NT6A 1JRYA 4O5UA 3EANA 3H8LA 1PBDA 5U63A 2YM1A 3LZWA 4A6NB 1FL2A 2Q7VA 2R46A 3T14A 4C74A 1IUXA 3GQKA 4PABA 2WDVA 3II4A 1EL7A 4ECHA 1CHUA 2C65A 1E1NA 1GETA 5BULA 1H84A 2EQ7A 3CN8A 4CCQA 3L8KA 1PN0A 1VRQB 4B69A 3G5SA 4U8IA 1YQZA 3HYWA 2XLUA 4IA6A 4AP1A 5KWFA 4TM0A 3T0KA 2BK5A 1LPFA 3D1CA 3QSSA 4A9WA 2E1MA 5HYMA 1JRXA 3AEBA 1NG3A 3B6DA 5C2TA 4G74A 1UKVG 5M0ZA 5KMRA 4M52A 1GRAA 3UOZA 3NYEA 5M10A 2BXRA 2C67A 3FIMB 3GWFA 2XDOA 3PO7A 4GUVA 3ICSA 3GDPA 2JBVA 2RGHA 1EL5A 3IWAA 3NRNA 2H89A 4OPGA 3UKPA 5BRTA 4U2LA 4EM3A 2WHDA 4H4PA 2C3CA 1GRGA 4FX9A 4UDRA 3B3RA 3ALLA 1IJHA 2F5ZA 1YQ3A 4ADWA 3SX6A 3AXBA 4I59A 4JQ9A 1RP0A 3SZCA 3I6DA 2ARDA 4OVIA 2YVFA 5FMHA 4JNQA 4EQWA 2BC0A 2WOIA 4HA6A 2YVJA 3AE4A 2Y6RA 2YR6A 3GRTA 1LQUA 2JK6A 5ER0A 1M6IA 3ATRA 3FBSA 3IHMA 3UKFA 4J31A 4OPCA 3NH3X 3SZFA 4YSXA 3AEDA 3F8PA 2BA9A 4O5QA 2FJEA 3HZLA 3SZ0A 4CY8A 2GAGB 1H82A 1QLBA 1O95A 4A5LA 3AEAA 3WE0A 2BS3A 2VOUA 1NDAA 4A79A 3CGEA 5KRQA 1PXBA 1BGJA 4H2PA 3GYXA 4JY3A 2YAUA 3V3NA 1YQ4A 2YR5A 3UOVA 2H88A 3NK1X 3AECA 2JB1A 3AYJA 3LXDA 1XANA 1CJ4A 4IVMB 4X9MA 3GYJA 2BRYA 2BS2A 5GRTA 3V3OA 2ACZA 3IC9A 1PDHA 1GTHA 2XFNA 2YLZA 1BZLA 1VDCA 2GV8A 3IF9A 4Y4LA 4CCRA 4ZN0A 4DGKA 3KD9A 2GH5A 1H7WA 1L9CA 2OLNA 1PXAA 1QO8A 2XCGA 3EPTA 3OC4A 3DK9A 4CNKA 3ICRA 3QJ4A 4E0VA 4B67A 2V3AA 3KKJA 1ZMCA 5KOWA 3HYVA 1CF3A 1XPQA 2V3BA 3UP5A 3UTGA 3DJGX 1N4VA 2QAEA 2WETA 4N9XA 3KLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9Y A;  1E6E A;  2A89 A;  2GB0 A;  5EBK A;  3UOX A;  2C7G A;  3ATQ A;  4IVO B;  1KDG A;  1W4X A;  2XLR A;  1OJT A;  3NYC A;  1NG4 A;  1N4W A;  4GR1 A;  4LA1 A;  3NG7 X;  3V76 A;  3GD3 A;  1MXT A;  3UKH A;  1Y56 A;  2VZ2 A;  3VR9 A;  3AB1 A;  2AQJ A;  4EQR A;  1B37 A;  2GF3 A;  5U1O A;  1CC2 A;  2IID A;  1PBC A;  1KSS A;  5BUK A;  1NHS A;  1GXF A;  4BK1 A;  2V5Z A;  1D7L A;  1PJ7 A;  1XHC A;  2GR1 A;  2BYB A;  2I0Z A;  2XYO A;  5EB4 A;  2YG5 A;  3UKK A;  4Z43 A;  3OZ2 A;  3P9U A;  4YWO A;  1GV4 A;  4GDE A;  3NHO X;  1CL0 A;  1ZKQ A;  4YSZ A;  1QJD A;  2J3N A;  1OJ9 A;  2BK4 A;  1CC4 A;  3GMB A;  1TDO A;  4GDP A;  3K7Q X;  3URH A;  1GRT A;  2JAE A;  4EQX A;  4U8O A;  5KXJ A;  3VR8 A;  3AEF A;  3DME A;  2R9Z A;  1DOE A;  1GRB A;  3AE2 A;  3PVC A;  4OPU A;  5HXI A;  4YKG A;  3ADA B;  4P9S A;  1AOG A;  4JY2 A;  1E1L A;  1FEB A;  2BK3 A;  4GF7 A;  1DXL A;  3DH9 A;  4KX6 A;  1H83 A;  3T37 A;  2V6O A;  3DJE A;  3LB8 A;  1CJC A;  3NN0 X;  1Y0P A;  3AD9 B;  4H4U A;  2BXS A;  2XVH A;  2BAC A;  2RAB A;  3C96 A;  2BC1 A;  3ALM A;  2PYX A;  1GES A;  2GR3 A;  4C5O A;  2WDQ A;  4B65 A;  3NK2 X;  2PHH A;  3AE3 A;  2NPX A;  3AE8 A;  3P4Q A;  1B8S A;  1GPE A;  1O94 A;  3BHK A;  3IHG A;  1D5T A;  3DK4 A;  2VQB A;  3Q9T A;  1LVL A;  2TMD A;  4H4Z A;  3UKA A;  1B4V A;  2Y6Q A;  4YKF A;  4CRT A;  2X8H A;  2XLT A;  1P2H A;  3O0H A;  1GND A;  4BJZ A;  2DKH A;  4TM4 A;  3KU9 A;  2JB2 A;  2CFY A;  1TDK A;  2XLP A;  4BK2 A;  2FJB A;  5JCL A;  1NHP A;  2WP6 A;  4X4J A;  3SFD A;  2WPC A;  3CPH G;  4K5S A;  3S61 A;  2YG3 A;  2RGJ A;  3L1R A;  4EMI A;  3GWD A;  3K30 A;  3GRS A;  1JNZ A;  3CGB A;  4Z2R A;  1JEH A;  5TR3 A;  2A8X A;  3NKS A;  2GR0 A;  2R45 A;  2AAQ A;  4EQS A;  1GTE A;  3VRD B;  2YM2 A;  3DK8 A;  3AEG A;  5IQ4 A;  4YTP A;  1TDF A;  2O9Z A;  2V61 A;  2GMH A;  3NYF A;  5KOX A;  3LZX A;  4J56 A;  4FK1 C;  2YG7 A;  1M64 A;  4U8J A;  1NHR A;  3CND A;  1Z6L A;  4H4R A;  4A7A A;  3AD8 B;  4IV9 A;  3UTF A;  2BCG G;  4U8L A;  5FS8 A;  1S2Y A;  1ZP0 A;  2DKI A;  1XDI A;  4OPT A;  2VQ7 A;  4OPL A;  2CUL A;  2X50 A;  2YG4 A;  1N1P A;  2GEW A;  3AD7 B;  4KPR A;  3GYI A;  2FJA A;  4B68 A;  2QA1 A;  5FS6 A;  3NN6 X;  2WPE A;  1NHQ A;  1N4U A;  2VRM A;  3AWI A;  3CTY A;  4MJW A;  4EIP A;  1IUT A;  4HB9 A;  4C3Y A;  3AYL A;  1JU2 A;  2YLX A;  4EM4 A;  1D4D A;  2VVL G;  2WBA A;  2Q0L A;  2ZZC A;  2OLO A;  2WOV A;  2WES A;  3SM8 A;  4J33 A;  4XXG A;  1HYU A;  1LTX R;  3BI2 A;  2TPR A;  1H7X A;  2GVC A;  1PHH A;  2XVF A;  4FDC B;  4ZCC A;  5CKU A;  4K5R A;  4BV6 A;  4UDQ A;  1E1K A;  4OPI A;  1IUS A;  1ZK7 A;  1FEA A;  3CPJ G;  4NEV A;  2YG6 A;  2IVD A;  3RP8 A;  1D7Y A;  5EB5 A;  1ZOY A;  3ZYX A;  1ZX9 A;  3UKQ A;  3FPZ A;  3QFB A;  1GRH A;  2FBW A;  4USR A;  5DBJ A;  4DSH A;  1NPX A;  2B9X A;  2Z5X A;  2BS4 A;  3QVP A;  1IUU A;  1OJD A;  2UZZ A;  4H4W A;  4CNJ A;  4K8D A;  1SEZ A;  1CJ2 A;  2C73 A;  4B63 A;  1LQT A;  1PJ5 A;  1KNR A;  2QCU A;  1GSN A;  4B64 A;  1K0J A;  4AT2 A;  2WP9 A;  1Y56 B;  4TM1 A;  2NVK X;  3EF6 A;  1GT8 A;  5FS9 A;  1H86 A;  3QVR A;  1D4E A;  3R9U A;  4BJY A;  4D04 A;  5L46 A;  3ISH A;  5FS7 A;  4I58 A;  4JN9 A;  3CNP A;  5HY5 A;  1KNP A;  1IUW A;  3ALJ A;  1F8R A;  4K2X A;  4H4S A;  2X99 A;  1COY A;  2GRT A;  3QFA A;  3QSE A;  1FOH A;  4H2N A;  4OCG A;  2C3D A;  1DOD A;  3RHA A;  1YKJ A;  1D4C A;  4WX1 A;  3UKL A;  4BUR A;  2YLW A;  3DA1 A;  4K22 A;  3P4S A;  2LFC A;  3K7T A;  3UTH A;  3GQH A;  1EL9 A;  3SFE A;  4D03 A;  2E5V A;  1YY5 A;  2GQW A;  1DJN A;  4RG3 A;  1F8W A;  1GEU A;  4U2S A;  1E39 A;  1X31 B;  1VG9 A;  3BNU A;  3UCL A;  1F6M A;  4NEW A;  1S3E A;  1O5W A;  4Z2U A;  2X8G A;  4IA5 A;  2Q6U A;  5BVA A;  3VRB A;  4H4V A;  1PS9 A;  3DGZ A;  2WU5 A;  2R0P A;  3F8R A;  1NEN A;  1DOC A;  1Q1W A;  2HQM A;  4GCM A;  3D8X A;  4TLZ A;  3RP6 A;  4OPD A;  3I3L A;  1GRF A;  2Z5Y A;  1LV0 A;  3G5R A;  4H7U A;  1REO A;  2IVE A;  1TRB A;  3ITJ A;  2XVJ A;  1E1M A;  4UP3 A;  2R4J A;  3NK0 X;  3E1T A;  4NTC A;  2XVE A;  3AE6 A;  3DJD A;  3GDN A;  3M12 A;  3P4P A;  2GAH B;  3JSK A;  4U8P A;  1B5Q A;  4WCT A;  2XFU A;  4AP3 A;  4LU6 A;  5C3J A;  4YSY A;  1OJA A;  3CGC A;  4A6N A;  4Z24 A;  4GRT A;  5KVI A;  4YXD A;  4H4Y A;  2OA1 A;  1PJ6 A;  3RED A;  4Z25 A;  1H81 A;  1IUV A;  4C3X A;  4EIQ A;  2C75 A;  4EMJ A;  1RYI A;  4AOX A;  2ZBW A;  2C66 A;  2EQ8 A;  1JRZ A;  3C4N A;  3LJP A;  2EQ9 A;  3UOY A;  1ZOV A;  4BK3 A;  2WDR A;  4B66 A;  5J7X A;  3S5W A;  1ZMD A;  1P2E A;  3CPI G;  3LAD A;  1ZDL A;  2Q0K A;  1TYP A;  1K0I A;  1NEK A;  1FEC A;  2VRL A;  1EL8 A;  3LOV A;  4AT0 A;  1MO9 A;  4H4Q A;  1Q9I A;  4JNA A;  4CY6 A;  3EAO A;  3BNM A;  4YTM A;  3F8D A;  3BI4 A;  4Y4M A;  3GD4 A;  1BF3 A;  4J2W A;  4APN A;  3K7M X;  2R0G A;  2RGO A;  3G5Q A;  1H6V A;  3BI5 A;  1F3P A;  3AE9 A;  1CJ3 A;  1S3B A;  3QSM A;  3ZDN A;  1TDE A;  4XWZ A;  1DOB A;  4RG4 A;  1PXC A;  3GMC A;  2WOW A;  1BGN A;  3ICT A;  2YR4 A;  4H50 A;  4JDR A;  2GQF A;  2E4G A;  2C64 A;  3CNT A;  3NTD A;  4Z44 A;  4H2R A;  1TYT A;  3VRA A;  2OAM A;  1BKW A;  2XFO A;  3CGD A;  4Y4N A;  2WEU A;  4USQ A;  4AOS A;  4A99 A;  3SUC A;  2AR8 A;  4K7Z A;  2VVM A;  3ABV A;  3H4K A;  2YWL A;  2YLT A;  3GSI A;  4J57 A;  3P4R A;  3C4A A;  3CIR A;  1L9D A;  4YT0 A;  1NAA A;  2BCP A;  2CVJ A;  5EOW A;  2EQ6 A;  1GRE A;  3FG2 P;  2CDU A;  2BAB A;  3P1W A;  5IQ1 A;  1S2Q A;  2B7R A;  4XWR A;  3Q6J A;  4TM3 A;  5U25 A;  3AE5 A;  1GAL A;  1OJC A;  2YQU A;  3FMW A;  4U2T A;  5KVH A;  2C76 A;  1TDN A;  2ZZ0 A;  2A87 A;  2B7S A;  4U8M A;  1FCD A;  1BWC A;  1PBB A;  2B76 A;  2GR2 A;  4A65 A;  5JCN A;  1ONF A;  2YLS A;  4ZCD A;  2FJD A;  1KSU A;  2WU2 A;  3NIX A;  4EMW A;  1ELI A;  5JCK A;  1EBD A;  2WPF A;  1MOK A;  4UDP A;  1KF6 A;  3VQR A;  4REK A;  4CBQ A;  4NTD A;  2C70 A;  1V59 A;  4X9N A;  3UP4 A;  3NTA A;  1F8S A;  1VG0 A;  2ZZB A;  3SQP A;  3CNS A;  4Z26 A;  4NZH A;  4C77 A;  3NGC X;  5LV9 A;  3DGH A;  1RSG A;  4H4X A;  5CQF A;  3AE7 A;  5IPY A;  2WQY A;  4LII A;  5HHF A;  1PBE A;  1KFY A;  2V60 A;  2YLR A;  4B1B A;  3CNJ A;  4U8N A;  2JKC A;  4U8K A;  3RP7 A;  4J34 A;  4DNA A;  1VQW A;  2R0C A;  2B9W A;  1L9E A;  3AYI A;  3UTE A;  2X8C A;  3PS9 A;  4ICY A;  4RSL A;  4YSH A;  3M0O A;  4TLX A;  5JCI A;  3AE1 A;  4Z2T A;  1GOS A;  1CC6 A;  4J36 A;  2R4E A;  1Q1R A;  3RNM A;  1E7P A;  2YVG A;  4DSG A;  5J60 A;  2OAL A;  3KPF A;  4PAA A;  3SGL A;  3DJJ A;  2WP5 A;  4FK1 A;  1DJQ A;  2APG A;  2XVI A;  3H8I A;  3COX A;  1CBO A;  3NLC A;  4YTN A;  1GER A;  3AEE A;  1DNC A;  1L0V A;  5JCM A;  1JNR A;  2C72 A;  3NNE A;  3KA7 A;  2JB3 A;  4H4T A;  3BHF A;  4NTE A;  3M13 A;  1LJ1 A;  1K0L A;  1JOA A;  1ZY8 A;  2WS3 A;  1K4Q A;  2GMJ A;  2XFP A;  4H2Q A;  2VVL A;  5GSN A;  2XLS A;  2XFQ A;  1PBF A;  2QA2 A;  3KVE A;  2W0H A;  2X3N A;  3NT6 A;  1JRY A;  4O5U A;  3EAN A;  3H8L A;  1PBD A;  5U63 A;  2YM1 A;  3LZW A;  4A6N B;  1FL2 A;  2Q7V A;  2R46 A;  4C74 A;  3GQK A;  1IUX A;  4PAB A;  2WDV A;  3II4 A;  1EL7 A;  4ECH A;  1CHU A;  2C65 A;  1E1N A;  1GET A;  5BUL A;  1H84 A;  2EQ7 A;  3CN8 A;  4CCQ A;  3L8K A;  1PN0 A;  1VRQ B;  4B69 A;  3G5S A;  4U8I A;  1YQZ A;  2XLU A;  4IA6 A;  4AP1 A;  5KWF A;  4TM0 A;  2BK5 A;  1LPF A;  3D1C A;  3QSS A;  4A9W A;  2E1M A;  5HYM A;  1JRX A;  3AEB A;  1NG3 A;  3B6D A;  5C2T A;  1UKV G;  5M0Z A;  4M52 A;  1GRA A;  3UOZ A;  3NYE A;  5M10 A;  2BXR A;  2C67 A;  3FIM B;  3GWF A;  2XDO A;  3PO7 A;  4GUV A;  3ICS A;  3GDP A;  2JBV A;  2RGH A;  1EL5 A;  3IWA A;  3NRN A;  2H89 A;  4OPG A;  3UKP A;  5BRT A;  4U2L A;  4EM3 A;  2WHD A;  4H4P A;  2C3C A;  1GRG A;  4FX9 A;  4UDR A;  3B3R A;  3ALL A;  1IJH A;  2F5Z A;  1YQ3 A;  4ADW A;  3AXB A;  4I59 A;  4JQ9 A;  1RP0 A;  3I6D A;  2ARD A;  4OVI A;  2YVF A;  5FMH A;  4JNQ A;  4EQW A;  2BC0 A;  2WOI A;  4HA6 A;  2YVJ A;  3AE4 A;  2Y6R A;  2YR6 A;  3GRT A;  1LQU A;  2JK6 A;  5ER0 A;  1M6I A;  3ATR A;  3FBS A;  3IHM A;  3UKF A;  4J31 A;  4OPC A;  3NH3 X;  4YSX A;  3AED A;  3F8P A;  2BA9 A;  4O5Q A;  2FJE A;  3HZL A;  4CY8 A;  2GAG B;  1H82 A;  1QLB A;  1O95 A;  4A5L A;  3AEA A;  3WE0 A;  2BS3 A;  2VOU A;  1NDA A;  4A79 A;  3CGE A;  5KRQ A;  1PXB A;  1BGJ A;  4H2P A;  4JY3 A;  3GYX A;  2YAU A;  3V3N A;  1YQ4 A;  2YR5 A;  3UOV A;  2H88 A;  3NK1 X;  3AEC A;  2JB1 A;  3AYJ A;  3LXD A;  1XAN A;  1CJ4 A;  4IVM B;  4X9M A;  3GYJ A;  2BS2 A;  5GRT A;  3V3O A;  2ACZ A;  3IC9 A;  1PDH A;  1GTH A;  2XFN A;  2YLZ A;  1BZL A;  1VDC A;  2GV8 A;  3IF9 A;  4Y4L A;  4CCR A;  4ZN0 A;  4DGK A;  3KD9 A;  2GH5 A;  1H7W A;  1L9C A;  2OLN A;  1PXA A;  1QO8 A;  2XCG A;  3EPT A;  3OC4 A;  3DK9 A;  4CNK A;  3ICR A;  3QJ4 A;  4E0V A;  4B67 A;  2V3A A;  3KKJ A;  1ZMC A;  5KOW A;  1CF3 A;  1XPQ A;  2V3B A;  3UP5 A;  3UTG A;  3DJG X;  1N4V A;  2QAE A;  2WET A;  4N9X A;  3KLJ A; 
#chains in the Genus database with same CATH topology
 3LK4 2;  1W0B A;  2D0U A;  2GB0 A;  5EBK A;  4YLH A;  2XQ6 A;  4IVO B;  3UUX B;  3RIU C;  1NG4 A;  3V76 A;  1MXT A;  4HTE A;  1OWA A;  1Y56 A;  2X51 A;  1OED B;  1YKH B;  3M3Z B;  3VR9 A;  1B37 A;  2AQJ A;  3R84 B;  1WYC A;  1RUD 4;  5U1O A;  1CC2 A;  1T98 A;  1PBC A;  2SPC A;  1NHS A;  2D9D A;  3N2G E;  3RYH E;  3E22 E;  4A5X A;  5EB4 A;  2YG5 A;  1Z7S 4;  3K3Q C;  1XZY A;  3RIF A;  5FL0 A;  2CM0 A;  3NHO X;  4GDE A;  1OXZ A;  4U33 A;  4NNJ A;  2A72 A;  1OJ9 A;  2BK4 A;  4ANJ A;  3GMB A;  2XQ3 A;  3CK6 A;  4GDP A;  3K7Q X;  2XAJ B;  1MNE A;  3EAB A;  4EQX A;  3DME A;  5L3G B;  3AE2 A;  4EYU A;  2YDR A;  3H3M A;  2XPK A;  1ASJ 4;  1HG2 A;  2BK3 A;  2BG9 A;  5H6R B;  1DU2 A;  4KX6 A;  1H83 A;  5L3E B;  5JDQ A;  1VCT A;  3AD9 B;  2PYL A;  4H4U A;  2BXS A;  2XVH A;  5AQO B;  4I43 B;  3C96 A;  2BC1 A;  3NWI A;  2HWC 4;  5AQQ B;  2MBG A;  4P09 A;  5FY7 A;  1HR0 T;  4C5O A;  2WDQ A;  2A2F X;  2LKG A;  2C5I T;  1GPE A;  4U2Y A;  3BHK A;  3NZP A;  1D5T A;  1LVL A;  2UXX B;  1B4V A;  4YKF A;  4H63 V;  1GND A;  3PJA A;  4KUM B;  4I50 E;  5AQF B;  1Z0P A;  2WPC A;  5EK2 A;  4K5S A;  2YG3 A;  4EMI A;  3GRS A;  3RC8 A;  1XMQ T;  1JNZ A;  4U31 A;  2DI4 A;  2NP9 A;  3Q5E A;  4CI3 B;  4WZX A;  2GR0 A;  3UUN A;  2PFV A;  2YM2 A;  5IQ4 A;  3FZK B;  4YTP A;  2IUB A;  1NHR A;  4TV8 E;  4A7A A;  3AD8 B;  3UTF A;  2BCG G;  1FMW A;  2DKI A;  5IUX A;  4QKN A;  4DMW A;  5JTG A;  1KK7 A;  2VL0 A;  1XDI A;  1HS7 A;  2VQ7 A;  1PVC 4;  3ZMV B;  4GKK T;  2YG4 A;  2GEW A;  3AD7 B;  4KPR A;  2BBH A;  3NN6 X;  1XNQ T;  4HB9 A;  3UTK A;  1D4D A;  2VVL G;  5HEO A;  5HEH A;  4LFB T;  2WZH A;  3OKQ A;  3ZST A;  3P4W A;  4MBQ A;  2XVF A;  1YD8 G;  5CKU A;  4K5R A;  1BEV 4;  5F5W A;  1E1K A;  1IUS A;  2BG9 C;  1COV 4;  1ZK7 A;  1FEA A;  3CPJ G;  4NEV A;  2PLV 4;  1PO2 4;  1WFD A;  1I94 T;  3P7I A;  3UKQ A;  3B5M A;  3FPZ A;  3ZT7 A;  4DSH A;  2QYW A;  5DBJ A;  4IE7 A;  1IUU A;  2UZZ A;  4KBM B;  4MLK A;  2XAQ B;  1S94 A;  3B13 A;  3AAE B;  3FZH B;  2QCU A;  4UIG A;  5AQJ B;  2BKO A;  3SXI A;  2JJ9 A;  4LF6 T;  2NVK X;  1GT8 A;  3KVB A;  3QVR A;  3BK9 A;  3J9X 1;  5L46 A;  2JMK A;  2JMH A;  2LHR A;  3LK2 B;  3NRY A;  1KNP A;  5HY5 A;  1HG5 A;  3SOL A;  4K2X A;  2X99 A;  3RHA A;  5LP6 E;  2PTF A;  2C3D A;  4MFR A;  5DQW A;  2YLW A;  2XQ4 A;  4ZI2 C;  5HXH A;  3N2K E;  2E5V A;  1YY5 A;  1DJN A;  4RG3 A;  3QC9 A;  3JD7 4;  3ZJ1 A;  2HPL A;  1VG9 A;  4ZEY A;  4HKA A;  4Z2U A;  4IA5 A;  3VRB A;  3RYF E;  4JI8 T;  2CE7 A;  4TLZ A;  5LBQ B;  2Z5Y A;  5FL1 A;  1TRB A;  4GK0 E;  4ADZ A;  3DJD A;  3AE6 A;  2GAH B;  4LU6 A;  2DHR A;  4A6N A;  4WNK A;  3ZEF B;  4H4Y A;  4ZS3 A;  5LGT B;  4Z25 A;  4EIQ A;  5TAO A;  2UUB T;  3ONX A;  3UOY A;  4BA9 A;  1JRZ A;  4BK3 A;  4CQI A;  5JDH A;  1BR4 A;  3C4X A;  5KX5 E;  1P2E A;  4DR2 T;  3QNU A;  4JUY A;  3LOV A;  1EV1 4;  5J2U E;  3PUG A;  4QXH B;  1QSD A;  5EK3 A;  1ZHC A;  4YTM A;  2E2A A;  4IDZ A;  3SZW A;  4UEL A;  3CX6 B;  5ABG A;  3PUA A;  2ACX A;  5FXX A;  2R0G A;  2RGO A;  3G5Q A;  1ZKE A;  3AE9 A;  4UVB B;  4F6R C;  2XQY A;  4IL9 A;  2WOW A;  4IST A;  4NIQ A;  4O2A E;  2ODU A;  3I0Q A;  3E0Z A;  3QK6 A;  1TYT A;  3VRA A;  2XAG B;  4AOS A;  4QH1 A;  5AQK B;  2BVM A;  2JQH A;  5ABF B;  2YLT A;  3GSI A;  4J57 A;  1L9D A;  3OBV E;  2QA7 A;  2BCP A;  5JH7 E;  2CVJ A;  5FXW A;  1US7 B;  3HKD E;  5FYM A;  4DUZ T;  4XWR A;  1GAL A;  1UUS A;  5KVH A;  1YKE B;  3AB3 B;  3T2Z A;  1IZN B;  5KMQ A;  2B76 A;  5AQT B;  4A65 A;  2Q9Q A;  3A7M A;  1ONF A;  1Y01 A;  3PUZ F;  2FJD A;  5JCK A;  2V6Y B;  1KF6 A;  3VQR A;  3IF8 B;  3UP4 A;  3NTA A;  3CNS A;  2F4V T;  2MTQ A;  1WCR A;  3U3I A;  1RSG A;  4PJL A;  1PBE A;  4A56 A;  2YLR A;  1X9B A;  2K9A A;  3M65 A;  4U8N A;  3RP7 A;  4IHJ E;  4DNA A;  2R0C A;  3NZQ A;  2KWH A;  2BZB A;  2H7O A;  2X8C A;  3PS9 A;  4YSH A;  3M0O A;  4TLX A;  3K1S A;  4IE0 A;  4Z2T A;  4IDQ A;  3C4Z A;  2XSB A;  2CBI A;  5HAX A;  2K5B B;  1PIV 4;  3OYZ A;  5J60 A;  2OAL A;  3DJJ A;  1UX4 A;  2CA5 A;  4FK1 A;  2APG A;  4UV8 B;  4EZ4 A;  1DNC A;  5L3D B;  2C72 A;  2ZM2 A;  3KA7 A;  3UU4 A;  3HYX A;  1D4M 4;  2V26 A;  2WS3 A;  1ZY8 A;  4H2Q A;  2VVL A;  3H8L A;  3RYC E;  2YM1 A;  3LZW A;  3GQK A;  3AVR A;  3II4 A;  2C65 A;  1GET A;  4N78 D;  2DNX A;  3ZMS B;  1PN0 A;  3GN5 A;  3CVR A;  3G5S A;  3HYW A;  2MPK A;  5KWF A;  1JRX A;  4CN1 A;  4AKR B;  1H8T D;  1UKV G;  5KMR A;  3D0T A;  4LF7 T;  5FXV A;  2WWV A;  2PBI A;  4AIU A;  3FXE B;  3KVA A;  2UXD T;  3RIA A;  2D5U A;  2E9X A;  1R09 4;  2RS5 4;  3KFW X;  5FP3 A;  3RQW A;  2A9U A;  1MQT D;  4HE8 A;  1RMU 4;  3MA9 A;  1IJH A;  2LLY A;  3SX6 A;  3AXB A;  4JQ9 A;  1RP0 A;  3N5L A;  1W09 A;  4HFI A;  3UU5 A;  4EQW A;  2WOI A;  2N2N A;  3VHL A;  5ABE A;  1J1J A;  3AXJ A;  5ER0 A;  3ATR A;  3IHM A;  5F8P A;  3NH3 X;  3IA3 A;  2KWI B;  1G73 A;  2PG8 A;  2DL1 A;  1KEY A;  2XQ9 A;  4P0A A;  2GAG B;  3SZ0 A;  2NW8 A;  1NDA A;  4A79 A;  2R06 4;  5KRQ A;  3IEE A;  2YAU A;  4U2Z A;  3UOV A;  2JB1 A;  3AYJ A;  1XAN A;  4B3S T;  4IVM B;  2BS2 A;  4ZI3 C;  5GRT A;  3CX7 B;  3V3O A;  2B1E A;  3ZT6 A;  4ZN0 A;  2GV8 A;  3I9Y A;  4X1Y E;  2IDO B;  1H7W A;  3RPU A;  1PXA A;  3EPT A;  4BJM A;  1X79 A;  2Q9Q D;  4HWD A;  2V3B A;  3UTG A;  3ETU A;  1N4V A;  3KLJ A;  4RHV 4;  3I9W A;  1E6E A;  3RQU A;  3UOX A;  2C7G A;  1KDG A;  2XLR A;  3K8P C;  1OJT A;  2KMF A;  1N4W A;  2LSI A;  3A5X A;  4FJO A;  3AB1 A;  3PUQ A;  2E5L T;  5HXE A;  5AFU L;  2E9X C;  2IID A;  1KSS A;  4ZZB A;  3JAF A;  3SYI A;  2RMU 4;  1D7L A;  3FBL A;  1MMD A;  3HI2 A;  2I0Z A;  2XYO A;  3UKK A;  1GV4 A;  1CL0 A;  1QJD A;  2OV9 A;  4K0K T;  4DUY T;  4UF0 A;  4U7I A;  2KSR A;  3ZN1 B;  1GRT A;  5KXJ A;  5HYA A;  5HXI A;  3PVC A;  2WBL A;  1MMG A;  2IHR 1;  3ADA B;  4P9S A;  4JY2 A;  3HA4 A;  2LM9 A;  2RPA A;  5CA0 E;  5M4Y A;  3T37 A;  1CJC A;  3NN0 X;  4XAX B;  4TUY E;  4TZ4 C;  2RAB A;  4V1A v;  2PYX A;  4I4T E;  3RX6 A;  2VB6 A;  1HRI 4;  1UCU A;  3AE8 A;  3P4Q A;  1O94 A;  5C8Y E;  4P1N A;  2TMD A;  5EK4 A;  2Y8D A;  4CRT A;  4QX8 B;  2DKH A;  2LT3 A;  5LGU B;  1NHP A;  1KNZ A;  2WP6 A;  4GAP A;  2XJ7 A;  4X4J A;  2JIW A;  2HPJ A;  3CPH G;  1SE7 A;  2V1D B;  3S61 A;  3V5S A;  3L1R A;  3GWD A;  3KBU A;  1T7S A;  3CGB A;  3JC6 D;  3NKS A;  5LG3 A;  3FXD B;  2VK9 A;  3AEG A;  1TDF A;  4AIS A;  3NYF A;  3LZX A;  4J56 A;  2N1G A;  2CWO A;  3CPZ A;  1M64 A;  4U8J A;  4AKH A;  2C4C A;  3CND A;  3EI0 A;  1Z6L A;  4H4R A;  4KI0 F;  2V5D A;  4QXB B;  1ZP0 A;  2H7V C;  2VKJ A;  4OPT A;  2X50 A;  3EAM A;  1N1P A;  1FMV A;  3GYI A;  2FJA A;  5IYZ E;  3AWI A;  4MJW A;  1IUT A;  2EHO A;  4C3Y A;  1O3X A;  4IE4 A;  4MAL A;  2WBA A;  2ZZC A;  1W9R A;  4TN7 B;  3S4U A;  2WES A;  3SM8 A;  4JI6 T;  2BKP A;  4XXG A;  3MZK B;  1LTX R;  3BI2 A;  4JI2 T;  1HNZ T;  4CI1 B;  2X9H A;  4UDQ A;  1D1B A;  2YK0 A;  3L09 A;  1D7Y A;  5EB5 A;  3ZYX A;  3QFB A;  2LRL A;  1MMA A;  2B9X A;  3WAK A;  2Z5X A;  2L9Q A;  4YFS A;  1J5W A;  4K8D A;  4B63 A;  3FB2 A;  1LQT A;  3MAC A;  1PJ5 A;  1GSN A;  4B64 A;  1K0J A;  4AT2 A;  2WP9 A;  2VKD A;  1Y56 B;  4H9S E;  1H86 A;  3R9U A;  3ISH A;  5FXZ A;  3CMM A;  5JRC B;  1VBC 4;  4HWH A;  4AKG A;  1F8R A;  1G8X A;  2NTY A;  1COY A;  3SS1 A;  4QH5 A;  1FOH A;  4H2N A;  4OCG A;  4LF5 T;  1D4C A;  3DA1 A;  4K22 A;  3P4S A;  4G73 A;  3GQH A;  1EL9 A;  4GB3 4;  3SFE A;  3ZYK A;  1K5M D;  2GQW A;  1D1C A;  1GEU A;  2LE8 A;  2XM2 A;  4U2S A;  4WW0 A;  3ZMU B;  1OED A;  3UCL A;  1F6M A;  5HXR A;  5HXS A;  1RVF 4;  2BG9 B;  3GA8 A;  4H4V A;  3DGZ A;  3ZMZ B;  3F8R A;  2BBJ A;  1NEN A;  3U78 A;  4GCM A;  2A3D A;  3D8X A;  2KLQ A;  2WY2 A;  3G5R A;  1LV0 A;  3C50 A;  4HFD A;  4O4I E;  3C4W A;  3ITJ A;  2UU9 T;  3J8F 4;  3VU7 H;  1T72 A;  2XVE A;  4WCT A;  3P4P A;  3JSK A;  1ZV4 X;  1B5Q A;  4AP3 A;  4H9N C;  4DMV A;  4YSY A;  1OJA A;  4LF9 T;  3CGC A;  4JEU B;  4GRT A;  3EVY A;  2XQ8 A;  2CXL A;  3RED A;  4C3X A;  1RYI A;  2C66 A;  4AQY T;  3S5W A;  2V8S V;  5J0Z A;  3LAD A;  2BDE A;  1ZDL A;  2UUC T;  1NEK A;  1FEC A;  2X9X A;  1MO9 A;  3V5U A;  3UFE A;  3ESL A;  5DQV A;  4Y4M A;  3Q5D A;  2W61 A;  5LCY A;  2J62 A;  3TLS A;  4APN A;  2Y48 B;  1CJ3 A;  4EYY R;  3QSM A;  3ZDN A;  1TDE A;  1RUJ 4;  4XWZ A;  4RG4 A;  5HCM A;  1D0X A;  4H50 A;  4ASK A;  1XMO T;  1IAP A;  3DJB A;  2E4G A;  4Z44 A;  3QB5 A;  1BKW A;  2FUP A;  3N9L A;  2XFO A;  3PDY A;  4Y4N A;  4HFB A;  2AR8 A;  4IDN A;  4MHC A;  4XZC A;  2X5I D;  3C4A A;  1MIY A;  4YT0 A;  5L4H A;  3PV0 F;  5EOW A;  1GQE A;  1GRE A;  2LOS A;  4KP3 C;  2CDU A;  2BAB A;  5IQ1 A;  1S2Q A;  2YQU A;  1RUF 4;  2G0U A;  2ZZ0 A;  2BKN A;  2EHO D;  2R04 4;  4KMC A;  2B7S A;  2OLT A;  1BWC A;  2GR2 A;  3R6N A;  1N32 T;  2YIN A;  4TWH A;  3NIX A;  2CLY C;  4EMW A;  2WPF A;  3RI5 A;  5JDN A;  2C70 A;  4C77 A;  1F8S A;  3SQP A;  5LV9 A;  3DGH A;  4G6G A;  4H4X A;  1PO1 4;  3AE7 A;  3CQC B;  4XBF B;  1UK5 A;  1KFY A;  4Q4V 4;  2J47 A;  3BQI A;  2JQK A;  2JKC A;  4J34 A;  3N9N A;  2RS1 4;  3UTE A;  4Q4W 4;  1IBK T;  5F3J A;  1VCS A;  4RSL A;  5JCI A;  2L3L A;  3AE1 A;  4EIW A;  1SHZ C;  4J2C A;  4NXN T;  1GOS A;  4DVD A;  1Q1R A;  4H9Q C;  2VQE T;  3UUL A;  3RF1 A;  4JLE A;  4PAA A;  4PNI A;  2ODV A;  5DJQ C;  4K0U A;  3C98 B;  5KMG P;  3COX A;  2NTX A;  2X0H A;  3ZCI A;  1GER A;  1JNR A;  4DV6 T;  5E0O A;  2JB3 A;  4H4T A;  3BHF A;  4O4H E;  3N2O A;  2GMJ A;  1POV 0;  2XFP A;  5GSN A;  2XLS A;  4G2A A;  2W0H A;  2X3N A;  1JRY A;  1RHI 4;  3EAN A;  4UVC B;  3LG7 A;  1PBD A;  3FZF B;  2CHO A;  4A6N B;  4C74 A;  4AQG A;  3UFG A;  3ZC0 A;  4PAB A;  4NPP A;  1CHU A;  2N9D A;  4ZS2 A;  5LOV E;  1E1N A;  1RUI 4;  4CCQ A;  2RM2 4;  3L8K A;  4A98 A;  1VRQ B;  4B69 A;  5LA6 E;  3ZN0 B;  1WR0 A;  4TM0 A;  1LVK A;  2BK5 A;  2WZI A;  1LPF A;  1U4Q A;  3D1C A;  2C0S A;  1NG3 A;  5C2T A;  4M52 A;  4TV9 E;  4IE6 A;  2BXR A;  3GWF A;  3SWH A;  2XDO A;  2JBV A;  2RGH A;  1T8B A;  3N9M A;  3IWA A;  2V7M A;  4JBW F;  1UX5 A;  5BRT A;  4U2L A;  5AQI B;  4EM3 A;  2WHD A;  4PW8 A;  4H4P A;  5JR9 B;  4FX9 A;  3B3R A;  3ALL A;  4ZHQ E;  1YQ3 A;  3B57 A;  3SZC A;  4F8H A;  2YVF A;  4DV5 T;  4JNQ A;  4HA6 A;  1HNW T;  4ILA A;  4JEH B;  2KZ7 B;  3PU3 A;  5H6Q B;  2VQF T;  3UKF A;  4L5G A;  3EUH A;  3AED A;  3F8P A;  1RUH 4;  4DBR A;  4AI6 A;  5FY0 A;  4CY8 A;  1H82 A;  1O95 A;  4AKI A;  3AEA A;  4UEM A;  1N33 T;  2BS3 A;  2VOU A;  4DND A;  4B3R T;  3GMI A;  4H2P A;  1YQ4 A;  5DAB A;  2H88 A;  3NK1 X;  1R8I A;  4PAG A;  3CQG B;  2D0T A;  3F57 A;  5ABF A;  2XY8 B;  2BRY A;  4DR3 T;  1LRZ A;  2X66 A;  1PDH A;  1GTH A;  2YLZ A;  1BZL A;  1IBL T;  4DGK A;  4JI1 T;  3PUV F;  4E7Z A;  4CNK A;  3DK9 A;  3ICR A;  5KOW A;  3HYV A;  1CF3 A;  1XPQ A;  2W00 A;  3KV6 A;  4OFZ A;  2CPT A;  3ONL C;  2K24 A;  2WET A;  3O1J A;  4N9X A;  3I1A A;  3CWZ B;  2B9Y A;  3PUY F;  1W4X A;  3NYC A;  2V6Y A;  4DV2 T;  4GR1 A;  3RKO A;  4LA1 A;  3GD3 A;  1IJ6 A;  3UKH A;  2WB5 A;  2VZ2 A;  4EQR A;  4LMK A;  5BUK A;  4QWN B;  5LB7 B;  2BRA A;  4BK1 A;  2CRB A;  1XHC A;  1M7K A;  2GR1 A;  3EHZ A;  4Z43 A;  3ANW B;  3P9U A;  1J5E T;  4YSZ A;  2J3N A;  1TDO A;  4X65 T;  2VVN A;  3URH A;  4DR4 T;  4U8O A;  2R9Z A;  1DOE A;  4OPU A;  4YKG A;  3HKE E;  2XQ5 A;  1AOG A;  4QHO A;  3RKG A;  4OHF A;  3IHR A;  2ZM8 A;  2DCF A;  1DXL A;  1IBM T;  1Z8U A;  3DH9 A;  2V6O A;  3DJE A;  3LB8 A;  1Y0P A;  2I0M A;  2J4G A;  2CXD A;  2BAC A;  3ALM A;  5LHH B;  2X67 A;  5ABH A;  1RUC 4;  2Q9Q C;  5BMV E;  1GES A;  2GR3 A;  4LF4 T;  4PK4 A;  5JQG E;  3NKZ A;  2PHH A;  3AE3 A;  2ES0 A;  4LF8 T;  5LYJ E;  3DK4 A;  3Q9T A;  4H4Z A;  2E9X B;  4ZOL E;  2X8H A;  2XLT A;  4BJZ A;  3KU9 A;  2ZLY A;  4HFV A;  1TDK A;  2CFY A;  2RR1 4;  2NWB A;  2XLP A;  2FJB A;  5AQP B;  2K3W A;  4X1K E;  3SFD A;  1VBA 4;  2XTL A;  3K30 A;  4IE5 A;  4IL4 A;  2IC6 A;  3AA0 B;  1H7C A;  4Z2R A;  3AXJ B;  2A8X A;  5TR3 A;  2MOZ A;  3SRZ A;  2CHN A;  2AAQ A;  1GTE A;  3VRD B;  2HN2 A;  4NWZ A;  2WWU A;  3DK8 A;  2V61 A;  2JQ9 A;  5LBM A;  1NA1 D;  4FK1 C;  3C64 A;  2GK9 A;  5LHI B;  2YG7 A;  4Q4X 4;  3FI7 A;  2XUE A;  4IV9 A;  4U8L A;  3MKD A;  5FS8 A;  2VUR A;  5HWX A;  4LFC T;  2NW7 A;  4QX7 B;  4B68 A;  2QA1 A;  2XSA A;  2WPE A;  1NHQ A;  1N4U A;  2VRM A;  4O2B E;  3CTY A;  4EIP A;  5JDG A;  4EEB A;  1JU2 A;  2YLX A;  4EM4 A;  3FBZ A;  5FVL A;  2BG9 E;  2WMN A;  2LM2 A;  4J33 A;  2YDS A;  1HYU A;  2TPR A;  1H7X A;  1PHH A;  4FDC B;  2W0G A;  4DR5 T;  1OOP D;  4HFC A;  4BV6 A;  4OPI A;  4I0U A;  2W2U A;  3HKC E;  2IVD A;  1ZOY A;  5HCJ A;  3C51 A;  1GRH A;  2BS4 A;  3QVP A;  2HHH T;  1OJD A;  4CNJ A;  4H4W A;  3T31 A;  4EED A;  1KNR A;  3UUB A;  3ZYL A;  3CQX C;  4U74 A;  3LK3 B;  4LFA T;  4IT4 A;  5JDL A;  3AAI A;  3EF6 A;  1ZEE A;  4PK5 A;  5FS9 A;  4BJY A;  4IRE A;  4JN9 A;  4UV9 B;  1AL2 4;  1IUW A;  3ALJ A;  3QSE A;  4EXT A;  4OYK A;  1DOD A;  1YKJ A;  4BUR A;  2V7J A;  4I55 E;  3HKB E;  4ISS A;  3O1H A;  3K7T A;  2RS3 4;  4UF0 B;  4O4J E;  4BAY B;  4D03 A;  5LNK A;  1I6Z A;  1F8W A;  1E39 A;  4UR9 A;  3N9O A;  1X31 B;  2KND A;  4DBQ A;  4NEW A;  4ZI7 E;  3Q5W A;  1XHZ A;  2X8G A;  1E1H B;  5BVA A;  3LBX B;  1PS9 A;  2R0P A;  1Q1W A;  3RP6 A;  2YN6 A;  3I3L A;  1GRF A;  4YJ2 E;  3TKL B;  1REO A;  2XZE A;  3RGL A;  2R4J A;  3NK0 X;  3E1T A;  4NTC A;  3GDN A;  3PTR B;  4U8P A;  2WCA A;  3ZT5 A;  5IWA T;  3FZM B;  1EAH 4;  2R07 4;  2KIN B;  3QUJ A;  5AQG B;  1MMN A;  5KVI A;  4YXD A;  4EOZ B;  2OA1 A;  5LHG B;  5KMS A;  1QUU A;  5LGN B;  1FIO A;  1IUV A;  5AQH B;  3RLF F;  2C75 A;  2ZBW A;  3C4N A;  1ZOV A;  3ZMT B;  2CBJ A;  4L9I A;  2WDR A;  3J7Y q;  3RHW A;  3KBT A;  5J7X A;  4B6X A;  5CA1 E;  4GYS A;  1ZMD A;  3CPI G;  2Q0K A;  5AQL B;  1TYP A;  1K0I A;  2DWK A;  2VRL A;  4AT0 A;  4H4Q A;  1VRB A;  1Q9I A;  4CY6 A;  3RIU A;  3EAO A;  3F8D A;  3BI4 A;  3QB5 K;  4J2W A;  1HX1 B;  4HN9 A;  3ZYM A;  3K7M X;  3BI5 A;  3ZC1 A;  1F3P A;  1S3B A;  2IIU A;  3ICT A;  2YR4 A;  2C64 A;  3NTD A;  1HF8 A;  1D0Z A;  4H2R A;  4HWF A;  2OAM A;  1CUN A;  3TLU A;  3CGD A;  4ERR A;  4ILB A;  4A99 A;  4K7Z A;  4DV1 T;  3ABV A;  2VVM A;  3H4K A;  4TNW A;  4FI5 A;  4LML A;  3Q5X A;  5IHY A;  2EQ6 A;  4WBN E;  2LRK A;  2CCQ A;  2X9Y A;  5U25 A;  2C76 A;  3PJA J;  1XDP A;  1YXR A;  4U8M A;  1PBB A;  4PJJ A;  4TNV A;  2YLS A;  1KSU A;  2IAK A;  2WU2 A;  4CN6 A;  2NR4 A;  1EBD A;  4UDP A;  2IC9 A;  1VG0 A;  2ZZB A;  4NZH A;  1R08 4;  3OPC A;  4O8S A;  5IPY A;  2WQY A;  5HHF A;  4GYR A;  5AQS B;  1VQW A;  4TX5 A;  4U72 A;  4JV5 T;  3AYI A;  4ICY A;  1VBB 4;  2IW5 B;  3K3N A;  3N9P A;  5HXC A;  5FNV E;  1U5P A;  2R4E A;  2RP4 A;  3LSV A;  1E7P A;  2YU2 A;  2YVG A;  3N9Q A;  3KPF A;  4IDO A;  3SGL A;  5FY1 A;  1DJQ A;  1FEW A;  3H8I A;  4H9O C;  4GIW A;  2EX3 A;  5JRC A;  3L8R A;  4HEA A;  5LMU T;  5JCM A;  4A97 A;  1VBE 4;  4CXY A;  1K0L A;  4HWI B;  4UVA B;  4KHP T;  4DV3 T;  2CLY B;  2K48 A;  2LSJ A;  5FKY A;  2PYJ A;  5U63 A;  4CZZ B;  2EHO C;  4UXN B;  2WDV A;  3T1Y T;  1EL7 A;  5HEG A;  4YY3 T;  4ECH A;  1YW0 A;  3NRX A;  3UU3 A;  5JRE A;  2VWA A;  1HFA A;  2EQ7 A;  2YDQ A;  1XHX A;  1YQZ A;  2W4X A;  2XLU A;  4IA6 A;  4AP1 A;  3H37 A;  2P9B A;  3QSS A;  4A9W A;  2E1M A;  1AR6 4;  4CI2 B;  1GRA A;  3A8Y C;  4ZZC A;  2C67 A;  3FIM B;  3PO7 A;  4GUV A;  3ICS A;  3OVU A;  1VOM A;  5JDF A;  3ZSS A;  2H89 A;  4X1I E;  3UKP A;  3X1D A;  4JI5 T;  1GRG A;  4H9P C;  3EDU A;  3JBG 4;  2XAS B;  4ADW A;  1VBD 4;  4HFH A;  4I59 A;  3I6D A;  4OVI A;  3CKD A;  2HH7 A;  4NUU A;  1LVF A;  3IBP A;  1HX8 A;  2YVJ A;  3AE4 A;  4JI4 T;  3AAA B;  5LJN A;  5EZY E;  3GRT A;  2JK6 A;  2JQQ A;  1M6I A;  2C5J A;  4J31 A;  3SZF A;  4YSX A;  3WAJ A;  3UU8 A;  1OED C;  2HN1 A;  2BA9 A;  4O5Q A;  2FJE A;  2VKO A;  2QGS A;  1QLB A;  3OTO T;  4A5L A;  2M6B A;  4HFE A;  2XAF B;  2BVL A;  3AA6 B;  3PUX F;  1PXB A;  2LJL A;  3GYX A;  2CWY A;  4JY3 A;  2NOX A;  4PFO A;  5GON E;  3AEC A;  4P0B A;  5L4E A;  2W66 A;  4X9M A;  2ACZ A;  3IC9 A;  1VDC A;  3IF9 A;  4CCR A;  2JPF A;  2Y6X A;  3KD9 A;  2GH5 A;  1L9C A;  2OLN A;  2XCG A;  2LOP A;  4GOU A;  4E0V A;  2V3A A;  3KKJ A;  4JI0 T;  5HWY A;  3DJG X;  4IDP A;  5CJ5 A;  3LJC A;  5KDM C;  2QAE A;  1EZ3 A;  3PUR A;  2A89 A;  4B3M T;  3ZLI A;  3T1H T;  3ATQ A;  5A1L A;  4H9R C;  3NG7 X;  1B7T A;  5CFB A;  1UGO A;  2AE9 A;  2GF3 A;  4Z91 A;  1GXF A;  5LG4 A;  2V5Z A;  1PJ7 A;  2BYB A;  4PDW D;  4U7Y A;  3OZ2 A;  4II2 A;  2QRX A;  4LMJ A;  2X9W A;  4YWO A;  4OK0 A;  5L3B B;  1ZKQ A;  2LSG A;  1XI1 A;  1RUG 4;  5AQU B;  4G9K A;  2XQ7 A;  1CC4 A;  4CN4 A;  5KMP A;  2E8I A;  1AR9 4;  2ZMA A;  5L2L A;  2KXP B;  2JAE A;  3VR8 A;  3AEF A;  1NAF A;  3OYX A;  5AQV B;  1GRB A;  2VAS A;  4DR1 T;  1BR2 A;  4QXC B;  3RRW A;  3RYI E;  4PJM A;  1E1L A;  5LJM A;  1FEB A;  3JAD A;  4GF7 A;  2HWB 4;  2UXC T;  2D2S A;  4HGA A;  1BR1 A;  3BQK A;  4DID B;  1VRH 4;  2X68 A;  4B65 A;  3NK2 X;  2NPX A;  1B8S A;  3DP7 A;  3IHG A;  2VQB A;  3UKA A;  2Y6Q A;  1P2H A;  3O0H A;  3HR0 A;  2CXF A;  4TM4 A;  3O1I A;  3MK7 C;  2JB2 A;  4X20 E;  5L3F B;  4BK2 A;  5JCL A;  3F31 A;  4NXM T;  4GK5 E;  2RGJ A;  4E7S A;  3O9X A;  1JEH A;  1UUR A;  2PZS A;  2R45 A;  4EQS A;  1MND A;  4WYV A;  2O9Z A;  5KOX A;  2GMH A;  5HEU A;  4JI3 T;  4ZI2 D;  1WYB A;  5JR9 A;  1S2Y A;  2KT9 A;  4OPL A;  1HTJ F;  3VKH A;  2CUL A;  4L0R A;  3NBX X;  5JDM A;  2Q9Q B;  5CGM A;  5FS6 A;  2VL8 A;  5L47 A;  2W67 A;  4AQF A;  4O4L E;  1XDO A;  2W63 A;  3AYL A;  3UQ7 A;  2X0L B;  2OA5 A;  3F2E A;  2Q0L A;  2OLO A;  2WOV A;  4TWF A;  3KV5 A;  1D0Y A;  3RRC A;  2UXB T;  1AJ3 A;  2GVC A;  4OYJ A;  4ZCC A;  3MXZ A;  2YEV C;  5FVK A;  1SUM B;  2YG6 A;  3RP8 A;  4ZXL A;  1ZX9 A;  2DLR A;  2LEH A;  2FBW A;  4USR A;  1NPX A;  2V7I A;  4G63 A;  3SY4 A;  4EAH A;  1SEZ A;  1CJ2 A;  2C73 A;  3TLT A;  4GAV A;  4TM1 A;  2AXD S;  3JAE A;  3DTO A;  1D4E A;  4D04 A;  4Z8X A;  5FS7 A;  4DR6 T;  4I58 A;  4IGU A;  5ADX L;  3CNP A;  4H4S A;  2GRT A;  3QFA A;  1FJG T;  4WX1 A;  3UKL A;  3UUM A;  3VKG A;  4Q4Y 4;  2WAU A;  4ILU A;  2LFC A;  3UTH A;  3ZKR A;  2VKH A;  1NCQ D;  3TLV A;  4EB6 E;  3BNU A;  3HL6 A;  1HRV 4;  1S3E A;  3KV4 A;  1O5W A;  4QH4 A;  2Q6U A;  2PW9 A;  3T2Y A;  2R6G F;  2LKH A;  3GN5 B;  4X64 T;  2L8K A;  2WU5 A;  5JR9 C;  1DOC A;  2XHE B;  2HQM A;  4OPD A;  1M62 A;  3ANW A;  4H7U A;  2LSK A;  2IVE A;  1MIV A;  2XVJ A;  1E1M A;  4UP3 A;  4EZH A;  4AQF C;  3M12 A;  4AKL A;  1HCI A;  2XFU A;  4ILC A;  5C3J A;  5KNL A;  1N36 T;  4Z24 A;  1HNX T;  3L3P A;  3OJA A;  1PJ6 A;  3QOF A;  2XM1 A;  1H81 A;  4NUV A;  4EMJ A;  4YHH T;  4AOX A;  2EQ8 A;  3LJP A;  2EQ9 A;  2C5K T;  4B66 A;  3PE0 A;  1EL8 A;  4U3C A;  4JNA A;  3UT5 E;  2XAH B;  3KV9 A;  4DO0 A;  5ETW A;  2DWG A;  3BNM A;  3O4X E;  1SA0 E;  3GD4 A;  1BF3 A;  3Q2M A;  3T8O A;  1H6V A;  4X62 T;  4IIJ E;  2YKS A;  1DOB A;  4DR7 T;  1PXC A;  2YU1 A;  3T2K A;  3GMC A;  1BGN A;  4JDR A;  2GQF A;  3FHN A;  3CNT A;  1WLX A;  1OED E;  3H3A A;  2WEU A;  4USQ A;  5HEJ A;  3P8C D;  3SUC A;  3RC3 A;  2YWL A;  3P4R A;  3CIR A;  4C90 A;  3P50 A;  1NAA A;  1XWM A;  3FG2 P;  1N34 T;  2LSY A;  3NVO A;  3KIN B;  4WBO A;  3P1W A;  1D1A A;  2B7R A;  3Q6J A;  4TM3 A;  3AE5 A;  1OJC A;  4U2T A;  3EDV A;  3FMW A;  4COF A;  1TDN A;  2PJQ A;  4II3 A;  2A87 A;  1FCD A;  4H63 H;  4G6H A;  5JCN A;  4B3T T;  3KDS E;  3CML A;  4ZCD A;  5AQM B;  1ELI A;  2LHN A;  1MOK A;  4HWC A;  4REK A;  4CBQ A;  4NTD A;  4X9N A;  1V59 A;  4KHZ F;  5LMN T;  4GKJ T;  2V6X A;  4Z26 A;  3NGC X;  2W62 A;  2YOE A;  1V9D A;  5CQF A;  4LII A;  2Z6E A;  3JC6 C;  2M6I A;  4JI7 T;  2PY5 A;  2V60 A;  3ETV A;  4CXW A;  4B1B A;  3CNJ A;  4U8K A;  3K3O A;  4Q25 A;  2ZM6 T;  2B9W A;  1L9E A;  2ZM0 A;  1E2A A;  2M67 A;  4CXX A;  1W0A A;  1CC6 A;  4J36 A;  3RNM A;  5FMN A;  4DSG A;  2WP5 A;  4C91 A;  2WSS V;  2XVI A;  3TLW A;  2MAW A;  1CBO A;  3ZCJ A;  5BR8 T;  1S35 A;  4YTN A;  3NLC A;  3AEE A;  3ONJ A;  3MJX A;  1L0V A;  3KPK A;  4X5T A;  3NNE A;  3AA1 B;  3JCF A;  4PK6 A;  4JYA T;  4NTE A;  3M13 A;  1LJ1 A;  1JOA A;  3Q9D A;  1K4Q A;  3UU6 A;  2CMR A;  3UQ4 A;  2XFQ A;  1PBF A;  2QA2 A;  3KVE A;  3ZPO A;  3NT6 A;  2I59 A;  4O5U A;  2MYS A;  3G06 A;  3WI3 A;  4BJN A;  4Z90 A;  1FL2 A;  2Q7V A;  2R46 A;  4DV7 T;  3T14 A;  1IUX A;  1MIW A;  4EGW A;  2WMO A;  2UUA T;  5BUL A;  3PU8 A;  1H84 A;  4YJ3 E;  1BR0 A;  3CN8 A;  3LBX A;  3PUW F;  4U8I A;  4ZI3 D;  2JRK A;  3T0K A;  4EV6 A;  4DV0 T;  5HYM A;  3AEB A;  4PJN A;  3B6D A;  4G74 A;  3ZJ2 A;  4DV4 T;  5M0Z A;  1WRD A;  3LDQ B;  3UOZ A;  3PUS A;  3NYE A;  5M10 A;  3GDP A;  2CEA A;  3LFM A;  1Y64 B;  5AQR B;  1EL5 A;  3NRN A;  4OPG A;  5LXT E;  5AQN B;  5J2T E;  2C3C A;  2WM9 A;  4UDR A;  4TWD A;  2F5Z A;  2I6H A;  4X66 T;  4YHJ A;  2ARD A;  2H3R A;  2NW9 A;  1AR7 4;  5FMH A;  2QVA A;  2BC0 A;  2Y6R A;  3RH3 A;  2YR6 A;  2E9X D;  5L3C B;  2EHO B;  1LQU A;  3FBS A;  2RA1 A;  4OPC A;  3GWH A;  3HZL A;  3CX8 B;  1XNR T;  3E08 A;  1IJ5 A;  2V7L A;  1RUE 4;  5JVD E;  3WE0 A;  2J1D G;  4AXP A;  3CGE A;  1WR6 A;  1LKX A;  1BGJ A;  3V3N A;  2R7F A;  2XQA A;  2YR5 A;  3LXD A;  2V7K A;  1CJ4 A;  3GYJ A;  1AR8 4;  2XFN A;  2V5C A;  4Y4L A;  3I0O A;  4M1P A;  2X0Y A;  5CB4 E;  5J1G A;  4OX9 T;  3L39 A;  3BQL A;  2UXN B;  1QO8 A;  3FZL B;  3OC4 A;  3W15 B;  3QJ4 A;  4B67 A;  3AVS A;  1ZMC A;  3UP5 A;  2IML A;  4PFP A;  1NWM X;  2VVS A;  1HXS 4;  3AA7 B; 
#chains in the Genus database with same CATH homology
 2B9Y A;  1E6E A;  2A89 A;  2GB0 A;  5EBK A;  3UOX A;  2C7G A;  3ATQ A;  4IVO B;  1KDG A;  1W4X A;  2XLR A;  1OJT A;  3NYC A;  1NG4 A;  1N4W A;  4GR1 A;  4LA1 A;  3NG7 X;  3V76 A;  3GD3 A;  1MXT A;  3UKH A;  1Y56 A;  2VZ2 A;  3VR9 A;  3AB1 A;  2AQJ A;  4EQR A;  1B37 A;  2GF3 A;  5U1O A;  1CC2 A;  2IID A;  1PBC A;  1KSS A;  5BUK A;  1NHS A;  1GXF A;  2BRA A;  3SYI A;  4BK1 A;  2V5Z A;  1D7L A;  1PJ7 A;  1XHC A;  2GR1 A;  2BYB A;  2I0Z A;  2XYO A;  5EB4 A;  2YG5 A;  3UKK A;  4Z43 A;  3OZ2 A;  3P9U A;  4II2 A;  4YWO A;  1GV4 A;  4GDE A;  3NHO X;  1CL0 A;  1ZKQ A;  4YSZ A;  1QJD A;  2J3N A;  4NNJ A;  1OJ9 A;  2BK4 A;  1CC4 A;  4G9K A;  3GMB A;  5KMP A;  1TDO A;  4GDP A;  3K7Q X;  3URH A;  1GRT A;  2JAE A;  4EQX A;  4U8O A;  5KXJ A;  3VR8 A;  3AEF A;  3DME A;  2R9Z A;  1DOE A;  1GRB A;  3AE2 A;  3PVC A;  4OPU A;  5HXI A;  4YKG A;  3ADA B;  4P9S A;  1AOG A;  4JY2 A;  1E1L A;  1FEB A;  2BK3 A;  4GF7 A;  1DXL A;  3DH9 A;  4KX6 A;  1H83 A;  3T37 A;  2V6O A;  3DJE A;  3LB8 A;  1CJC A;  3NN0 X;  1Y0P A;  3AD9 B;  4H4U A;  2BXS A;  2XVH A;  2BAC A;  2RAB A;  3C96 A;  2BC1 A;  3ALM A;  2PYX A;  1GES A;  2GR3 A;  4C5O A;  2WDQ A;  4B65 A;  3NK2 X;  2PHH A;  3AE3 A;  2NPX A;  3AE8 A;  3P4Q A;  1B8S A;  1GPE A;  1O94 A;  3BHK A;  3IHG A;  1D5T A;  3DK4 A;  2VQB A;  3Q9T A;  1LVL A;  2TMD A;  4H4Z A;  3UKA A;  1B4V A;  2Y6Q A;  4YKF A;  4CRT A;  2X8H A;  2XLT A;  1P2H A;  3O0H A;  1GND A;  4BJZ A;  2DKH A;  4TM4 A;  3KU9 A;  2JB2 A;  2CFY A;  1TDK A;  2XLP A;  4BK2 A;  2FJB A;  5JCL A;  1NHP A;  2WP6 A;  4GAP A;  4X4J A;  3SFD A;  2WPC A;  3CPH G;  4K5S A;  3S61 A;  2YG3 A;  2RGJ A;  3L1R A;  4EMI A;  3GWD A;  3K30 A;  3GRS A;  1JNZ A;  3CGB A;  4Z2R A;  1JEH A;  5TR3 A;  2A8X A;  3NKS A;  2GR0 A;  2R45 A;  2AAQ A;  4EQS A;  1GTE A;  3VRD B;  4NWZ A;  2YM2 A;  3DK8 A;  3AEG A;  5IQ4 A;  4YTP A;  1TDF A;  2O9Z A;  2V61 A;  2GMH A;  3NYF A;  5KOX A;  3LZX A;  4J56 A;  4FK1 C;  2YG7 A;  1M64 A;  4U8J A;  2C4C A;  1NHR A;  3CND A;  1Z6L A;  4H4R A;  4A7A A;  3AD8 B;  4IV9 A;  3UTF A;  2BCG G;  4U8L A;  5FS8 A;  1S2Y A;  1ZP0 A;  2DKI A;  1XDI A;  4OPT A;  2VQ7 A;  4OPL A;  2CUL A;  2X50 A;  2YG4 A;  1N1P A;  2GEW A;  3AD7 B;  4KPR A;  3GYI A;  2FJA A;  4B68 A;  2QA1 A;  5FS6 A;  3NN6 X;  2WPE A;  1NHQ A;  1N4U A;  2VRM A;  3AWI A;  3CTY A;  4MJW A;  4EIP A;  1IUT A;  4HB9 A;  4C3Y A;  3AYL A;  1JU2 A;  2YLX A;  4EM4 A;  1D4D A;  2VVL G;  2WBA A;  2Q0L A;  2ZZC A;  2OLO A;  2WOV A;  2WES A;  3SM8 A;  4J33 A;  4XXG A;  1HYU A;  1LTX R;  3BI2 A;  2TPR A;  1H7X A;  2GVC A;  1PHH A;  2XVF A;  4FDC B;  4ZCC A;  5CKU A;  4K5R A;  4BV6 A;  4UDQ A;  1E1K A;  4OPI A;  1IUS A;  1ZK7 A;  1FEA A;  3CPJ G;  4NEV A;  2YG6 A;  2IVD A;  3RP8 A;  1D7Y A;  5EB5 A;  1ZOY A;  3ZYX A;  1ZX9 A;  3UKQ A;  3FPZ A;  3QFB A;  1GRH A;  2FBW A;  4USR A;  5DBJ A;  4DSH A;  1NPX A;  2B9X A;  2Z5X A;  2BS4 A;  3QVP A;  3SY4 A;  1IUU A;  1OJD A;  2UZZ A;  4H4W A;  3T31 A;  4CNJ A;  4K8D A;  1SEZ A;  1CJ2 A;  2C73 A;  4B63 A;  1LQT A;  1PJ5 A;  4GAV A;  1KNR A;  2QCU A;  1GSN A;  4B64 A;  1K0J A;  3SXI A;  2WP9 A;  4AT2 A;  1Y56 B;  4TM1 A;  2NVK X;  3EF6 A;  1GT8 A;  5FS9 A;  1H86 A;  3QVR A;  1D4E A;  3R9U A;  4BJY A;  4D04 A;  5L46 A;  3ISH A;  3CMM A;  5FS7 A;  4I58 A;  4JN9 A;  3CNP A;  5HY5 A;  1KNP A;  1IUW A;  3ALJ A;  1F8R A;  4K2X A;  4H4S A;  2X99 A;  1COY A;  2GRT A;  3QFA A;  3QSE A;  1FOH A;  4H2N A;  4OCG A;  2C3D A;  1DOD A;  3RHA A;  1YKJ A;  1D4C A;  4WX1 A;  3UKL A;  4BUR A;  2YLW A;  3DA1 A;  4K22 A;  3P4S A;  2LFC A;  3K7T A;  4G73 A;  3UTH A;  3GQH A;  1EL9 A;  3SFE A;  4D03 A;  2E5V A;  1YY5 A;  2GQW A;  1DJN A;  4RG3 A;  1F8W A;  1GEU A;  4U2S A;  1E39 A;  1X31 B;  1VG9 A;  3BNU A;  3UCL A;  1F6M A;  4NEW A;  1S3E A;  1O5W A;  4Z2U A;  2X8G A;  4IA5 A;  2Q6U A;  5BVA A;  3VRB A;  3T2Y A;  4H4V A;  1PS9 A;  3DGZ A;  2WU5 A;  2R0P A;  3F8R A;  1NEN A;  1DOC A;  1Q1W A;  2HQM A;  4GCM A;  3D8X A;  4TLZ A;  3RP6 A;  4OPD A;  3I3L A;  1GRF A;  2Z5Y A;  1LV0 A;  3G5R A;  4H7U A;  1REO A;  2IVE A;  1TRB A;  3ITJ A;  2XVJ A;  1E1M A;  4UP3 A;  2R4J A;  3NK0 X;  3E1T A;  4NTC A;  2XVE A;  3AE6 A;  3DJD A;  3GDN A;  3M12 A;  3P4P A;  2GAH B;  3JSK A;  4U8P A;  1B5Q A;  4WCT A;  2XFU A;  4AP3 A;  4LU6 A;  5C3J A;  5KNL A;  4YSY A;  1OJA A;  3CGC A;  4A6N A;  4Z24 A;  4GRT A;  5KVI A;  4YXD A;  4H4Y A;  2OA1 A;  1PJ6 A;  3RED A;  5KMS A;  4Z25 A;  1H81 A;  1IUV A;  4C3X A;  4EIQ A;  2C75 A;  4EMJ A;  1RYI A;  4AOX A;  2ZBW A;  2C66 A;  2EQ8 A;  1JRZ A;  3C4N A;  3LJP A;  2EQ9 A;  3UOY A;  1ZOV A;  4BK3 A;  2WDR A;  4B66 A;  5J7X A;  3S5W A;  1ZMD A;  1P2E A;  3CPI G;  3LAD A;  1ZDL A;  2Q0K A;  1TYP A;  1K0I A;  1NEK A;  1FEC A;  2VRL A;  1EL8 A;  3LOV A;  4AT0 A;  1MO9 A;  4H4Q A;  1Q9I A;  4JNA A;  4CY6 A;  3EAO A;  3BNM A;  4YTM A;  3F8D A;  3BI4 A;  4Y4M A;  3SZW A;  3GD4 A;  1BF3 A;  4J2W A;  4APN A;  3K7M X;  2R0G A;  2RGO A;  3G5Q A;  1H6V A;  3BI5 A;  1F3P A;  3AE9 A;  1CJ3 A;  1S3B A;  3QSM A;  3ZDN A;  1TDE A;  4XWZ A;  1DOB A;  4RG4 A;  1PXC A;  3T2K A;  3GMC A;  2WOW A;  1BGN A;  3ICT A;  2YR4 A;  4H50 A;  4JDR A;  2GQF A;  2E4G A;  2C64 A;  3CNT A;  3NTD A;  4Z44 A;  4H2R A;  1TYT A;  3VRA A;  2OAM A;  1BKW A;  2XFO A;  3CGD A;  4Y4N A;  2WEU A;  4USQ A;  4AOS A;  4A99 A;  3SUC A;  2AR8 A;  4K7Z A;  2VVM A;  3ABV A;  3H4K A;  2YWL A;  2YLT A;  3GSI A;  4J57 A;  3P4R A;  3C4A A;  3CIR A;  1L9D A;  4YT0 A;  1NAA A;  2BCP A;  2CVJ A;  5EOW A;  2EQ6 A;  1GRE A;  3FG2 P;  2CDU A;  2BAB A;  3P1W A;  5IQ1 A;  1S2Q A;  2B7R A;  4XWR A;  3Q6J A;  4TM3 A;  5U25 A;  3AE5 A;  1GAL A;  1OJC A;  2YQU A;  3FMW A;  4U2T A;  5KVH A;  2C76 A;  1TDN A;  2ZZ0 A;  4II3 A;  3T2Z A;  2A87 A;  2B7S A;  4U8M A;  1FCD A;  1BWC A;  5KMQ A;  1PBB A;  2B76 A;  2GR2 A;  4G6H A;  4A65 A;  5JCN A;  1ONF A;  2YLS A;  4ZCD A;  2FJD A;  1KSU A;  2WU2 A;  3NIX A;  4EMW A;  1ELI A;  5JCK A;  1EBD A;  2WPF A;  1MOK A;  4UDP A;  1KF6 A;  3VQR A;  4REK A;  4CBQ A;  4NTD A;  2C70 A;  1V59 A;  4X9N A;  3UP4 A;  3NTA A;  1F8S A;  1VG0 A;  2ZZB A;  3SQP A;  3CNS A;  4Z26 A;  4NZH A;  4C77 A;  3NGC X;  5LV9 A;  3DGH A;  4G6G A;  1RSG A;  4H4X A;  5CQF A;  3AE7 A;  5IPY A;  2WQY A;  4LII A;  5HHF A;  1PBE A;  1KFY A;  2V60 A;  2YLR A;  4B1B A;  3CNJ A;  4U8N A;  2JKC A;  4U8K A;  3RP7 A;  4J34 A;  4DNA A;  1VQW A;  2R0C A;  2B9W A;  1L9E A;  3AYI A;  3UTE A;  2X8C A;  3PS9 A;  4ICY A;  4RSL A;  4YSH A;  3M0O A;  4TLX A;  5JCI A;  3AE1 A;  4Z2T A;  1GOS A;  1CC6 A;  4J36 A;  2R4E A;  1Q1R A;  3RNM A;  1E7P A;  2YVG A;  4DSG A;  5J60 A;  2OAL A;  3KPF A;  4PAA A;  3SGL A;  3DJJ A;  2WP5 A;  4FK1 A;  1DJQ A;  2APG A;  2XVI A;  3H8I A;  3COX A;  1CBO A;  3NLC A;  4YTN A;  1GER A;  3AEE A;  1DNC A;  1L0V A;  3KPK A;  5JCM A;  1JNR A;  2C72 A;  3NNE A;  3KA7 A;  2JB3 A;  4H4T A;  3BHF A;  3HYX A;  4NTE A;  3M13 A;  1LJ1 A;  1K0L A;  1JOA A;  1ZY8 A;  2WS3 A;  1K4Q A;  2GMJ A;  2XFP A;  4H2Q A;  2VVL A;  5GSN A;  2XLS A;  2XFQ A;  1PBF A;  2QA2 A;  3KVE A;  2W0H A;  2X3N A;  3NT6 A;  1JRY A;  4O5U A;  3EAN A;  3H8L A;  1PBD A;  5U63 A;  2YM1 A;  3LZW A;  4A6N B;  1FL2 A;  2Q7V A;  2R46 A;  3T14 A;  4C74 A;  1IUX A;  3GQK A;  4PAB A;  2WDV A;  3II4 A;  1EL7 A;  4ECH A;  1CHU A;  2C65 A;  1E1N A;  1GET A;  5BUL A;  1H84 A;  2EQ7 A;  3CN8 A;  4CCQ A;  3L8K A;  1PN0 A;  1VRQ B;  4B69 A;  3G5S A;  4U8I A;  1YQZ A;  3HYW A;  2XLU A;  4IA6 A;  4AP1 A;  5KWF A;  4TM0 A;  3T0K A;  2BK5 A;  1LPF A;  3D1C A;  3QSS A;  4A9W A;  2E1M A;  5HYM A;  1JRX A;  3AEB A;  1NG3 A;  3B6D A;  5C2T A;  4G74 A;  1UKV G;  5M0Z A;  5KMR A;  4M52 A;  1GRA A;  3UOZ A;  3NYE A;  5M10 A;  2BXR A;  2C67 A;  3FIM B;  3GWF A;  2XDO A;  3PO7 A;  4GUV A;  3ICS A;  3GDP A;  2JBV A;  2RGH A;  1EL5 A;  3IWA A;  3NRN A;  2H89 A;  4OPG A;  3UKP A;  5BRT A;  4U2L A;  4EM3 A;  2WHD A;  4H4P A;  2C3C A;  1GRG A;  4FX9 A;  4UDR A;  3B3R A;  3ALL A;  1IJH A;  2F5Z A;  1YQ3 A;  4ADW A;  3SX6 A;  3AXB A;  4I59 A;  4JQ9 A;  1RP0 A;  3SZC A;  3I6D A;  2ARD A;  4OVI A;  2YVF A;  5FMH A;  4JNQ A;  4EQW A;  2BC0 A;  2WOI A;  4HA6 A;  2YVJ A;  3AE4 A;  2Y6R A;  2YR6 A;  3GRT A;  1LQU A;  2JK6 A;  5ER0 A;  1M6I A;  3ATR A;  3FBS A;  3IHM A;  3UKF A;  4J31 A;  4OPC A;  3NH3 X;  3SZF A;  4YSX A;  3AED A;  3F8P A;  2BA9 A;  4O5Q A;  2FJE A;  3HZL A;  3SZ0 A;  4CY8 A;  2GAG B;  1H82 A;  1QLB A;  1O95 A;  4A5L A;  3AEA A;  3WE0 A;  2BS3 A;  2VOU A;  1NDA A;  4A79 A;  3CGE A;  5KRQ A;  1PXB A;  1BGJ A;  4H2P A;  3GYX A;  4JY3 A;  2YAU A;  3V3N A;  1YQ4 A;  2YR5 A;  3UOV A;  2H88 A;  3NK1 X;  3AEC A;  2JB1 A;  3AYJ A;  3LXD A;  1XAN A;  1CJ4 A;  4IVM B;  4X9M A;  3GYJ A;  2BRY A;  2BS2 A;  5GRT A;  3V3O A;  2ACZ A;  3IC9 A;  1PDH A;  1GTH A;  2XFN A;  2YLZ A;  1BZL A;  1VDC A;  2GV8 A;  3IF9 A;  4Y4L A;  4CCR A;  4ZN0 A;  4DGK A;  3KD9 A;  2GH5 A;  1H7W A;  1L9C A;  2OLN A;  1PXA A;  1QO8 A;  2XCG A;  3EPT A;  3OC4 A;  3DK9 A;  4CNK A;  3ICR A;  3QJ4 A;  4E0V A;  4B67 A;  2V3A A;  3KKJ A;  1ZMC A;  5KOW A;  3HYV A;  1CF3 A;  1XPQ A;  2V3B A;  3UP5 A;  3UTG A;  3DJG X;  1N4V A;  2QAE A;  2WET A;  4N9X A;  3KLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...