4YTMA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 206
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytmA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytmA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytmA04
1K4QA 5KXJA 3EF6A 4NEWA 1GXFA 1PBBA 2XVFA 1H6VA 2WEUA 2X8CA 2YG4A 1PDHA 3SFEA 3ADAB 3UTEA 4AT0A 3EPTA 2ACZA 1DOEA 2WPCA 1EL8A 1D5TA 4H4RA 1GTEA 1GRGA 3SQPA 4LU6A 4Z44A 5C3JA 2XCGA 3NK0X 2IVDA 4YSHA 3LB8A 1IUTA 1LQTA 2R4JA 3AD9B 3LJPA 2WBAA 2BC0A 2WESA 3DK4A 3F8DA 3AE1A 2X3NA 3RNMA 1E7PA 2YG3A 2XVHA 1NHPA 4REKA 2W0HA 1JEHA 3L1RA 3SUCA 3QFAA 1JOAA 1IUVA 2V5ZA 4U8KA 1VG0A 1NHSA 1E6EA 2BA9A 1YKJA 2XVJA 3IHGA 1HYUA 4TM3A 1Y56A 1JRYA 2GR1A 1D7YA 2V60A 3AEAA 2C3CA 1NDAA 1D7LA 2C67A 2EQ9A 3CGCA 3QJ4A 1N4WA 2BXSA 2Q0LA 2C64A 1KSSA 1MOKA 1TDFA 2XFNA 3M13A 2PHHA 4M52A 4D04A 3AE6A 1IUXA 2E1MA 2GVCA 3UTFA 4CCRA 4IV9A 4A65A 3AE4A 1KSUA 2C70A 3CGEA 4AP3A 3NIXA 1YQ4A 3AE3A 2OLOA 4BK1A 4J33A 3ABVA 1H83A 2XLPA 1LPFA 3UKHA 1TYPA 1IUSA 1W4XA 2ZZ0A 1B5QA 2ZZCA 3BI5A 3NRNA 4IVOB 3NNEA 1E1MA 4EQXA 1GRTA 2WPFA 3NT6A 1F3PA 2XVEA 3K30A 3QVRA 4RG4A 2BS3A 2TMDA 2YQUA 1AOGA 2GH5A 3GSIA 1GETA 1P2EA 3AYJA 3ISHA 2FJEA 4I59A 4JQ9A 4OPLA 4BK2A 4CNKA 4Z25A 1PBEA 1REOA 4OVIA 4Z43A 3FBSA 2OLNA 3ICTA 2GR3A 4ZCCA 3B6DA 1KF6A 1SEZA 2YWLA 4RSLA 1S3EA 3CNSA 3QFBA 1YQZA 2XFQA 4EIQA 2WS3A 1E1KA 3UKLA 4JDRA 5HYMA 4H2PA 2B9XA 1NHQA 4H4VA 2B76A 3IC9A 4XWZA 3S61A 2GV8A 1F6MA 2VOUA 3UTHA 4C74A 2BS4A 2FJBA 1GRAA 2XFPA 4J56A 3GYXA 2WOIA 1DJNA 4GDEA 1ONFA 1FEAA 5KOWA 1GERA 4KX6A 3ICRA 5BUKA 2XLRA 4ADWA 1BKWA 4UDQA 1L0VA 3GQKA 2WDRA 2VVLG 1CHUA 4YKFA 3UOXA 3D1CA 5KVIA 3AE9A 3CTYA 2Z5XA 4TLXA 1GRBA 1M64A 2R46A 2IIDA 1PN0A 1MXTA 4DNAA 4ZCDA 3KVEA 4OPDA 4FK1A 3DJGX 2X8GA 2BK4A 4BJZA 3AWIA 5JCIA 3AE5A 2VRLA 3VR8A 3AE8A 2Y6RA 4H4WA 1CJ4A 3I3LA 2A8XA 1PJ5A 3NK2X 3QVPA 1CC2A 4JNAA 3FPZA 1GREA 3DMEA 3Q6JA 3LOVA 4GCMA 3H4KA 4C3YA 5BVAA 5M10A 2BABA 2VVMA 3GRSA 3BI2A 3G5SA 3UOVA 3NGCX 2QA1A 3CNDA 4TLZA 1O5WA 3NG7X 4NTDA 1NEKA 4YSXA 3GDPA 2GRTA 3GD3A 4H4QA 3AEFA 3I6DA 4A79A 4K2XA 4EM3A 2VVLA 4GR1A 2R45A 5J60A 4AOSA 1M6IA 3BNMA 3AD8B 2AR8A 3ZYXA 1ZY8A 4H7UA 2ZBWA 3C96A 2QCUA 3PS9A 1GRFA 2IVEA 1VQWA 2C66A 3GMBA 4N9XA 4USRA 3L8KA 4FX9A 2WETA 4MJWA 1ZMCA 2XLSA 3K7QX 5CKUA 3LADA 5J7XA 3AE2A 3KU9A 4AP1A 4DSHA 5KRQA 4OPTA 2YLWA 1UKVG 2YVFA 4I58A 3AECA 4B63A 2C3DA 5BULA 1Q9IA 3H8IA 1XDIA 1TYTA 3DK9A 3V76A 3GWDA 3EAOA 1S3BA 4CY6A 2GR2A 2LFCA 3NK1X 3QSEA 3AEGA 4H4PA 2A89A 4OPUA 3WE0A 4A6NB 1ZDLA 3M12A 3BHKA 5GRTA 4BJYA 1D4EA 1ELIA 1ZKQA 1QJDA 4H4SA 2HQMA 2C73A 4C5OA 2GAGB 2XDOA 4YSZA 1D4CA 3DGZA 2XLTA 4U8PA 4GUVA 4E0VA 4LA1A 5HY5A 5IPYA 1V59A 1H7XA 1O94A 4AT2A 4C77A 2E4GA 4JY3A 1NENA 1ZK7A 3NYFA 2WOWA 4GF7A 2RGHA 5EOWA 2Q6UA 1LV0A 1H81A 2CULA 1JNZA 2Y6QA 4U8NA 3UKPA 2AQJA 1DOBA 4DGKA 3UKFA 4BK3A 3OC4A 1GPEA 4Z2RA 1PXCA 3EANA 4CCQA 5KOXA 3CNPA 1TDNA 4ZN0A 2UZZA 1BZLA 1GALA 2DKIA 2XLUA 2WP5A 2WP9A 4H4ZA 2YLRA 2WU5A 4J57A 4NTCA 1MO9A 2X99A 1FEBA 3VQRA 1S2QA 2B7RA 3H8LA 3IF9A 3DA1A 4Z24A 4YTPA 3BHFA 3UTGA 3ITJA 1RP0A 2C75A 3GDNA 4RG3A 4ECHA 2OAMA 4NEVA 3UP5A 4Z26A 2QAEA 4WCTA 1D4DA 3AYLA 2R9ZA 2GAHB 4NZHA 5FS9A 2FBWA 4O5QA 4K7ZA 4B69A 3DJEA 1K0JA 3AB1A 4X9MA 4J31A 1DOCA 3GMCA 3CGBA 2JKCA 4NTEA 4U2TA 1BGJA 4CRTA 1F8SA 4C3XA 2I0ZA 2YAUA 3AXBA 4H4XA 3ALJA 4Y4LA 4EQWA 1N4UA 1VDCA 4B65A 4TM4A 2FJDA 1KNRA 3C4NA 4PABA 3KKJA 2GEWA 3DGHA 4H4YA 5GSNA 2PYXA 4UDRA 1PJ6A 3V3OA 4B1BA 5JCKA 4O5UA 2GQWA 3DK8A 2YG5A 3ALLA 4HB9A 4IVMB 3BI4A 2V61A 3GQHA 2BK5A 4FK1C 4HA6A 1TDEA 1OJDA 3DJDA 3CNTA 5EB4A 1F8RA 1IJHA 3F8PA 3K7TA 3KLJA 1H82A 3VRAA 4TM1A 2JK6A 1DODA 3G5RA 4A6NA 4AOXA 2GQFA 1E1LA 4CY8A 1K0LA 3S5WA 4EMWA 4YT0A 1GRHA 3COXA 1BGNA 2APGA 1NG3A 1BWCA 2YG6A 3SGLA 2BC1A 4X9NA 1ZP0A 3ZDNA 5EBKA 2R0PA 2XYOA 2CVJA 2FJAA 2C72A 4U8LA 4J34A 1ZOVA 2BK3A 3AEBA 3GYIA 3QSMA 3URHA 2WQYA 1XANA 2GMJA 2WPEA 4EQRA 2CDUA 1CC6A 3NTDA 3Q9TA 3KA7A 1Y0PA 3ATRA 5DBJA 1RSGA 3F8RA 4KPRA 3RHAA 1JU2A 4A7AA 2YLTA 4YSYA 4H4UA 2YLZA 4YWOA 3R9UA 1BF3A 2YVGA 1PHHA 5U25A 4EM4A 4YXDA 2XFUA 1GTHA 3K7MX 4A9WA 2BCPA 2X8HA 1TDOA 2ZZBA 4EQSA 5JCNA 1TRBA 5TR3A 3UOZA 1K0IA 3GYJA 1TDKA 1ZMDA 4OPIA 3UCLA 4OCGA 2YLXA 2JBVA 2WOVA 4H4TA 4TM0A 2V6OA 5LV9A 3T37A 3VRBA 1XHCA 2YM2A 3ALMA 1ZX9A 1H7WA 2EQ7A 1JRXA 4APNA 1PBCA 4Z2TA 4EMJA 2EQ6A 3RP7A 2B9WA 3P1WA 3UKKA 4J36A 3CGDA 3UKQA 1O95A 5FS7A 2OA1A 4U8IA 3SFDA 1GSNA 4B64A 1B37A 3QSSA 5ER0A 4K5SA 4UP3A 1CC4A 2WU2A 1CF3A 1L9DA 2RGOA 3UOYA 3UP4A 2R0GA 2YM1A 4JN9A 4A5LA 2R0CA 2C65A 5FS8A 4BV6A 5L46A 1GESA 3UKAA 3P4QA 5KVHA 4H2NA 4H2QA 1LVLA 1ZOYA 3CNJA 2WHDA 3JSKA 2BS2A 2YLSA 1XPQA 1FOHA 5EB5A 4B68A 2CFYA 4Z2UA 3FG2P 5JCMA 1NPXA 1NAAA 3IWAA 3NH3X 2JB2A 2DKHA 2YG7A 5M0ZA 3BNUA 3ICSA 1Z6LA 5BRTA 4K8DA 4BURA 1GOSA 2XFOA 4H2RA 3AYIA 1N1PA 5C2TA 2A87A 4J2WA 3P4SA 2H89A 2BACA 2NPXA 4PAAA 4U2SA 4XXGA 5FS6A 4JY2A 4WX1A 1CJ2A 1PBFA 2GF3A 1DNCA 4IA5A 5IQ1A 2TPRA 1Q1RA 4A99A 3RP6A 1CJCA 3II4A 1GT8A 1RYIA 1VG9A 2WDQA 5FMHA 3IHMA 5U63A 1L9EA 4X4JA 3OZ2A 2ARDA 1FL2A 2R4EA 2YR4A 5IQ4A 2Q0KA 4EMIA 2VRMA 1COYA 4YTNA 4CBQA 3PO7A 3CPIG 3V3NA 3CIRA 4U8MA 1EL5A 2Q7VA 2QA2A 2GMHA 3HZLA 4CNJA 5HXIA 3RP8A 1CL0A 1QLBA 2GR0A 2F5ZA 2JAEA 3C4AA 3FMWA 3B3RA 2WDVA 2J3NA 3CN8A 1S2YA 1IUUA 2BYBA 1H86A 1OJAA 2H88A 3AD7B 2JB1A 3G5QA 4FDCB 1GV4A 3LZXA 2VZ2A 3NN0X 3CPHG 4U8JA 2O9ZA 4IA6A 1FECA 4B66A 4B67A 1CBOA 3AE7A 1PJ7A 1X31B 2BXRA 2WP6A 5CQFA 5KWFA 1EL7A 1E39A 3NN6X 2Z5YA 2VQ7A 2GB0A 1LQUA 3DJJA 4DSGA 1F8WA 1N4VA 1JNRA 4P9SA 3KPFA 3GRTA 3NKSA 4H50A 3ATQA 3E1TA 3P9UA 1Y56B 3REDA 4XWRA 2OALA 1KDGA 3LXDA 2B7SA 1NG4A 2X50A 4ICYA 2C7GA 2NVKX 4U2LA 1LTXR 1QO8A 4USQA 4K5RA 1DXLA 3DH9A 4OPGA 1EL9A 3O0HA 1B8SA 1H84A 2AAQA 4Y4MA 4YTMA 4JNQA 3AEDA 1GEUA 4K22A 1PBDA 2JB3A 2RABA 1PXAA 5HHFA 3SM8A 2YR6A 3KD9A 4GDPA 3NTAA 3AEEA 3VR9A 4YKGA 1EBDA 5JCLA 1IUWA 1P2HA 3LZWA 3PVCA 3P4PA 1L9CA 4LIIA 1OJ9A 3NYEA 3GWFA 2RGJA 1YY5A 4U8OA 2B9YA 1DJQA 1E1NA 2E5VA 1FCDA 3VRDB 3NYCA 1PS9A 1B4VA 4Y4NA 2C76A 1OJCA 1LJ1A 3GD4A 1PXBA 3FIMB 1KNPA 2XVIA 1VRQB 3CPJG 4GRTA 4UDPA 3NHOX 2V3AA 5U1OA 2YR5A 1GNDA 2YVJA 1NHRA 3P4RA 3M0OA 3D8XA 1YQ3A 4OPCA 1Q1WA 2EQ8A 2V3BA 3NLCA 1KFYA 1CJ3A 1OJTA 1JRZA 4EIPA 2VQBA 4D03A 2BCGG
chains in the Genus database with same CATH superfamily
1K4QA 4NEWA 5EK4A 2R6GF 3OVUA 1H6VA 3ADAB 1PDHA 4IE7A 3SFEA 2ZMAA 3EPTA 3ZN0B 1D5TA 3WAKA 2VL8A 1GTEA 2HWC4 1COV4 2B1EA 3S4UA 2XCGA 3AAIA 3RLFF 5LHGB 3LB8A 1IUTA 2ZM8A 2R4JA 1W9RA 5AQPB 5BMVE 4GB34 2X3NA 2LEHA 1NHPA 2W0HA 1JEHA 5ABFA 3KV9A 4BAYB 2D2SA 4EZ4A 3I1AA 4TM3A 4HWDA 5LYJE 3HKCE 2R7FA 2C3CA 1D7LA 2C67A 2EQ9A 1N36T 3L39A 3EVYA 4IE4A 5HXEA 1HFAA 4G6GA 3RRWA 4B3TT 2MTQA 1MOKA 1TDFA 2PHHA 3AE6A 2GVCA 2E1MA 3UTFA 1HXS4 4IV9A 4GK0E 4A65A 3MKDA 1KSUA 4ILCA 4AXPA 1YQ4A 2OLOA 1ZKEA 3T31A 4H9OC 2XLPA 2X51A 2VWAA 2W66A 3IA3A 1E1MA 4DV7T 3NT6A 4NWZA 3K30A 3QVRA 5ETWA 2BS3A 3PURA 5FY0A 2TMDA 2GH5A 4OPLA 1GETA 4HTEA 3RH3A 1REOA 2VB6A 2ACXA 4Z43A 3FI7A 1MIVA 5JDFA 2QA7A 2XASB 4EXTA 4H63V 3LJCA 3N9MA 3PJAA 1YQZA 3QFBA 2WBLA 2WS3A 1UK5A 4H4VA 1NHQA 3IC9A 3S61A 1HNWT 3UTHA 1M62A 1GRAA 1Z7S4 1VOMA 1DJNA 1ONFA 1FEAA 1GERA 2XAQB 1J5ET 4DR4T 5BUKA 2XLRA 1X9BA 3RIAA 4UDQA 4IL4A 4OX9T 4ZOLE 4DNDA 2WM9A 1M64A 3I0QA 5LCYA 2XAJB 2LKHA 2CPTA 1MQTD 3MJXA 5AQVB 3AA6B 3UU5A 2X8GA 4U31A 3AWIA 1SE7A 2VRLA 1XNQT 1CJ4A 1PJ5A 2V6YA 3BQKA 1XHZA 3JC6C 1GREA 2SPCA 2VKHA 3H4KA 4JUYA 2IDOB 4ZI3C 5F3JA 2PY5A 3UOVA 4JI3T 3CNDA 4TLZA 1O5WA 2GRTA 3AB3B 5JVDE 2JJ9A 4IT4A 4K2XA 1S35A 2VVLA 4GR1A 2R45A 2PTFA 3RC8A 5FP3A 5J2TE 4CZZB 3C96A 5HAXA 1RUE4 4CN1A 1VQWA 4AQYT 4N9XA 2RPAA 2WETA 5CJ5A 3HR0A 3K7QX 5KRQA 3AE2A 3CKDA 4DSHA 4OPTA 2YLWA 5AQMB 4LF6T 2V7KA 4ZEYA 5L3GB 1TYTA 2CLYC 1IBMT 3GWDA 2ZLYA 4YJ3E 1ZDLA 2XSBA 1AR94 2DHRA 4DBQA 5GRTA 1ELIA 3ETVA 4H4SA 4IDOA 4MFRA 2XLTA 3LG7A 4U8PA 4E0VA 1H7XA 4CXWA 2WMOA 4GF7A 1LV0A 2HH7A 4H9NC 4EIWA 4UF0A 2UUCT 2AQJA 4O4HE 4G74A 4DGKA 2VKDA 3CQXC 4CCQA 3CNPA 4ZN0A 1GALA 4BJNA 3VHLA 4KI0F 2XLUA 2WP5A 4H4ZA 4AQFC 2LJLA 4CQIA 2LKGA 1MO9A 1FEBA 1YKHB 5CA1E 3IF9A 3DA1A 5AQRB 3UTGA 3ITJA 3GDNA 5JDGA 3U3IA 4B3MT 2LHRA 1D4DA 2EHOD 2R9ZA 5FS9A 2FBWA 3BQIA 3FBZA 2D5UA 2XZEA 3UU6A 1DOCA 4CRTA 1BGJA 4DR5T 2D0TA 1F8SA 5KX5E 2I0ZA 2PJQA 3T1YT 4HFBA 1OEDB 1VDCA 3C4NA 3KKJA 4UDRA 5JTGA 3ZMTB 2GQWA 2BKPA 2YG5A 4HB9A 3ZJ1A 2YDRA 2X9HA 3DJDA 1IJHA 3K7TA 2VKJA 4NPPA 4DV3T 1M7KA 1FJGT 4A6NA 4AI6A 1K0LA 4EMWA 4X64T 3COXA 1VBE4 1NG3A 1VCTA 1BWCA 4UXNB 2YG6A 4X9NA 2Q9QD 3CWZB 4JLEA 2XYOA 2ZM2A 5HEHA 2X9WA 5FXXA 4COFA 4J34A 3HYXA 3ZC0A 3UU3A 4EQRA 3NTDA 3KA7A 3MZKB 1Y0PA 5DBJA 3IEEA 4OYJA 2WZHA 4G9KA 3RHWA 3C98B 2YLZA 5CFBA 1BF3A 2YVGA 3U78A 3K7MX 3LBXB 2PG8A 4A9WA 2A72A 1TDOA 3MA9A 1K0IA 3GYJA 4JI5T 3T2YA 5FMNA 4AKIA 3UCLA 5H6RB 2JBVA 2OA5A 2RR14 3EDUA 2YM2A 2EQ7A 4JEHB 4QXHB 3UKQA 4PDWD 3RKOA 4B64A 3PUVF 4GYRA 4UP3A 1CC4A 2WU2A 2RGOA 2R0GA 2C65A 5FS8A 2KMFA 1IAPA 1GESA 3P4QA 1LVLA 3A7MA 2MOZA 2CXFA 2CFYA 5JCMA 1NPXA 3NH3X 1T8BA 2DKHA 3AAEB 2V26A 2CWYA 1Z6LA 3UUNA 4QHOA 4H2RA 4TNWA 3AYIA 3RGLA 2X0LB 2BG9B 2CXDA 4UV8B 3Q5EA 4EYYR 4XXGA 4LMKA 3IBPA 4WX1A 4IA5A 1D0YA 3F31A 5IQ1A 2JRKA 3C4XA 1RMU4 4A99A 1UCUA 3RP6A 2PFVA 1D1BA 3N9OA 4DIDB 5FMHA 1Z8UA 5U63A 2LOPA 4X4JA 5IQ4A 1FL2A 3UQ4A 2KINB 2R4EA 3LFMA 2HPLA 3SRZA 4EMIA 4CBQA 3PU8A 4AKLA 1EL5A 4C91A 1WLXA 3OKQA 2Q7VA 2QA2A 4GKJT 1WFDA 3FMWA 5L3EB 2F5ZA 1NCQD 4PFPA 3NRYA 3CN8A 4YHHT 4AQFA 3AD7B 2H88A 4FDCB 3ZJ2A 2VZ2A 3KV4A 3CPHG 3R84B 2O9ZA 2K3WA 1T98A 5CQFA 2QVAA 4WNKA 1EL7A 1E39A 1HG5A 5AQFB 2M6BA 2JQQA 5ABFB 3KVBA 3DJJA 4AKHA 3GRTA 3E1TA 4PAGA 2B7SA 2X50A 4ICYA 4PJJA 2C7GA 5HXCA 3N2KE 1QO8A 4ILBA 4U33A 2BVLA 2I6HA 4JNQA 3FZHB 5C8YE 5HHFA 2V5CA 3NTAA 2XTLA 4O2AE 5JCLA 4II2A 5LXTE 1OJ9A 2K5BB 2E2AA 2YDQA 5HEJA 3VU7H 2CM0A 1PS9A 3KDSE 2YOEA 1LJ1A 2BKOA 3GD4A 1PXBA 2V6XA 1KNPA 1VRQB 1R8IA 3SZ0A 3OBVE 1NHRA 2YVJA 3P4RA 4NUVA 3HKEE 5AQSB 3D8XA 1YQ3A 4UVBB 2V7JA 3NLCA 1KFYA 2CE7A 4UR9A 1OJTA 4EIPA 2VQBA 4U7IA 1PHHA 4A56A 2JQHA 2WEUA 1FMWA 3UTEA 4IDPA 1DOEA 2KSRA 1OOPD 5L3CB 4U2YA 4LU6A 3RQUA 3SOLA 1LQTA 5JREA 1Y01A 3AXJA 4TN7B 2WESA 3ZT5A 3DK4A 3EDVA 4OK0A 3DTOA 2LM2A 3L1RA 4PK4A 4U8KA 1E6EA 2R064 3KBTA 3KVAA 1JRYA 3K3OA 2V60A 1EAH4 2V6YB 3QJ4A 2QYWA 2BXSA 4O4LE 1KSSA 4M52A 3M13A 4CCRA 3BQLA 3AE4A 2IW5B 2A3DA 5HXRA 1N33T 1RHI4 1HTJF 2YINA 1E1HB 1B7TA 3IHRA 3UU8A 4YLHA 1TYPA 3UKHA 2ZZ0A 2ZZCA 1B5QA 1RVF4 4IVOB 4MHCA 1GRTA 2RS54 3PE0A 3P50A 3FXDB 3GSIA 4YFSA 5BR8T 1XHXA 4CNKA 1PBEA 1R094 3ICTA 3N9LA 3PUZF 3UQ7A 1RUC4 1MMGA 4RSLA 3CNSA 3F2EA 1HG2A 4EIQA 5HYMA 4H2PA 3A5XA 4XWZA 2EHOC 2GV8A 2ZM6T 2I59A 4GK5E 4XAXB 3N9PA 1HX8A 1VCSA 2C4CA 5EK3A 2E9XC 3ICRA 5FYMA 2J1DG 3BK9A 1L0VA 4DR2T 2LSYA 4X1IE 3UOXA 2I0MA 2DCFA 4WW0A 5KVIA 4P0AA 3CTYA 4TLXA 1GRBA 3NZQA 4UF0B 4DNAA 2D0UA 5DQWA 3UU4A 3V5UA 5LMNT 4LFCT 2BK4A 4BJZA 3JD74 2JQ9A 4K0KT 2C5JA 4Z90A 2PZSA 1VBC4 2ZM0A 4LMLA 1UUSA 1AR74 1V9DA 3NK2X 3EAMA 3C50A 3Q6JA 4GCMA 3LOVA 2JIWA 2BABA 2VVMA 3GRSA 3Q2MA 3G5SA 5HYAA 1D4M4 4TX5A 1LVKA 5AQLB 4DMWA 2E5LT 2NP9A 2XY8B 2Q9QC 1GQEA 3GD3A 2PBIA 4A79A 3PUXF 3CX8B 1HRI4 5DABA 1O3XA 2XQ5A 2YKSA 1GRFA 3RYCE 2C66A 3GMBA 4P0BA 4FX9A 4IE6A 4DR3T 4HWIB 3QNUA 1UKVG 1PO24 3AECA 1T7SA 4B63A 4GYSA 2C3DA 5BULA 1Q9IA 1XDIA 3C4ZA 1OWAA 2RA1A 1D0XA 2WMNA 4OHFA 5HCMA 4Q4V4 4IGUA 5LG3A 2YN6A 3QSEA 4OPUA 3WE0A 4A6NB 3HKDE 3BHKA 1D4EA 1QJDA 4UEMA 4F6RC 2RMU4 2HQMA 2C73A 3N2GE 2XDOA 1KK7A 4YSZA 4X65T 5M4YA 4LA1A 4AT2A 1XZYA 1NENA 2M6IA 3NYFA 2WOWA 3PDYA 5DJQC 3SXIA 2X0YA 4UV9B 2DWKA 2Y6QA 2N2NA 4U8NA 3UKPA 4P1NA 2JMKA 4X20E 5AQKB 3PUYF 3ZSTA 4FJOA 5FNVE 1TDNA 3TLSA 5LOVE 2DKIA 3HI2A 3QB5A 2WP9A 1XDOA 2X67A 4J57A 5AQTB 4NTCA 2B7RA 3TLTA 1BR0A 1RP0A 2C75A 2W62A 4YJ2E 5AQUB 3GWHA 2OAMA 3RKGA 3UP5A 5IUXA 2KWIB 3ZMSB 3AYLA 2GAHB 4KUMB 1D1CA 4CXYA 4ILAA 2WWVA 4ZHQE 2W0GA 4PW8A 4JI4T 4B69A 4X9MA 4J31A 2YDSA 4KP3C 3CGBA 5KMQA 2NTYA 3V5SA 4H4XA 3KV6A 2K48A 2YU2A 3JAEA 4WBNE 4YY3T 4BA9A 3SX6A 4Z8XA 2PYXA 4GKKT 2KWHA 2KNDA 4IVMB 4Q4W4 3BI4A 2V61A 4FK1C 4HA6A 4ZI2C 1TDEA 3CNTA 3GA8A 4IL9A 5HEGA 1F8RA 3F8PA 3ANWA 2VQET 1K5MD 2GQFA 1E1LA 3C4WA 4YT0A 3KBUA 4IDZA 2APGA 4ISTA 3ZMUB 2E9XA 3WAJA 1ZP0A 3AA7B 2R0PA 1HR0T 3HYWA 4DV5T 4L9IA 4AQGA 2FJAA 4HGAA 4GAVA 4U8LA 3OYZA 1ZOVA 4U2ZA 3GYIA 3QSMA 1XANA 3SZWA 1IBLT 3ATRA 2GK9A 4HWFA 3L09A 4A7AA 4YSYA 4H4UA 4YWOA 4CXXA 3R9UA 2IHR1 4EM4A 2X5ID 2XFUA 5TR3A 3CVRA 1TDKA 4OCGA 2NR4A 2YLXA 2LRKA 4KBMB 4U72A 4TM0A 2V6OA 5LV9A 4X62T 3VRBA 4Z2TA 1JRXA 4Q25A 2EQ6A 3RP7A 1IZNB 3K3NA 2B9WA 3UKKA 1N32T 2L9QA 2OA1A 4U8IA 3SFDA 1E2AA 4IHJE 2AXDS 3AVSA 3ESLA 4DO0A 1CF3A 2R074 4A5LA 5LJMA 3UP4A 3N9NA 1ZOYA 3CNJA 4A5XA 2MAWA 4I4TE 2BS2A 2WZIA 1XPQA 5EB5A 1NAAA 3W15B 3PV0F 3ICSA 4K8DA 1DU2A 4OYKA 1N1PA 2H89A 1SA0E 5EZYE 4JY2A 4HE8A 5HEUA 1DNCA 1GT8A 1VG9A 5LGUB 3ONXA 3RI5A 2BKNA 1L9EA 2XSAA 4QX7B 4F8HA 4JV5T 2YR4A 3M65A 4EB6E 2VRMA 1COYA 4YTNA 3PO7A 3CPIG 2UXNB 3CIRA 3ETUA 4WBOA 1YW0A 2X0HA 4KHZF 5HXIA 2GR0A 2JAEA 1MMNA 2WDVA 5JDHA 1S2YA 3ZKRA 1IUUA 2BYBA 4P9SA 2NW9A 4JI6T 2IMLA 3LZXA 2BBHA 3WI3A 3AXJB 4U8JA 4B66A 2NOXA 1CBOA 3AE7A 5ABHA 1PJ7A 2WP6A 5KWFA 3NN6X 2Z5YA 2HWB4 2PYLA 5AQGB 4DVDA 4NNJA 3REDA 3N2OA 1WRDA 3LXDA 3ZT7A 1LTXR 4USQA 3PUSA 4JI2T 3MK7C 3O0HA 1AR64 2XUEA 4AKRB 2L8KA 2AAQA 4Y4MA 2HHHT 1PBDA 5FVKA 1PXAA 4HFEA 2YR6A 4B3ST 4GDPA 4G6HA 3AEEA 5HEOA 3VR9A 1EBDA 1P2HA 1HX1B 1AL24 3GWFA 4DV1T 2RGJA 3EHZA 1VBA4 5HWYA 2C76A 3T14A 3OJAA 4QKNA 3FIMB 4TV9E 2VVNA 2XVIA 3NHOX 2YR5A 4DV6T 3FHNA 3NWIA 3DJBA 3M0OA 2EQ8A 1CJ3A 1D1AA 1FIOA 5JDQA 5LB7B 4A97A 5KXJA 1RUD4 1GXFA 2XVFA 2X8CA 3RF1A 4B6XA 4LFBT 4IIJE 4H9SE 4QX8B 4JI8T 2WPCA 4H4RA 2QGSA 1GRGA 3SQPA 1UX4A 3NK0X 4YSHA 4UIGA 1T72A 1Y64B 5LJNA 4UVCB 3E08A 2LOSA 3F8DA 5CGMA 3RNMA 1E7PA 4IE0A 1H8TD 4C90A 2XVHA 4G63A 3SUCA 3QFAA 2V5ZA 1IUVA 4CI1B 3AA1B 1YKJA 2XVJA 2CWOA 1HYUA 1Y56A 3AEAA 1NDAA 1BR1A 3CGCA 1N4WA 3CQGB 1WYBA 2C64A 2W00A 4YHJA 2XFNA 4RHV4 4D04A 1Z0PA 1IUXA 2V8SV 1D0ZA 1WCRA 2C70A 4BK1A 2KLQA 4J33A 3ABVA 3RIUC 4Q4X4 1LPFA 3NVOA 3QK6A 1VRBA 1IUSA 1W4XA 3BI5A 2CEAA 3NNEA 2WPFA 4X1YE 2XVEA 2QRXA 2YK0A 2UXBT 3ISHA 4I59A 4OVIA 5TAOA 2OLNA 2XQ9A 4ZCCA 3B6DA 3UFEA 1CUNA 2YWLA 1W0AA 5FKYA 4ANJA 2XFQA 3UKLA 2B9XA 3RYHE 1U5PA 3SYIA 5FY1A 2XFPA 4J56A 2WOIA 3ZCIA 4EEDA 4GDEA 5KNLA 4QH4A 2WAUA 3UUMA 5J0ZA 2JPFA 3T2ZA 1BKWA 1S94A 5JRCA 4JI0T 3JAFA 2VVLG 3D1CA 3AE9A 5ABGA 2R46A 2WCAA 1MXTA 1PN0A 3T0KA 3KVEA 2ES0A 4OPDA 3EI0A 5AQJB 2VL0A 2BG9C 2BRYA 3G06A 4HWCA 4ZI3D 3VR8A 3AE8A 3SWHA 1YXRA 2XHEB 4H4WA 4IE5A 2V7MA 4JNAA 4I55E 5BVAA 3DMEA 5M10A 3OPCA 3K8PC 1W0BA 3PUAA 3D0TA 4J2CA 4CN6A 4EZHA 5IHYA 2Z6EA 3NG7X 4NTDA 4YSXA 1NWMX 3GDPA 2KZ7B 4EAHA 4HN9A 3P8CD 4H4QA 2NW8A 1M6IA 4ZZCA 3ZYXA 4H7UA 1HRV4 2ZBWA 4PJLA 4HFVA 3PS9A 4NUUA 4USRA 3L8KA 4OFZA 4MJWA 4QWNB 1ZMCA 2XLSA 5J7XA 3LADA 3KU9A 4AP1A 4P09A 5HXSA 3JCFA 2WSSV 4UELA 1BEV4 3FZMB 3V76A 3O1HA 3OYXA 3ANWB 3EAOA 1S3BA 2LT3A 2GR2A 4EOZB 3NK1X 3AEGA 4EV6A 2EHOB 3K1SA 4ZZBA 2A89A 3M12A 1LVFA 4HEAA 1ZKQA 4C5OA 2VASA 2E9XB 4GOUA 1D4CA 3GMIA 4GUVA 4H63H 1XI1A 1O94A 4C77A 5L3DB 2F4VT 3AVRA 1ZK7A 1HNZT 4BJMA 2Q6UA 3L8RA 1H81A 1JNZA 3ONLC 2FUPA 4E7SA 1DOBA 3UKFA 4MLKA 3UULA 4BK3A 3OC4A 2CCQA 1GPEA 3EANA 5KOXA 2VQFT 2UZZA 3FB2A 3AAAB 2YLRA 3LK2B 3Q9DA 1S2QA 4Z24A 1YKEB 3J7Yq 4YTPA 3BHFA 2NW7A 4Z91A 4O4IE 2V1DB 5HXHA 4LF7T 4RG3A 4NEVA 1MMAA 4Z26A 2QAEA 4U3CA 2VKOA 3ZLIA 5L2LA 4O5QA 5L3BB 2LM9A 5AFUL 3DJEA 2BG9E 3AB1A 2Q9QB 2V7LA 5L47A 1HNXT 3GMCA 4NTEA 4U2TA 5KMGP 4C3XA 3HA4A 2YAUA 2KXPB 3GN5A 3RIUA 4Y4LA 1MIYA 4B65A 2FJDA 1KNRA 5FY7A 3A8YC 2GEWA 4H4YA 1WR0A 5LGTB 3V3OA 1PJ6A 4O5UA 3DK8A 4G73A 3C64A 3ALLA 1NAFA 4U74A 5H6QB 5EB4A 1EV14 2Y6XA 3Q5XA 3ONJA 4DBRA 3KLJA 4I50E 1H82A 2JK6A 4TWDA 2XJ7A 4AOXA 5JR9C 1MMDA 4CY8A 4JI7T 2CXLA 3UTKA 4N78D 3SGLA 1RUI4 5EK2A 2BC1A 3ZDNA 3X1DA 5EBKA 5JDLA 2MYSA 4LFAT 5FVLA 4QH1A 5FL1A 3AEBA 3RC3A 4IREA 3URHA 5ADXL 4TWHA 3OTOT 2GMJA 1MNEA 2WPEA 3Q9TA 4HFCA 3F8RA 4PFOA 4JI1T 1JU2A 4NXNT 3CX6B 3NZPA 4V1Av 3Q5WA 5L3FB 4O4JE 5U25A 3SZCA 2UXXB 1GTHA 2CMRA 3K3QC 4L5GA 2BCPA 2X8HA 2ZZBA 5JCNA 1TRBA 3UOZA 1PIV4 3PUQA 5KMSA 2ODVA 1ZMDA 2HN2A 4UVAB 2Y8DA 1G73A 4H4TA 3I9WA 2HPJA 3T37A 1ZX9A 1H7WA 1PBCA 3B5MA 2IAKA 3P1WA 1XNRT 2G0UA 4J36A 5FS7A 1GSNA 4DMVA 4K5SA 1XMOT 2V7IA 1L9DA 5L46A 3Q5DA 2YM1A 2R0CA 4BV6A 3R6NA 4EYUA 4ZXLA 5KVHA 4ZS2A 2WHDA 2W61A 2X9YA 3JSKA 1FOHA 1W09A 2DLRA 5FXWA 2XM2A 4Z2UA 4ASKA 3IWAA 5LA6E 2YG7A 4AIUA 5M0ZA 4CN4A 3E22E 4BURA 1GOSA 1BR2A 2XFOA 3EUHA 3KPKA 2A87A 4LF4T 2NPXA 5FS6A 4PAAA 4U2SA 5LBMA 1ZEEA 1H7CA 1CJ2A 2GF3A 5A1LA 2TPRA 1Q1RA 3ZN1B 3PUWF 1CJCA 3II4A 4PK6A 4DR6T 5JQGE 2LSIA 3OZ2A 2ARDA 2LHNA 1KNZA 2CA5A 2Q0KA 3ZMZB 2VVSA 5JDNA 4AISA 3V3NA 3HKBE 2GMHA 3HZLA 1CL0A 4ZI7E 3C4AA 3H3MA 3O9XA 1H86A 2JB1A 1GV4A 3NN0X 4IA6A 1FECA 4B67A 2BXRA 1X31B 1RUJ4 1I6ZA 1VBB4 2VQ7A 2GB0A 2AE9A 5AQIB 2R044 1LQUA 4DSGA 1F8WA 2XQ6A 5LHIB 3KPFA 3NKSA 2WB5A 2H3RA 3P9UA 3B57A 2CLYB 1Y56B 4XWRA 3HYVA 2OALA 2EHOA 1NG4A 2NVKX 4U2LA 2WY2A 3CX7B 4K5RA 1DXLA 3DH9A 4GAPA 5L4HA 1EL9A 1GEUA 5HWXA 2H7VC 2RABA 4JEUB 3IF8B 3KD9A 5F8PA 5LGNB 3LZWA 3SZFA 3KV5A 2K9AA 4PJMA 1YY5A 2B9YA 3ZYKA 1B4VA 1VBD4 1OJCA 4ZS3A 5JR9A 4GRTA 1GNDA 3M3ZB 4A98A 4B3RT 4OPCA 3PU3A 4QXCB 1JRZA 3GYXA 4D03A 3EF6A 2LSGA 4K7ZA 1PBBA 2Q9QA 3UUXB 2YG4A 2MBGA 4AT0A 2N9DA 4TV8E 2ACZA 1EL8A 2XAFB 4HKAA 4O8SA 2PW9A 5JRCB 4CI2B 4Z44A 5C3JA 2IVDA 2M67A 4PK5A 3QB5K 3AD9B 3UT5E 3ZT6A 3CMMA 3LJPA 2WBAA 3SY4A 4HFHA 5DQVA 2BC0A 3FXEB 3AE1A 1UGOA 2W4XA 2BVMA 4WZXA 2YG3A 4U7YA 4REKA 1SUMB 4HFIA 1JOAA 1VG0A 2VURA 1NHSA 3O1IA 1HF8A 2BA9A 2CHOA 4ADZA 3IHGA 4I43B 4DUZT 4TNVA 3KFWX 2GR1A 1J1JA 1D7YA 2Q0LA 2BZBA 3CGEA 4AP3A 3NIXA 3I9YA 3O4XE 3AE3A 5J1GA 3N5LA 1H83A 2W67A 4PNIA 3H3AA 3NRNA 2NWBA 2V5DA 3I0OA 4EQXA 3E0ZA 3TLUA 1F3PA 4RG4A 2YQUA 1AOGA 4JQ9A 3AYJA 1P2EA 2FJEA 4BK2A 4Z25A 3FBSA 5LP6E 2CBIA 2GR3A 1PVC4 5J2UE 1KF6A 1SEZA 3HL6A 1S3EA 2X66A 3F57A 3J8F4 1E1KA 4JDRA 2E9XD 2B76A 4HWHA 3CQCB 3N9QA 1F6MA 2VOUA 4IDNA 2L3LA 4C74A 2BS4A 2FJBA 2YEVC 3MACA 5KOWA 4JBWF 4KX6A 4ADWA 4XBFB 3GQKA 2WDRA 4L0RA 1CHUA 4YKFA 2Z5XA 2LRLA 4K0UA 2BBJA 2IIDA 5KMPA 4ZCDA 4FK1A 3DJGX 4EGWA 5JCIA 3AE5A 3ZMVB 4LF9T 2Y6RA 3NRXA 1RUH4 3I3LA 2A8XA 3FZFB 3T8OA 3QVPA 1CC2A 4DR1T 3FPZA 5FXVA 4C3YA 3RPUA 2UUAT 2DL1A 3BI2A 4LF8T 3NGCX 2QA1A 3PJAJ 2ODUA 1NEKA 3DP7A 5AQQB 1OXZA 4X1KE 3RYIE 3AEFA 3I6DA 3LSVA 4EM3A 5J60A 4AOSA 3BNMA 1HS7A 3AD8B 1OEDC 1BR4A 4QH5A 2AR8A 3TLWA 1ZY8A 3GN5B 2QCUA 2CHNA 4II3A 2IVEA 5LHHB 3ZC1A 3T1HT 4X5TA 1US7B 2IC6A 2PLV4 5CKUA 4KMCA 2RP4A 1ASJ4 2YVFA 3JBG4 2HN1A 4I58A 3H37A 2LSJA 3H8IA 3DK9A 3ZYMA 1X79A 2XQ3A 4CY6A 3VKGA 1G8XA 2LFCA 4I0UA 1ZHCA 4H4PA 1R084 2XQYA 1IJ5A 3PTRB 4BJYA 5IWAT 2OLTA 2GAGB 2RS34 5IPYA 3DGZA 5HY5A 3CMLA 1V59A 2E4GA 4JY3A 1MIWA 2RGHA 5EOWA 4E7ZA 2CULA 3FZKB 2Y48B 5LBQB 4Z2RA 3VKHA 1PXCA 1BZLA 2A9UA 2N1GA 5JH7E 2WU5A 3VQRA 2X99A 3AA0B 2DI4A 3H8LA 2UUBT 3ZSSA 1I94T 4ECHA 5GONE 4TZ4C 3L3PA 2DNXA 4WCTA 2WWUA 4NZHA 3FZLB 5KMRA 2RS14 3RRCA 1K0JA 1HCIA 2X9XA 4Q4Y4 3ZEFB 3QUJA 2JKCA 1IJ6A 1SHZC 4HFDA 3AXBA 4EQWA 3ALJA 3RYFE 5IYZE 3RIFA 1N4UA 4TM4A 5KDMC 3LDQB 4PABA 4ZI2D 2UU9T 3DGHA 5GSNA 4B1BA 5JCKA 2XPKA 4H9PC 4WYVA 3GQHA 2BK5A 1OJDA 2LLYA 5FL0A 1OEDE 3VRAA 4TM1A 4DV2T 2IIUA 4DV0T 3JC6D 1DODA 3G5RA 5FXZA 4GIWA 3S5WA 4XZCA 1GRHA 1BGNA 3UUBA 3T2KA 2J4GA 1WR6A 3SS1A 4QXBB 3B13A 2CVJA 4FI5A 2J47A 2C72A 2EX3A 3QOFA 4EEBA 4LF5T 5LG4A 2BK3A 2WQYA 5ABEA 1CC6A 2CDUA 1RSGA 4KPRA 3RHAA 2YLTA 5LNKA 2D9DA 3LK42 4TUYE 4YXDA 3TKLB 3CPZA 4MBQA 4EQSA 2C5KT 2C0SA 4H9QC 2X68A 4OPIA 4M1PA 1N34T 4X66T 3ZCJA 3PUGA 2WOVA 4DUYT 1J5WA 4DR7T 1U4QA 2PYJA 3CK6A 1XHCA 2VK9A 3ALMA 4APNA 4EMJA 3P7IA 2RM24 1OEDA 3ZPOA 3CGDA 1O95A 2XM1A 1B37A 3QSSA 5ER0A 1AR84 2XAGB 3P4WA 2XAHB 3UOYA 1KEYA 4JN9A 2C5IT 4ISSA 3NBXX 3UKAA 4H2NA 1LKXA 2LSKA 4H2QA 2LE8A 2YLSA 4B68A 2YU1A 3FG2P 1ZV4X 1LRZA 1XMQT 2JB2A 3C51A 2H7OA 1IBKT 1FMVA 3BNUA 5BRTA 4PJNA 1XWMA 1QUUA 5C2TA 2DWGA 5JR9B 4J2WA 3P4SA 2BACA 4ERRA 1PBFA 2JMHA 1RYIA 1UURA 2WDQA 3RX6A 3IHMA 2OV9A 3JADA 1PO14 2XQAA 5AQOB 4U8MA 4CNJA 2BDEA 4JYAT 3RP8A 1QSDA 1QLBA 2CRBA 3FBLA 2BRAA 3B3RA 2KT9A 5LMUT 2P9BA 2J3NA 2XQ7A 2MPKA 2IUBA 1OJAA 3G5QA 5AQNB 4LMJA 3LBXA 1POV0 4IDQA 4TWFA 4O2BE 4AKGA 3LK3B 3J9X1 5HCJA 2K24A 2IC9A 5AQHB 4KHPT 1N4VA 5JDMA 1JNRA 5L4EA 3NKZA 5CB4E 4H50A 3ATQA 5F5WA 2UXDT 2UXCT 1KDGA 4MALA 3TLVA 3EABA 1NA1D 2E8IA 4OPGA 4H9RC 1B8SA 1H84A 4YTMA 3AEDA 4K22A 4DV4T 2JB3A 3SM8A 1XDPA 3KINB 4YKGA 2NTXA 1RUG4 1IUWA 3PVCA 3P4PA 2J62A 2JQKA 1L9CA 4LIIA 2CBJA 1FEWA 3NYEA 4U8OA 2XQ8A 2W2UA 1E1NA 1DJQA 2E5VA 3MXZA 4NXMT 2A2FX 4NIQA 1FCDA 3VRDB 1RUF4 3QC9A 3NYCA 2XQ4A 1UX5A 4Y4NA 1EZ3A 4ILUA 2BG9A 2W63A 5E0OA 3CPJG 5U1OA 4UDPA 2V3AA 1YD8G 3ZYLA 3RQWA 5CA0E 1WYCA 3O1JA 3UFGA 1AJ3A 1VRH4 1MNDA 4G2AA 1Q1WA 4CI3B 2V3BA 2BCGG
chains in the Genus database with same CATH topology
1K4QA 5KXJA 3EF6A 4NEWA 1GXFA 1PBBA 2XVFA 1H6VA 2WEUA 2X8CA 2YG4A 1PDHA 3SFEA 3ADAB 3UTEA 4AT0A 3EPTA 2ACZA 1DOEA 2WPCA 1EL8A 1D5TA 4H4RA 1GTEA 1GRGA 3SQPA 4LU6A 4Z44A 5C3JA 2XCGA 3NK0X 2IVDA 4YSHA 3LB8A 1IUTA 1LQTA 2R4JA 3AD9B 3LJPA 3CMMA 2WBAA 3SY4A 2BC0A 2WESA 3DK4A 3F8DA 3AE1A 2X3NA 3RNMA 1E7PA 2YG3A 2XVHA 1NHPA 4REKA 2W0HA 1JEHA 3L1RA 3SUCA 3QFAA 1JOAA 1IUVA 2V5ZA 4U8KA 1VG0A 1NHSA 1E6EA 2BA9A 1YKJA 2XVJA 3IHGA 1HYUA 4TM3A 1Y56A 1JRYA 2GR1A 1D7YA 2V60A 3AEAA 2C3CA 1NDAA 1D7LA 2C67A 2EQ9A 3CGCA 3QJ4A 1N4WA 2BXSA 2Q0LA 2C64A 4G6GA 1KSSA 1MOKA 1TDFA 2XFNA 3M13A 2PHHA 4M52A 4D04A 3AE6A 1IUXA 2E1MA 2GVCA 3UTFA 4CCRA 4IV9A 4A65A 3AE4A 1KSUA 2C70A 3CGEA 4AP3A 3NIXA 1YQ4A 3AE3A 2OLOA 4BK1A 4J33A 3ABVA 3T31A 1H83A 2XLPA 1LPFA 3UKHA 1TYPA 1IUSA 1W4XA 2ZZ0A 1B5QA 2ZZCA 3BI5A 3NRNA 4IVOB 3NNEA 1E1MA 4EQXA 1GRTA 2WPFA 3NT6A 4NWZA 1F3PA 2XVEA 3K30A 3QVRA 4RG4A 2BS3A 2TMDA 2YQUA 1AOGA 2GH5A 3GSIA 1GETA 1P2EA 3AYJA 3ISHA 2FJEA 4I59A 4JQ9A 4OPLA 4BK2A 4CNKA 4Z25A 1PBEA 1REOA 4OVIA 4Z43A 3FBSA 2OLNA 3ICTA 2GR3A 4ZCCA 3B6DA 1KF6A 1SEZA 2YWLA 4RSLA 1S3EA 3CNSA 3QFBA 1YQZA 2XFQA 4EIQA 2WS3A 1E1KA 3UKLA 4JDRA 5HYMA 4H2PA 2B9XA 1NHQA 4H4VA 2B76A 3IC9A 4XWZA 3S61A 2GV8A 1F6MA 2VOUA 3SYIA 3UTHA 4C74A 2BS4A 2FJBA 1GRAA 2XFPA 3GYXA 4J56A 2WOIA 2C4CA 1DJNA 4GDEA 1ONFA 1FEAA 5KOWA 5KNLA 1GERA 4KX6A 3ICRA 5BUKA 2XLRA 3T2ZA 4ADWA 1BKWA 4UDQA 1L0VA 3GQKA 2WDRA 2VVLG 1CHUA 4YKFA 3UOXA 3D1CA 5KVIA 3AE9A 3CTYA 2Z5XA 4TLXA 1GRBA 1M64A 2R46A 2IIDA 1PN0A 1MXTA 5KMPA 3T0KA 4DNAA 4ZCDA 3KVEA 4OPDA 4FK1A 3DJGX 2X8GA 2BK4A 4BJZA 3AWIA 5JCIA 3AE5A 2BRYA 2VRLA 3VR8A 3AE8A 2Y6RA 4H4WA 1CJ4A 3I3LA 2A8XA 1PJ5A 3NK2X 3QVPA 1CC2A 4JNAA 3FPZA 1GREA 3DMEA 3Q6JA 3LOVA 4GCMA 3H4KA 4C3YA 5BVAA 5M10A 2BABA 2VVMA 3GRSA 3BI2A 3G5SA 3UOVA 3NGCX 2QA1A 3CNDA 4TLZA 1O5WA 3NG7X 4NTDA 1NEKA 4YSXA 3GDPA 2GRTA 3GD3A 4H4QA 3AEFA 3I6DA 4A79A 4K2XA 4EM3A 2VVLA 4GR1A 2R45A 5J60A 4AOSA 1M6IA 3BNMA 3AD8B 2AR8A 3ZYXA 1ZY8A 4H7UA 2ZBWA 3C96A 2QCUA 3PS9A 1GRFA 4II3A 2IVEA 1VQWA 2C66A 3GMBA 4N9XA 4USRA 3L8KA 4FX9A 2WETA 4MJWA 1ZMCA 2XLSA 3K7QX 5CKUA 3LADA 5J7XA 3AE2A 3KU9A 4AP1A 4DSHA 5KRQA 4OPTA 2YLWA 1UKVG 2YVFA 4I58A 3AECA 4B63A 2C3DA 5BULA 1Q9IA 3H8IA 1XDIA 1TYTA 3DK9A 3V76A 3GWDA 3EAOA 1S3BA 4CY6A 2GR2A 2LFCA 3NK1X 3QSEA 3AEGA 4H4PA 2A89A 4OPUA 3WE0A 4A6NB 1ZDLA 3M12A 3BHKA 5GRTA 4BJYA 1D4EA 1ELIA 1ZKQA 1QJDA 4H4SA 2HQMA 2C73A 4C5OA 2GAGB 2XDOA 4YSZA 1D4CA 3DGZA 2XLTA 4U8PA 4GUVA 4E0VA 4LA1A 5HY5A 5IPYA 1V59A 1H7XA 1O94A 4AT2A 4C77A 2E4GA 4JY3A 1NENA 1ZK7A 3NYFA 2WOWA 4GF7A 2RGHA 5EOWA 2Q6UA 1LV0A 3SXIA 1H81A 2CULA 1JNZA 2Y6QA 4U8NA 3UKPA 2AQJA 4G74A 1DOBA 4DGKA 3UKFA 4BK3A 3OC4A 1GPEA 4Z2RA 1PXCA 3EANA 4CCQA 5KOXA 3CNPA 1TDNA 4ZN0A 2UZZA 1BZLA 1GALA 2DKIA 2XLUA 2WP5A 2WP9A 4H4ZA 2YLRA 2WU5A 4J57A 4NTCA 1MO9A 2X99A 1FEBA 3VQRA 1S2QA 2B7RA 3H8LA 3IF9A 3DA1A 4Z24A 4YTPA 3BHFA 3UTGA 3ITJA 1RP0A 2C75A 3GDNA 4RG3A 4ECHA 2OAMA 4NEVA 3UP5A 4Z26A 2QAEA 4WCTA 1D4DA 3AYLA 2R9ZA 2GAHB 4NZHA 5FS9A 2FBWA 4O5QA 5KMRA 4K7ZA 4B69A 3DJEA 1K0JA 3AB1A 4X9MA 4J31A 1DOCA 3GMCA 3CGBA 2JKCA 4NTEA 4U2TA 1BGJA 5KMQA 1F8SA 4C3XA 4CRTA 2I0ZA 2YAUA 3AXBA 4H4XA 3ALJA 4Y4LA 4EQWA 1N4UA 1VDCA 4B65A 4TM4A 2FJDA 1KNRA 3C4NA 4PABA 3SX6A 3KKJA 2GEWA 3DGHA 4H4YA 5GSNA 2PYXA 4UDRA 1PJ6A 3V3OA 4B1BA 5JCKA 4O5UA 2GQWA 3DK8A 4G73A 2YG5A 3ALLA 4HB9A 4IVMB 3BI4A 2V61A 3GQHA 2BK5A 4FK1C 4HA6A 1TDEA 1OJDA 3DJDA 3CNTA 5EB4A 1F8RA 1IJHA 3F8PA 3K7TA 3KLJA 1H82A 3VRAA 4TM1A 2JK6A 1DODA 3G5RA 4A6NA 4AOXA 2GQFA 1E1LA 4CY8A 1K0LA 3S5WA 4EMWA 4YT0A 1GRHA 3COXA 1BGNA 2APGA 3T2KA 1NG3A 1BWCA 2YG6A 3SGLA 2BC1A 4X9NA 1ZP0A 3ZDNA 5EBKA 2R0PA 3HYWA 2XYOA 2CVJA 2FJAA 4GAVA 2C72A 4U8LA 4J34A 1ZOVA 2BK3A 3AEBA 3HYXA 3GYIA 3QSMA 3URHA 2WQYA 1XANA 2GMJA 2WPEA 3SZWA 2CDUA 1CC6A 3NTDA 3Q9TA 4EQRA 3KA7A 1Y0PA 3ATRA 5DBJA 1RSGA 3F8RA 4KPRA 3RHAA 4G9KA 1JU2A 4A7AA 2YLTA 4YSYA 4H4UA 2YLZA 4YWOA 3R9UA 1BF3A 2YVGA 1PHHA 5U25A 4EM4A 4YXDA 3SZCA 2XFUA 1GTHA 3K7MX 4A9WA 2BCPA 2X8HA 1TDOA 2ZZBA 4EQSA 5JCNA 1TRBA 5TR3A 3UOZA 5KMSA 1K0IA 3GYJA 1TDKA 1ZMDA 3T2YA 4OPIA 3UCLA 4OCGA 2YLXA 2JBVA 2WOVA 4H4TA 4TM0A 2V6OA 5LV9A 3T37A 3VRBA 1XHCA 2YM2A 3ALMA 1ZX9A 1H7WA 2EQ7A 1JRXA 4APNA 1PBCA 4Z2TA 4EMJA 2EQ6A 3RP7A 2B9WA 3P1WA 3UKKA 4J36A 3CGDA 3UKQA 1O95A 5FS7A 2OA1A 4U8IA 3SFDA 1GSNA 4B64A 1B37A 3QSSA 5ER0A 4K5SA 4UP3A 1CC4A 2WU2A 1CF3A 1L9DA 2RGOA 3UOYA 3UP4A 2R0GA 2YM1A 4JN9A 4A5LA 2R0CA 2C65A 5FS8A 4BV6A 5L46A 1GESA 3UKAA 3P4QA 5KVHA 4H2NA 4H2QA 1LVLA 1ZOYA 3CNJA 2WHDA 3JSKA 2BS2A 2YLSA 1XPQA 1FOHA 5EB5A 4B68A 2CFYA 4Z2UA 3FG2P 5JCMA 1NPXA 1NAAA 3IWAA 3NH3X 2JB2A 2DKHA 2YG7A 5M0ZA 3BNUA 3ICSA 1Z6LA 5BRTA 4K8DA 4BURA 1GOSA 2XFOA 4H2RA 3AYIA 1N1PA 3KPKA 5C2TA 2A87A 4J2WA 3P4SA 2H89A 2BACA 2NPXA 4PAAA 4U2SA 4XXGA 5FS6A 4JY2A 4WX1A 1CJ2A 1PBFA 2GF3A 1DNCA 4IA5A 5IQ1A 2TPRA 1Q1RA 4A99A 3RP6A 1CJCA 3II4A 1GT8A 1RYIA 1VG9A 2WDQA 5FMHA 3IHMA 5U63A 1L9EA 4X4JA 3OZ2A 2ARDA 1FL2A 2R4EA 2YR4A 5IQ4A 2Q0KA 4EMIA 2VRMA 1COYA 4YTNA 4CBQA 3PO7A 3CPIG 3V3NA 3CIRA 4U8MA 1EL5A 2Q7VA 2QA2A 2GMHA 3HZLA 4CNJA 5HXIA 3RP8A 1CL0A 1QLBA 2GR0A 2F5ZA 2JAEA 3C4AA 3FMWA 2BRAA 3B3RA 2WDVA 2J3NA 3CN8A 1S2YA 1IUUA 2BYBA 1H86A 1OJAA 2H88A 3AD7B 2JB1A 3G5QA 4FDCB 1GV4A 3LZXA 2VZ2A 3NN0X 3CPHG 4U8JA 2O9ZA 4IA6A 1FECA 4B66A 4B67A 1CBOA 3AE7A 1PJ7A 1X31B 2BXRA 2WP6A 5CQFA 5KWFA 1EL7A 1E39A 3NN6X 2Z5YA 2VQ7A 2GB0A 1LQUA 3DJJA 4DSGA 1F8WA 1N4VA 1JNRA 4P9SA 3KPFA 3GRTA 3NKSA 4H50A 3ATQA 4NNJA 3E1TA 3P9UA 1Y56B 3REDA 4XWRA 3HYVA 2OALA 1KDGA 3LXDA 2B7SA 1NG4A 2X50A 4ICYA 2C7GA 2NVKX 4U2LA 1LTXR 1QO8A 4USQA 4K5RA 1DXLA 3DH9A 4GAPA 4OPGA 1EL9A 3O0HA 1B8SA 1H84A 2AAQA 4Y4MA 4YTMA 4JNQA 3AEDA 1GEUA 4K22A 1PBDA 2JB3A 2RABA 1PXAA 5HHFA 3SM8A 2YR6A 3KD9A 4GDPA 3NTAA 4G6HA 3AEEA 3VR9A 4YKGA 1EBDA 5JCLA 1IUWA 1P2HA 3LZWA 3PVCA 3P4PA 4II2A 1L9CA 4LIIA 3SZFA 1OJ9A 3NYEA 3GWFA 2RGJA 1YY5A 4U8OA 2B9YA 1DJQA 1E1NA 2E5VA 1FCDA 3VRDB 3NYCA 1PS9A 1B4VA 4Y4NA 2C76A 1OJCA 3T14A 1LJ1A 3GD4A 1PXBA 3FIMB 1KNPA 2XVIA 1VRQB 3CPJG 4GRTA 4UDPA 3NHOX 2V3AA 5U1OA 2YR5A 1GNDA 3SZ0A 2YVJA 1NHRA 3P4RA 3M0OA 3D8XA 1YQ3A 4OPCA 1Q1WA 2EQ8A 2V3BA 3NLCA 1KFYA 1CJ3A 1OJTA 1JRZA 4EIPA 2VQBA 4D03A 2BCGG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4Q A;  5KXJ A;  3EF6 A;  4NEW A;  1GXF A;  1PBB A;  2XVF A;  1H6V A;  2WEU A;  2X8C A;  2YG4 A;  1PDH A;  3SFE A;  3ADA B;  3UTE A;  4AT0 A;  3EPT A;  2ACZ A;  1DOE A;  2WPC A;  1EL8 A;  1D5T A;  4H4R A;  1GTE A;  1GRG A;  3SQP A;  4LU6 A;  4Z44 A;  5C3J A;  2XCG A;  3NK0 X;  2IVD A;  4YSH A;  3LB8 A;  1IUT A;  1LQT A;  2R4J A;  3AD9 B;  3LJP A;  2WBA A;  2BC0 A;  2WES A;  3DK4 A;  3F8D A;  3AE1 A;  2X3N A;  3RNM A;  1E7P A;  2YG3 A;  2XVH A;  1NHP A;  4REK A;  2W0H A;  1JEH A;  3L1R A;  3SUC A;  3QFA A;  1JOA A;  1IUV A;  2V5Z A;  4U8K A;  1VG0 A;  1NHS A;  1E6E A;  2BA9 A;  1YKJ A;  2XVJ A;  3IHG A;  1HYU A;  4TM3 A;  1Y56 A;  1JRY A;  2GR1 A;  1D7Y A;  2V60 A;  3AEA A;  2C3C A;  1NDA A;  1D7L A;  2C67 A;  2EQ9 A;  3CGC A;  3QJ4 A;  1N4W A;  2BXS A;  2Q0L A;  2C64 A;  1KSS A;  1MOK A;  1TDF A;  2XFN A;  3M13 A;  2PHH A;  4M52 A;  4D04 A;  3AE6 A;  1IUX A;  2E1M A;  2GVC A;  3UTF A;  4CCR A;  4IV9 A;  4A65 A;  3AE4 A;  1KSU A;  2C70 A;  3CGE A;  4AP3 A;  3NIX A;  1YQ4 A;  3AE3 A;  2OLO A;  4BK1 A;  4J33 A;  3ABV A;  1H83 A;  2XLP A;  1LPF A;  3UKH A;  1TYP A;  1IUS A;  1W4X A;  2ZZ0 A;  1B5Q A;  2ZZC A;  3BI5 A;  3NRN A;  4IVO B;  3NNE A;  1E1M A;  4EQX A;  1GRT A;  2WPF A;  3NT6 A;  1F3P A;  2XVE A;  3K30 A;  3QVR A;  4RG4 A;  2BS3 A;  2TMD A;  2YQU A;  1AOG A;  2GH5 A;  3GSI A;  1GET A;  1P2E A;  3AYJ A;  3ISH A;  2FJE A;  4I59 A;  4JQ9 A;  4OPL A;  4BK2 A;  4CNK A;  4Z25 A;  1PBE A;  1REO A;  4OVI A;  4Z43 A;  3FBS A;  2OLN A;  3ICT A;  2GR3 A;  4ZCC A;  3B6D A;  1KF6 A;  1SEZ A;  2YWL A;  4RSL A;  1S3E A;  3CNS A;  3QFB A;  1YQZ A;  2XFQ A;  4EIQ A;  2WS3 A;  1E1K A;  3UKL A;  4JDR A;  5HYM A;  4H2P A;  2B9X A;  1NHQ A;  4H4V A;  2B76 A;  3IC9 A;  4XWZ A;  3S61 A;  2GV8 A;  1F6M A;  2VOU A;  3UTH A;  4C74 A;  2BS4 A;  2FJB A;  1GRA A;  2XFP A;  4J56 A;  3GYX A;  2WOI A;  1DJN A;  4GDE A;  1ONF A;  1FEA A;  5KOW A;  1GER A;  4KX6 A;  3ICR A;  5BUK A;  2XLR A;  4ADW A;  1BKW A;  4UDQ A;  1L0V A;  3GQK A;  2WDR A;  2VVL G;  1CHU A;  4YKF A;  3UOX A;  3D1C A;  5KVI A;  3AE9 A;  3CTY A;  2Z5X A;  4TLX A;  1GRB A;  1M64 A;  2R46 A;  2IID A;  1PN0 A;  1MXT A;  4DNA A;  4ZCD A;  3KVE A;  4OPD A;  4FK1 A;  3DJG X;  2X8G A;  2BK4 A;  4BJZ A;  3AWI A;  5JCI A;  3AE5 A;  2VRL A;  3VR8 A;  3AE8 A;  2Y6R A;  4H4W A;  1CJ4 A;  3I3L A;  2A8X A;  1PJ5 A;  3NK2 X;  3QVP A;  1CC2 A;  4JNA A;  3FPZ A;  1GRE A;  3DME A;  3Q6J A;  3LOV A;  4GCM A;  3H4K A;  4C3Y A;  5BVA A;  5M10 A;  2BAB A;  2VVM A;  3GRS A;  3BI2 A;  3G5S A;  3UOV A;  3NGC X;  2QA1 A;  3CND A;  4TLZ A;  1O5W A;  3NG7 X;  4NTD A;  1NEK A;  4YSX A;  3GDP A;  2GRT A;  3GD3 A;  4H4Q A;  3AEF A;  3I6D A;  4A79 A;  4K2X A;  4EM3 A;  2VVL A;  4GR1 A;  2R45 A;  5J60 A;  4AOS A;  1M6I A;  3BNM A;  3AD8 B;  2AR8 A;  3ZYX A;  1ZY8 A;  4H7U A;  2ZBW A;  3C96 A;  2QCU A;  3PS9 A;  1GRF A;  2IVE A;  1VQW A;  2C66 A;  3GMB A;  4N9X A;  4USR A;  3L8K A;  4FX9 A;  2WET A;  4MJW A;  1ZMC A;  2XLS A;  3K7Q X;  5CKU A;  3LAD A;  5J7X A;  3AE2 A;  3KU9 A;  4AP1 A;  4DSH A;  5KRQ A;  4OPT A;  2YLW A;  1UKV G;  2YVF A;  4I58 A;  3AEC A;  4B63 A;  2C3D A;  5BUL A;  1Q9I A;  3H8I A;  1XDI A;  1TYT A;  3DK9 A;  3V76 A;  3GWD A;  3EAO A;  1S3B A;  4CY6 A;  2GR2 A;  2LFC A;  3NK1 X;  3QSE A;  3AEG A;  4H4P A;  2A89 A;  4OPU A;  3WE0 A;  4A6N B;  1ZDL A;  3M12 A;  3BHK A;  5GRT A;  4BJY A;  1D4E A;  1ELI A;  1ZKQ A;  1QJD A;  4H4S A;  2HQM A;  2C73 A;  4C5O A;  2GAG B;  2XDO A;  4YSZ A;  1D4C A;  3DGZ A;  2XLT A;  4U8P A;  4GUV A;  4E0V A;  4LA1 A;  5HY5 A;  5IPY A;  1V59 A;  1H7X A;  1O94 A;  4AT2 A;  4C77 A;  2E4G A;  4JY3 A;  1NEN A;  1ZK7 A;  3NYF A;  2WOW A;  4GF7 A;  2RGH A;  5EOW A;  2Q6U A;  1LV0 A;  1H81 A;  2CUL A;  1JNZ A;  2Y6Q A;  4U8N A;  3UKP A;  2AQJ A;  1DOB A;  4DGK A;  3UKF A;  4BK3 A;  3OC4 A;  1GPE A;  4Z2R A;  1PXC A;  3EAN A;  4CCQ A;  5KOX A;  3CNP A;  1TDN A;  4ZN0 A;  2UZZ A;  1BZL A;  1GAL A;  2DKI A;  2XLU A;  2WP5 A;  2WP9 A;  4H4Z A;  2YLR A;  2WU5 A;  4J57 A;  4NTC A;  1MO9 A;  2X99 A;  1FEB A;  3VQR A;  1S2Q A;  2B7R A;  3H8L A;  3IF9 A;  3DA1 A;  4Z24 A;  4YTP A;  3BHF A;  3UTG A;  3ITJ A;  1RP0 A;  2C75 A;  3GDN A;  4RG3 A;  4ECH A;  2OAM A;  4NEV A;  3UP5 A;  4Z26 A;  2QAE A;  4WCT A;  1D4D A;  3AYL A;  2R9Z A;  2GAH B;  4NZH A;  5FS9 A;  2FBW A;  4O5Q A;  4K7Z A;  4B69 A;  3DJE A;  1K0J A;  3AB1 A;  4X9M A;  4J31 A;  1DOC A;  3GMC A;  3CGB A;  2JKC A;  4NTE A;  4U2T A;  1BGJ A;  4CRT A;  1F8S A;  4C3X A;  2I0Z A;  2YAU A;  3AXB A;  4H4X A;  3ALJ A;  4Y4L A;  4EQW A;  1N4U A;  1VDC A;  4B65 A;  4TM4 A;  2FJD A;  1KNR A;  3C4N A;  4PAB A;  3KKJ A;  2GEW A;  3DGH A;  4H4Y A;  5GSN A;  2PYX A;  4UDR A;  1PJ6 A;  3V3O A;  4B1B A;  5JCK A;  4O5U A;  2GQW A;  3DK8 A;  2YG5 A;  3ALL A;  4HB9 A;  4IVM B;  3BI4 A;  2V61 A;  3GQH A;  2BK5 A;  4FK1 C;  4HA6 A;  1TDE A;  1OJD A;  3DJD A;  3CNT A;  5EB4 A;  1F8R A;  1IJH A;  3F8P A;  3K7T A;  3KLJ A;  1H82 A;  3VRA A;  4TM1 A;  2JK6 A;  1DOD A;  3G5R A;  4A6N A;  4AOX A;  2GQF A;  1E1L A;  4CY8 A;  1K0L A;  3S5W A;  4EMW A;  4YT0 A;  1GRH A;  3COX A;  1BGN A;  2APG A;  1NG3 A;  1BWC A;  2YG6 A;  3SGL A;  2BC1 A;  4X9N A;  1ZP0 A;  3ZDN A;  5EBK A;  2R0P A;  2XYO A;  2CVJ A;  2FJA A;  2C72 A;  4U8L A;  4J34 A;  1ZOV A;  2BK3 A;  3AEB A;  3GYI A;  3QSM A;  3URH A;  2WQY A;  1XAN A;  2GMJ A;  2WPE A;  4EQR A;  2CDU A;  1CC6 A;  3NTD A;  3Q9T A;  3KA7 A;  1Y0P A;  3ATR A;  5DBJ A;  1RSG A;  3F8R A;  4KPR A;  3RHA A;  1JU2 A;  4A7A A;  2YLT A;  4YSY A;  4H4U A;  2YLZ A;  4YWO A;  3R9U A;  1BF3 A;  2YVG A;  1PHH A;  5U25 A;  4EM4 A;  4YXD A;  2XFU A;  1GTH A;  3K7M X;  4A9W A;  2BCP A;  2X8H A;  1TDO A;  2ZZB A;  4EQS A;  5JCN A;  1TRB A;  5TR3 A;  3UOZ A;  1K0I A;  3GYJ A;  1TDK A;  1ZMD A;  4OPI A;  3UCL A;  4OCG A;  2YLX A;  2JBV A;  2WOV A;  4H4T A;  4TM0 A;  2V6O A;  5LV9 A;  3T37 A;  3VRB A;  1XHC A;  2YM2 A;  3ALM A;  1ZX9 A;  1H7W A;  2EQ7 A;  1JRX A;  4APN A;  1PBC A;  4Z2T A;  4EMJ A;  2EQ6 A;  3RP7 A;  2B9W A;  3P1W A;  3UKK A;  4J36 A;  3CGD A;  3UKQ A;  1O95 A;  5FS7 A;  2OA1 A;  4U8I A;  3SFD A;  1GSN A;  4B64 A;  1B37 A;  3QSS A;  5ER0 A;  4K5S A;  4UP3 A;  1CC4 A;  2WU2 A;  1CF3 A;  1L9D A;  2RGO A;  3UOY A;  3UP4 A;  2R0G A;  2YM1 A;  4JN9 A;  4A5L A;  2R0C A;  2C65 A;  5FS8 A;  4BV6 A;  5L46 A;  1GES A;  3UKA A;  3P4Q A;  5KVH A;  4H2N A;  4H2Q A;  1LVL A;  1ZOY A;  3CNJ A;  2WHD A;  3JSK A;  2BS2 A;  2YLS A;  1XPQ A;  1FOH A;  5EB5 A;  4B68 A;  2CFY A;  4Z2U A;  3FG2 P;  5JCM A;  1NPX A;  1NAA A;  3IWA A;  3NH3 X;  2JB2 A;  2DKH A;  2YG7 A;  5M0Z A;  3BNU A;  3ICS A;  1Z6L A;  5BRT A;  4K8D A;  4BUR A;  1GOS A;  2XFO A;  4H2R A;  3AYI A;  1N1P A;  5C2T A;  2A87 A;  4J2W A;  3P4S A;  2H89 A;  2BAC A;  2NPX A;  4PAA A;  4U2S A;  4XXG A;  5FS6 A;  4JY2 A;  4WX1 A;  1CJ2 A;  1PBF A;  2GF3 A;  1DNC A;  4IA5 A;  5IQ1 A;  2TPR A;  1Q1R A;  4A99 A;  3RP6 A;  1CJC A;  3II4 A;  1GT8 A;  1RYI A;  1VG9 A;  2WDQ A;  5FMH A;  3IHM A;  5U63 A;  1L9E A;  4X4J A;  3OZ2 A;  2ARD A;  1FL2 A;  2R4E A;  2YR4 A;  5IQ4 A;  2Q0K A;  4EMI A;  2VRM A;  1COY A;  4YTN A;  4CBQ A;  3PO7 A;  3CPI G;  3V3N A;  3CIR A;  4U8M A;  1EL5 A;  2Q7V A;  2QA2 A;  2GMH A;  3HZL A;  4CNJ A;  5HXI A;  3RP8 A;  1CL0 A;  1QLB A;  2GR0 A;  2F5Z A;  2JAE A;  3C4A A;  3FMW A;  3B3R A;  2WDV A;  2J3N A;  3CN8 A;  1S2Y A;  1IUU A;  2BYB A;  1H86 A;  1OJA A;  2H88 A;  3AD7 B;  2JB1 A;  3G5Q A;  4FDC B;  1GV4 A;  3LZX A;  2VZ2 A;  3NN0 X;  3CPH G;  4U8J A;  2O9Z A;  4IA6 A;  1FEC A;  4B66 A;  4B67 A;  1CBO A;  3AE7 A;  1PJ7 A;  1X31 B;  2BXR A;  2WP6 A;  5CQF A;  5KWF A;  1EL7 A;  1E39 A;  3NN6 X;  2Z5Y A;  2VQ7 A;  2GB0 A;  1LQU A;  3DJJ A;  4DSG A;  1F8W A;  1N4V A;  1JNR A;  4P9S A;  3KPF A;  3GRT A;  3NKS A;  4H50 A;  3ATQ A;  3E1T A;  3P9U A;  1Y56 B;  3RED A;  4XWR A;  2OAL A;  1KDG A;  3LXD A;  2B7S A;  1NG4 A;  2X50 A;  4ICY A;  2C7G A;  2NVK X;  4U2L A;  1LTX R;  1QO8 A;  4USQ A;  4K5R A;  1DXL A;  3DH9 A;  4OPG A;  1EL9 A;  3O0H A;  1B8S A;  1H84 A;  2AAQ A;  4Y4M A;  4YTM A;  4JNQ A;  3AED A;  1GEU A;  4K22 A;  1PBD A;  2JB3 A;  2RAB A;  1PXA A;  5HHF A;  3SM8 A;  2YR6 A;  3KD9 A;  4GDP A;  3NTA A;  3AEE A;  3VR9 A;  4YKG A;  1EBD A;  5JCL A;  1IUW A;  1P2H A;  3LZW A;  3PVC A;  3P4P A;  1L9C A;  4LII A;  1OJ9 A;  3NYE A;  3GWF A;  2RGJ A;  1YY5 A;  4U8O A;  2B9Y A;  1DJQ A;  1E1N A;  2E5V A;  1FCD A;  3VRD B;  3NYC A;  1PS9 A;  1B4V A;  4Y4N A;  2C76 A;  1OJC A;  1LJ1 A;  3GD4 A;  1PXB A;  3FIM B;  1KNP A;  2XVI A;  1VRQ B;  3CPJ G;  4GRT A;  4UDP A;  3NHO X;  2V3A A;  5U1O A;  2YR5 A;  1GND A;  2YVJ A;  1NHR A;  3P4R A;  3M0O A;  3D8X A;  1YQ3 A;  4OPC A;  1Q1W A;  2EQ8 A;  2V3B A;  3NLC A;  1KFY A;  1CJ3 A;  1OJT A;  1JRZ A;  4EIP A;  2VQB A;  4D03 A;  2BCG G; 
#chains in the Genus database with same CATH topology
 1K4Q A;  4NEW A;  5EK4 A;  2R6G F;  3OVU A;  1H6V A;  3ADA B;  1PDH A;  4IE7 A;  3SFE A;  2ZMA A;  3EPT A;  3ZN0 B;  1D5T A;  3WAK A;  2VL8 A;  1GTE A;  2HWC 4;  1COV 4;  2B1E A;  3S4U A;  2XCG A;  3AAI A;  3RLF F;  5LHG B;  3LB8 A;  1IUT A;  2ZM8 A;  2R4J A;  1W9R A;  5AQP B;  5BMV E;  4GB3 4;  2X3N A;  2LEH A;  1NHP A;  2W0H A;  1JEH A;  5ABF A;  3KV9 A;  4BAY B;  2D2S A;  4EZ4 A;  3I1A A;  4TM3 A;  4HWD A;  5LYJ E;  3HKC E;  2R7F A;  2C3C A;  1D7L A;  2C67 A;  2EQ9 A;  1N36 T;  3L39 A;  3EVY A;  4IE4 A;  5HXE A;  1HFA A;  4G6G A;  3RRW A;  4B3T T;  2MTQ A;  1MOK A;  1TDF A;  2PHH A;  3AE6 A;  2GVC A;  2E1M A;  3UTF A;  1HXS 4;  4IV9 A;  4GK0 E;  4A65 A;  3MKD A;  1KSU A;  4ILC A;  4AXP A;  1YQ4 A;  2OLO A;  1ZKE A;  3T31 A;  4H9O C;  2XLP A;  2X51 A;  2VWA A;  2W66 A;  3IA3 A;  1E1M A;  4DV7 T;  3NT6 A;  4NWZ A;  3K30 A;  3QVR A;  5ETW A;  2BS3 A;  3PUR A;  5FY0 A;  2TMD A;  2GH5 A;  4OPL A;  1GET A;  4HTE A;  3RH3 A;  1REO A;  2VB6 A;  2ACX A;  4Z43 A;  3FI7 A;  1MIV A;  5JDF A;  2QA7 A;  2XAS B;  4EXT A;  4H63 V;  3LJC A;  3N9M A;  3PJA A;  1YQZ A;  3QFB A;  2WBL A;  2WS3 A;  1UK5 A;  4H4V A;  1NHQ A;  3IC9 A;  3S61 A;  1HNW T;  3UTH A;  1M62 A;  1GRA A;  1Z7S 4;  1VOM A;  1DJN A;  1ONF A;  1FEA A;  1GER A;  2XAQ B;  1J5E T;  4DR4 T;  5BUK A;  2XLR A;  1X9B A;  3RIA A;  4UDQ A;  4IL4 A;  4OX9 T;  4ZOL E;  4DND A;  2WM9 A;  1M64 A;  3I0Q A;  5LCY A;  2XAJ B;  2LKH A;  2CPT A;  1MQT D;  3MJX A;  5AQV B;  3AA6 B;  3UU5 A;  2X8G A;  4U31 A;  3AWI A;  1SE7 A;  2VRL A;  1XNQ T;  1CJ4 A;  1PJ5 A;  2V6Y A;  3BQK A;  1XHZ A;  3JC6 C;  1GRE A;  2SPC A;  2VKH A;  3H4K A;  4JUY A;  2IDO B;  4ZI3 C;  5F3J A;  2PY5 A;  3UOV A;  4JI3 T;  3CND A;  4TLZ A;  1O5W A;  2GRT A;  3AB3 B;  5JVD E;  2JJ9 A;  4IT4 A;  4K2X A;  1S35 A;  2VVL A;  4GR1 A;  2R45 A;  2PTF A;  3RC8 A;  5FP3 A;  5J2T E;  4CZZ B;  3C96 A;  5HAX A;  1RUE 4;  4CN1 A;  1VQW A;  4AQY T;  4N9X A;  2RPA A;  2WET A;  5CJ5 A;  3HR0 A;  3K7Q X;  5KRQ A;  3AE2 A;  3CKD A;  4DSH A;  4OPT A;  2YLW A;  5AQM B;  4LF6 T;  2V7K A;  4ZEY A;  5L3G B;  1TYT A;  2CLY C;  1IBM T;  3GWD A;  2ZLY A;  4YJ3 E;  1ZDL A;  2XSB A;  1AR9 4;  2DHR A;  4DBQ A;  5GRT A;  1ELI A;  3ETV A;  4H4S A;  4IDO A;  4MFR A;  2XLT A;  3LG7 A;  4U8P A;  4E0V A;  1H7X A;  4CXW A;  2WMO A;  4GF7 A;  1LV0 A;  2HH7 A;  4H9N C;  4EIW A;  4UF0 A;  2UUC T;  2AQJ A;  4O4H E;  4G74 A;  4DGK A;  2VKD A;  3CQX C;  4CCQ A;  3CNP A;  4ZN0 A;  1GAL A;  4BJN A;  3VHL A;  4KI0 F;  2XLU A;  2WP5 A;  4H4Z A;  4AQF C;  2LJL A;  4CQI A;  2LKG A;  1MO9 A;  1FEB A;  1YKH B;  5CA1 E;  3IF9 A;  3DA1 A;  5AQR B;  3UTG A;  3ITJ A;  3GDN A;  5JDG A;  3U3I A;  4B3M T;  2LHR A;  1D4D A;  2EHO D;  2R9Z A;  5FS9 A;  2FBW A;  3BQI A;  3FBZ A;  2D5U A;  2XZE A;  3UU6 A;  1DOC A;  4CRT A;  1BGJ A;  4DR5 T;  2D0T A;  1F8S A;  5KX5 E;  2I0Z A;  2PJQ A;  3T1Y T;  4HFB A;  1OED B;  1VDC A;  3C4N A;  3KKJ A;  4UDR A;  5JTG A;  3ZMT B;  2GQW A;  2BKP A;  2YG5 A;  4HB9 A;  3ZJ1 A;  2YDR A;  2X9H A;  3DJD A;  1IJH A;  3K7T A;  2VKJ A;  4NPP A;  4DV3 T;  1M7K A;  1FJG T;  4A6N A;  4AI6 A;  1K0L A;  4EMW A;  4X64 T;  3COX A;  1VBE 4;  1NG3 A;  1VCT A;  1BWC A;  4UXN B;  2YG6 A;  4X9N A;  2Q9Q D;  3CWZ B;  4JLE A;  2XYO A;  2ZM2 A;  5HEH A;  2X9W A;  5FXX A;  4COF A;  4J34 A;  3HYX A;  3ZC0 A;  3UU3 A;  4EQR A;  3NTD A;  3KA7 A;  3MZK B;  1Y0P A;  5DBJ A;  3IEE A;  4OYJ A;  2WZH A;  4G9K A;  3RHW A;  3C98 B;  2YLZ A;  5CFB A;  1BF3 A;  2YVG A;  3U78 A;  3K7M X;  3LBX B;  2PG8 A;  4A9W A;  2A72 A;  1TDO A;  3MA9 A;  1K0I A;  3GYJ A;  4JI5 T;  3T2Y A;  5FMN A;  4AKI A;  3UCL A;  5H6R B;  2JBV A;  2OA5 A;  2RR1 4;  3EDU A;  2YM2 A;  2EQ7 A;  4JEH B;  4QXH B;  3UKQ A;  4PDW D;  3RKO A;  4B64 A;  3PUV F;  4GYR A;  4UP3 A;  1CC4 A;  2WU2 A;  2RGO A;  2R0G A;  2C65 A;  5FS8 A;  2KMF A;  1IAP A;  1GES A;  3P4Q A;  1LVL A;  3A7M A;  2MOZ A;  2CXF A;  2CFY A;  5JCM A;  1NPX A;  3NH3 X;  1T8B A;  2DKH A;  3AAE B;  2V26 A;  2CWY A;  1Z6L A;  3UUN A;  4QHO A;  4H2R A;  4TNW A;  3AYI A;  3RGL A;  2X0L B;  2BG9 B;  2CXD A;  4UV8 B;  3Q5E A;  4EYY R;  4XXG A;  4LMK A;  3IBP A;  4WX1 A;  4IA5 A;  1D0Y A;  3F31 A;  5IQ1 A;  2JRK A;  3C4X A;  1RMU 4;  4A99 A;  1UCU A;  3RP6 A;  2PFV A;  1D1B A;  3N9O A;  4DID B;  5FMH A;  1Z8U A;  5U63 A;  2LOP A;  4X4J A;  5IQ4 A;  1FL2 A;  3UQ4 A;  2KIN B;  2R4E A;  3LFM A;  2HPL A;  3SRZ A;  4EMI A;  4CBQ A;  3PU8 A;  4AKL A;  1EL5 A;  4C91 A;  1WLX A;  3OKQ A;  2Q7V A;  2QA2 A;  4GKJ T;  1WFD A;  3FMW A;  5L3E B;  2F5Z A;  1NCQ D;  4PFP A;  3NRY A;  3CN8 A;  4YHH T;  4AQF A;  3AD7 B;  2H88 A;  4FDC B;  3ZJ2 A;  2VZ2 A;  3KV4 A;  3CPH G;  3R84 B;  2O9Z A;  2K3W A;  1T98 A;  5CQF A;  2QVA A;  4WNK A;  1EL7 A;  1E39 A;  1HG5 A;  5AQF B;  2M6B A;  2JQQ A;  5ABF B;  3KVB A;  3DJJ A;  4AKH A;  3GRT A;  3E1T A;  4PAG A;  2B7S A;  2X50 A;  4ICY A;  4PJJ A;  2C7G A;  5HXC A;  3N2K E;  1QO8 A;  4ILB A;  4U33 A;  2BVL A;  2I6H A;  4JNQ A;  3FZH B;  5C8Y E;  5HHF A;  2V5C A;  3NTA A;  2XTL A;  4O2A E;  5JCL A;  4II2 A;  5LXT E;  1OJ9 A;  2K5B B;  2E2A A;  2YDQ A;  5HEJ A;  3VU7 H;  2CM0 A;  1PS9 A;  3KDS E;  2YOE A;  1LJ1 A;  2BKO A;  3GD4 A;  1PXB A;  2V6X A;  1KNP A;  1VRQ B;  1R8I A;  3SZ0 A;  3OBV E;  1NHR A;  2YVJ A;  3P4R A;  4NUV A;  3HKE E;  5AQS B;  3D8X A;  1YQ3 A;  4UVB B;  2V7J A;  3NLC A;  1KFY A;  2CE7 A;  4UR9 A;  1OJT A;  4EIP A;  2VQB A;  4U7I A;  1PHH A;  4A56 A;  2JQH A;  2WEU A;  1FMW A;  3UTE A;  4IDP A;  1DOE A;  2KSR A;  1OOP D;  5L3C B;  4U2Y A;  4LU6 A;  3RQU A;  3SOL A;  1LQT A;  5JRE A;  1Y01 A;  3AXJ A;  4TN7 B;  2WES A;  3ZT5 A;  3DK4 A;  3EDV A;  4OK0 A;  3DTO A;  2LM2 A;  3L1R A;  4PK4 A;  4U8K A;  1E6E A;  2R06 4;  3KBT A;  3KVA A;  1JRY A;  3K3O A;  2V60 A;  1EAH 4;  2V6Y B;  3QJ4 A;  2QYW A;  2BXS A;  4O4L E;  1KSS A;  4M52 A;  3M13 A;  4CCR A;  3BQL A;  3AE4 A;  2IW5 B;  2A3D A;  5HXR A;  1N33 T;  1RHI 4;  1HTJ F;  2YIN A;  1E1H B;  1B7T A;  3IHR A;  3UU8 A;  4YLH A;  1TYP A;  3UKH A;  2ZZ0 A;  2ZZC A;  1B5Q A;  1RVF 4;  4IVO B;  4MHC A;  1GRT A;  2RS5 4;  3PE0 A;  3P50 A;  3FXD B;  3GSI A;  4YFS A;  5BR8 T;  1XHX A;  4CNK A;  1PBE A;  1R09 4;  3ICT A;  3N9L A;  3PUZ F;  3UQ7 A;  1RUC 4;  1MMG A;  4RSL A;  3CNS A;  3F2E A;  1HG2 A;  4EIQ A;  5HYM A;  4H2P A;  3A5X A;  4XWZ A;  2EHO C;  2GV8 A;  2ZM6 T;  2I59 A;  4GK5 E;  4XAX B;  3N9P A;  1HX8 A;  1VCS A;  2C4C A;  5EK3 A;  2E9X C;  3ICR A;  5FYM A;  2J1D G;  3BK9 A;  1L0V A;  4DR2 T;  2LSY A;  4X1I E;  3UOX A;  2I0M A;  2DCF A;  4WW0 A;  5KVI A;  4P0A A;  3CTY A;  4TLX A;  1GRB A;  3NZQ A;  4UF0 B;  4DNA A;  2D0U A;  5DQW A;  3UU4 A;  3V5U A;  5LMN T;  4LFC T;  2BK4 A;  4BJZ A;  3JD7 4;  2JQ9 A;  4K0K T;  2C5J A;  4Z90 A;  2PZS A;  1VBC 4;  2ZM0 A;  4LML A;  1UUS A;  1AR7 4;  1V9D A;  3NK2 X;  3EAM A;  3C50 A;  3Q6J A;  4GCM A;  3LOV A;  2JIW A;  2BAB A;  2VVM A;  3GRS A;  3Q2M A;  3G5S A;  5HYA A;  1D4M 4;  4TX5 A;  1LVK A;  5AQL B;  4DMW A;  2E5L T;  2NP9 A;  2XY8 B;  2Q9Q C;  1GQE A;  3GD3 A;  2PBI A;  4A79 A;  3PUX F;  3CX8 B;  1HRI 4;  5DAB A;  1O3X A;  2XQ5 A;  2YKS A;  1GRF A;  3RYC E;  2C66 A;  3GMB A;  4P0B A;  4FX9 A;  4IE6 A;  4DR3 T;  4HWI B;  3QNU A;  1UKV G;  1PO2 4;  3AEC A;  1T7S A;  4B63 A;  4GYS A;  2C3D A;  5BUL A;  1Q9I A;  1XDI A;  3C4Z A;  1OWA A;  2RA1 A;  1D0X A;  2WMN A;  4OHF A;  5HCM A;  4Q4V 4;  4IGU A;  5LG3 A;  2YN6 A;  3QSE A;  4OPU A;  3WE0 A;  4A6N B;  3HKD E;  3BHK A;  1D4E A;  1QJD A;  4UEM A;  4F6R C;  2RMU 4;  2HQM A;  2C73 A;  3N2G E;  2XDO A;  1KK7 A;  4YSZ A;  4X65 T;  5M4Y A;  4LA1 A;  4AT2 A;  1XZY A;  1NEN A;  2M6I A;  3NYF A;  2WOW A;  3PDY A;  5DJQ C;  3SXI A;  2X0Y A;  4UV9 B;  2DWK A;  2Y6Q A;  2N2N A;  4U8N A;  3UKP A;  4P1N A;  2JMK A;  4X20 E;  5AQK B;  3PUY F;  3ZST A;  4FJO A;  5FNV E;  1TDN A;  3TLS A;  5LOV E;  2DKI A;  3HI2 A;  3QB5 A;  2WP9 A;  1XDO A;  2X67 A;  4J57 A;  5AQT B;  4NTC A;  2B7R A;  3TLT A;  1BR0 A;  1RP0 A;  2C75 A;  2W62 A;  4YJ2 E;  5AQU B;  3GWH A;  2OAM A;  3RKG A;  3UP5 A;  5IUX A;  2KWI B;  3ZMS B;  3AYL A;  2GAH B;  4KUM B;  1D1C A;  4CXY A;  4ILA A;  2WWV A;  4ZHQ E;  2W0G A;  4PW8 A;  4JI4 T;  4B69 A;  4X9M A;  4J31 A;  2YDS A;  4KP3 C;  3CGB A;  5KMQ A;  2NTY A;  3V5S A;  4H4X A;  3KV6 A;  2K48 A;  2YU2 A;  3JAE A;  4WBN E;  4YY3 T;  4BA9 A;  3SX6 A;  4Z8X A;  2PYX A;  4GKK T;  2KWH A;  2KND A;  4IVM B;  4Q4W 4;  3BI4 A;  2V61 A;  4FK1 C;  4HA6 A;  4ZI2 C;  1TDE A;  3CNT A;  3GA8 A;  4IL9 A;  5HEG A;  1F8R A;  3F8P A;  3ANW A;  2VQE T;  1K5M D;  2GQF A;  1E1L A;  3C4W A;  4YT0 A;  3KBU A;  4IDZ A;  2APG A;  4IST A;  3ZMU B;  2E9X A;  3WAJ A;  1ZP0 A;  3AA7 B;  2R0P A;  1HR0 T;  3HYW A;  4DV5 T;  4L9I A;  4AQG A;  2FJA A;  4HGA A;  4GAV A;  4U8L A;  3OYZ A;  1ZOV A;  4U2Z A;  3GYI A;  3QSM A;  1XAN A;  3SZW A;  1IBL T;  3ATR A;  2GK9 A;  4HWF A;  3L09 A;  4A7A A;  4YSY A;  4H4U A;  4YWO A;  4CXX A;  3R9U A;  2IHR 1;  4EM4 A;  2X5I D;  2XFU A;  5TR3 A;  3CVR A;  1TDK A;  4OCG A;  2NR4 A;  2YLX A;  2LRK A;  4KBM B;  4U72 A;  4TM0 A;  2V6O A;  5LV9 A;  4X62 T;  3VRB A;  4Z2T A;  1JRX A;  4Q25 A;  2EQ6 A;  3RP7 A;  1IZN B;  3K3N A;  2B9W A;  3UKK A;  1N32 T;  2L9Q A;  2OA1 A;  4U8I A;  3SFD A;  1E2A A;  4IHJ E;  2AXD S;  3AVS A;  3ESL A;  4DO0 A;  1CF3 A;  2R07 4;  4A5L A;  5LJM A;  3UP4 A;  3N9N A;  1ZOY A;  3CNJ A;  4A5X A;  2MAW A;  4I4T E;  2BS2 A;  2WZI A;  1XPQ A;  5EB5 A;  1NAA A;  3W15 B;  3PV0 F;  3ICS A;  4K8D A;  1DU2 A;  4OYK A;  1N1P A;  2H89 A;  1SA0 E;  5EZY E;  4JY2 A;  4HE8 A;  5HEU A;  1DNC A;  1GT8 A;  1VG9 A;  5LGU B;  3ONX A;  3RI5 A;  2BKN A;  1L9E A;  2XSA A;  4QX7 B;  4F8H A;  4JV5 T;  2YR4 A;  3M65 A;  4EB6 E;  2VRM A;  1COY A;  4YTN A;  3PO7 A;  3CPI G;  2UXN B;  3CIR A;  3ETU A;  4WBO A;  1YW0 A;  2X0H A;  4KHZ F;  5HXI A;  2GR0 A;  2JAE A;  1MMN A;  2WDV A;  5JDH A;  1S2Y A;  3ZKR A;  1IUU A;  2BYB A;  4P9S A;  2NW9 A;  4JI6 T;  2IML A;  3LZX A;  2BBH A;  3WI3 A;  3AXJ B;  4U8J A;  4B66 A;  2NOX A;  1CBO A;  3AE7 A;  5ABH A;  1PJ7 A;  2WP6 A;  5KWF A;  3NN6 X;  2Z5Y A;  2HWB 4;  2PYL A;  5AQG B;  4DVD A;  4NNJ A;  3RED A;  3N2O A;  1WRD A;  3LXD A;  3ZT7 A;  1LTX R;  4USQ A;  3PUS A;  4JI2 T;  3MK7 C;  3O0H A;  1AR6 4;  2XUE A;  4AKR B;  2L8K A;  2AAQ A;  4Y4M A;  2HHH T;  1PBD A;  5FVK A;  1PXA A;  4HFE A;  2YR6 A;  4B3S T;  4GDP A;  4G6H A;  3AEE A;  5HEO A;  3VR9 A;  1EBD A;  1P2H A;  1HX1 B;  1AL2 4;  3GWF A;  4DV1 T;  2RGJ A;  3EHZ A;  1VBA 4;  5HWY A;  2C76 A;  3T14 A;  3OJA A;  4QKN A;  3FIM B;  4TV9 E;  2VVN A;  2XVI A;  3NHO X;  2YR5 A;  4DV6 T;  3FHN A;  3NWI A;  3DJB A;  3M0O A;  2EQ8 A;  1CJ3 A;  1D1A A;  1FIO A;  5JDQ A;  5LB7 B;  4A97 A;  5KXJ A;  1RUD 4;  1GXF A;  2XVF A;  2X8C A;  3RF1 A;  4B6X A;  4LFB T;  4IIJ E;  4H9S E;  4QX8 B;  4JI8 T;  2WPC A;  4H4R A;  2QGS A;  1GRG A;  3SQP A;  1UX4 A;  3NK0 X;  4YSH A;  4UIG A;  1T72 A;  1Y64 B;  5LJN A;  4UVC B;  3E08 A;  2LOS A;  3F8D A;  5CGM A;  3RNM A;  1E7P A;  4IE0 A;  1H8T D;  4C90 A;  2XVH A;  4G63 A;  3SUC A;  3QFA A;  2V5Z A;  1IUV A;  4CI1 B;  3AA1 B;  1YKJ A;  2XVJ A;  2CWO A;  1HYU A;  1Y56 A;  3AEA A;  1NDA A;  1BR1 A;  3CGC A;  1N4W A;  3CQG B;  1WYB A;  2C64 A;  2W00 A;  4YHJ A;  2XFN A;  4RHV 4;  4D04 A;  1Z0P A;  1IUX A;  2V8S V;  1D0Z A;  1WCR A;  2C70 A;  4BK1 A;  2KLQ A;  4J33 A;  3ABV A;  3RIU C;  4Q4X 4;  1LPF A;  3NVO A;  3QK6 A;  1VRB A;  1IUS A;  1W4X A;  3BI5 A;  2CEA A;  3NNE A;  2WPF A;  4X1Y E;  2XVE A;  2QRX A;  2YK0 A;  2UXB T;  3ISH A;  4I59 A;  4OVI A;  5TAO A;  2OLN A;  2XQ9 A;  4ZCC A;  3B6D A;  3UFE A;  1CUN A;  2YWL A;  1W0A A;  5FKY A;  4ANJ A;  2XFQ A;  3UKL A;  2B9X A;  3RYH E;  1U5P A;  3SYI A;  5FY1 A;  2XFP A;  4J56 A;  2WOI A;  3ZCI A;  4EED A;  4GDE A;  5KNL A;  4QH4 A;  2WAU A;  3UUM A;  5J0Z A;  2JPF A;  3T2Z A;  1BKW A;  1S94 A;  5JRC A;  4JI0 T;  3JAF A;  2VVL G;  3D1C A;  3AE9 A;  5ABG A;  2R46 A;  2WCA A;  1MXT A;  1PN0 A;  3T0K A;  3KVE A;  2ES0 A;  4OPD A;  3EI0 A;  5AQJ B;  2VL0 A;  2BG9 C;  2BRY A;  3G06 A;  4HWC A;  4ZI3 D;  3VR8 A;  3AE8 A;  3SWH A;  1YXR A;  2XHE B;  4H4W A;  4IE5 A;  2V7M A;  4JNA A;  4I55 E;  5BVA A;  3DME A;  5M10 A;  3OPC A;  3K8P C;  1W0B A;  3PUA A;  3D0T A;  4J2C A;  4CN6 A;  4EZH A;  5IHY A;  2Z6E A;  3NG7 X;  4NTD A;  4YSX A;  1NWM X;  3GDP A;  2KZ7 B;  4EAH A;  4HN9 A;  3P8C D;  4H4Q A;  2NW8 A;  1M6I A;  4ZZC A;  3ZYX A;  4H7U A;  1HRV 4;  2ZBW A;  4PJL A;  4HFV A;  3PS9 A;  4NUU A;  4USR A;  3L8K A;  4OFZ A;  4MJW A;  4QWN B;  1ZMC A;  2XLS A;  5J7X A;  3LAD A;  3KU9 A;  4AP1 A;  4P09 A;  5HXS A;  3JCF A;  2WSS V;  4UEL A;  1BEV 4;  3FZM B;  3V76 A;  3O1H A;  3OYX A;  3ANW B;  3EAO A;  1S3B A;  2LT3 A;  2GR2 A;  4EOZ B;  3NK1 X;  3AEG A;  4EV6 A;  2EHO B;  3K1S A;  4ZZB A;  2A89 A;  3M12 A;  1LVF A;  4HEA A;  1ZKQ A;  4C5O A;  2VAS A;  2E9X B;  4GOU A;  1D4C A;  3GMI A;  4GUV A;  4H63 H;  1XI1 A;  1O94 A;  4C77 A;  5L3D B;  2F4V T;  3AVR A;  1ZK7 A;  1HNZ T;  4BJM A;  2Q6U A;  3L8R A;  1H81 A;  1JNZ A;  3ONL C;  2FUP A;  4E7S A;  1DOB A;  3UKF A;  4MLK A;  3UUL A;  4BK3 A;  3OC4 A;  2CCQ A;  1GPE A;  3EAN A;  5KOX A;  2VQF T;  2UZZ A;  3FB2 A;  3AAA B;  2YLR A;  3LK2 B;  3Q9D A;  1S2Q A;  4Z24 A;  1YKE B;  3J7Y q;  4YTP A;  3BHF A;  2NW7 A;  4Z91 A;  4O4I E;  2V1D B;  5HXH A;  4LF7 T;  4RG3 A;  4NEV A;  1MMA A;  4Z26 A;  2QAE A;  4U3C A;  2VKO A;  3ZLI A;  5L2L A;  4O5Q A;  5L3B B;  2LM9 A;  5AFU L;  3DJE A;  2BG9 E;  3AB1 A;  2Q9Q B;  2V7L A;  5L47 A;  1HNX T;  3GMC A;  4NTE A;  4U2T A;  5KMG P;  4C3X A;  3HA4 A;  2YAU A;  2KXP B;  3GN5 A;  3RIU A;  4Y4L A;  1MIY A;  4B65 A;  2FJD A;  1KNR A;  5FY7 A;  3A8Y C;  2GEW A;  4H4Y A;  1WR0 A;  5LGT B;  3V3O A;  1PJ6 A;  4O5U A;  3DK8 A;  4G73 A;  3C64 A;  3ALL A;  1NAF A;  4U74 A;  5H6Q B;  5EB4 A;  1EV1 4;  2Y6X A;  3Q5X A;  3ONJ A;  4DBR A;  3KLJ A;  4I50 E;  1H82 A;  2JK6 A;  4TWD A;  2XJ7 A;  4AOX A;  5JR9 C;  1MMD A;  4CY8 A;  4JI7 T;  2CXL A;  3UTK A;  4N78 D;  3SGL A;  1RUI 4;  5EK2 A;  2BC1 A;  3ZDN A;  3X1D A;  5EBK A;  5JDL A;  2MYS A;  4LFA T;  5FVL A;  4QH1 A;  5FL1 A;  3AEB A;  3RC3 A;  4IRE A;  3URH A;  5ADX L;  4TWH A;  3OTO T;  2GMJ A;  1MNE A;  2WPE A;  3Q9T A;  4HFC A;  3F8R A;  4PFO A;  4JI1 T;  1JU2 A;  4NXN T;  3CX6 B;  3NZP A;  4V1A v;  3Q5W A;  5L3F B;  4O4J E;  5U25 A;  3SZC A;  2UXX B;  1GTH A;  2CMR A;  3K3Q C;  4L5G A;  2BCP A;  2X8H A;  2ZZB A;  5JCN A;  1TRB A;  3UOZ A;  1PIV 4;  3PUQ A;  5KMS A;  2ODV A;  1ZMD A;  2HN2 A;  4UVA B;  2Y8D A;  1G73 A;  4H4T A;  3I9W A;  2HPJ A;  3T37 A;  1ZX9 A;  1H7W A;  1PBC A;  3B5M A;  2IAK A;  3P1W A;  1XNR T;  2G0U A;  4J36 A;  5FS7 A;  1GSN A;  4DMV A;  4K5S A;  1XMO T;  2V7I A;  1L9D A;  5L46 A;  3Q5D A;  2YM1 A;  2R0C A;  4BV6 A;  3R6N A;  4EYU A;  4ZXL A;  5KVH A;  4ZS2 A;  2WHD A;  2W61 A;  2X9Y A;  3JSK A;  1FOH A;  1W09 A;  2DLR A;  5FXW A;  2XM2 A;  4Z2U A;  4ASK A;  3IWA A;  5LA6 E;  2YG7 A;  4AIU A;  5M0Z A;  4CN4 A;  3E22 E;  4BUR A;  1GOS A;  1BR2 A;  2XFO A;  3EUH A;  3KPK A;  2A87 A;  4LF4 T;  2NPX A;  5FS6 A;  4PAA A;  4U2S A;  5LBM A;  1ZEE A;  1H7C A;  1CJ2 A;  2GF3 A;  5A1L A;  2TPR A;  1Q1R A;  3ZN1 B;  3PUW F;  1CJC A;  3II4 A;  4PK6 A;  4DR6 T;  5JQG E;  2LSI A;  3OZ2 A;  2ARD A;  2LHN A;  1KNZ A;  2CA5 A;  2Q0K A;  3ZMZ B;  2VVS A;  5JDN A;  4AIS A;  3V3N A;  3HKB E;  2GMH A;  3HZL A;  1CL0 A;  4ZI7 E;  3C4A A;  3H3M A;  3O9X A;  1H86 A;  2JB1 A;  1GV4 A;  3NN0 X;  4IA6 A;  1FEC A;  4B67 A;  2BXR A;  1X31 B;  1RUJ 4;  1I6Z A;  1VBB 4;  2VQ7 A;  2GB0 A;  2AE9 A;  5AQI B;  2R04 4;  1LQU A;  4DSG A;  1F8W A;  2XQ6 A;  5LHI B;  3KPF A;  3NKS A;  2WB5 A;  2H3R A;  3P9U A;  3B57 A;  2CLY B;  1Y56 B;  4XWR A;  3HYV A;  2OAL A;  2EHO A;  1NG4 A;  2NVK X;  4U2L A;  2WY2 A;  3CX7 B;  4K5R A;  1DXL A;  3DH9 A;  4GAP A;  5L4H A;  1EL9 A;  1GEU A;  5HWX A;  2H7V C;  2RAB A;  4JEU B;  3IF8 B;  3KD9 A;  5F8P A;  5LGN B;  3LZW A;  3SZF A;  3KV5 A;  2K9A A;  4PJM A;  1YY5 A;  2B9Y A;  3ZYK A;  1B4V A;  1VBD 4;  1OJC A;  4ZS3 A;  5JR9 A;  4GRT A;  1GND A;  3M3Z B;  4A98 A;  4B3R T;  4OPC A;  3PU3 A;  4QXC B;  1JRZ A;  3GYX A;  4D03 A;  3EF6 A;  2LSG A;  4K7Z A;  1PBB A;  2Q9Q A;  3UUX B;  2YG4 A;  2MBG A;  4AT0 A;  2N9D A;  4TV8 E;  2ACZ A;  1EL8 A;  2XAF B;  4HKA A;  4O8S A;  2PW9 A;  5JRC B;  4CI2 B;  4Z44 A;  5C3J A;  2IVD A;  2M67 A;  4PK5 A;  3QB5 K;  3AD9 B;  3UT5 E;  3ZT6 A;  3CMM A;  3LJP A;  2WBA A;  3SY4 A;  4HFH A;  5DQV A;  2BC0 A;  3FXE B;  3AE1 A;  1UGO A;  2W4X A;  2BVM A;  4WZX A;  2YG3 A;  4U7Y A;  4REK A;  1SUM B;  4HFI A;  1JOA A;  1VG0 A;  2VUR A;  1NHS A;  3O1I A;  1HF8 A;  2BA9 A;  2CHO A;  4ADZ A;  3IHG A;  4I43 B;  4DUZ T;  4TNV A;  3KFW X;  2GR1 A;  1J1J A;  1D7Y A;  2Q0L A;  2BZB A;  3CGE A;  4AP3 A;  3NIX A;  3I9Y A;  3O4X E;  3AE3 A;  5J1G A;  3N5L A;  1H83 A;  2W67 A;  4PNI A;  3H3A A;  3NRN A;  2NWB A;  2V5D A;  3I0O A;  4EQX A;  3E0Z A;  3TLU A;  1F3P A;  4RG4 A;  2YQU A;  1AOG A;  4JQ9 A;  3AYJ A;  1P2E A;  2FJE A;  4BK2 A;  4Z25 A;  3FBS A;  5LP6 E;  2CBI A;  2GR3 A;  1PVC 4;  5J2U E;  1KF6 A;  1SEZ A;  3HL6 A;  1S3E A;  2X66 A;  3F57 A;  3J8F 4;  1E1K A;  4JDR A;  2E9X D;  2B76 A;  4HWH A;  3CQC B;  3N9Q A;  1F6M A;  2VOU A;  4IDN A;  2L3L A;  4C74 A;  2BS4 A;  2FJB A;  2YEV C;  3MAC A;  5KOW A;  4JBW F;  4KX6 A;  4ADW A;  4XBF B;  3GQK A;  2WDR A;  4L0R A;  1CHU A;  4YKF A;  2Z5X A;  2LRL A;  4K0U A;  2BBJ A;  2IID A;  5KMP A;  4ZCD A;  4FK1 A;  3DJG X;  4EGW A;  5JCI A;  3AE5 A;  3ZMV B;  4LF9 T;  2Y6R A;  3NRX A;  1RUH 4;  3I3L A;  2A8X A;  3FZF B;  3T8O A;  3QVP A;  1CC2 A;  4DR1 T;  3FPZ A;  5FXV A;  4C3Y A;  3RPU A;  2UUA T;  2DL1 A;  3BI2 A;  4LF8 T;  3NGC X;  2QA1 A;  3PJA J;  2ODU A;  1NEK A;  3DP7 A;  5AQQ B;  1OXZ A;  4X1K E;  3RYI E;  3AEF A;  3I6D A;  3LSV A;  4EM3 A;  5J60 A;  4AOS A;  3BNM A;  1HS7 A;  3AD8 B;  1OED C;  1BR4 A;  4QH5 A;  2AR8 A;  3TLW A;  1ZY8 A;  3GN5 B;  2QCU A;  2CHN A;  4II3 A;  2IVE A;  5LHH B;  3ZC1 A;  3T1H T;  4X5T A;  1US7 B;  2IC6 A;  2PLV 4;  5CKU A;  4KMC A;  2RP4 A;  1ASJ 4;  2YVF A;  3JBG 4;  2HN1 A;  4I58 A;  3H37 A;  2LSJ A;  3H8I A;  3DK9 A;  3ZYM A;  1X79 A;  2XQ3 A;  4CY6 A;  3VKG A;  1G8X A;  2LFC A;  4I0U A;  1ZHC A;  4H4P A;  1R08 4;  2XQY A;  1IJ5 A;  3PTR B;  4BJY A;  5IWA T;  2OLT A;  2GAG B;  2RS3 4;  5IPY A;  3DGZ A;  5HY5 A;  3CML A;  1V59 A;  2E4G A;  4JY3 A;  1MIW A;  2RGH A;  5EOW A;  4E7Z A;  2CUL A;  3FZK B;  2Y48 B;  5LBQ B;  4Z2R A;  3VKH A;  1PXC A;  1BZL A;  2A9U A;  2N1G A;  5JH7 E;  2WU5 A;  3VQR A;  2X99 A;  3AA0 B;  2DI4 A;  3H8L A;  2UUB T;  3ZSS A;  1I94 T;  4ECH A;  5GON E;  4TZ4 C;  3L3P A;  2DNX A;  4WCT A;  2WWU A;  4NZH A;  3FZL B;  5KMR A;  2RS1 4;  3RRC A;  1K0J A;  1HCI A;  2X9X A;  4Q4Y 4;  3ZEF B;  3QUJ A;  2JKC A;  1IJ6 A;  1SHZ C;  4HFD A;  3AXB A;  4EQW A;  3ALJ A;  3RYF E;  5IYZ E;  3RIF A;  1N4U A;  4TM4 A;  5KDM C;  3LDQ B;  4PAB A;  4ZI2 D;  2UU9 T;  3DGH A;  5GSN A;  4B1B A;  5JCK A;  2XPK A;  4H9P C;  4WYV A;  3GQH A;  2BK5 A;  1OJD A;  2LLY A;  5FL0 A;  1OED E;  3VRA A;  4TM1 A;  4DV2 T;  2IIU A;  4DV0 T;  3JC6 D;  1DOD A;  3G5R A;  5FXZ A;  4GIW A;  3S5W A;  4XZC A;  1GRH A;  1BGN A;  3UUB A;  3T2K A;  2J4G A;  1WR6 A;  3SS1 A;  4QXB B;  3B13 A;  2CVJ A;  4FI5 A;  2J47 A;  2C72 A;  2EX3 A;  3QOF A;  4EEB A;  4LF5 T;  5LG4 A;  2BK3 A;  2WQY A;  5ABE A;  1CC6 A;  2CDU A;  1RSG A;  4KPR A;  3RHA A;  2YLT A;  5LNK A;  2D9D A;  3LK4 2;  4TUY E;  4YXD A;  3TKL B;  3CPZ A;  4MBQ A;  4EQS A;  2C5K T;  2C0S A;  4H9Q C;  2X68 A;  4OPI A;  4M1P A;  1N34 T;  4X66 T;  3ZCJ A;  3PUG A;  2WOV A;  4DUY T;  1J5W A;  4DR7 T;  1U4Q A;  2PYJ A;  3CK6 A;  1XHC A;  2VK9 A;  3ALM A;  4APN A;  4EMJ A;  3P7I A;  2RM2 4;  1OED A;  3ZPO A;  3CGD A;  1O95 A;  2XM1 A;  1B37 A;  3QSS A;  5ER0 A;  1AR8 4;  2XAG B;  3P4W A;  2XAH B;  3UOY A;  1KEY A;  4JN9 A;  2C5I T;  4ISS A;  3NBX X;  3UKA A;  4H2N A;  1LKX A;  2LSK A;  4H2Q A;  2LE8 A;  2YLS A;  4B68 A;  2YU1 A;  3FG2 P;  1ZV4 X;  1LRZ A;  1XMQ T;  2JB2 A;  3C51 A;  2H7O A;  1IBK T;  1FMV A;  3BNU A;  5BRT A;  4PJN A;  1XWM A;  1QUU A;  5C2T A;  2DWG A;  5JR9 B;  4J2W A;  3P4S A;  2BAC A;  4ERR A;  1PBF A;  2JMH A;  1RYI A;  1UUR A;  2WDQ A;  3RX6 A;  3IHM A;  2OV9 A;  3JAD A;  1PO1 4;  2XQA A;  5AQO B;  4U8M A;  4CNJ A;  2BDE A;  4JYA T;  3RP8 A;  1QSD A;  1QLB A;  2CRB A;  3FBL A;  2BRA A;  3B3R A;  2KT9 A;  5LMU T;  2P9B A;  2J3N A;  2XQ7 A;  2MPK A;  2IUB A;  1OJA A;  3G5Q A;  5AQN B;  4LMJ A;  3LBX A;  1POV 0;  4IDQ A;  4TWF A;  4O2B E;  4AKG A;  3LK3 B;  3J9X 1;  5HCJ A;  2K24 A;  2IC9 A;  5AQH B;  4KHP T;  1N4V A;  5JDM A;  1JNR A;  5L4E A;  3NKZ A;  5CB4 E;  4H50 A;  3ATQ A;  5F5W A;  2UXD T;  2UXC T;  1KDG A;  4MAL A;  3TLV A;  3EAB A;  1NA1 D;  2E8I A;  4OPG A;  4H9R C;  1B8S A;  1H84 A;  4YTM A;  3AED A;  4K22 A;  4DV4 T;  2JB3 A;  3SM8 A;  1XDP A;  3KIN B;  4YKG A;  2NTX A;  1RUG 4;  1IUW A;  3PVC A;  3P4P A;  2J62 A;  2JQK A;  1L9C A;  4LII A;  2CBJ A;  1FEW A;  3NYE A;  4U8O A;  2XQ8 A;  2W2U A;  1E1N A;  1DJQ A;  2E5V A;  3MXZ A;  4NXM T;  2A2F X;  4NIQ A;  1FCD A;  3VRD B;  1RUF 4;  3QC9 A;  3NYC A;  2XQ4 A;  1UX5 A;  4Y4N A;  1EZ3 A;  4ILU A;  2BG9 A;  2W63 A;  5E0O A;  3CPJ G;  5U1O A;  4UDP A;  2V3A A;  1YD8 G;  3ZYL A;  3RQW A;  5CA0 E;  1WYC A;  3O1J A;  3UFG A;  1AJ3 A;  1VRH 4;  1MND A;  4G2A A;  1Q1W A;  4CI3 B;  2V3B A;  2BCG G; 
#chains in the Genus database with same CATH homology
 1K4Q A;  5KXJ A;  3EF6 A;  4NEW A;  1GXF A;  1PBB A;  2XVF A;  1H6V A;  2WEU A;  2X8C A;  2YG4 A;  1PDH A;  3SFE A;  3ADA B;  3UTE A;  4AT0 A;  3EPT A;  2ACZ A;  1DOE A;  2WPC A;  1EL8 A;  1D5T A;  4H4R A;  1GTE A;  1GRG A;  3SQP A;  4LU6 A;  4Z44 A;  5C3J A;  2XCG A;  3NK0 X;  2IVD A;  4YSH A;  3LB8 A;  1IUT A;  1LQT A;  2R4J A;  3AD9 B;  3LJP A;  3CMM A;  2WBA A;  3SY4 A;  2BC0 A;  2WES A;  3DK4 A;  3F8D A;  3AE1 A;  2X3N A;  3RNM A;  1E7P A;  2YG3 A;  2XVH A;  1NHP A;  4REK A;  2W0H A;  1JEH A;  3L1R A;  3SUC A;  3QFA A;  1JOA A;  1IUV A;  2V5Z A;  4U8K A;  1VG0 A;  1NHS A;  1E6E A;  2BA9 A;  1YKJ A;  2XVJ A;  3IHG A;  1HYU A;  4TM3 A;  1Y56 A;  1JRY A;  2GR1 A;  1D7Y A;  2V60 A;  3AEA A;  2C3C A;  1NDA A;  1D7L A;  2C67 A;  2EQ9 A;  3CGC A;  3QJ4 A;  1N4W A;  2BXS A;  2Q0L A;  2C64 A;  4G6G A;  1KSS A;  1MOK A;  1TDF A;  2XFN A;  3M13 A;  2PHH A;  4M52 A;  4D04 A;  3AE6 A;  1IUX A;  2E1M A;  2GVC A;  3UTF A;  4CCR A;  4IV9 A;  4A65 A;  3AE4 A;  1KSU A;  2C70 A;  3CGE A;  4AP3 A;  3NIX A;  1YQ4 A;  3AE3 A;  2OLO A;  4BK1 A;  4J33 A;  3ABV A;  3T31 A;  1H83 A;  2XLP A;  1LPF A;  3UKH A;  1TYP A;  1IUS A;  1W4X A;  2ZZ0 A;  1B5Q A;  2ZZC A;  3BI5 A;  3NRN A;  4IVO B;  3NNE A;  1E1M A;  4EQX A;  1GRT A;  2WPF A;  3NT6 A;  4NWZ A;  1F3P A;  2XVE A;  3K30 A;  3QVR A;  4RG4 A;  2BS3 A;  2TMD A;  2YQU A;  1AOG A;  2GH5 A;  3GSI A;  1GET A;  1P2E A;  3AYJ A;  3ISH A;  2FJE A;  4I59 A;  4JQ9 A;  4OPL A;  4BK2 A;  4CNK A;  4Z25 A;  1PBE A;  1REO A;  4OVI A;  4Z43 A;  3FBS A;  2OLN A;  3ICT A;  2GR3 A;  4ZCC A;  3B6D A;  1KF6 A;  1SEZ A;  2YWL A;  4RSL A;  1S3E A;  3CNS A;  3QFB A;  1YQZ A;  2XFQ A;  4EIQ A;  2WS3 A;  1E1K A;  3UKL A;  4JDR A;  5HYM A;  4H2P A;  2B9X A;  1NHQ A;  4H4V A;  2B76 A;  3IC9 A;  4XWZ A;  3S61 A;  2GV8 A;  1F6M A;  2VOU A;  3SYI A;  3UTH A;  4C74 A;  2BS4 A;  2FJB A;  1GRA A;  2XFP A;  3GYX A;  4J56 A;  2WOI A;  2C4C A;  1DJN A;  4GDE A;  1ONF A;  1FEA A;  5KOW A;  5KNL A;  1GER A;  4KX6 A;  3ICR A;  5BUK A;  2XLR A;  3T2Z A;  4ADW A;  1BKW A;  4UDQ A;  1L0V A;  3GQK A;  2WDR A;  2VVL G;  1CHU A;  4YKF A;  3UOX A;  3D1C A;  5KVI A;  3AE9 A;  3CTY A;  2Z5X A;  4TLX A;  1GRB A;  1M64 A;  2R46 A;  2IID A;  1PN0 A;  1MXT A;  5KMP A;  3T0K A;  4DNA A;  4ZCD A;  3KVE A;  4OPD A;  4FK1 A;  3DJG X;  2X8G A;  2BK4 A;  4BJZ A;  3AWI A;  5JCI A;  3AE5 A;  2BRY A;  2VRL A;  3VR8 A;  3AE8 A;  2Y6R A;  4H4W A;  1CJ4 A;  3I3L A;  2A8X A;  1PJ5 A;  3NK2 X;  3QVP A;  1CC2 A;  4JNA A;  3FPZ A;  1GRE A;  3DME A;  3Q6J A;  3LOV A;  4GCM A;  3H4K A;  4C3Y A;  5BVA A;  5M10 A;  2BAB A;  2VVM A;  3GRS A;  3BI2 A;  3G5S A;  3UOV A;  3NGC X;  2QA1 A;  3CND A;  4TLZ A;  1O5W A;  3NG7 X;  4NTD A;  1NEK A;  4YSX A;  3GDP A;  2GRT A;  3GD3 A;  4H4Q A;  3AEF A;  3I6D A;  4A79 A;  4K2X A;  4EM3 A;  2VVL A;  4GR1 A;  2R45 A;  5J60 A;  4AOS A;  1M6I A;  3BNM A;  3AD8 B;  2AR8 A;  3ZYX A;  1ZY8 A;  4H7U A;  2ZBW A;  3C96 A;  2QCU A;  3PS9 A;  1GRF A;  4II3 A;  2IVE A;  1VQW A;  2C66 A;  3GMB A;  4N9X A;  4USR A;  3L8K A;  4FX9 A;  2WET A;  4MJW A;  1ZMC A;  2XLS A;  3K7Q X;  5CKU A;  3LAD A;  5J7X A;  3AE2 A;  3KU9 A;  4AP1 A;  4DSH A;  5KRQ A;  4OPT A;  2YLW A;  1UKV G;  2YVF A;  4I58 A;  3AEC A;  4B63 A;  2C3D A;  5BUL A;  1Q9I A;  3H8I A;  1XDI A;  1TYT A;  3DK9 A;  3V76 A;  3GWD A;  3EAO A;  1S3B A;  4CY6 A;  2GR2 A;  2LFC A;  3NK1 X;  3QSE A;  3AEG A;  4H4P A;  2A89 A;  4OPU A;  3WE0 A;  4A6N B;  1ZDL A;  3M12 A;  3BHK A;  5GRT A;  4BJY A;  1D4E A;  1ELI A;  1ZKQ A;  1QJD A;  4H4S A;  2HQM A;  2C73 A;  4C5O A;  2GAG B;  2XDO A;  4YSZ A;  1D4C A;  3DGZ A;  2XLT A;  4U8P A;  4GUV A;  4E0V A;  4LA1 A;  5HY5 A;  5IPY A;  1V59 A;  1H7X A;  1O94 A;  4AT2 A;  4C77 A;  2E4G A;  4JY3 A;  1NEN A;  1ZK7 A;  3NYF A;  2WOW A;  4GF7 A;  2RGH A;  5EOW A;  2Q6U A;  1LV0 A;  3SXI A;  1H81 A;  2CUL A;  1JNZ A;  2Y6Q A;  4U8N A;  3UKP A;  2AQJ A;  4G74 A;  1DOB A;  4DGK A;  3UKF A;  4BK3 A;  3OC4 A;  1GPE A;  4Z2R A;  1PXC A;  3EAN A;  4CCQ A;  5KOX A;  3CNP A;  1TDN A;  4ZN0 A;  2UZZ A;  1BZL A;  1GAL A;  2DKI A;  2XLU A;  2WP5 A;  2WP9 A;  4H4Z A;  2YLR A;  2WU5 A;  4J57 A;  4NTC A;  1MO9 A;  2X99 A;  1FEB A;  3VQR A;  1S2Q A;  2B7R A;  3H8L A;  3IF9 A;  3DA1 A;  4Z24 A;  4YTP A;  3BHF A;  3UTG A;  3ITJ A;  1RP0 A;  2C75 A;  3GDN A;  4RG3 A;  4ECH A;  2OAM A;  4NEV A;  3UP5 A;  4Z26 A;  2QAE A;  4WCT A;  1D4D A;  3AYL A;  2R9Z A;  2GAH B;  4NZH A;  5FS9 A;  2FBW A;  4O5Q A;  5KMR A;  4K7Z A;  4B69 A;  3DJE A;  1K0J A;  3AB1 A;  4X9M A;  4J31 A;  1DOC A;  3GMC A;  3CGB A;  2JKC A;  4NTE A;  4U2T A;  1BGJ A;  5KMQ A;  1F8S A;  4C3X A;  4CRT A;  2I0Z A;  2YAU A;  3AXB A;  4H4X A;  3ALJ A;  4Y4L A;  4EQW A;  1N4U A;  1VDC A;  4B65 A;  4TM4 A;  2FJD A;  1KNR A;  3C4N A;  4PAB A;  3SX6 A;  3KKJ A;  2GEW A;  3DGH A;  4H4Y A;  5GSN A;  2PYX A;  4UDR A;  1PJ6 A;  3V3O A;  4B1B A;  5JCK A;  4O5U A;  2GQW A;  3DK8 A;  4G73 A;  2YG5 A;  3ALL A;  4HB9 A;  4IVM B;  3BI4 A;  2V61 A;  3GQH A;  2BK5 A;  4FK1 C;  4HA6 A;  1TDE A;  1OJD A;  3DJD A;  3CNT A;  5EB4 A;  1F8R A;  1IJH A;  3F8P A;  3K7T A;  3KLJ A;  1H82 A;  3VRA A;  4TM1 A;  2JK6 A;  1DOD A;  3G5R A;  4A6N A;  4AOX A;  2GQF A;  1E1L A;  4CY8 A;  1K0L A;  3S5W A;  4EMW A;  4YT0 A;  1GRH A;  3COX A;  1BGN A;  2APG A;  3T2K A;  1NG3 A;  1BWC A;  2YG6 A;  3SGL A;  2BC1 A;  4X9N A;  1ZP0 A;  3ZDN A;  5EBK A;  2R0P A;  3HYW A;  2XYO A;  2CVJ A;  2FJA A;  4GAV A;  2C72 A;  4U8L A;  4J34 A;  1ZOV A;  2BK3 A;  3AEB A;  3HYX A;  3GYI A;  3QSM A;  3URH A;  2WQY A;  1XAN A;  2GMJ A;  2WPE A;  3SZW A;  2CDU A;  1CC6 A;  3NTD A;  3Q9T A;  4EQR A;  3KA7 A;  1Y0P A;  3ATR A;  5DBJ A;  1RSG A;  3F8R A;  4KPR A;  3RHA A;  4G9K A;  1JU2 A;  4A7A A;  2YLT A;  4YSY A;  4H4U A;  2YLZ A;  4YWO A;  3R9U A;  1BF3 A;  2YVG A;  1PHH A;  5U25 A;  4EM4 A;  4YXD A;  3SZC A;  2XFU A;  1GTH A;  3K7M X;  4A9W A;  2BCP A;  2X8H A;  1TDO A;  2ZZB A;  4EQS A;  5JCN A;  1TRB A;  5TR3 A;  3UOZ A;  5KMS A;  1K0I A;  3GYJ A;  1TDK A;  1ZMD A;  3T2Y A;  4OPI A;  3UCL A;  4OCG A;  2YLX A;  2JBV A;  2WOV A;  4H4T A;  4TM0 A;  2V6O A;  5LV9 A;  3T37 A;  3VRB A;  1XHC A;  2YM2 A;  3ALM A;  1ZX9 A;  1H7W A;  2EQ7 A;  1JRX A;  4APN A;  1PBC A;  4Z2T A;  4EMJ A;  2EQ6 A;  3RP7 A;  2B9W A;  3P1W A;  3UKK A;  4J36 A;  3CGD A;  3UKQ A;  1O95 A;  5FS7 A;  2OA1 A;  4U8I A;  3SFD A;  1GSN A;  4B64 A;  1B37 A;  3QSS A;  5ER0 A;  4K5S A;  4UP3 A;  1CC4 A;  2WU2 A;  1CF3 A;  1L9D A;  2RGO A;  3UOY A;  3UP4 A;  2R0G A;  2YM1 A;  4JN9 A;  4A5L A;  2R0C A;  2C65 A;  5FS8 A;  4BV6 A;  5L46 A;  1GES A;  3UKA A;  3P4Q A;  5KVH A;  4H2N A;  4H2Q A;  1LVL A;  1ZOY A;  3CNJ A;  2WHD A;  3JSK A;  2BS2 A;  2YLS A;  1XPQ A;  1FOH A;  5EB5 A;  4B68 A;  2CFY A;  4Z2U A;  3FG2 P;  5JCM A;  1NPX A;  1NAA A;  3IWA A;  3NH3 X;  2JB2 A;  2DKH A;  2YG7 A;  5M0Z A;  3BNU A;  3ICS A;  1Z6L A;  5BRT A;  4K8D A;  4BUR A;  1GOS A;  2XFO A;  4H2R A;  3AYI A;  1N1P A;  3KPK A;  5C2T A;  2A87 A;  4J2W A;  3P4S A;  2H89 A;  2BAC A;  2NPX A;  4PAA A;  4U2S A;  4XXG A;  5FS6 A;  4JY2 A;  4WX1 A;  1CJ2 A;  1PBF A;  2GF3 A;  1DNC A;  4IA5 A;  5IQ1 A;  2TPR A;  1Q1R A;  4A99 A;  3RP6 A;  1CJC A;  3II4 A;  1GT8 A;  1RYI A;  1VG9 A;  2WDQ A;  5FMH A;  3IHM A;  5U63 A;  1L9E A;  4X4J A;  3OZ2 A;  2ARD A;  1FL2 A;  2R4E A;  2YR4 A;  5IQ4 A;  2Q0K A;  4EMI A;  2VRM A;  1COY A;  4YTN A;  4CBQ A;  3PO7 A;  3CPI G;  3V3N A;  3CIR A;  4U8M A;  1EL5 A;  2Q7V A;  2QA2 A;  2GMH A;  3HZL A;  4CNJ A;  5HXI A;  3RP8 A;  1CL0 A;  1QLB A;  2GR0 A;  2F5Z A;  2JAE A;  3C4A A;  3FMW A;  2BRA A;  3B3R A;  2WDV A;  2J3N A;  3CN8 A;  1S2Y A;  1IUU A;  2BYB A;  1H86 A;  1OJA A;  2H88 A;  3AD7 B;  2JB1 A;  3G5Q A;  4FDC B;  1GV4 A;  3LZX A;  2VZ2 A;  3NN0 X;  3CPH G;  4U8J A;  2O9Z A;  4IA6 A;  1FEC A;  4B66 A;  4B67 A;  1CBO A;  3AE7 A;  1PJ7 A;  1X31 B;  2BXR A;  2WP6 A;  5CQF A;  5KWF A;  1EL7 A;  1E39 A;  3NN6 X;  2Z5Y A;  2VQ7 A;  2GB0 A;  1LQU A;  3DJJ A;  4DSG A;  1F8W A;  1N4V A;  1JNR A;  4P9S A;  3KPF A;  3GRT A;  3NKS A;  4H50 A;  3ATQ A;  4NNJ A;  3E1T A;  3P9U A;  1Y56 B;  3RED A;  4XWR A;  3HYV A;  2OAL A;  1KDG A;  3LXD A;  2B7S A;  1NG4 A;  2X50 A;  4ICY A;  2C7G A;  2NVK X;  4U2L A;  1LTX R;  1QO8 A;  4USQ A;  4K5R A;  1DXL A;  3DH9 A;  4GAP A;  4OPG A;  1EL9 A;  3O0H A;  1B8S A;  1H84 A;  2AAQ A;  4Y4M A;  4YTM A;  4JNQ A;  3AED A;  1GEU A;  4K22 A;  1PBD A;  2JB3 A;  2RAB A;  1PXA A;  5HHF A;  3SM8 A;  2YR6 A;  3KD9 A;  4GDP A;  3NTA A;  4G6H A;  3AEE A;  3VR9 A;  4YKG A;  1EBD A;  5JCL A;  1IUW A;  1P2H A;  3LZW A;  3PVC A;  3P4P A;  4II2 A;  1L9C A;  4LII A;  3SZF A;  1OJ9 A;  3NYE A;  3GWF A;  2RGJ A;  1YY5 A;  4U8O A;  2B9Y A;  1DJQ A;  1E1N A;  2E5V A;  1FCD A;  3VRD B;  3NYC A;  1PS9 A;  1B4V A;  4Y4N A;  2C76 A;  1OJC A;  3T14 A;  1LJ1 A;  3GD4 A;  1PXB A;  3FIM B;  1KNP A;  2XVI A;  1VRQ B;  3CPJ G;  4GRT A;  4UDP A;  3NHO X;  2V3A A;  5U1O A;  2YR5 A;  1GND A;  3SZ0 A;  2YVJ A;  1NHR A;  3P4R A;  3M0O A;  3D8X A;  1YQ3 A;  4OPC A;  1Q1W A;  2EQ8 A;  2V3B A;  3NLC A;  1KFY A;  1CJ3 A;  1OJT A;  1JRZ A;  4EIP A;  2VQB A;  4D03 A;  2BCG G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...