4YTMA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 206
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytmA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytmA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytmA04
3NYEA 2OALA 5HYMA 1E1MA 3UP5A 2GR0A 1AOGA 3AWIA 3GRTA 3CGCA 3ICTA 3CPJG 4LU6A 1H83A 3CTYA 1IUXA 1JRXA 4A7AA 5U1OA 1H86A 3ISHA 1VG0A 5M10A 3EPTA 3NLCA 4H2NA 4EIPA 3NK1X 2C67A 1H6VA 3NKSA 4H4WA 3LZWA 2WETA 3BHKA 3AE2A 2RGJA 2BC0A 2JB3A 2YLZA 3UKQA 4C77A 4GF7A 1LQUA 3CPIG 2XFUA 1ZMCA 4OPDA 3UOVA 4H4PA 1OJDA 2GRTA 3G5RA 3NNEA 1EL5A 3ATRA 3AYJA 3CNDA 1LVLA 2B7RA 2RGHA 4C3XA 4TM0A 4TM4A 2E5VA 3CNTA 2GMHA 3F8PA 1D4DA 4J33A 2GR1A 1TRBA 2BCGG 2ZZBA 4USQA 3NGCX 4FK1A 2XLUA 4Z26A 3I3LA 2JKCA 2APGA 2Q0KA 4N9XA 4U8KA 2B9YA 2TPRA 4UDQA 4Z24A 4IA6A 2WP5A 2XLTA 1NPXA 3DK9A 4U8NA 3GYIA 4I58A 2YVJA 4YSYA 1KSSA 1PBBA 2R4EA 2ZZ0A 4XWZA 1PXBA 3CGBA 4GCMA 4GDPA 3UCLA 1GTEA 2WESA 3UTFA 2FJBA 3CNSA 4U8PA 3D1CA 1VRQB 5KVIA 3BI4A 5KOWA 2VVLG 1PN0A 1TYTA 1K4QA 4DNAA 1DOCA 1XHCA 4NZHA 4H4VA 4REKA 4FDCB 2JK6A 2WQYA 2H88A 1K0IA 4CNKA 1S2YA 5EOWA 4UDPA 1ONFA 2YLWA 1H7XA 3P4SA 3UOXA 4H2RA 1PDHA 1CC2A 1CL0A 4Z2RA 1PHHA 3NYCA 1E39A 3BNUA 5ER0A 2FBWA 3UKPA 3S5WA 1NHQA 3AD7B 1PJ5A 1GPEA 4J57A 5U63A 2JB1A 5KRQA 1E6EA 1GEUA 2NVKX 3QFBA 2OAMA 2C75A 2GEWA 2OLNA 3E1TA 4J36A 3ITJA 4GR1A 1Y56B 2GQFA 1O5WA 4BK3A 1IUSA 1LPFA 1NHPA 4K22A 1JOAA 1GT8A 2LFCA 3SGLA 3COXA 3VRDB 1M64A 2XYOA 2AQJA 5BVAA 1RYIA 1MXTA 2XFOA 3AB1A 3DA1A 1H7WA 3GSIA 4U2LA 2PHHA 1XPQA 2HQMA 1IUTA 2YG5A 3AE4A 1EL8A 3AYIA 3DH9A 1LJ1A 1OJTA 3IHGA 1LQTA 4YXDA 1LV0A 2A89A 5EB4A 3Q9TA 4EIQA 2YWLA 1BKWA 1CF3A 1GOSA 2QAEA 1L0VA 4H4ZA 1F8SA 4OVIA 4Z44A 5IPYA 3QVRA 5C3JA 1NHRA 1N4UA 2EQ9A 3LADA 3REDA 3AD9B 2BXSA 2EQ8A 4J31A 4Z2TA 2BK3A 4LIIA 5JCKA 2TMDA 4U8JA 4PAAA 3K30A 4X9NA 3FBSA 5JCLA 3VR8A 1ZX9A 1JNZA 2UZZA 2C73A 1CHUA 4CBQA 1SEZA 4RG4A 4AP3A 3KVEA 2EQ7A 2YG4A 2XFQA 2WP9A 2VZ2A 4OPTA 3V76A 2JBVA 4LA1A 2BACA 1OJCA 2WPCA 3F8DA 4XWRA 3GMBA 1CJ3A 1JEHA 4HB9A 2R45A 2WPFA 3BI5A 4H4TA 5EBKA 1GRAA 1B37A 1FECA 1GXFA 2R0PA 2XVIA 5M0ZA 1S3BA 2BYBA 3QVPA 2YAUA 3PO7A 4EM3A 1DOBA 3LB8A 4B64A 1EL9A 4HA6A 5KXJA 5FS8A 2R46A 4JNAA 1GREA 3K7MX 4U2TA 1CJCA 3CGEA 1BWCA 1MOKA 4RSLA 5FS7A 3KKJA 4YWOA 2YQUA 5HHFA 4P9SA 3FIMB 3I6DA 4ZN0A 1B8SA 2OLOA 2WDQA 2IVEA 2XVEA 3D8XA 3KPFA 4U8MA 1B5QA 4TLXA 1NAAA 3AD8B 4D04A 3GD3A 2YG7A 1JNRA 2V60A 3NYFA 4AOSA 4X4JA 4UP3A 2GF3A 4O5UA 4B68A 1NDAA 3G5QA 4C74A 1H82A 1HYUA 3NIXA 1O94A 5FMHA 4ECHA 1N1PA 1QLBA 5IQ1A 4Z2UA 1ELIA 3URHA 4YKGA 3AE8A 1COYA 2V5ZA 1GETA 2BK4A 3AE6A 3NN0X 2IIDA 1KDGA 1CJ2A 3DJGX 5JCMA 3C96A 4TM1A 1E1NA 1F3PA 2A87A 4YKFA 2C3CA 1PXAA 2C7GA 2RGOA 3K7QX 4H4RA 3EF6A 4BK1A 3KD9A 1D4CA 4U8OA 2C76A 3RP7A 4DSHA 2VQ7A 5HXIA 4Z25A 5JCNA 1ZMDA 2XFPA 1K0JA 4A6NA 5BULA 3AE1A 2DKHA 3ZDNA 3QSEA 1NEKA 2WOVA 3UKAA 2ARDA 3P1WA 3UTHA 1E1LA 2X50A 3EAOA 3L8KA 4MJWA 4NTCA 4J34A 4K2XA 4JN9A 2GV8A 3AE9A 1GERA 4JDRA 4H7UA 1PXCA 4OPIA 4E0VA 4JY2A 4NEWA 2B9WA 3DK4A 4IA5A 5KWFA 4IVMB 3NT6A 2YG6A 4GRTA 5L46A 5BUKA 3GQHA 4H4QA 2R0CA 4B63A 2A8XA 3BI2A 2ACZA 5HY5A 3P4PA 1IUUA 4EQWA 3AEDA 1ZP0A 1NHSA 2R0GA 1TDFA 3UKLA 2IVDA 3ZYXA 1OJAA 2YLSA 4XXGA 4AOXA 3Q6JA 1DJQA 2B7SA 3ICSA 2BS3A 1ZK7A 2DKIA 3EANA 1GTHA 2BC1A 1DOEA 1JRYA 1PJ7A 1K0LA 1YQZA 3UOZA 4EQXA 3AEGA 4H50A 4ADWA 2XVHA 4B67A 2I0ZA 3H8IA 2Z5XA 1KFYA 2YR6A 3GDPA 3NRNA 1Z6LA 2E4GA 1JRZA 2QCUA 2BK5A 5FS6A 1LTXR 4OPLA 1IUVA 2V3AA 1YQ3A 2VQBA 3GDNA 3FG2P 3LOVA 4GDEA 3AXBA 4A79A 3SM8A 4OCGA 1XDIA 3QFAA 1GV4A 1P2EA 2ZBWA 3GMCA 4UDRA 2YVFA 3OZ2A 3C4NA 1GSNA 4B1BA 4WCTA 3ADAB 1L9DA 1TDNA 4Y4NA 2YG3A 1PBFA 3QSMA 3HZLA 2WP6A 1PBCA 3S61A 4AT2A 2O9ZA 4ZCCA 3SFEA 4A99A 3RP8A 1M6IA 3AEEA 2VVLA 2GB0A 2BS2A 1GRFA 3CNPA 3PVCA 4J56A 2VRLA 2WPEA 2BS4A 3NG7X 1NG3A 4H2QA 2EQ6A 3PS9A 1F8WA 3SQPA 2JB2A 1BGNA 2XFNA 1PBDA 1Q1WA 1CJ4A 4A5LA 5KVHA 1TYPA 3AEBA 3IWAA 1V59A 3AECA 1S3EA 1ZKQA 4K5RA 2XCGA 3BHFA 3AE5A 2YR5A 3UKHA 3UOYA 4CRTA 4CY6A 1TDKA 3SUCA 3DJDA 3B6DA 4M52A 1KSUA 1YKJA 4X9MA 1BZLA 1ZY8A 3AE7A 4FX9A 3ABVA 2CULA 4EM4A 1YY5A 2X99A 3WE0A 1YQ4A 4D03A 1PBEA 1X31B 3KA7A 2YLXA 2GAGB 3G5SA 2X8GA 1EBDA 1REOA 3FMWA 2GQWA 3ICRA 4TLZA 1DODA 2WEUA 4ZCDA 3RNMA 4CY8A 4A6NB 4NEVA 2YM1A 2OA1A 1NENA 3GYXA 1L9CA 4OPUA 1ZOVA 3VR9A 1H81A 3GWFA 1E7PA 3CGDA 3IF9A 1XANA 4BJZA 1CBOA 3H4KA 2X8HA 4H4YA 4B66A 1GNDA 5KOXA 2YLTA 4NTEA 4YSHA 2X3NA 1W4XA 3P9UA 3AEFA 2GAHB 4YSZA 1GRTA 4BV6A 2QA2A 4YTPA 1QO8A 3UTEA 1D5TA 4Y4LA 2B76A 1O95A 4CCRA 3CPHG 1KNRA 2B9XA 2NPXA 3NTDA 3QJ4A 5BRTA 3GYJA 1UKVG 3VRAA 1VG9A 2WOWA 3DJJA 3CN8A 3P4QA 1DJNA 1PJ6A 4O5QA 2WOIA 5GRTA 4AP1A 1GALA 3DGZA 4YSXA 2WDVA 1PS9A 2F5ZA 4AT0A 4A9WA 4EQSA 3VRBA 1GRBA 2E1MA 1IJHA 2FJEA 3RP6A 3GRSA 4A65A 4TM3A 3UKFA 3II4A 2WDRA 3UTGA 4BURA 3GQKA 2XVFA 4RG3A 1KF6A 1CC6A 5EB5A 5U25A 3RHAA 3VQRA 1EL7A 2FJDA 5C2TA 1H84A 2C66A 3AEAA 1FCDA 1FOHA 2J3NA 2XLSA 3DJEA 2WU2A 2BXRA 4H4UA 4B65A 2X8CA 1E1KA 2BA9A 1FEBA 1N4VA 3SFDA 2QA1A 3M0OA 4KX6A 3AYLA 1NG4A 2V6OA 2CDUA 3CIRA 1Q9IA 2V3BA 3NH3X 5J7XA 2GH5A 1S2QA 4JY3A 4WX1A 1VDCA 2XVJA 3LZXA 3BNMA 1FL2A 5DBJA 2CVJA 4Y4MA 3KU9A 3UP4A 2Y6RA 3LXDA 4C5OA 5IQ4A 1KNPA 3O0HA 4YTMA 2VVMA 2W0HA 3R9UA 4BJYA 4U2SA 5JCIA 4DGKA 4J2WA 3QSSA 1D4EA 1Y0PA 3ALJA 3M13A 3DK8A 3OC4A 2WS3A 2BABA 3C4AA 5TR3A 4YT0A 3ATQA 4USRA 1F6MA 4JNQA 3ALMA 4APNA 4NTDA 2ZZCA 1FEAA 2C65A 3NK0X 1L9EA 4PABA 5LV9A 1DNCA 2RABA 2C70A 3GWDA 4K8DA 1VQWA 2XDOA 2Q7VA 3UKKA 2C3DA 2C64A 1GRGA 1BGJA 3P4RA 1IUWA 2WHDA 3B3RA 3NTAA 3JSKA 4I59A 2R9ZA 3FPZA 4JQ9A 4EMWA 1BF3A 1RP0A 1Q1RA 3NK2X 2JAEA 3H8LA 2Q0LA 3KLJA 2CFYA 2WU5A 3V3NA 1Y56A 2YR4A 4EQRA 4CNJA 2AR8A 1N4WA 2YLRA 4K5SA 3L1RA 4U8LA 1B4VA 2C72A 4EMIA 3M12A 3K7TA 2BCPA 2R4JA 2V61A 3F8RA 5CKUA 2Z5YA 4U8IA 2Q6UA 1OJ9A 1TDEA 2GR2A 2YM2A 1TDOA 4KPRA 2AAQA 4FK1C 1P2HA 4K7ZA 1JU2A 1QJDA 1D7YA 3AE3A 1F8RA 2XLPA 1ZDLA 4ICYA 3NN6X 3IHMA 4OPCA 3NHOX 3DMEA 4CCQA 2XLRA 3ALLA 1D7LA 4BK2A 4B69A 3DGHA 5FS9A 4H4SA 4EMJA 3IC9A 3LJPA 5GSNA 2Y6QA 4YTNA 4IVOB 5J60A 2PYXA 1RSGA 4IV9A 1ZOYA 1GRHA 4GUVA 1CC4A 4DSGA 2GR3A 2VRMA 4H4XA 4H2PA 2FJAA 1MO9A 2GMJA 2H89A 4Z43A 2WBAA 2VOUA 1DXLA 3T37A 3CNJA 2GVCA 5CQFA 2YVGA 3GD4A 4OPGA 4C3YA 1GESA 3V3OA
chains in the Genus database with same CATH superfamily
3NYEA 3UU3A 5HYMA 1E1MA 4Z8XA 5HXEA 1LVKA 3CPJG 2K5BB 4EV6A 1H86A 3ISHA 4TX5A 4WW0A 5BMVE 2VL0A 2C67A 2CPTA 3ONXA 2WETA 2HWC4 3B13A 5LB7B 3CPIG 2XFUA 4OPDA 2SPCA 3RKOA 2ZM2A 4H4PA 3NKZA 3U3IA 3Q5DA 1LVLA 2RGHA 1VBD4 1PO14 3FB2A 3BK9A 4TM4A 5AQPB 3V5UA 3HYXA 2NOXA 2GMHA 5JDNA 2BCGG 2ZZBA 1DU2A 2VK9A 1RUE4 3CKDA 1GESA 4N9XA 4YHHT 2V6YB 2B9YA 2TPRA 4Z24A 2RA1A 3RKGA 2WP5A 1NPXA 4I58A 2R4EA 2E9XA 4DIDB 3OYZA 4PDWD 3K3QC 3UTFA 2FJBA 4ILAA 4LF9T 1K4QA 1XHCA 1KEYA 1YKHB 3T14A 1HNZT 3SY4A 5EOWA 5F8PA 4G9KA 4DBQA 2UXNB 3UOXA 1CC2A 2LLYA 4JI2T 3RLFF 5AQSB 4Z2RA 1PHHA 1E39A 3BNUA 5LG3A 3JD74 3S5WA 5U63A 4J57A 1XDOA 2NVKX 2GEWA 3FZKB 4ZI2C 3JAFA 3QNUA 4GR1A 1Y56B 2KT9A 4ZEYA 1O5WA 4L0RA 5J2UE 3SGLA 1QSDA 5LG4A 5IHYA 3AB1A 3GSIA 2LSGA 1XPQA 1HX1B 3AE4A 1EL8A 3UQ4A 1OJTA 4ASKA 4IDPA 1LV0A 1RUD4 2HN2A 5CGMA 1BKWA 4H63H 1GOSA 1L0VA 2VKOA 2KNDA 2DWGA 2ZM6T 3AD9B 2EQ8A 4Z2TA 2BK3A 3K30A 5HCJA 4ZI7E 2UZZA 2V1DB 4I50E 1VOMA 3CMLA 4HWDA 3LSVA 2XHEB 4UR9A 3EABA 2XFQA 4OPTA 2JBVA 4LA1A 2BACA 1OJCA 1X79A 2WPCA 2EHOB 1B37A 1FECA 2OA5A 2RS14 4EM3A 1EL9A 4HA6A 5JRCB 2R46A 2XASB 4UXNB 4U2TA 3CPZA 1HG5A 4QH5A 2X0HA 5FS7A 3KKJA 4AQGA 4ZN0A 1B8SA 4U7YA 3Q5EA 2IVEA 2XVEA 3F57A 4AXPA 4TLXA 2R6GF 3AAIA 3V5SA 2V60A 4AOSA 3B5MA 4O4HE 4L5GA 4JI4T 4UP3A 2GF3A 3P7IA 4O5UA 4C74A 3G5QA 1H82A 4CI2B 2F4VT 3NIXA 2BRAA 1O94A 3AA7B 5FMHA 1N1PA 1QLBA 3RQUA 2LHNA 1GETA 4PJNA 2IIDA 4OK0A 3DJGX 1E1NA 1F3PA 2A87A 3K7QX 4EGWA 5JQGE 3Q2MA 4FJOA 1N34T 5LOVE 3W15B 4DSHA 1NAFA 3AAEB 2YN6A 2J4GA 1MQTD 2MYSA 5JCNA 2XFPA 4F6RC 5BULA 3SWHA 2X68A 3L8KA 3EAOA 2GV8A 1GERA 4O8SA 4H7UA 1PXCA 3PUSA 5JDFA 4IE6A 2NTYA 5KWFA 1G73A 3NT6A 4PAGA 4IVMB 2YG6A 3NRYA 4H4QA 2R0CA 4B63A 4NNJA 4HE8A 2ACZA 2I0MA 5GONE 2CBIA 3N9MA 4EQWA 3AEDA 4HGAA 1TDFA 4CI1B 2IVDA 3TLWA 2LOSA 2B7SA 1ZK7A 3EUHA 2CHOA 1DOEA 5JR9A 2YU2A 3A5XA 1BR2A 2Z5XA 2CCQA 3GDPA 2E4GA 1JRZA 2QCUA 4Z2UA 3GDNA 2VQBA 2IDOB 4A79A 5F5WA 1VRH4 1XDIA 1P2EA 4UDRA 3WI3A 2YVFA 4B1BA 1GSNA 4WCTA 1L9DA 1TDNA 3RX6A 1OWAA 3S61A 2O9ZA 1RMU4 2DNXA 4CXXA 1M6IA 5JH7E 2GB0A 1GRFA 1U4QA 2HPLA 5JDHA 1XZYA 4JEUB 2PG8A 1ZEEA 2HN1A 1F8WA 2RP4A 4X66T 3A8YC 1Q1WA 5KVHA 1TYPA 3AEBA 1ZHCA 1S3EA 3AE5A 5L3DB 4CRTA 5FXVA 5AQLB 1E1HB 1UCUA 1ZY8A 4C91A 3WE0A 1YQ4A 2GAGB 4NWZA 1EBDA 3RNMA 4TLZA 4CY8A 1DODA 2WWVA 2YM1A 2CLYC 4CI3B 3GYXA 4YJ2E 4IL4A 4AIUA 4LF7T 2YOEA 5F3JA 3GWFA 1E7PA 1D0XA 1OOPD 3H4KA 4B66A 5KOXA 2VURA 1GNDA 4DV1T 2X3NA 3P9UA 3AEFA 2BBJA 3PUZF 5L47A 4GIWA 5FXXA 4YSZA 1XMOT 4YTPA 1QO8A 2B76A 1O95A 4CCRA 1KNRA 2B9XA 3GYJA 1VG9A 3CN8A 1DJNA 2WOIA 3DGZA 3MK7C 5ABHA 2E1MA 2M6IA 4DV6T 4G73A 3GRSA 4A65A 5FMNA 3UKFA 3II4A 5U25A 1WR0A 2HWB4 3HI2A 2W67A 5KMGP 1FCDA 1FOHA 2MTQA 4B65A 1Z0PA 2X8CA 1E1KA 2BA9A 1V9DA 2D5UA 2VASA 1N4VA 3SFDA 3OYXA 1RUI4 4WBNE 1RUJ4 4OYJA 4HFCA 2CVJA 4Y4MA 4B3RT 2QVAA 4N78D 4YTMA 4J2WA 2WAUA 3SZWA 1COV4 3M13A 2LKGA 4P0BA 5DQVA 3QB5K 5AQKB 4O4LE 4TWDA 2WS3A 4AKRB 2BABA 3C4AA 2ZM0A 4YT0A 5TR3A 1WYBA 5JDMA 3ALMA 4HFVA 4DVDA 2ZZCA 4PABA 3LJCA 5TAOA 1DNCA 4K8DA 3ZCJA 3GWDA 4L9IA 4YJ3E 2XDOA 3UU8A 2XPKA 4HWIB 3B3RA 4H9NC 2R9ZA 3TKLB 3FPZA 4I43B 2E2AA 2VKJA 2BBHA 3T1HT 5KMSA 2C4CA 3NK2X 2JAEA 4PJLA 2CFYA 4DNDA 1Y56A 2YR4A 5HEGA 2AR8A 4AKLA 5FXZA 5L3BB 4U8LA 1B4VA 4EMIA 5AQFB 3M12A 2BCPA 3RYHE 2LSYA 1OJ9A 1TDEA 2X66A 2BG9E 2XLPA 1ZDLA 4UF0A 3ZYLA 4H9PC 3NN6X 3UU5A 1UX5A 3NHOX 4TWHA 2XLRA 1D7LA 2IC6A 5JVDE 3DGHA 3KV6A 4H4SA 3HR0A 5EZYE 4EMJA 2X51A 2E9XC 5GSNA 4IVOB 4U7IA 3ZC1A 4NIQA 4IV9A 3KVAA 1GRHA 5L3EB 4PW8A 5AQHB 3JAEA 2JQ9A 3ZN1B 3T37A 2GVCA 4OPGA 4C3YA 4PFOA 2KXPB 2WY2A 2N2NA 2GR0A 3GRTA 2K3WA 5CB4E 3ICTA 3DTOA 3CTYA 1IUXA 2A72A 4A7AA 5U1OA 3EPTA 3NLCA 3EAMA 4H2NA 5L3GB 3VKGA 2UU9T 3PU8A 4H9OC 4ISSA 2R074 2W4XA 3UUBA 2RGJA 2BC0A 4GF7A 1LQUA 4HFHA 3UOVA 1IBLT 4CZZB 3NNEA 2EHOD 3VU7H 3RRCA 3AYJA 1HCIA 2XQ3A 4H9SE 3JC6C 3CNTA 2X9HA 4TNWA 2AXDS 2PYJA 4JV5T 1FEWA 4NXMT 2XLUA 1MIYA 3I3LA 4U74A 2APGA 2Q0KA 1B7TA 5HEUA 4U8NA 2YVJA 3P50A 2C5JA 1MMDA 4XWZA 5EK4A 1PXBA 4LFAT 4GCMA 1T98A 3A7MA 3ZYKA 4CN4A 1VRQB 3BI4A 5KVIA 3FXDB 2LT3A 1PN0A 1TYTA 2EX3A 1DOCA 4REKA 3FZMB 2WQYA 2V6XA 2H88A 1K0IA 2DL1A 1ONFA 3FI7A 2YLWA 4JI3T 3PE0A 3P4SA 3ZN0B 1PDHA 1CL0A 4P0AA 2X0YA 1XWMA 5JR9C 2JB1A 1E6EA 3MACA 4ANJA 5LGNB 2C75A 2OLNA 1R094 1N33T 3ITJA 3RPUA 4BK3A 1IUSA 3ANWA 3G06A 1RYIA 2IUBA 1MXTA 2XFOA 2G0UA 3DA1A 3R84B 5A1LA 1RUH4 2C5KT 5LA6E 1IUTA 4PK4A 1O3XA 2YG5A 3AYIA 1S94A 2Q9QC 4IREA 2WBLA 1LQTA 4O2AE 3T8OA 4EIQA 2YWLA 5IPYA 1D0ZA 2LSIA 4GK5E 4U72A 1BR4A 3GA8A 1F8SA 3QVRA 1N4UA 3REDA 2JQHA 4MFRA 2IMLA 3QUJA 5HAXA 4LIIA 5JCKA 4PAAA 4X9NA 3FBSA 2IHR1 5JCLA 3GN5B 1JNZA 2WZIA 3N9LA 1D1AA 2C73A 4CBQA 4WBOA 5AQOB 1H8TD 3KVEA 2CXFA 2CXDA 2L3LA 2YG4A 3F8DA 2BG9B 2XQ7A 4U33A 1JEHA 5KMQA 2V5DA 4H4TA 2WSSV 3RYCE 5EBKA 5IYZE 5M0ZA 3OVUA 1HS7A 1S3BA 3HKDE 1T7SA 3IA3A 5JDLA 2YAUA 3LB8A 3NVOA 5KXJA 4Q4W4 2QRXA 4RSLA 4TUYE 4YWOA 2YQUA 5HHFA 3I6DA 1J5WA 1AR84 2OLOA 5FL0A 3KPFA 2BVLA 3MA9A 3U78A 3AD8B 2V7MA 2UXDT 2ACXA 5DABA 5AQGB 4DO0A 4XZCA 2VKDA 4X5TA 5IQ1A 4LMJA 3LK3B 2JMKA 2KWHA 2BK4A 4ZI2D 4O2BE 5AQJB 3VKHA 3RI5A 3ZPOA 5JCMA 4TM1A 4QXHB 3S4UA 1PXAA 4H4RA 2DLRA 4BK1A 1D4CA 3RP7A 3RIFA 4Z25A 3NBXX 4A6NA 3FXEB 3ZDNA 1NEKA 3UKAA 3N9PA 2X50A 4TNVA 3AA6B 4JUYA 4JN9A 3AE9A 2LEHA 4LF4T 4GB34 4A97A 2NWBA 2B9WA 5HWYA 4E7SA 3O1HA 5J2TE 5BUKA 3RGLA 3HKBE 5HY5A 1YXRA 3P4PA 4KHZF 2I59A 2W61A 2RS34 4NXNT 1VBC4 1WYCA 3Q6JA 3ICSA 4I55E 4IDOA 4MALA 2DKIA 2BKPA 5DJQC 1K0LA 1PJ7A 2MPKA 4H50A 3AA1B 2J62A 3UULA 2VWAA 4ADWA 2KMFA 4B67A 2I0ZA 5LBQB 2HHHT 2YR6A 4OPLA 4Z91A 1IUVA 2V3AA 2ZMAA 2YDRA 2VKHA 3MZKB 4OCGA 3QFAA 1GV4A 3TLSA 4G63A 2XM2A 3ADAB 4LFCT 1PBFA 1T72A 3FZFB 4G2AA 2PBIA 3QK6A 3RP8A 2VVLA 4ZS3A 3CNPA 2CA5A 4ZOLE 2V7IA 1FIOA 4X1IE 2VQFT 4J56A 4DBRA 3ZT7A 1NG3A 4H2QA 2XAQB 4G6HA 5BR8T 2JB2A 2MBGA 2BDEA 4YY3T 3IWAA 4DUYT 4U3CA 1V59A 4K5RA 3BHFA 4GKKT 2H7VC 1TDKA 3GMIA 5FVLA 4M52A 4X9MA 1Y64B 5LNKA 1W9RA 1D1BA 2IAKA 2X5ID 4D03A 2YLXA 2BRYA 2X8GA 1REOA 4A56A 1IBMT 5HWXA 1NENA 5LJMA 3CX8B 3ZT5A 2NW7A 5FXWA 4DV4T 3VR9A 3ZEFB 4H9RC 1XANA 2JQQA 2X8HA 2HH7A 4H4YA 4AKHA 4EEBA 5LMNT 1W4XA 5J0ZA 1D5TA 3PUVF 3ZKRA 4Y4LA 3TLVA 2NPXA 1XHXA 3KV9A 3QJ4A 1BR0A 1MIVA 3P4QA 1PJ6A 3ANWB 3SZCA 1PS9A 4EQSA 3D0TA 2W66A 1IJHA 3ZC0A 3RP6A 1R084 2XTLA 2K48A 3N9NA 2X9WA 1J5ET 2ODUA 3UTGA 4BURA 3GQKA 4IE7A 1CC6A 1SA0E 5CA1E 1I6ZA 4UV8B 1H84A 2C66A 3AEAA 3PUGA 3DJEA 4H4UA 1SHZC 2XY8B 4TN7B 2QA1A 3M0OA 1OEDC 2CDUA 3CIRA 2V3BA 2GH5A 1S2QA 4JY3A 3N2GE 2XVJA 3UP4A 2W62A 4NUUA 2KSRA 5IQ4A 2W0HA 2VVMA 5JCIA 4DGKA 2GK9A 2XSBA 4ZXLA 3QSSA 1WR6A 3ALJA 3DK8A 2L9QA 3L09A 4UIGA 3HL6A 4AKGA 3KVBA 5L4EA 4ZS2A 1F6MA 2C65A 3NK0X 2K9AA 1L9EA 5KMPA 4DV5T 2RMU4 1VQWA 2C3DA 1GRGA 3C4ZA 3JSKA 3UUNA 3RH3A 5H6QB 1RP0A 2XQAA 5HXHA 2WU5A 4CNJA 1IAPA 4K5SA 2YLRA 4HFBA 4UV9B 2DI4A 1UUSA 3FBLA 5LHGB 2R4JA 4I0UA 5EK3A 5KX5E 1WFDA 4NPPA 2Y8DA 2YM2A 2AAQA 1P2HA 1MMNA 1D7YA 3AE3A 3PTRB 1F8RA 4LFBT 1OEDE 1EAH4 3RYFE 3IHMA 2DWKA 4OPCA 2VVSA 4BK2A 3IC9A 4UELA 2Y6QA 3SXIA 1ZOYA 2XSAA 3QOFA 1CC4A 4DSGA 3RIUA 3MXZA 4WNKA 2Z6EA 1M62A 1AR94 2FJAA 1MO9A 4OHFA 2H89A 4II3A 5M4YA 4Z43A 4OX9T 5CQFA 2JB3A 5J7XA 3EDVA 5HXRA 2OALA 3UP5A 4U2YA 4V1Av 1AOGA 4LU6A 4ILUA 1US7B 2JIWA 1H83A 4HEAA 1JRXA 5AQMB 4JEHB 3I0QA 3NK1X 1H6VA 1VRBA 4H4WA 3LZWA 4OYKA 2PJQA 2XQ9A 3UKQA 2YLZA 4C77A 3CQXC 4B6XA 2XQ6A 3CVRA 5HXSA 3JADA 4MLKA 3ONJA 1W0AA 2YDQA 1OJDA 2GRTA 2DHRA 4KUMB 3KDSE 5JREA 3ATRA 3CNDA 2LOPA 2B7RA 4KP3C 2Q9QA 4C3XA 2CXLA 3ZMTB 5HCMA 4TM0A 5AQUB 2BG9A 3KINB 1H7CA 2E5VA 2KLQA 3LK2B 3F8PA 4QH4A 2RPAA 2GR1A 1TRBA 2RS54 4M1PA 5FKYA 2NP9A 4FK1A 2NW9A 4IE0A 4Z26A 2UUBT 4UDQA 4DR5T 5FP3A 5L3CB 3DK9A 4TZ4C 2WM9A 3GYIA 4YSYA 1KSSA 2LSKA 5ETWA 1PBBA 2ZZ0A 3RHWA 2AE9A 3UFGA 4DMVA 5LXTE 3UCLA 3PV0F 3LBXA 1W0BA 2E9XD 5AQNB 5KOWA 1VBB4 4GAVA 4NZHA 4UVAB 4H4VA 4FDCB 2JMHA 3IEEA 2BVMA 1S2YA 2LRKA 4U2ZA 3PURA 4H2RA 3JBG4 3NRXA 3E08A 3NYCA 2IIUA 4OFZA 5E0OA 5H6RB 2FBWA 3UT5E 2XQ8A 3E0ZA 3AD7B 3CWZB 4J36A 4DV7T 2GQFA 1LPFA 3T2KA 1HNXT 4K22A 2D0UA 1JOAA 2LFCA 3COXA 1M64A 2XYOA 4HN9A 4QHOA 2WMNA 1XDPA 4KMCA 1H7WA 4U2LA 4IDQA 2PHHA 3LK42 3OKQA 2HQMA 4DV0T 3O1IA 2QGSA 5LYJE 3DH9A 5FY1A 4YXDA 2IW5B 3C4XA 2A89A 3Q9TA 2EHOC 5C8YE 5AFUL 3T2ZA 3QB5A 3BQIA 5C3JA 2EQ9A 3LADA 2RM24 2BXSA 2PLV4 3AVRA 3KFWX 4CN6A 4LF5T 2TMDA 3LFMA 1ASJ4 1HG2A 2BZBA 1CHUA 2XM1A 1SEZA 4RG4A 2CBJA 4AP3A 4IIJE 2BKOA 2VZ2A 3V76A 2RR14 4QXBB 3J7Yq 1HX8A 4UF0B 4BA9A 1HR0T 3GMBA 4XWRA 4HB9A 3BI5A 1GRAA 1GXFA 2R0PA 2XVIA 1Z8UA 3N5LA 2BYBA 4O4IE 1W09A 4DV3T 3QVPA 3PO7A 4II2A 3NWIA 4GYSA 5FS8A 4IDNA 1GREA 1CJCA 3CGEA 3RC8A 1OXZA 4AQFC 3FIMB 2WDQA 4IT4A 3D8XA 2K24A 2D0TA 3RF1A 3TLTA 1GQEA 2YG7A 2WCAA 1HF8A 4YHJA 4B68A 1NDAA 3IBPA 5LGUB 4EEDA 1HYUA 4ECHA 3EHZA 4Q4Y4 4YFSA 1ELIA 3SRZA 3OBVE 1COYA 4RHV4 3UUMA 3C50A 1CJ2A 4MHCA 4TV8E 4YKFA 2C3CA 1POV0 1LRZA 2C7GA 2VL8A 2RGOA 1MMGA 4U8OA 5HXIA 1K0JA 4GAPA 3AE1A 2DKHA 3QSEA 3PUQA 4EZ4A 2ARDA 1SUMB 3P1WA 3UTHA 4NTCA 4LMLA 4J34A 4K2XA 3T1YT 4DR2T 3RRWA 2XUEA 3AA0B 2KZ7B 4JY2A 1E2AA 2X0LB 4GRTA 5L46A 5CFBA 3GQHA 1X9BA 4JYAT 2CLYB 1CUNA 3HYVA 1IUUA 5HXCA 1KNZA 1ZP0A 1NHSA 1MNEA 3EI0A 3M65A 2R0GA 2PYLA 3UTKA 1N36T 4IHJE 4EZHA 3HKCE 4JBWF 2YINA 2YLSA 5KMRA 4HWFA 4CQIA 4AOXA 2B1EA 2N9DA 3EANA 1GTHA 2W63A 1YQZA 4X1KE 2KINB 4QXCB 1YD8G 5AQIB 4EOZB 3ZMSB 3PJAA 2V7JA 4BAYB 3H8IA 4HKAA 1KFYA 3NRNA 2IC9A 3GN5A 1NCQD 2J47A 1Z6LA 5FS6A 3UKPA 5AQQB 2L8KA 1YQ3A 4GDEA 3FG2P 3AXBA 3SM8A 3RQWA 1M7KA 2ZBWA 3OTOT 4H63V 3OZ2A 3NZPA 3C4NA 2MOZA 4K0KT 3QSMA 4X64T 3EVYA 3OPCA 4PK5A 2WP6A 1PBCA 5HYAA 4AT2A 4ZI3C 4ZCCA 4A99A 3AXJA 3L3PA 4I4TE 3AEEA 4QX7B 2BS2A 3N9OA 3PVCA 4BJNA 2E5LT 2BS4A 3NG7X 3J8F4 4B3MT 3PS9A 3AXJB 3SQPA 1BGNA 3O4XE 5FL1A 1CJ4A 3PJAJ 2XCGA 3UKHA 3CX6B 2C0SA 3SUCA 3DJDA 3B6DA 3AVSA 3SZ0A 4X20E 3PDYA 1RUG4 5ABFA 3AE7A 4FX9A 2CULA 2X99A 1K5MD 1PBEA 1X31B 1IZNB 2NW8A 2VQET 3G5SA 2WWUA 3ICRA 4UEMA 4ZCDA 1I94T 2WEUA 4NEVA 2OA1A 1L9CA 4OPUA 1ZV4X 3CGDA 3IF9A 3F2EA 2YU1A 2UXBT 1CBOA 3CQCB 1EV14 3H37A 4TV9E 2KWIB 2XQ4A 4DMWA 2GAHB 1GRTA 4BV6A 3UTEA 4Q25A 4COFA 3ZMUB 3I0OA 3VRAA 2WOWA 3DJJA 1WCRA 3GWHA 1HFAA 1GALA 3SOLA 4QWNB 4DUZT 5FYMA 3VRBA 1GRBA 3H3AA 5J1GA 1UGOA 3CK6A 4TM3A 2H3RA 4C90A 2WDRA 4CN1A 2XJ7A 3KBUA 1KF6A 1NWMX 2FJDA 1PVC4 3P8CD 4AISA 1ZKEA 4J2CA 4HTEA 2XQ5A 5LJNA 5HEHA 4KX6A 4NUVA 3NH3X 1Q9IA 3LG7A 1FL2A 3ZMVB 3ONLC 4JI8T 3LXDA 1KNPA 3I9YA 3O0HA 5L3FB 4BJYA 2LM2A 2V26A 4KI0F 1Y0PA 3Q5XA 3OC4A 3ATQA 4NTDA 2LKHA 4UVBB 4IE4A 2V8SV 5LV9A 2R064 1G8XA 4LMKA 1IUWA 2WHDA 1PIV4 3NTAA 1BF3A 5ABFB 5JDQA 2YDSA 4JI7T 3ZCIA 4U31A 2D2SA 3BQKA 3JC6D 2V7LA 1Q1RA 3KLJA 3V3NA 4A5XA 4EQRA 1AL24 3FZHB 3L1RA 4EIWA 3HYWA 2C72A 3PUXF 3K7TA 2V61A 3N2KE 3F8RA 2Z5YA 4X1YE 4P09A 3WAJA 2GR2A 1TDOA 3N2OA 4K7ZA 5LBMA 1VCSA 3MJXA 4CCQA 3DMEA 4ZZBA 4MBQA 4P1NA 5J60A 3PUAA 3LBXB 5JDGA 4AI6A 3JCFA 2GR3A 3OJAA 2VRMA 3UQ7A 4H4XA 2GMJA 2PZSA 2OLTA 3C4WA 3SS1A 4B3TT 3CNJA 1Y01A 3GD4A 4QKNA 4XBFB 4F8HA 3V3OA 4AKIA 5L4HA 5FY0A 3AWIA 3CGCA 2JJ9A 4KHPT 4DR1T 2WMOA 5KDMC 2M6BA 4JI0T 5ABGA 4JI1T 2P9BA 1KK7A 1VG0A 5M10A 4EIPA 4LF6T 3CX7B 2LRLA 3NKSA 3BHKA 3AE2A 3ZJ2A 1RVF4 1D1CA 1OEDB 1MNDA 4AQYT 2CWOA 1ZMCA 3H3MA 3BQLA 3FHNA 4HFEA 4DR4T 3G5RA 4QX8B 2XQYA 1YKEB 1EL5A 1AR74 1UX4A 1FMWA 2LJLA 2YEVC 4X62T 4JI5T 1D4DA 4J33A 3Q5WA 4USQA 5EK2A 3NGCX 4JLEA 2CHNA 3K8PC 3C98B 2D9DA 2JKCA 4U8KA 2R7FA 4IA6A 2I6HA 2XLTA 1FMVA 2M67A 2A9UA 3CGBA 4GDPA 1GTEA 2WESA 2JRKA 4ADZA 3CNSA 3RIUC 4U8PA 3D1CA 3B57A 2VVLG 5FVKA 4DNAA 3ZSSA 2LM9A 4PK6A 2XAHB 2JK6A 4ERRA 4CNKA 3FZLB 4AQFA 4UDPA 1H7XA 3UUXB 1R8IA 4EAHA 2LHRA 5IUXA 4IL9A 5ER0A 1NHQA 1PJ5A 1GPEA 5LHIB 5KRQA 3F31A 1GEUA 4O4JE 2OAMA 3QFBA 3E1TA 2CMRA 2CEAA 1NHPA 2XZEA 1GT8A 3VRDB 5BVAA 2AQJA 2VVNA 3N9QA 4FI5A 3ZSTA 4PJJA 4ILBA 1LJ1A 3IHGA 2MAWA 5EB4A 2BG9C 1CF3A 4H4ZA 2QAEA 4OVIA 4Z44A 1NHRA 1XMQT 4HFDA 4J31A 1UK5A 4K0UA 4U8JA 4EYUA 2V6YA 2DCFA 2WZHA 3VR8A 1ZX9A 4Z90A 1RUC4 3DP7A 4HWCA 2EQ7A 2WP9A 2JPFA 2PTFA 3J9X1 1CJ3A 4LF8T 3ETUA 2R45A 2WPFA 4XAXB 1DOBA 2A2FX 4B64A 2BKNA 5IWAT 4JNAA 3ESLA 3K7MX 4DV2T 2ZM8A 1BWCA 1MOKA 4P9SA 1U5PA 2OV9A 5FNVE 3UU4A 2UUAT 4U8MA 1B5QA 1NAAA 4D04A 3GD3A 4GK0E 1JNRA 3NYFA 4X4JA 4PJMA 1YW0A 3AAAB 3IF8B 3P4WA 3URHA 5JR9B 4YKGA 3AE8A 2V5ZA 3NN0X 3AE6A 3PUYF 1KDGA 2ES0A 3O1JA 3C96A 3RYIE 1VBE4 2Y48B 5FY7A 2A3DA 3EF6A 3KV4A 3KD9A 1RUF4 2C76A 1HNWT 4BJMA 2ODVA 2QYWA 2VQ7A 2WB5A 1HRI4 4WYVA 4E7ZA 3L39A 1ZMDA 5CA0E 2W2UA 2CRBA 2Q9QD 3E22E 2WOVA 1D0YA 2V7KA 2Q9QB 1E1LA 4ZZCA 4MJWA 1IBKT 4JDRA 2YKSA 4OPIA 4E0VA 5KNLA 3L8RA 4NEWA 3DK4A 4IA5A 5LMUT 2X67A 4G74A 2UXCT 3SYIA 2A8XA 3BI2A 3WAKA 1BEV4 1FJGT 5AQTB 3UKLA 3ZYXA 3R6NA 1OJAA 5HEOA 4XXGA 2V5CA 1DJQA 3M3ZB 2BS3A 1SE7A 4IDZA 2BC1A 1JRYA 3UOZA 2R044 4EQXA 1UURA 3AEGA 2ZLYA 2LE8A 2XVHA 3SZFA 2X9YA 3ZYMA 3KBTA 4QH1A 1BR1A 2BK5A 1LTXR 3LOVA 5LGTB 3GMCA 4GYRA 2C5IT 4JI6T 3T0KA 2LSJA 2YG3A 4Y4NA 3O9XA 3RC3A 3HZLA 1LVFA 3SFEA 3QC9A 4DR6T 4X65T 1VCTA 2VRLA 2WPEA 1NA1D 2Y6XA 3CMMA 2EQ6A 2E8IA 4ISTA 2XFNA 1PBDA 4A5LA 3AECA 1ZKQA 1MMAA 2J1DG 2YR5A 1XI1A 3UOYA 1HTJF 4CY6A 1N32T 3RIAA 1KSUA 1YKJA 1XNQT 1BZLA 2PY5A 3ABVA 2UXXB 4EM4A 1YY5A 1AJ3A 2CE7A 3KA7A 4PFPA 3FMWA 3UU6A 2GQWA 1S35A 4A6NB 2HPJA 2XAGB 4ILCA 1ZOVA 3SX6A 2VB6A 2XAJB 1H81A 1T8BA 4A98A 4BJZA 1IJ6A 2E9XB 3K1SA 2YLTA 4NTEA 4YSHA 2UUCT 3T31A 2PFVA 2W0GA 2QA2A 1EZ3A 4HFIA 3CPHG 3NTDA 3HA4A 3I1AA 3ZMZB 5BRTA 1UKVG 2PW9A 3I9WA 3ETVA 5GRTA 4O5QA 4AP1A 4YSXA 2WDVA 3C51A 2F5ZA 4AT0A 4A9WA 3CQGB 4PNIA 3AB3B 3ZT6A 3IHRA 5AQRB 2FJEA 5ADXL 1QUUA 3Q9DA 4IGUA 4GKJT 4EXTA 1MIWA 2XVFA 4RG3A 2XAFB 5EB5A 3RHAA 3VQRA 1Z7S4 4GOUA 1PO24 2CM0A 5CJ5A 1EL7A 4Q4V4 5C2TA 1LKXA 3NZQA 4H9QC 5AQVB 4G6GA 3X1DA 2J3NA 2XLSA 5LHHB 2WU2A 4ZI3D 2BXRA 1FEBA 5DQWA 3AYLA 1WRDA 1NG4A 2V6OA 3KPKA 1J1JA 3PUWF 4B3ST 4WX1A 1VDCA 3K3OA 3LZXA 3BNMA 5DBJA 4UVCB 5LCYA 3KU9A 1XHZA 4HWHA 5ABEA 2N1GA 2Y6RA 4C5OA 4DR3T 5JRCA 4DR7T 3R9UA 4TWFA 3K3NA 4U2SA 5L2LA 1D4EA 3ZLIA 2YK0A 2NTXA 1HRV4 3KV5A 4ZHQE 1AR64 1D4M4 4USRA 4JNQA 4APNA 3VHLA 1FEAA 4EYYR 1VBA4 3FBZA 2C70A 2RABA 3UKKA 1IJ5A 2Q7VA 2C64A 1BGJA 3P4RA 4JQ9A 4I59A 1RHI4 4EMWA 4Q4X4 2W00A 3TLUA 3H8LA 2Q0LA 2JQKA 1WLXA 4WZXA 1N4WA 4CXWA 5CKUA 4U8IA 4KBMB 2Q6UA 3HKEE 4KPRA 5LP6E 4FK1C 3PU3A 2QA7A 1JU2A 1QJDA 3UFEA 2EHOA 3DJBA 4ICYA 2H7OA 1XNRT 2FUPA 5JTGA 5HEJA 3ALLA 4B69A 2NR4A 5FS9A 3LJPA 4YTNA 2PYXA 1RSGA 1HXS4 3EDUA 1OEDA 4GUVA 4IE5A 3C64A 4YLHA 2X9XA 3ZJ1A 3T2YA 4H2PA 4CXYA 2WBAA 2VOUA 1DXLA 3LDQB 2YVGA 3MKDA 4EB6E 2CWYA
chains in the Genus database with same CATH topology
3NYEA 2OALA 5HYMA 1E1MA 3UP5A 2GR0A 1AOGA 3AWIA 3GRTA 3CGCA 3ICTA 3CPJG 4LU6A 1H83A 3CTYA 1IUXA 1JRXA 4A7AA 5U1OA 1H86A 3ISHA 1VG0A 5M10A 3EPTA 3NLCA 4H2NA 4EIPA 3NK1X 2C67A 1H6VA 3NKSA 4H4WA 3LZWA 2WETA 3BHKA 3AE2A 2RGJA 2BC0A 2JB3A 2YLZA 3UKQA 4C77A 4GF7A 1LQUA 3CPIG 2XFUA 1ZMCA 4OPDA 3UOVA 4H4PA 1OJDA 2GRTA 3G5RA 3NNEA 1EL5A 3ATRA 3AYJA 3CNDA 1LVLA 2B7RA 2RGHA 4C3XA 4TM0A 4TM4A 2E5VA 3CNTA 3HYXA 2GMHA 3F8PA 1D4DA 4J33A 2GR1A 1TRBA 2BCGG 2ZZBA 4USQA 3NGCX 4FK1A 2XLUA 4Z26A 3I3LA 2JKCA 2APGA 2Q0KA 4N9XA 4U8KA 2B9YA 2TPRA 4UDQA 4Z24A 4IA6A 2WP5A 2XLTA 1NPXA 3DK9A 4U8NA 3GYIA 4I58A 2YVJA 4YSYA 1KSSA 1PBBA 2R4EA 2ZZ0A 4XWZA 1PXBA 3CGBA 4GCMA 4GDPA 3UCLA 1GTEA 2WESA 3UTFA 2FJBA 3CNSA 4U8PA 3D1CA 1VRQB 5KVIA 3BI4A 5KOWA 2VVLG 1PN0A 1TYTA 1K4QA 4DNAA 4GAVA 1DOCA 1XHCA 4NZHA 4H4VA 4REKA 4FDCB 2JK6A 2WQYA 3T14A 2H88A 3SY4A 1K0IA 4CNKA 1S2YA 5EOWA 4G9KA 4UDPA 1ONFA 2YLWA 1H7XA 3P4SA 3UOXA 4H2RA 1PDHA 1CC2A 1CL0A 4Z2RA 1PHHA 3NYCA 1E39A 3BNUA 5ER0A 2FBWA 3UKPA 3S5WA 1NHQA 3AD7B 1PJ5A 1GPEA 4J57A 5U63A 2JB1A 5KRQA 1E6EA 1GEUA 2NVKX 3QFBA 2OAMA 2C75A 2GEWA 2OLNA 3E1TA 4J36A 3ITJA 4GR1A 1Y56B 2GQFA 1O5WA 4BK3A 1IUSA 1LPFA 1NHPA 3T2KA 4K22A 1JOAA 1GT8A 2LFCA 3SGLA 3COXA 3VRDB 1M64A 2XYOA 2AQJA 5BVAA 1RYIA 1MXTA 2XFOA 3AB1A 3DA1A 1H7WA 3GSIA 4U2LA 2PHHA 1XPQA 2HQMA 1IUTA 2YG5A 3AE4A 1EL8A 3AYIA 3DH9A 1LJ1A 1OJTA 3IHGA 1LQTA 4YXDA 1LV0A 2A89A 5EB4A 3Q9TA 4EIQA 2YWLA 1BKWA 1CF3A 1GOSA 2QAEA 1L0VA 4H4ZA 1F8SA 4OVIA 4Z44A 3T2ZA 5IPYA 3QVRA 5C3JA 1NHRA 1N4UA 2EQ9A 3LADA 3REDA 3AD9B 2BXSA 2EQ8A 4J31A 4Z2TA 2BK3A 4LIIA 5JCKA 2TMDA 4U8JA 4PAAA 3K30A 4X9NA 3FBSA 5JCLA 3VR8A 1ZX9A 1JNZA 2UZZA 2C73A 1CHUA 4CBQA 1SEZA 4RG4A 4AP3A 3KVEA 2EQ7A 2YG4A 2XFQA 2WP9A 2VZ2A 4OPTA 3V76A 2JBVA 4LA1A 2BACA 1OJCA 2WPCA 3F8DA 4XWRA 3GMBA 1CJ3A 1JEHA 5KMQA 4HB9A 2R45A 2WPFA 3BI5A 4H4TA 5EBKA 1GRAA 1B37A 1FECA 1GXFA 2R0PA 2XVIA 5M0ZA 1S3BA 2BYBA 3QVPA 2YAUA 3PO7A 4EM3A 1DOBA 3LB8A 4B64A 1EL9A 4HA6A 4II2A 5KXJA 5FS8A 2R46A 4JNAA 1GREA 3K7MX 4U2TA 1CJCA 3CGEA 1BWCA 1MOKA 4RSLA 5FS7A 3KKJA 4YWOA 2YQUA 5HHFA 4P9SA 3FIMB 3I6DA 4ZN0A 1B8SA 2OLOA 2WDQA 2IVEA 2XVEA 3D8XA 3KPFA 4U8MA 1B5QA 4TLXA 1NAAA 3AD8B 4D04A 3GD3A 2YG7A 1JNRA 2V60A 3NYFA 4AOSA 4X4JA 4UP3A 2GF3A 4O5UA 4B68A 1NDAA 3G5QA 4C74A 1H82A 1HYUA 3NIXA 2BRAA 1O94A 5FMHA 4ECHA 1N1PA 1QLBA 5IQ1A 4Z2UA 1ELIA 3URHA 4YKGA 3AE8A 1COYA 2V5ZA 1GETA 2BK4A 3AE6A 3NN0X 2IIDA 1KDGA 1CJ2A 3DJGX 5JCMA 3C96A 4TM1A 1E1NA 1F3PA 2A87A 4YKFA 2C3CA 1PXAA 2C7GA 2RGOA 3K7QX 4H4RA 3EF6A 4BK1A 3KD9A 1D4CA 4U8OA 2C76A 3RP7A 4DSHA 2VQ7A 5HXIA 4Z25A 5JCNA 1ZMDA 2XFPA 1K0JA 4A6NA 4GAPA 5BULA 3AE1A 2DKHA 3ZDNA 3QSEA 1NEKA 2WOVA 3UKAA 2ARDA 3P1WA 3UTHA 1E1LA 2X50A 3EAOA 3L8KA 4MJWA 4NTCA 4J34A 4K2XA 4JN9A 2GV8A 3AE9A 1GERA 4JDRA 4H7UA 1PXCA 4OPIA 4E0VA 5KNLA 4JY2A 4NEWA 2B9WA 3DK4A 4IA5A 5KWFA 4IVMB 3NT6A 2YG6A 4GRTA 5L46A 5BUKA 4G74A 4H4QA 3GQHA 3SYIA 2R0CA 4B63A 4NNJA 2A8XA 3BI2A 2ACZA 3HYVA 5HY5A 3P4PA 1IUUA 4EQWA 3AEDA 1ZP0A 1NHSA 2R0GA 1TDFA 3UKLA 2IVDA 3ZYXA 1OJAA 5KMRA 2YLSA 4XXGA 4AOXA 3Q6JA 1DJQA 2B7SA 3ICSA 2BS3A 1ZK7A 2DKIA 3EANA 1GTHA 2BC1A 1DOEA 1JRYA 1PJ7A 1K0LA 1YQZA 3UOZA 4EQXA 3AEGA 4H50A 4ADWA 2XVHA 3SZFA 4B67A 2I0ZA 3H8IA 2Z5XA 1KFYA 2YR6A 3GDPA 3NRNA 1Z6LA 2E4GA 1JRZA 2QCUA 2BK5A 5FS6A 1LTXR 4OPLA 1IUVA 2V3AA 1YQ3A 2VQBA 3GDNA 3FG2P 3LOVA 4GDEA 3AXBA 4A79A 3SM8A 4OCGA 1XDIA 3QFAA 1GV4A 1P2EA 2ZBWA 3GMCA 4UDRA 2YVFA 3OZ2A 3C4NA 1GSNA 3T0KA 4B1BA 4WCTA 3ADAB 1L9DA 1TDNA 4Y4NA 2YG3A 1PBFA 3QSMA 3HZLA 2WP6A 1PBCA 3S61A 4AT2A 2O9ZA 4ZCCA 3SFEA 4A99A 3RP8A 1M6IA 3AEEA 2VVLA 2GB0A 2BS2A 1GRFA 3CNPA 3PVCA 4J56A 2VRLA 2WPEA 2BS4A 3NG7X 3CMMA 1NG3A 4H2QA 2EQ6A 3PS9A 1F8WA 4G6HA 2JB2A 1BGNA 2XFNA 3SQPA 1PBDA 1Q1WA 1CJ4A 4A5LA 5KVHA 1TYPA 3AEBA 3IWAA 1V59A 3AECA 1S3EA 1ZKQA 4K5RA 2XCGA 3BHFA 3AE5A 2YR5A 3UKHA 3UOYA 4CRTA 4CY6A 1TDKA 3SUCA 3DJDA 3B6DA 4M52A 1KSUA 1YKJA 4X9MA 3SZ0A 1BZLA 1ZY8A 3AE7A 4FX9A 3ABVA 2CULA 4EM4A 1YY5A 2X99A 3WE0A 1YQ4A 4D03A 1PBEA 1X31B 3KA7A 2YLXA 2GAGB 3G5SA 2BRYA 4NWZA 2X8GA 1EBDA 1REOA 3FMWA 2GQWA 3ICRA 4TLZA 1DODA 2WEUA 4ZCDA 3RNMA 4CY8A 4A6NB 4NEVA 2YM1A 2OA1A 1NENA 3GYXA 1L9CA 4OPUA 1ZOVA 3SX6A 3VR9A 1H81A 3GWFA 1E7PA 3CGDA 3IF9A 1XANA 4BJZA 1CBOA 3H4KA 2X8HA 4H4YA 4B66A 1GNDA 5KOXA 2YLTA 4NTEA 4YSHA 2X3NA 1W4XA 3P9UA 3AEFA 2GAHB 3T31A 4YSZA 1GRTA 4BV6A 2QA2A 4YTPA 1QO8A 3UTEA 1D5TA 4Y4LA 2B76A 1O95A 4CCRA 3CPHG 1KNRA 2B9XA 2NPXA 3NTDA 3QJ4A 5BRTA 3GYJA 1UKVG 3VRAA 1VG9A 2WOWA 3DJJA 3CN8A 3P4QA 1DJNA 1PJ6A 4O5QA 2WOIA 5GRTA 4AP1A 3SZCA 1GALA 3DGZA 4YSXA 2WDVA 1PS9A 2F5ZA 4AT0A 4A9WA 4EQSA 3VRBA 1GRBA 2E1MA 1IJHA 2FJEA 3RP6A 4G73A 3GRSA 4A65A 4TM3A 3UKFA 3II4A 2WDRA 3UTGA 4BURA 3GQKA 2XVFA 4RG3A 1KF6A 1CC6A 5EB5A 5U25A 3RHAA 3VQRA 1EL7A 2FJDA 5C2TA 1H84A 4G6GA 2C66A 3AEAA 1FCDA 1FOHA 2J3NA 2XLSA 3DJEA 2WU2A 2BXRA 4H4UA 4B65A 2X8CA 1E1KA 2BA9A 1FEBA 1N4VA 3SFDA 2QA1A 3M0OA 4KX6A 3AYLA 1NG4A 2V6OA 3KPKA 2CDUA 3CIRA 1Q9IA 2V3BA 3NH3X 5J7XA 2GH5A 1S2QA 4JY3A 4WX1A 1VDCA 2XVJA 3LZXA 3BNMA 1FL2A 5DBJA 2CVJA 4Y4MA 3KU9A 3UP4A 2Y6RA 3LXDA 4C5OA 5IQ4A 1KNPA 3O0HA 4YTMA 2VVMA 2W0HA 3R9UA 4BJYA 4U2SA 5JCIA 4DGKA 4J2WA 3QSSA 3SZWA 1D4EA 1Y0PA 3ALJA 3M13A 3DK8A 3OC4A 2WS3A 2BABA 3C4AA 5TR3A 4YT0A 3ATQA 4USRA 1F6MA 4JNQA 3ALMA 4APNA 4NTDA 2ZZCA 1FEAA 2C65A 3NK0X 1L9EA 4PABA 5KMPA 5LV9A 1DNCA 2RABA 2C70A 3GWDA 4K8DA 1VQWA 2XDOA 2Q7VA 3UKKA 2C3DA 2C64A 1GRGA 1BGJA 3P4RA 1IUWA 2WHDA 3B3RA 3NTAA 3JSKA 4I59A 2R9ZA 3FPZA 4JQ9A 4EMWA 1BF3A 1RP0A 5KMSA 2C4CA 1Q1RA 3NK2X 2JAEA 3H8LA 2Q0LA 3KLJA 2CFYA 2WU5A 3V3NA 1Y56A 2YR4A 4EQRA 4CNJA 2AR8A 1N4WA 2YLRA 4K5SA 3L1RA 4U8LA 1B4VA 3HYWA 2C72A 4EMIA 3M12A 3K7TA 2BCPA 2R4JA 2V61A 3F8RA 5CKUA 2Z5YA 4U8IA 2Q6UA 1OJ9A 1TDEA 2GR2A 2YM2A 1TDOA 4KPRA 2AAQA 4FK1C 1P2HA 4K7ZA 1JU2A 1QJDA 1D7YA 3AE3A 1F8RA 2XLPA 1ZDLA 4ICYA 3NN6X 3IHMA 4OPCA 3NHOX 3DMEA 4CCQA 2XLRA 3ALLA 1D7LA 4BK2A 4B69A 3DGHA 5FS9A 4H4SA 4EMJA 3IC9A 3LJPA 5GSNA 2Y6QA 4YTNA 4IVOB 5J60A 2PYXA 1RSGA 4IV9A 1ZOYA 3SXIA 1GRHA 4GUVA 1CC4A 4DSGA 2GR3A 2VRMA 4H4XA 3T2YA 4H2PA 2FJAA 1MO9A 2GMJA 2H89A 4II3A 4Z43A 2WBAA 2VOUA 1DXLA 3T37A 3CNJA 2GVCA 5CQFA 2YVGA 3GD4A 4OPGA 4C3YA 1GESA 3V3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYE A;  2OAL A;  5HYM A;  1E1M A;  3UP5 A;  2GR0 A;  1AOG A;  3AWI A;  3GRT A;  3CGC A;  3ICT A;  3CPJ G;  4LU6 A;  1H83 A;  3CTY A;  1IUX A;  1JRX A;  4A7A A;  5U1O A;  1H86 A;  3ISH A;  1VG0 A;  5M10 A;  3EPT A;  3NLC A;  4H2N A;  4EIP A;  3NK1 X;  2C67 A;  1H6V A;  3NKS A;  4H4W A;  3LZW A;  2WET A;  3BHK A;  3AE2 A;  2RGJ A;  2BC0 A;  2JB3 A;  2YLZ A;  3UKQ A;  4C77 A;  4GF7 A;  1LQU A;  3CPI G;  2XFU A;  1ZMC A;  4OPD A;  3UOV A;  4H4P A;  1OJD A;  2GRT A;  3G5R A;  3NNE A;  1EL5 A;  3ATR A;  3AYJ A;  3CND A;  1LVL A;  2B7R A;  2RGH A;  4C3X A;  4TM0 A;  4TM4 A;  2E5V A;  3CNT A;  2GMH A;  3F8P A;  1D4D A;  4J33 A;  2GR1 A;  1TRB A;  2BCG G;  2ZZB A;  4USQ A;  3NGC X;  4FK1 A;  2XLU A;  4Z26 A;  3I3L A;  2JKC A;  2APG A;  2Q0K A;  4N9X A;  4U8K A;  2B9Y A;  2TPR A;  4UDQ A;  4Z24 A;  4IA6 A;  2WP5 A;  2XLT A;  1NPX A;  3DK9 A;  4U8N A;  3GYI A;  4I58 A;  2YVJ A;  4YSY A;  1KSS A;  1PBB A;  2R4E A;  2ZZ0 A;  4XWZ A;  1PXB A;  3CGB A;  4GCM A;  4GDP A;  3UCL A;  1GTE A;  2WES A;  3UTF A;  2FJB A;  3CNS A;  4U8P A;  3D1C A;  1VRQ B;  5KVI A;  3BI4 A;  5KOW A;  2VVL G;  1PN0 A;  1TYT A;  1K4Q A;  4DNA A;  1DOC A;  1XHC A;  4NZH A;  4H4V A;  4REK A;  4FDC B;  2JK6 A;  2WQY A;  2H88 A;  1K0I A;  4CNK A;  1S2Y A;  5EOW A;  4UDP A;  1ONF A;  2YLW A;  1H7X A;  3P4S A;  3UOX A;  4H2R A;  1PDH A;  1CC2 A;  1CL0 A;  4Z2R A;  1PHH A;  3NYC A;  1E39 A;  3BNU A;  5ER0 A;  2FBW A;  3UKP A;  3S5W A;  1NHQ A;  3AD7 B;  1PJ5 A;  1GPE A;  4J57 A;  5U63 A;  2JB1 A;  5KRQ A;  1E6E A;  1GEU A;  2NVK X;  3QFB A;  2OAM A;  2C75 A;  2GEW A;  2OLN A;  3E1T A;  4J36 A;  3ITJ A;  4GR1 A;  1Y56 B;  2GQF A;  1O5W A;  4BK3 A;  1IUS A;  1LPF A;  1NHP A;  4K22 A;  1JOA A;  1GT8 A;  2LFC A;  3SGL A;  3COX A;  3VRD B;  1M64 A;  2XYO A;  2AQJ A;  5BVA A;  1RYI A;  1MXT A;  2XFO A;  3AB1 A;  3DA1 A;  1H7W A;  3GSI A;  4U2L A;  2PHH A;  1XPQ A;  2HQM A;  1IUT A;  2YG5 A;  3AE4 A;  1EL8 A;  3AYI A;  3DH9 A;  1LJ1 A;  1OJT A;  3IHG A;  1LQT A;  4YXD A;  1LV0 A;  2A89 A;  5EB4 A;  3Q9T A;  4EIQ A;  2YWL A;  1BKW A;  1CF3 A;  1GOS A;  2QAE A;  1L0V A;  4H4Z A;  1F8S A;  4OVI A;  4Z44 A;  5IPY A;  3QVR A;  5C3J A;  1NHR A;  1N4U A;  2EQ9 A;  3LAD A;  3RED A;  3AD9 B;  2BXS A;  2EQ8 A;  4J31 A;  4Z2T A;  2BK3 A;  4LII A;  5JCK A;  2TMD A;  4U8J A;  4PAA A;  3K30 A;  4X9N A;  3FBS A;  5JCL A;  3VR8 A;  1ZX9 A;  1JNZ A;  2UZZ A;  2C73 A;  1CHU A;  4CBQ A;  1SEZ A;  4RG4 A;  4AP3 A;  3KVE A;  2EQ7 A;  2YG4 A;  2XFQ A;  2WP9 A;  2VZ2 A;  4OPT A;  3V76 A;  2JBV A;  4LA1 A;  2BAC A;  1OJC A;  2WPC A;  3F8D A;  4XWR A;  3GMB A;  1CJ3 A;  1JEH A;  4HB9 A;  2R45 A;  2WPF A;  3BI5 A;  4H4T A;  5EBK A;  1GRA A;  1B37 A;  1FEC A;  1GXF A;  2R0P A;  2XVI A;  5M0Z A;  1S3B A;  2BYB A;  3QVP A;  2YAU A;  3PO7 A;  4EM3 A;  1DOB A;  3LB8 A;  4B64 A;  1EL9 A;  4HA6 A;  5KXJ A;  5FS8 A;  2R46 A;  4JNA A;  1GRE A;  3K7M X;  4U2T A;  1CJC A;  3CGE A;  1BWC A;  1MOK A;  4RSL A;  5FS7 A;  3KKJ A;  4YWO A;  2YQU A;  5HHF A;  4P9S A;  3FIM B;  3I6D A;  4ZN0 A;  1B8S A;  2OLO A;  2WDQ A;  2IVE A;  2XVE A;  3D8X A;  3KPF A;  4U8M A;  1B5Q A;  4TLX A;  1NAA A;  3AD8 B;  4D04 A;  3GD3 A;  2YG7 A;  1JNR A;  2V60 A;  3NYF A;  4AOS A;  4X4J A;  4UP3 A;  2GF3 A;  4O5U A;  4B68 A;  1NDA A;  3G5Q A;  4C74 A;  1H82 A;  1HYU A;  3NIX A;  1O94 A;  5FMH A;  4ECH A;  1N1P A;  1QLB A;  5IQ1 A;  4Z2U A;  1ELI A;  3URH A;  4YKG A;  3AE8 A;  1COY A;  2V5Z A;  1GET A;  2BK4 A;  3AE6 A;  3NN0 X;  2IID A;  1KDG A;  1CJ2 A;  3DJG X;  5JCM A;  3C96 A;  4TM1 A;  1E1N A;  1F3P A;  2A87 A;  4YKF A;  2C3C A;  1PXA A;  2C7G A;  2RGO A;  3K7Q X;  4H4R A;  3EF6 A;  4BK1 A;  3KD9 A;  1D4C A;  4U8O A;  2C76 A;  3RP7 A;  4DSH A;  2VQ7 A;  5HXI A;  4Z25 A;  5JCN A;  1ZMD A;  2XFP A;  1K0J A;  4A6N A;  5BUL A;  3AE1 A;  2DKH A;  3ZDN A;  3QSE A;  1NEK A;  2WOV A;  3UKA A;  2ARD A;  3P1W A;  3UTH A;  1E1L A;  2X50 A;  3EAO A;  3L8K A;  4MJW A;  4NTC A;  4J34 A;  4K2X A;  4JN9 A;  2GV8 A;  3AE9 A;  1GER A;  4JDR A;  4H7U A;  1PXC A;  4OPI A;  4E0V A;  4JY2 A;  4NEW A;  2B9W A;  3DK4 A;  4IA5 A;  5KWF A;  4IVM B;  3NT6 A;  2YG6 A;  4GRT A;  5L46 A;  5BUK A;  3GQH A;  4H4Q A;  2R0C A;  4B63 A;  2A8X A;  3BI2 A;  2ACZ A;  5HY5 A;  3P4P A;  1IUU A;  4EQW A;  3AED A;  1ZP0 A;  1NHS A;  2R0G A;  1TDF A;  3UKL A;  2IVD A;  3ZYX A;  1OJA A;  2YLS A;  4XXG A;  4AOX A;  3Q6J A;  1DJQ A;  2B7S A;  3ICS A;  2BS3 A;  1ZK7 A;  2DKI A;  3EAN A;  1GTH A;  2BC1 A;  1DOE A;  1JRY A;  1PJ7 A;  1K0L A;  1YQZ A;  3UOZ A;  4EQX A;  3AEG A;  4H50 A;  4ADW A;  2XVH A;  4B67 A;  2I0Z A;  3H8I A;  2Z5X A;  1KFY A;  2YR6 A;  3GDP A;  3NRN A;  1Z6L A;  2E4G A;  1JRZ A;  2QCU A;  2BK5 A;  5FS6 A;  1LTX R;  4OPL A;  1IUV A;  2V3A A;  1YQ3 A;  2VQB A;  3GDN A;  3FG2 P;  3LOV A;  4GDE A;  3AXB A;  4A79 A;  3SM8 A;  4OCG A;  1XDI A;  3QFA A;  1GV4 A;  1P2E A;  2ZBW A;  3GMC A;  4UDR A;  2YVF A;  3OZ2 A;  3C4N A;  1GSN A;  4B1B A;  4WCT A;  3ADA B;  1L9D A;  1TDN A;  4Y4N A;  2YG3 A;  1PBF A;  3QSM A;  3HZL A;  2WP6 A;  1PBC A;  3S61 A;  4AT2 A;  2O9Z A;  4ZCC A;  3SFE A;  4A99 A;  3RP8 A;  1M6I A;  3AEE A;  2VVL A;  2GB0 A;  2BS2 A;  1GRF A;  3CNP A;  3PVC A;  4J56 A;  2VRL A;  2WPE A;  2BS4 A;  3NG7 X;  1NG3 A;  4H2Q A;  2EQ6 A;  3PS9 A;  1F8W A;  3SQP A;  2JB2 A;  1BGN A;  2XFN A;  1PBD A;  1Q1W A;  1CJ4 A;  4A5L A;  5KVH A;  1TYP A;  3AEB A;  3IWA A;  1V59 A;  3AEC A;  1S3E A;  1ZKQ A;  4K5R A;  2XCG A;  3BHF A;  3AE5 A;  2YR5 A;  3UKH A;  3UOY A;  4CRT A;  4CY6 A;  1TDK A;  3SUC A;  3DJD A;  3B6D A;  4M52 A;  1KSU A;  1YKJ A;  4X9M A;  1BZL A;  1ZY8 A;  3AE7 A;  4FX9 A;  3ABV A;  2CUL A;  4EM4 A;  1YY5 A;  2X99 A;  3WE0 A;  1YQ4 A;  4D03 A;  1PBE A;  1X31 B;  3KA7 A;  2YLX A;  2GAG B;  3G5S A;  2X8G A;  1EBD A;  1REO A;  3FMW A;  2GQW A;  3ICR A;  4TLZ A;  1DOD A;  2WEU A;  4ZCD A;  3RNM A;  4CY8 A;  4A6N B;  4NEV A;  2YM1 A;  2OA1 A;  1NEN A;  3GYX A;  1L9C A;  4OPU A;  1ZOV A;  3VR9 A;  1H81 A;  3GWF A;  1E7P A;  3CGD A;  3IF9 A;  1XAN A;  4BJZ A;  1CBO A;  3H4K A;  2X8H A;  4H4Y A;  4B66 A;  1GND A;  5KOX A;  2YLT A;  4NTE A;  4YSH A;  2X3N A;  1W4X A;  3P9U A;  3AEF A;  2GAH B;  4YSZ A;  1GRT A;  4BV6 A;  2QA2 A;  4YTP A;  1QO8 A;  3UTE A;  1D5T A;  4Y4L A;  2B76 A;  1O95 A;  4CCR A;  3CPH G;  1KNR A;  2B9X A;  2NPX A;  3NTD A;  3QJ4 A;  5BRT A;  3GYJ A;  1UKV G;  3VRA A;  1VG9 A;  2WOW A;  3DJJ A;  3CN8 A;  3P4Q A;  1DJN A;  1PJ6 A;  4O5Q A;  2WOI A;  5GRT A;  4AP1 A;  1GAL A;  3DGZ A;  4YSX A;  2WDV A;  1PS9 A;  2F5Z A;  4AT0 A;  4A9W A;  4EQS A;  3VRB A;  1GRB A;  2E1M A;  1IJH A;  2FJE A;  3RP6 A;  3GRS A;  4A65 A;  4TM3 A;  3UKF A;  3II4 A;  2WDR A;  3UTG A;  4BUR A;  3GQK A;  2XVF A;  4RG3 A;  1KF6 A;  1CC6 A;  5EB5 A;  5U25 A;  3RHA A;  3VQR A;  1EL7 A;  2FJD A;  5C2T A;  1H84 A;  2C66 A;  3AEA A;  1FCD A;  1FOH A;  2J3N A;  2XLS A;  3DJE A;  2WU2 A;  2BXR A;  4H4U A;  4B65 A;  2X8C A;  1E1K A;  2BA9 A;  1FEB A;  1N4V A;  3SFD A;  2QA1 A;  3M0O A;  4KX6 A;  3AYL A;  1NG4 A;  2V6O A;  2CDU A;  3CIR A;  1Q9I A;  2V3B A;  3NH3 X;  5J7X A;  2GH5 A;  1S2Q A;  4JY3 A;  4WX1 A;  1VDC A;  2XVJ A;  3LZX A;  3BNM A;  1FL2 A;  5DBJ A;  2CVJ A;  4Y4M A;  3KU9 A;  3UP4 A;  2Y6R A;  3LXD A;  4C5O A;  5IQ4 A;  1KNP A;  3O0H A;  4YTM A;  2VVM A;  2W0H A;  3R9U A;  4BJY A;  4U2S A;  5JCI A;  4DGK A;  4J2W A;  3QSS A;  1D4E A;  1Y0P A;  3ALJ A;  3M13 A;  3DK8 A;  3OC4 A;  2WS3 A;  2BAB A;  3C4A A;  5TR3 A;  4YT0 A;  3ATQ A;  4USR A;  1F6M A;  4JNQ A;  3ALM A;  4APN A;  4NTD A;  2ZZC A;  1FEA A;  2C65 A;  3NK0 X;  1L9E A;  4PAB A;  5LV9 A;  1DNC A;  2RAB A;  2C70 A;  3GWD A;  4K8D A;  1VQW A;  2XDO A;  2Q7V A;  3UKK A;  2C3D A;  2C64 A;  1GRG A;  1BGJ A;  3P4R A;  1IUW A;  2WHD A;  3B3R A;  3NTA A;  3JSK A;  4I59 A;  2R9Z A;  3FPZ A;  4JQ9 A;  4EMW A;  1BF3 A;  1RP0 A;  1Q1R A;  3NK2 X;  2JAE A;  3H8L A;  2Q0L A;  3KLJ A;  2CFY A;  2WU5 A;  3V3N A;  1Y56 A;  2YR4 A;  4EQR A;  4CNJ A;  2AR8 A;  1N4W A;  2YLR A;  4K5S A;  3L1R A;  4U8L A;  1B4V A;  2C72 A;  4EMI A;  3M12 A;  3K7T A;  2BCP A;  2R4J A;  2V61 A;  3F8R A;  5CKU A;  2Z5Y A;  4U8I A;  2Q6U A;  1OJ9 A;  1TDE A;  2GR2 A;  2YM2 A;  1TDO A;  4KPR A;  2AAQ A;  4FK1 C;  1P2H A;  4K7Z A;  1JU2 A;  1QJD A;  1D7Y A;  3AE3 A;  1F8R A;  2XLP A;  1ZDL A;  4ICY A;  3NN6 X;  3IHM A;  4OPC A;  3NHO X;  3DME A;  4CCQ A;  2XLR A;  3ALL A;  1D7L A;  4BK2 A;  4B69 A;  3DGH A;  5FS9 A;  4H4S A;  4EMJ A;  3IC9 A;  3LJP A;  5GSN A;  2Y6Q A;  4YTN A;  4IVO B;  5J60 A;  2PYX A;  1RSG A;  4IV9 A;  1ZOY A;  1GRH A;  4GUV A;  1CC4 A;  4DSG A;  2GR3 A;  2VRM A;  4H4X A;  4H2P A;  2FJA A;  1MO9 A;  2GMJ A;  2H89 A;  4Z43 A;  2WBA A;  2VOU A;  1DXL A;  3T37 A;  3CNJ A;  2GVC A;  5CQF A;  2YVG A;  3GD4 A;  4OPG A;  4C3Y A;  1GES A;  3V3O A; 
#chains in the Genus database with same CATH topology
 3NYE A;  3UU3 A;  5HYM A;  1E1M A;  4Z8X A;  5HXE A;  1LVK A;  3CPJ G;  2K5B B;  4EV6 A;  1H86 A;  3ISH A;  4TX5 A;  4WW0 A;  5BMV E;  2VL0 A;  2C67 A;  2CPT A;  3ONX A;  2WET A;  2HWC 4;  3B13 A;  5LB7 B;  3CPI G;  2XFU A;  4OPD A;  2SPC A;  3RKO A;  2ZM2 A;  4H4P A;  3NKZ A;  3U3I A;  3Q5D A;  1LVL A;  2RGH A;  1VBD 4;  1PO1 4;  3FB2 A;  3BK9 A;  4TM4 A;  5AQP B;  3V5U A;  3HYX A;  2NOX A;  2GMH A;  5JDN A;  2BCG G;  2ZZB A;  1DU2 A;  2VK9 A;  1RUE 4;  3CKD A;  1GES A;  4N9X A;  4YHH T;  2V6Y B;  2B9Y A;  2TPR A;  4Z24 A;  2RA1 A;  3RKG A;  2WP5 A;  1NPX A;  4I58 A;  2R4E A;  2E9X A;  4DID B;  3OYZ A;  4PDW D;  3K3Q C;  3UTF A;  2FJB A;  4ILA A;  4LF9 T;  1K4Q A;  1XHC A;  1KEY A;  1YKH B;  3T14 A;  1HNZ T;  3SY4 A;  5EOW A;  5F8P A;  4G9K A;  4DBQ A;  2UXN B;  3UOX A;  1CC2 A;  2LLY A;  4JI2 T;  3RLF F;  5AQS B;  4Z2R A;  1PHH A;  1E39 A;  3BNU A;  5LG3 A;  3JD7 4;  3S5W A;  5U63 A;  4J57 A;  1XDO A;  2NVK X;  2GEW A;  3FZK B;  4ZI2 C;  3JAF A;  3QNU A;  4GR1 A;  1Y56 B;  2KT9 A;  4ZEY A;  1O5W A;  4L0R A;  5J2U E;  3SGL A;  1QSD A;  5LG4 A;  5IHY A;  3AB1 A;  3GSI A;  2LSG A;  1XPQ A;  1HX1 B;  3AE4 A;  1EL8 A;  3UQ4 A;  1OJT A;  4ASK A;  4IDP A;  1LV0 A;  1RUD 4;  2HN2 A;  5CGM A;  1BKW A;  4H63 H;  1GOS A;  1L0V A;  2VKO A;  2KND A;  2DWG A;  2ZM6 T;  3AD9 B;  2EQ8 A;  4Z2T A;  2BK3 A;  3K30 A;  5HCJ A;  4ZI7 E;  2UZZ A;  2V1D B;  4I50 E;  1VOM A;  3CML A;  4HWD A;  3LSV A;  2XHE B;  4UR9 A;  3EAB A;  2XFQ A;  4OPT A;  2JBV A;  4LA1 A;  2BAC A;  1OJC A;  1X79 A;  2WPC A;  2EHO B;  1B37 A;  1FEC A;  2OA5 A;  2RS1 4;  4EM3 A;  1EL9 A;  4HA6 A;  5JRC B;  2R46 A;  2XAS B;  4UXN B;  4U2T A;  3CPZ A;  1HG5 A;  4QH5 A;  2X0H A;  5FS7 A;  3KKJ A;  4AQG A;  4ZN0 A;  1B8S A;  4U7Y A;  3Q5E A;  2IVE A;  2XVE A;  3F57 A;  4AXP A;  4TLX A;  2R6G F;  3AAI A;  3V5S A;  2V60 A;  4AOS A;  3B5M A;  4O4H E;  4L5G A;  4JI4 T;  4UP3 A;  2GF3 A;  3P7I A;  4O5U A;  4C74 A;  3G5Q A;  1H82 A;  4CI2 B;  2F4V T;  3NIX A;  2BRA A;  1O94 A;  3AA7 B;  5FMH A;  1N1P A;  1QLB A;  3RQU A;  2LHN A;  1GET A;  4PJN A;  2IID A;  4OK0 A;  3DJG X;  1E1N A;  1F3P A;  2A87 A;  3K7Q X;  4EGW A;  5JQG E;  3Q2M A;  4FJO A;  1N34 T;  5LOV E;  3W15 B;  4DSH A;  1NAF A;  3AAE B;  2YN6 A;  2J4G A;  1MQT D;  2MYS A;  5JCN A;  2XFP A;  4F6R C;  5BUL A;  3SWH A;  2X68 A;  3L8K A;  3EAO A;  2GV8 A;  1GER A;  4O8S A;  4H7U A;  1PXC A;  3PUS A;  5JDF A;  4IE6 A;  2NTY A;  5KWF A;  1G73 A;  3NT6 A;  4PAG A;  4IVM B;  2YG6 A;  3NRY A;  4H4Q A;  2R0C A;  4B63 A;  4NNJ A;  4HE8 A;  2ACZ A;  2I0M A;  5GON E;  2CBI A;  3N9M A;  4EQW A;  3AED A;  4HGA A;  1TDF A;  4CI1 B;  2IVD A;  3TLW A;  2LOS A;  2B7S A;  1ZK7 A;  3EUH A;  2CHO A;  1DOE A;  5JR9 A;  2YU2 A;  3A5X A;  1BR2 A;  2Z5X A;  2CCQ A;  3GDP A;  2E4G A;  1JRZ A;  2QCU A;  4Z2U A;  3GDN A;  2VQB A;  2IDO B;  4A79 A;  5F5W A;  1VRH 4;  1XDI A;  1P2E A;  4UDR A;  3WI3 A;  2YVF A;  4B1B A;  1GSN A;  4WCT A;  1L9D A;  1TDN A;  3RX6 A;  1OWA A;  3S61 A;  2O9Z A;  1RMU 4;  2DNX A;  4CXX A;  1M6I A;  5JH7 E;  2GB0 A;  1GRF A;  1U4Q A;  2HPL A;  5JDH A;  1XZY A;  4JEU B;  2PG8 A;  1ZEE A;  2HN1 A;  1F8W A;  2RP4 A;  4X66 T;  3A8Y C;  1Q1W A;  5KVH A;  1TYP A;  3AEB A;  1ZHC A;  1S3E A;  3AE5 A;  5L3D B;  4CRT A;  5FXV A;  5AQL B;  1E1H B;  1UCU A;  1ZY8 A;  4C91 A;  3WE0 A;  1YQ4 A;  2GAG B;  4NWZ A;  1EBD A;  3RNM A;  4TLZ A;  4CY8 A;  1DOD A;  2WWV A;  2YM1 A;  2CLY C;  4CI3 B;  3GYX A;  4YJ2 E;  4IL4 A;  4AIU A;  4LF7 T;  2YOE A;  5F3J A;  3GWF A;  1E7P A;  1D0X A;  1OOP D;  3H4K A;  4B66 A;  5KOX A;  2VUR A;  1GND A;  4DV1 T;  2X3N A;  3P9U A;  3AEF A;  2BBJ A;  3PUZ F;  5L47 A;  4GIW A;  5FXX A;  4YSZ A;  1XMO T;  4YTP A;  1QO8 A;  2B76 A;  1O95 A;  4CCR A;  1KNR A;  2B9X A;  3GYJ A;  1VG9 A;  3CN8 A;  1DJN A;  2WOI A;  3DGZ A;  3MK7 C;  5ABH A;  2E1M A;  2M6I A;  4DV6 T;  4G73 A;  3GRS A;  4A65 A;  5FMN A;  3UKF A;  3II4 A;  5U25 A;  1WR0 A;  2HWB 4;  3HI2 A;  2W67 A;  5KMG P;  1FCD A;  1FOH A;  2MTQ A;  4B65 A;  1Z0P A;  2X8C A;  1E1K A;  2BA9 A;  1V9D A;  2D5U A;  2VAS A;  1N4V A;  3SFD A;  3OYX A;  1RUI 4;  4WBN E;  1RUJ 4;  4OYJ A;  4HFC A;  2CVJ A;  4Y4M A;  4B3R T;  2QVA A;  4N78 D;  4YTM A;  4J2W A;  2WAU A;  3SZW A;  1COV 4;  3M13 A;  2LKG A;  4P0B A;  5DQV A;  3QB5 K;  5AQK B;  4O4L E;  4TWD A;  2WS3 A;  4AKR B;  2BAB A;  3C4A A;  2ZM0 A;  4YT0 A;  5TR3 A;  1WYB A;  5JDM A;  3ALM A;  4HFV A;  4DVD A;  2ZZC A;  4PAB A;  3LJC A;  5TAO A;  1DNC A;  4K8D A;  3ZCJ A;  3GWD A;  4L9I A;  4YJ3 E;  2XDO A;  3UU8 A;  2XPK A;  4HWI B;  3B3R A;  4H9N C;  2R9Z A;  3TKL B;  3FPZ A;  4I43 B;  2E2A A;  2VKJ A;  2BBH A;  3T1H T;  5KMS A;  2C4C A;  3NK2 X;  2JAE A;  4PJL A;  2CFY A;  4DND A;  1Y56 A;  2YR4 A;  5HEG A;  2AR8 A;  4AKL A;  5FXZ A;  5L3B B;  4U8L A;  1B4V A;  4EMI A;  5AQF B;  3M12 A;  2BCP A;  3RYH E;  2LSY A;  1OJ9 A;  1TDE A;  2X66 A;  2BG9 E;  2XLP A;  1ZDL A;  4UF0 A;  3ZYL A;  4H9P C;  3NN6 X;  3UU5 A;  1UX5 A;  3NHO X;  4TWH A;  2XLR A;  1D7L A;  2IC6 A;  5JVD E;  3DGH A;  3KV6 A;  4H4S A;  3HR0 A;  5EZY E;  4EMJ A;  2X51 A;  2E9X C;  5GSN A;  4IVO B;  4U7I A;  3ZC1 A;  4NIQ A;  4IV9 A;  3KVA A;  1GRH A;  5L3E B;  4PW8 A;  5AQH B;  3JAE A;  2JQ9 A;  3ZN1 B;  3T37 A;  2GVC A;  4OPG A;  4C3Y A;  4PFO A;  2KXP B;  2WY2 A;  2N2N A;  2GR0 A;  3GRT A;  2K3W A;  5CB4 E;  3ICT A;  3DTO A;  3CTY A;  1IUX A;  2A72 A;  4A7A A;  5U1O A;  3EPT A;  3NLC A;  3EAM A;  4H2N A;  5L3G B;  3VKG A;  2UU9 T;  3PU8 A;  4H9O C;  4ISS A;  2R07 4;  2W4X A;  3UUB A;  2RGJ A;  2BC0 A;  4GF7 A;  1LQU A;  4HFH A;  3UOV A;  1IBL T;  4CZZ B;  3NNE A;  2EHO D;  3VU7 H;  3RRC A;  3AYJ A;  1HCI A;  2XQ3 A;  4H9S E;  3JC6 C;  3CNT A;  2X9H A;  4TNW A;  2AXD S;  2PYJ A;  4JV5 T;  1FEW A;  4NXM T;  2XLU A;  1MIY A;  3I3L A;  4U74 A;  2APG A;  2Q0K A;  1B7T A;  5HEU A;  4U8N A;  2YVJ A;  3P50 A;  2C5J A;  1MMD A;  4XWZ A;  5EK4 A;  1PXB A;  4LFA T;  4GCM A;  1T98 A;  3A7M A;  3ZYK A;  4CN4 A;  1VRQ B;  3BI4 A;  5KVI A;  3FXD B;  2LT3 A;  1PN0 A;  1TYT A;  2EX3 A;  1DOC A;  4REK A;  3FZM B;  2WQY A;  2V6X A;  2H88 A;  1K0I A;  2DL1 A;  1ONF A;  3FI7 A;  2YLW A;  4JI3 T;  3PE0 A;  3P4S A;  3ZN0 B;  1PDH A;  1CL0 A;  4P0A A;  2X0Y A;  1XWM A;  5JR9 C;  2JB1 A;  1E6E A;  3MAC A;  4ANJ A;  5LGN B;  2C75 A;  2OLN A;  1R09 4;  1N33 T;  3ITJ A;  3RPU A;  4BK3 A;  1IUS A;  3ANW A;  3G06 A;  1RYI A;  2IUB A;  1MXT A;  2XFO A;  2G0U A;  3DA1 A;  3R84 B;  5A1L A;  1RUH 4;  2C5K T;  5LA6 E;  1IUT A;  4PK4 A;  1O3X A;  2YG5 A;  3AYI A;  1S94 A;  2Q9Q C;  4IRE A;  2WBL A;  1LQT A;  4O2A E;  3T8O A;  4EIQ A;  2YWL A;  5IPY A;  1D0Z A;  2LSI A;  4GK5 E;  4U72 A;  1BR4 A;  3GA8 A;  1F8S A;  3QVR A;  1N4U A;  3RED A;  2JQH A;  4MFR A;  2IML A;  3QUJ A;  5HAX A;  4LII A;  5JCK A;  4PAA A;  4X9N A;  3FBS A;  2IHR 1;  5JCL A;  3GN5 B;  1JNZ A;  2WZI A;  3N9L A;  1D1A A;  2C73 A;  4CBQ A;  4WBO A;  5AQO B;  1H8T D;  3KVE A;  2CXF A;  2CXD A;  2L3L A;  2YG4 A;  3F8D A;  2BG9 B;  2XQ7 A;  4U33 A;  1JEH A;  5KMQ A;  2V5D A;  4H4T A;  2WSS V;  3RYC E;  5EBK A;  5IYZ E;  5M0Z A;  3OVU A;  1HS7 A;  1S3B A;  3HKD E;  1T7S A;  3IA3 A;  5JDL A;  2YAU A;  3LB8 A;  3NVO A;  5KXJ A;  4Q4W 4;  2QRX A;  4RSL A;  4TUY E;  4YWO A;  2YQU A;  5HHF A;  3I6D A;  1J5W A;  1AR8 4;  2OLO A;  5FL0 A;  3KPF A;  2BVL A;  3MA9 A;  3U78 A;  3AD8 B;  2V7M A;  2UXD T;  2ACX A;  5DAB A;  5AQG B;  4DO0 A;  4XZC A;  2VKD A;  4X5T A;  5IQ1 A;  4LMJ A;  3LK3 B;  2JMK A;  2KWH A;  2BK4 A;  4ZI2 D;  4O2B E;  5AQJ B;  3VKH A;  3RI5 A;  3ZPO A;  5JCM A;  4TM1 A;  4QXH B;  3S4U A;  1PXA A;  4H4R A;  2DLR A;  4BK1 A;  1D4C A;  3RP7 A;  3RIF A;  4Z25 A;  3NBX X;  4A6N A;  3FXE B;  3ZDN A;  1NEK A;  3UKA A;  3N9P A;  2X50 A;  4TNV A;  3AA6 B;  4JUY A;  4JN9 A;  3AE9 A;  2LEH A;  4LF4 T;  4GB3 4;  4A97 A;  2NWB A;  2B9W A;  5HWY A;  4E7S A;  3O1H A;  5J2T E;  5BUK A;  3RGL A;  3HKB E;  5HY5 A;  1YXR A;  3P4P A;  4KHZ F;  2I59 A;  2W61 A;  2RS3 4;  4NXN T;  1VBC 4;  1WYC A;  3Q6J A;  3ICS A;  4I55 E;  4IDO A;  4MAL A;  2DKI A;  2BKP A;  5DJQ C;  1K0L A;  1PJ7 A;  2MPK A;  4H50 A;  3AA1 B;  2J62 A;  3UUL A;  2VWA A;  4ADW A;  2KMF A;  4B67 A;  2I0Z A;  5LBQ B;  2HHH T;  2YR6 A;  4OPL A;  4Z91 A;  1IUV A;  2V3A A;  2ZMA A;  2YDR A;  2VKH A;  3MZK B;  4OCG A;  3QFA A;  1GV4 A;  3TLS A;  4G63 A;  2XM2 A;  3ADA B;  4LFC T;  1PBF A;  1T72 A;  3FZF B;  4G2A A;  2PBI A;  3QK6 A;  3RP8 A;  2VVL A;  4ZS3 A;  3CNP A;  2CA5 A;  4ZOL E;  2V7I A;  1FIO A;  4X1I E;  2VQF T;  4J56 A;  4DBR A;  3ZT7 A;  1NG3 A;  4H2Q A;  2XAQ B;  4G6H A;  5BR8 T;  2JB2 A;  2MBG A;  2BDE A;  4YY3 T;  3IWA A;  4DUY T;  4U3C A;  1V59 A;  4K5R A;  3BHF A;  4GKK T;  2H7V C;  1TDK A;  3GMI A;  5FVL A;  4M52 A;  4X9M A;  1Y64 B;  5LNK A;  1W9R A;  1D1B A;  2IAK A;  2X5I D;  4D03 A;  2YLX A;  2BRY A;  2X8G A;  1REO A;  4A56 A;  1IBM T;  5HWX A;  1NEN A;  5LJM A;  3CX8 B;  3ZT5 A;  2NW7 A;  5FXW A;  4DV4 T;  3VR9 A;  3ZEF B;  4H9R C;  1XAN A;  2JQQ A;  2X8H A;  2HH7 A;  4H4Y A;  4AKH A;  4EEB A;  5LMN T;  1W4X A;  5J0Z A;  1D5T A;  3PUV F;  3ZKR A;  4Y4L A;  3TLV A;  2NPX A;  1XHX A;  3KV9 A;  3QJ4 A;  1BR0 A;  1MIV A;  3P4Q A;  1PJ6 A;  3ANW B;  3SZC A;  1PS9 A;  4EQS A;  3D0T A;  2W66 A;  1IJH A;  3ZC0 A;  3RP6 A;  1R08 4;  2XTL A;  2K48 A;  3N9N A;  2X9W A;  1J5E T;  2ODU A;  3UTG A;  4BUR A;  3GQK A;  4IE7 A;  1CC6 A;  1SA0 E;  5CA1 E;  1I6Z A;  4UV8 B;  1H84 A;  2C66 A;  3AEA A;  3PUG A;  3DJE A;  4H4U A;  1SHZ C;  2XY8 B;  4TN7 B;  2QA1 A;  3M0O A;  1OED C;  2CDU A;  3CIR A;  2V3B A;  2GH5 A;  1S2Q A;  4JY3 A;  3N2G E;  2XVJ A;  3UP4 A;  2W62 A;  4NUU A;  2KSR A;  5IQ4 A;  2W0H A;  2VVM A;  5JCI A;  4DGK A;  2GK9 A;  2XSB A;  4ZXL A;  3QSS A;  1WR6 A;  3ALJ A;  3DK8 A;  2L9Q A;  3L09 A;  4UIG A;  3HL6 A;  4AKG A;  3KVB A;  5L4E A;  4ZS2 A;  1F6M A;  2C65 A;  3NK0 X;  2K9A A;  1L9E A;  5KMP A;  4DV5 T;  2RMU 4;  1VQW A;  2C3D A;  1GRG A;  3C4Z A;  3JSK A;  3UUN A;  3RH3 A;  5H6Q B;  1RP0 A;  2XQA A;  5HXH A;  2WU5 A;  4CNJ A;  1IAP A;  4K5S A;  2YLR A;  4HFB A;  4UV9 B;  2DI4 A;  1UUS A;  3FBL A;  5LHG B;  2R4J A;  4I0U A;  5EK3 A;  5KX5 E;  1WFD A;  4NPP A;  2Y8D A;  2YM2 A;  2AAQ A;  1P2H A;  1MMN A;  1D7Y A;  3AE3 A;  3PTR B;  1F8R A;  4LFB T;  1OED E;  1EAH 4;  3RYF E;  3IHM A;  2DWK A;  4OPC A;  2VVS A;  4BK2 A;  3IC9 A;  4UEL A;  2Y6Q A;  3SXI A;  1ZOY A;  2XSA A;  3QOF A;  1CC4 A;  4DSG A;  3RIU A;  3MXZ A;  4WNK A;  2Z6E A;  1M62 A;  1AR9 4;  2FJA A;  1MO9 A;  4OHF A;  2H89 A;  4II3 A;  5M4Y A;  4Z43 A;  4OX9 T;  5CQF A;  2JB3 A;  5J7X A;  3EDV A;  5HXR A;  2OAL A;  3UP5 A;  4U2Y A;  4V1A v;  1AOG A;  4LU6 A;  4ILU A;  1US7 B;  2JIW A;  1H83 A;  4HEA A;  1JRX A;  5AQM B;  4JEH B;  3I0Q A;  3NK1 X;  1H6V A;  1VRB A;  4H4W A;  3LZW A;  4OYK A;  2PJQ A;  2XQ9 A;  3UKQ A;  2YLZ A;  4C77 A;  3CQX C;  4B6X A;  2XQ6 A;  3CVR A;  5HXS A;  3JAD A;  4MLK A;  3ONJ A;  1W0A A;  2YDQ A;  1OJD A;  2GRT A;  2DHR A;  4KUM B;  3KDS E;  5JRE A;  3ATR A;  3CND A;  2LOP A;  2B7R A;  4KP3 C;  2Q9Q A;  4C3X A;  2CXL A;  3ZMT B;  5HCM A;  4TM0 A;  5AQU B;  2BG9 A;  3KIN B;  1H7C A;  2E5V A;  2KLQ A;  3LK2 B;  3F8P A;  4QH4 A;  2RPA A;  2GR1 A;  1TRB A;  2RS5 4;  4M1P A;  5FKY A;  2NP9 A;  4FK1 A;  2NW9 A;  4IE0 A;  4Z26 A;  2UUB T;  4UDQ A;  4DR5 T;  5FP3 A;  5L3C B;  3DK9 A;  4TZ4 C;  2WM9 A;  3GYI A;  4YSY A;  1KSS A;  2LSK A;  5ETW A;  1PBB A;  2ZZ0 A;  3RHW A;  2AE9 A;  3UFG A;  4DMV A;  5LXT E;  3UCL A;  3PV0 F;  3LBX A;  1W0B A;  2E9X D;  5AQN B;  5KOW A;  1VBB 4;  4GAV A;  4NZH A;  4UVA B;  4H4V A;  4FDC B;  2JMH A;  3IEE A;  2BVM A;  1S2Y A;  2LRK A;  4U2Z A;  3PUR A;  4H2R A;  3JBG 4;  3NRX A;  3E08 A;  3NYC A;  2IIU A;  4OFZ A;  5E0O A;  5H6R B;  2FBW A;  3UT5 E;  2XQ8 A;  3E0Z A;  3AD7 B;  3CWZ B;  4J36 A;  4DV7 T;  2GQF A;  1LPF A;  3T2K A;  1HNX T;  4K22 A;  2D0U A;  1JOA A;  2LFC A;  3COX A;  1M64 A;  2XYO A;  4HN9 A;  4QHO A;  2WMN A;  1XDP A;  4KMC A;  1H7W A;  4U2L A;  4IDQ A;  2PHH A;  3LK4 2;  3OKQ A;  2HQM A;  4DV0 T;  3O1I A;  2QGS A;  5LYJ E;  3DH9 A;  5FY1 A;  4YXD A;  2IW5 B;  3C4X A;  2A89 A;  3Q9T A;  2EHO C;  5C8Y E;  5AFU L;  3T2Z A;  3QB5 A;  3BQI A;  5C3J A;  2EQ9 A;  3LAD A;  2RM2 4;  2BXS A;  2PLV 4;  3AVR A;  3KFW X;  4CN6 A;  4LF5 T;  2TMD A;  3LFM A;  1ASJ 4;  1HG2 A;  2BZB A;  1CHU A;  2XM1 A;  1SEZ A;  4RG4 A;  2CBJ A;  4AP3 A;  4IIJ E;  2BKO A;  2VZ2 A;  3V76 A;  2RR1 4;  4QXB B;  3J7Y q;  1HX8 A;  4UF0 B;  4BA9 A;  1HR0 T;  3GMB A;  4XWR A;  4HB9 A;  3BI5 A;  1GRA A;  1GXF A;  2R0P A;  2XVI A;  1Z8U A;  3N5L A;  2BYB A;  4O4I E;  1W09 A;  4DV3 T;  3QVP A;  3PO7 A;  4II2 A;  3NWI A;  4GYS A;  5FS8 A;  4IDN A;  1GRE A;  1CJC A;  3CGE A;  3RC8 A;  1OXZ A;  4AQF C;  3FIM B;  2WDQ A;  4IT4 A;  3D8X A;  2K24 A;  2D0T A;  3RF1 A;  3TLT A;  1GQE A;  2YG7 A;  2WCA A;  1HF8 A;  4YHJ A;  4B68 A;  1NDA A;  3IBP A;  5LGU B;  4EED A;  1HYU A;  4ECH A;  3EHZ A;  4Q4Y 4;  4YFS A;  1ELI A;  3SRZ A;  3OBV E;  1COY A;  4RHV 4;  3UUM A;  3C50 A;  1CJ2 A;  4MHC A;  4TV8 E;  4YKF A;  2C3C A;  1POV 0;  1LRZ A;  2C7G A;  2VL8 A;  2RGO A;  1MMG A;  4U8O A;  5HXI A;  1K0J A;  4GAP A;  3AE1 A;  2DKH A;  3QSE A;  3PUQ A;  4EZ4 A;  2ARD A;  1SUM B;  3P1W A;  3UTH A;  4NTC A;  4LML A;  4J34 A;  4K2X A;  3T1Y T;  4DR2 T;  3RRW A;  2XUE A;  3AA0 B;  2KZ7 B;  4JY2 A;  1E2A A;  2X0L B;  4GRT A;  5L46 A;  5CFB A;  3GQH A;  1X9B A;  4JYA T;  2CLY B;  1CUN A;  3HYV A;  1IUU A;  5HXC A;  1KNZ A;  1ZP0 A;  1NHS A;  1MNE A;  3EI0 A;  3M65 A;  2R0G A;  2PYL A;  3UTK A;  1N36 T;  4IHJ E;  4EZH A;  3HKC E;  4JBW F;  2YIN A;  2YLS A;  5KMR A;  4HWF A;  4CQI A;  4AOX A;  2B1E A;  2N9D A;  3EAN A;  1GTH A;  2W63 A;  1YQZ A;  4X1K E;  2KIN B;  4QXC B;  1YD8 G;  5AQI B;  4EOZ B;  3ZMS B;  3PJA A;  2V7J A;  4BAY B;  3H8I A;  4HKA A;  1KFY A;  3NRN A;  2IC9 A;  3GN5 A;  1NCQ D;  2J47 A;  1Z6L A;  5FS6 A;  3UKP A;  5AQQ B;  2L8K A;  1YQ3 A;  4GDE A;  3FG2 P;  3AXB A;  3SM8 A;  3RQW A;  1M7K A;  2ZBW A;  3OTO T;  4H63 V;  3OZ2 A;  3NZP A;  3C4N A;  2MOZ A;  4K0K T;  3QSM A;  4X64 T;  3EVY A;  3OPC A;  4PK5 A;  2WP6 A;  1PBC A;  5HYA A;  4AT2 A;  4ZI3 C;  4ZCC A;  4A99 A;  3AXJ A;  3L3P A;  4I4T E;  3AEE A;  4QX7 B;  2BS2 A;  3N9O A;  3PVC A;  4BJN A;  2E5L T;  2BS4 A;  3NG7 X;  3J8F 4;  4B3M T;  3PS9 A;  3AXJ B;  3SQP A;  1BGN A;  3O4X E;  5FL1 A;  1CJ4 A;  3PJA J;  2XCG A;  3UKH A;  3CX6 B;  2C0S A;  3SUC A;  3DJD A;  3B6D A;  3AVS A;  3SZ0 A;  4X20 E;  3PDY A;  1RUG 4;  5ABF A;  3AE7 A;  4FX9 A;  2CUL A;  2X99 A;  1K5M D;  1PBE A;  1X31 B;  1IZN B;  2NW8 A;  2VQE T;  3G5S A;  2WWU A;  3ICR A;  4UEM A;  4ZCD A;  1I94 T;  2WEU A;  4NEV A;  2OA1 A;  1L9C A;  4OPU A;  1ZV4 X;  3CGD A;  3IF9 A;  3F2E A;  2YU1 A;  2UXB T;  1CBO A;  3CQC B;  1EV1 4;  3H37 A;  4TV9 E;  2KWI B;  2XQ4 A;  4DMW A;  2GAH B;  1GRT A;  4BV6 A;  3UTE A;  4Q25 A;  4COF A;  3ZMU B;  3I0O A;  3VRA A;  2WOW A;  3DJJ A;  1WCR A;  3GWH A;  1HFA A;  1GAL A;  3SOL A;  4QWN B;  4DUZ T;  5FYM A;  3VRB A;  1GRB A;  3H3A A;  5J1G A;  1UGO A;  3CK6 A;  4TM3 A;  2H3R A;  4C90 A;  2WDR A;  4CN1 A;  2XJ7 A;  3KBU A;  1KF6 A;  1NWM X;  2FJD A;  1PVC 4;  3P8C D;  4AIS A;  1ZKE A;  4J2C A;  4HTE A;  2XQ5 A;  5LJN A;  5HEH A;  4KX6 A;  4NUV A;  3NH3 X;  1Q9I A;  3LG7 A;  1FL2 A;  3ZMV B;  3ONL C;  4JI8 T;  3LXD A;  1KNP A;  3I9Y A;  3O0H A;  5L3F B;  4BJY A;  2LM2 A;  2V26 A;  4KI0 F;  1Y0P A;  3Q5X A;  3OC4 A;  3ATQ A;  4NTD A;  2LKH A;  4UVB B;  4IE4 A;  2V8S V;  5LV9 A;  2R06 4;  1G8X A;  4LMK A;  1IUW A;  2WHD A;  1PIV 4;  3NTA A;  1BF3 A;  5ABF B;  5JDQ A;  2YDS A;  4JI7 T;  3ZCI A;  4U31 A;  2D2S A;  3BQK A;  3JC6 D;  2V7L A;  1Q1R A;  3KLJ A;  3V3N A;  4A5X A;  4EQR A;  1AL2 4;  3FZH B;  3L1R A;  4EIW A;  3HYW A;  2C72 A;  3PUX F;  3K7T A;  2V61 A;  3N2K E;  3F8R A;  2Z5Y A;  4X1Y E;  4P09 A;  3WAJ A;  2GR2 A;  1TDO A;  3N2O A;  4K7Z A;  5LBM A;  1VCS A;  3MJX A;  4CCQ A;  3DME A;  4ZZB A;  4MBQ A;  4P1N A;  5J60 A;  3PUA A;  3LBX B;  5JDG A;  4AI6 A;  3JCF A;  2GR3 A;  3OJA A;  2VRM A;  3UQ7 A;  4H4X A;  2GMJ A;  2PZS A;  2OLT A;  3C4W A;  3SS1 A;  4B3T T;  3CNJ A;  1Y01 A;  3GD4 A;  4QKN A;  4XBF B;  4F8H A;  3V3O A;  4AKI A;  5L4H A;  5FY0 A;  3AWI A;  3CGC A;  2JJ9 A;  4KHP T;  4DR1 T;  2WMO A;  5KDM C;  2M6B A;  4JI0 T;  5ABG A;  4JI1 T;  2P9B A;  1KK7 A;  1VG0 A;  5M10 A;  4EIP A;  4LF6 T;  3CX7 B;  2LRL A;  3NKS A;  3BHK A;  3AE2 A;  3ZJ2 A;  1RVF 4;  1D1C A;  1OED B;  1MND A;  4AQY T;  2CWO A;  1ZMC A;  3H3M A;  3BQL A;  3FHN A;  4HFE A;  4DR4 T;  3G5R A;  4QX8 B;  2XQY A;  1YKE B;  1EL5 A;  1AR7 4;  1UX4 A;  1FMW A;  2LJL A;  2YEV C;  4X62 T;  4JI5 T;  1D4D A;  4J33 A;  3Q5W A;  4USQ A;  5EK2 A;  3NGC X;  4JLE A;  2CHN A;  3K8P C;  3C98 B;  2D9D A;  2JKC A;  4U8K A;  2R7F A;  4IA6 A;  2I6H A;  2XLT A;  1FMV A;  2M67 A;  2A9U A;  3CGB A;  4GDP A;  1GTE A;  2WES A;  2JRK A;  4ADZ A;  3CNS A;  3RIU C;  4U8P A;  3D1C A;  3B57 A;  2VVL G;  5FVK A;  4DNA A;  3ZSS A;  2LM9 A;  4PK6 A;  2XAH B;  2JK6 A;  4ERR A;  4CNK A;  3FZL B;  4AQF A;  4UDP A;  1H7X A;  3UUX B;  1R8I A;  4EAH A;  2LHR A;  5IUX A;  4IL9 A;  5ER0 A;  1NHQ A;  1PJ5 A;  1GPE A;  5LHI B;  5KRQ A;  3F31 A;  1GEU A;  4O4J E;  2OAM A;  3QFB A;  3E1T A;  2CMR A;  2CEA A;  1NHP A;  2XZE A;  1GT8 A;  3VRD B;  5BVA A;  2AQJ A;  2VVN A;  3N9Q A;  4FI5 A;  3ZST A;  4PJJ A;  4ILB A;  1LJ1 A;  3IHG A;  2MAW A;  5EB4 A;  2BG9 C;  1CF3 A;  4H4Z A;  2QAE A;  4OVI A;  4Z44 A;  1NHR A;  1XMQ T;  4HFD A;  4J31 A;  1UK5 A;  4K0U A;  4U8J A;  4EYU A;  2V6Y A;  2DCF A;  2WZH A;  3VR8 A;  1ZX9 A;  4Z90 A;  1RUC 4;  3DP7 A;  4HWC A;  2EQ7 A;  2WP9 A;  2JPF A;  2PTF A;  3J9X 1;  1CJ3 A;  4LF8 T;  3ETU A;  2R45 A;  2WPF A;  4XAX B;  1DOB A;  2A2F X;  4B64 A;  2BKN A;  5IWA T;  4JNA A;  3ESL A;  3K7M X;  4DV2 T;  2ZM8 A;  1BWC A;  1MOK A;  4P9S A;  1U5P A;  2OV9 A;  5FNV E;  3UU4 A;  2UUA T;  4U8M A;  1B5Q A;  1NAA A;  4D04 A;  3GD3 A;  4GK0 E;  1JNR A;  3NYF A;  4X4J A;  4PJM A;  1YW0 A;  3AAA B;  3IF8 B;  3P4W A;  3URH A;  5JR9 B;  4YKG A;  3AE8 A;  2V5Z A;  3NN0 X;  3AE6 A;  3PUY F;  1KDG A;  2ES0 A;  3O1J A;  3C96 A;  3RYI E;  1VBE 4;  2Y48 B;  5FY7 A;  2A3D A;  3EF6 A;  3KV4 A;  3KD9 A;  1RUF 4;  2C76 A;  1HNW T;  4BJM A;  2ODV A;  2QYW A;  2VQ7 A;  2WB5 A;  1HRI 4;  4WYV A;  4E7Z A;  3L39 A;  1ZMD A;  5CA0 E;  2W2U A;  2CRB A;  2Q9Q D;  3E22 E;  2WOV A;  1D0Y A;  2V7K A;  2Q9Q B;  1E1L A;  4ZZC A;  4MJW A;  1IBK T;  4JDR A;  2YKS A;  4OPI A;  4E0V A;  5KNL A;  3L8R A;  4NEW A;  3DK4 A;  4IA5 A;  5LMU T;  2X67 A;  4G74 A;  2UXC T;  3SYI A;  2A8X A;  3BI2 A;  3WAK A;  1BEV 4;  1FJG T;  5AQT B;  3UKL A;  3ZYX A;  3R6N A;  1OJA A;  5HEO A;  4XXG A;  2V5C A;  1DJQ A;  3M3Z B;  2BS3 A;  1SE7 A;  4IDZ A;  2BC1 A;  1JRY A;  3UOZ A;  2R04 4;  4EQX A;  1UUR A;  3AEG A;  2ZLY A;  2LE8 A;  2XVH A;  3SZF A;  2X9Y A;  3ZYM A;  3KBT A;  4QH1 A;  1BR1 A;  2BK5 A;  1LTX R;  3LOV A;  5LGT B;  3GMC A;  4GYR A;  2C5I T;  4JI6 T;  3T0K A;  2LSJ A;  2YG3 A;  4Y4N A;  3O9X A;  3RC3 A;  3HZL A;  1LVF A;  3SFE A;  3QC9 A;  4DR6 T;  4X65 T;  1VCT A;  2VRL A;  2WPE A;  1NA1 D;  2Y6X A;  3CMM A;  2EQ6 A;  2E8I A;  4IST A;  2XFN A;  1PBD A;  4A5L A;  3AEC A;  1ZKQ A;  1MMA A;  2J1D G;  2YR5 A;  1XI1 A;  3UOY A;  1HTJ F;  4CY6 A;  1N32 T;  3RIA A;  1KSU A;  1YKJ A;  1XNQ T;  1BZL A;  2PY5 A;  3ABV A;  2UXX B;  4EM4 A;  1YY5 A;  1AJ3 A;  2CE7 A;  3KA7 A;  4PFP A;  3FMW A;  3UU6 A;  2GQW A;  1S35 A;  4A6N B;  2HPJ A;  2XAG B;  4ILC A;  1ZOV A;  3SX6 A;  2VB6 A;  2XAJ B;  1H81 A;  1T8B A;  4A98 A;  4BJZ A;  1IJ6 A;  2E9X B;  3K1S A;  2YLT A;  4NTE A;  4YSH A;  2UUC T;  3T31 A;  2PFV A;  2W0G A;  2QA2 A;  1EZ3 A;  4HFI A;  3CPH G;  3NTD A;  3HA4 A;  3I1A A;  3ZMZ B;  5BRT A;  1UKV G;  2PW9 A;  3I9W A;  3ETV A;  5GRT A;  4O5Q A;  4AP1 A;  4YSX A;  2WDV A;  3C51 A;  2F5Z A;  4AT0 A;  4A9W A;  3CQG B;  4PNI A;  3AB3 B;  3ZT6 A;  3IHR A;  5AQR B;  2FJE A;  5ADX L;  1QUU A;  3Q9D A;  4IGU A;  4GKJ T;  4EXT A;  1MIW A;  2XVF A;  4RG3 A;  2XAF B;  5EB5 A;  3RHA A;  3VQR A;  1Z7S 4;  4GOU A;  1PO2 4;  2CM0 A;  5CJ5 A;  1EL7 A;  4Q4V 4;  5C2T A;  1LKX A;  3NZQ A;  4H9Q C;  5AQV B;  4G6G A;  3X1D A;  2J3N A;  2XLS A;  5LHH B;  2WU2 A;  4ZI3 D;  2BXR A;  1FEB A;  5DQW A;  3AYL A;  1WRD A;  1NG4 A;  2V6O A;  3KPK A;  1J1J A;  3PUW F;  4B3S T;  4WX1 A;  1VDC A;  3K3O A;  3LZX A;  3BNM A;  5DBJ A;  4UVC B;  5LCY A;  3KU9 A;  1XHZ A;  4HWH A;  5ABE A;  2N1G A;  2Y6R A;  4C5O A;  4DR3 T;  5JRC A;  4DR7 T;  3R9U A;  4TWF A;  3K3N A;  4U2S A;  5L2L A;  1D4E A;  3ZLI A;  2YK0 A;  2NTX A;  1HRV 4;  3KV5 A;  4ZHQ E;  1AR6 4;  1D4M 4;  4USR A;  4JNQ A;  4APN A;  3VHL A;  1FEA A;  4EYY R;  1VBA 4;  3FBZ A;  2C70 A;  2RAB A;  3UKK A;  1IJ5 A;  2Q7V A;  2C64 A;  1BGJ A;  3P4R A;  4JQ9 A;  4I59 A;  1RHI 4;  4EMW A;  4Q4X 4;  2W00 A;  3TLU A;  3H8L A;  2Q0L A;  2JQK A;  1WLX A;  4WZX A;  1N4W A;  4CXW A;  5CKU A;  4U8I A;  4KBM B;  2Q6U A;  3HKE E;  4KPR A;  5LP6 E;  4FK1 C;  3PU3 A;  2QA7 A;  1JU2 A;  1QJD A;  3UFE A;  2EHO A;  3DJB A;  4ICY A;  2H7O A;  1XNR T;  2FUP A;  5JTG A;  5HEJ A;  3ALL A;  4B69 A;  2NR4 A;  5FS9 A;  3LJP A;  4YTN A;  2PYX A;  1RSG A;  1HXS 4;  3EDU A;  1OED A;  4GUV A;  4IE5 A;  3C64 A;  4YLH A;  2X9X A;  3ZJ1 A;  3T2Y A;  4H2P A;  4CXY A;  2WBA A;  2VOU A;  1DXL A;  3LDQ B;  2YVG A;  3MKD A;  4EB6 E;  2CWY A; 
#chains in the Genus database with same CATH homology
 3NYE A;  2OAL A;  5HYM A;  1E1M A;  3UP5 A;  2GR0 A;  1AOG A;  3AWI A;  3GRT A;  3CGC A;  3ICT A;  3CPJ G;  4LU6 A;  1H83 A;  3CTY A;  1IUX A;  1JRX A;  4A7A A;  5U1O A;  1H86 A;  3ISH A;  1VG0 A;  5M10 A;  3EPT A;  3NLC A;  4H2N A;  4EIP A;  3NK1 X;  2C67 A;  1H6V A;  3NKS A;  4H4W A;  3LZW A;  2WET A;  3BHK A;  3AE2 A;  2RGJ A;  2BC0 A;  2JB3 A;  2YLZ A;  3UKQ A;  4C77 A;  4GF7 A;  1LQU A;  3CPI G;  2XFU A;  1ZMC A;  4OPD A;  3UOV A;  4H4P A;  1OJD A;  2GRT A;  3G5R A;  3NNE A;  1EL5 A;  3ATR A;  3AYJ A;  3CND A;  1LVL A;  2B7R A;  2RGH A;  4C3X A;  4TM0 A;  4TM4 A;  2E5V A;  3CNT A;  3HYX A;  2GMH A;  3F8P A;  1D4D A;  4J33 A;  2GR1 A;  1TRB A;  2BCG G;  2ZZB A;  4USQ A;  3NGC X;  4FK1 A;  2XLU A;  4Z26 A;  3I3L A;  2JKC A;  2APG A;  2Q0K A;  4N9X A;  4U8K A;  2B9Y A;  2TPR A;  4UDQ A;  4Z24 A;  4IA6 A;  2WP5 A;  2XLT A;  1NPX A;  3DK9 A;  4U8N A;  3GYI A;  4I58 A;  2YVJ A;  4YSY A;  1KSS A;  1PBB A;  2R4E A;  2ZZ0 A;  4XWZ A;  1PXB A;  3CGB A;  4GCM A;  4GDP A;  3UCL A;  1GTE A;  2WES A;  3UTF A;  2FJB A;  3CNS A;  4U8P A;  3D1C A;  1VRQ B;  5KVI A;  3BI4 A;  5KOW A;  2VVL G;  1PN0 A;  1TYT A;  1K4Q A;  4DNA A;  4GAV A;  1DOC A;  1XHC A;  4NZH A;  4H4V A;  4REK A;  4FDC B;  2JK6 A;  2WQY A;  3T14 A;  2H88 A;  3SY4 A;  1K0I A;  4CNK A;  1S2Y A;  5EOW A;  4G9K A;  4UDP A;  1ONF A;  2YLW A;  1H7X A;  3P4S A;  3UOX A;  4H2R A;  1PDH A;  1CC2 A;  1CL0 A;  4Z2R A;  1PHH A;  3NYC A;  1E39 A;  3BNU A;  5ER0 A;  2FBW A;  3UKP A;  3S5W A;  1NHQ A;  3AD7 B;  1PJ5 A;  1GPE A;  4J57 A;  5U63 A;  2JB1 A;  5KRQ A;  1E6E A;  1GEU A;  2NVK X;  3QFB A;  2OAM A;  2C75 A;  2GEW A;  2OLN A;  3E1T A;  4J36 A;  3ITJ A;  4GR1 A;  1Y56 B;  2GQF A;  1O5W A;  4BK3 A;  1IUS A;  1LPF A;  1NHP A;  3T2K A;  4K22 A;  1JOA A;  1GT8 A;  2LFC A;  3SGL A;  3COX A;  3VRD B;  1M64 A;  2XYO A;  2AQJ A;  5BVA A;  1RYI A;  1MXT A;  2XFO A;  3AB1 A;  3DA1 A;  1H7W A;  3GSI A;  4U2L A;  2PHH A;  1XPQ A;  2HQM A;  1IUT A;  2YG5 A;  3AE4 A;  1EL8 A;  3AYI A;  3DH9 A;  1LJ1 A;  1OJT A;  3IHG A;  1LQT A;  4YXD A;  1LV0 A;  2A89 A;  5EB4 A;  3Q9T A;  4EIQ A;  2YWL A;  1BKW A;  1CF3 A;  1GOS A;  2QAE A;  1L0V A;  4H4Z A;  1F8S A;  4OVI A;  4Z44 A;  3T2Z A;  5IPY A;  3QVR A;  5C3J A;  1NHR A;  1N4U A;  2EQ9 A;  3LAD A;  3RED A;  3AD9 B;  2BXS A;  2EQ8 A;  4J31 A;  4Z2T A;  2BK3 A;  4LII A;  5JCK A;  2TMD A;  4U8J A;  4PAA A;  3K30 A;  4X9N A;  3FBS A;  5JCL A;  3VR8 A;  1ZX9 A;  1JNZ A;  2UZZ A;  2C73 A;  1CHU A;  4CBQ A;  1SEZ A;  4RG4 A;  4AP3 A;  3KVE A;  2EQ7 A;  2YG4 A;  2XFQ A;  2WP9 A;  2VZ2 A;  4OPT A;  3V76 A;  2JBV A;  4LA1 A;  2BAC A;  1OJC A;  2WPC A;  3F8D A;  4XWR A;  3GMB A;  1CJ3 A;  1JEH A;  5KMQ A;  4HB9 A;  2R45 A;  2WPF A;  3BI5 A;  4H4T A;  5EBK A;  1GRA A;  1B37 A;  1FEC A;  1GXF A;  2R0P A;  2XVI A;  5M0Z A;  1S3B A;  2BYB A;  3QVP A;  2YAU A;  3PO7 A;  4EM3 A;  1DOB A;  3LB8 A;  4B64 A;  1EL9 A;  4HA6 A;  4II2 A;  5KXJ A;  5FS8 A;  2R46 A;  4JNA A;  1GRE A;  3K7M X;  4U2T A;  1CJC A;  3CGE A;  1BWC A;  1MOK A;  4RSL A;  5FS7 A;  3KKJ A;  4YWO A;  2YQU A;  5HHF A;  4P9S A;  3FIM B;  3I6D A;  4ZN0 A;  1B8S A;  2OLO A;  2WDQ A;  2IVE A;  2XVE A;  3D8X A;  3KPF A;  4U8M A;  1B5Q A;  4TLX A;  1NAA A;  3AD8 B;  4D04 A;  3GD3 A;  2YG7 A;  1JNR A;  2V60 A;  3NYF A;  4AOS A;  4X4J A;  4UP3 A;  2GF3 A;  4O5U A;  4B68 A;  1NDA A;  3G5Q A;  4C74 A;  1H82 A;  1HYU A;  3NIX A;  2BRA A;  1O94 A;  5FMH A;  4ECH A;  1N1P A;  1QLB A;  5IQ1 A;  4Z2U A;  1ELI A;  3URH A;  4YKG A;  3AE8 A;  1COY A;  2V5Z A;  1GET A;  2BK4 A;  3AE6 A;  3NN0 X;  2IID A;  1KDG A;  1CJ2 A;  3DJG X;  5JCM A;  3C96 A;  4TM1 A;  1E1N A;  1F3P A;  2A87 A;  4YKF A;  2C3C A;  1PXA A;  2C7G A;  2RGO A;  3K7Q X;  4H4R A;  3EF6 A;  4BK1 A;  3KD9 A;  1D4C A;  4U8O A;  2C76 A;  3RP7 A;  4DSH A;  2VQ7 A;  5HXI A;  4Z25 A;  5JCN A;  1ZMD A;  2XFP A;  1K0J A;  4A6N A;  4GAP A;  5BUL A;  3AE1 A;  2DKH A;  3ZDN A;  3QSE A;  1NEK A;  2WOV A;  3UKA A;  2ARD A;  3P1W A;  3UTH A;  1E1L A;  2X50 A;  3EAO A;  3L8K A;  4MJW A;  4NTC A;  4J34 A;  4K2X A;  4JN9 A;  2GV8 A;  3AE9 A;  1GER A;  4JDR A;  4H7U A;  1PXC A;  4OPI A;  4E0V A;  5KNL A;  4JY2 A;  4NEW A;  2B9W A;  3DK4 A;  4IA5 A;  5KWF A;  4IVM B;  3NT6 A;  2YG6 A;  4GRT A;  5L46 A;  5BUK A;  4G74 A;  4H4Q A;  3GQH A;  3SYI A;  2R0C A;  4B63 A;  4NNJ A;  2A8X A;  3BI2 A;  2ACZ A;  3HYV A;  5HY5 A;  3P4P A;  1IUU A;  4EQW A;  3AED A;  1ZP0 A;  1NHS A;  2R0G A;  1TDF A;  3UKL A;  2IVD A;  3ZYX A;  1OJA A;  5KMR A;  2YLS A;  4XXG A;  4AOX A;  3Q6J A;  1DJQ A;  2B7S A;  3ICS A;  2BS3 A;  1ZK7 A;  2DKI A;  3EAN A;  1GTH A;  2BC1 A;  1DOE A;  1JRY A;  1PJ7 A;  1K0L A;  1YQZ A;  3UOZ A;  4EQX A;  3AEG A;  4H50 A;  4ADW A;  2XVH A;  3SZF A;  4B67 A;  2I0Z A;  3H8I A;  2Z5X A;  1KFY A;  2YR6 A;  3GDP A;  3NRN A;  1Z6L A;  2E4G A;  1JRZ A;  2QCU A;  2BK5 A;  5FS6 A;  1LTX R;  4OPL A;  1IUV A;  2V3A A;  1YQ3 A;  2VQB A;  3GDN A;  3FG2 P;  3LOV A;  4GDE A;  3AXB A;  4A79 A;  3SM8 A;  4OCG A;  1XDI A;  3QFA A;  1GV4 A;  1P2E A;  2ZBW A;  3GMC A;  4UDR A;  2YVF A;  3OZ2 A;  3C4N A;  1GSN A;  3T0K A;  4B1B A;  4WCT A;  3ADA B;  1L9D A;  1TDN A;  4Y4N A;  2YG3 A;  1PBF A;  3QSM A;  3HZL A;  2WP6 A;  1PBC A;  3S61 A;  4AT2 A;  2O9Z A;  4ZCC A;  3SFE A;  4A99 A;  3RP8 A;  1M6I A;  3AEE A;  2VVL A;  2GB0 A;  2BS2 A;  1GRF A;  3CNP A;  3PVC A;  4J56 A;  2VRL A;  2WPE A;  2BS4 A;  3NG7 X;  3CMM A;  1NG3 A;  4H2Q A;  2EQ6 A;  3PS9 A;  1F8W A;  4G6H A;  2JB2 A;  1BGN A;  2XFN A;  3SQP A;  1PBD A;  1Q1W A;  1CJ4 A;  4A5L A;  5KVH A;  1TYP A;  3AEB A;  3IWA A;  1V59 A;  3AEC A;  1S3E A;  1ZKQ A;  4K5R A;  2XCG A;  3BHF A;  3AE5 A;  2YR5 A;  3UKH A;  3UOY A;  4CRT A;  4CY6 A;  1TDK A;  3SUC A;  3DJD A;  3B6D A;  4M52 A;  1KSU A;  1YKJ A;  4X9M A;  3SZ0 A;  1BZL A;  1ZY8 A;  3AE7 A;  4FX9 A;  3ABV A;  2CUL A;  4EM4 A;  1YY5 A;  2X99 A;  3WE0 A;  1YQ4 A;  4D03 A;  1PBE A;  1X31 B;  3KA7 A;  2YLX A;  2GAG B;  3G5S A;  2BRY A;  4NWZ A;  2X8G A;  1EBD A;  1REO A;  3FMW A;  2GQW A;  3ICR A;  4TLZ A;  1DOD A;  2WEU A;  4ZCD A;  3RNM A;  4CY8 A;  4A6N B;  4NEV A;  2YM1 A;  2OA1 A;  1NEN A;  3GYX A;  1L9C A;  4OPU A;  1ZOV A;  3SX6 A;  3VR9 A;  1H81 A;  3GWF A;  1E7P A;  3CGD A;  3IF9 A;  1XAN A;  4BJZ A;  1CBO A;  3H4K A;  2X8H A;  4H4Y A;  4B66 A;  1GND A;  5KOX A;  2YLT A;  4NTE A;  4YSH A;  2X3N A;  1W4X A;  3P9U A;  3AEF A;  2GAH B;  3T31 A;  4YSZ A;  1GRT A;  4BV6 A;  2QA2 A;  4YTP A;  1QO8 A;  3UTE A;  1D5T A;  4Y4L A;  2B76 A;  1O95 A;  4CCR A;  3CPH G;  1KNR A;  2B9X A;  2NPX A;  3NTD A;  3QJ4 A;  5BRT A;  3GYJ A;  1UKV G;  3VRA A;  1VG9 A;  2WOW A;  3DJJ A;  3CN8 A;  3P4Q A;  1DJN A;  1PJ6 A;  4O5Q A;  2WOI A;  5GRT A;  4AP1 A;  3SZC A;  1GAL A;  3DGZ A;  4YSX A;  2WDV A;  1PS9 A;  2F5Z A;  4AT0 A;  4A9W A;  4EQS A;  3VRB A;  1GRB A;  2E1M A;  1IJH A;  2FJE A;  3RP6 A;  4G73 A;  3GRS A;  4A65 A;  4TM3 A;  3UKF A;  3II4 A;  2WDR A;  3UTG A;  4BUR A;  3GQK A;  2XVF A;  4RG3 A;  1KF6 A;  1CC6 A;  5EB5 A;  5U25 A;  3RHA A;  3VQR A;  1EL7 A;  2FJD A;  5C2T A;  1H84 A;  4G6G A;  2C66 A;  3AEA A;  1FCD A;  1FOH A;  2J3N A;  2XLS A;  3DJE A;  2WU2 A;  2BXR A;  4H4U A;  4B65 A;  2X8C A;  1E1K A;  2BA9 A;  1FEB A;  1N4V A;  3SFD A;  2QA1 A;  3M0O A;  4KX6 A;  3AYL A;  1NG4 A;  2V6O A;  3KPK A;  2CDU A;  3CIR A;  1Q9I A;  2V3B A;  3NH3 X;  5J7X A;  2GH5 A;  1S2Q A;  4JY3 A;  4WX1 A;  1VDC A;  2XVJ A;  3LZX A;  3BNM A;  1FL2 A;  5DBJ A;  2CVJ A;  4Y4M A;  3KU9 A;  3UP4 A;  2Y6R A;  3LXD A;  4C5O A;  5IQ4 A;  1KNP A;  3O0H A;  4YTM A;  2VVM A;  2W0H A;  3R9U A;  4BJY A;  4U2S A;  5JCI A;  4DGK A;  4J2W A;  3QSS A;  3SZW A;  1D4E A;  1Y0P A;  3ALJ A;  3M13 A;  3DK8 A;  3OC4 A;  2WS3 A;  2BAB A;  3C4A A;  5TR3 A;  4YT0 A;  3ATQ A;  4USR A;  1F6M A;  4JNQ A;  3ALM A;  4APN A;  4NTD A;  2ZZC A;  1FEA A;  2C65 A;  3NK0 X;  1L9E A;  4PAB A;  5KMP A;  5LV9 A;  1DNC A;  2RAB A;  2C70 A;  3GWD A;  4K8D A;  1VQW A;  2XDO A;  2Q7V A;  3UKK A;  2C3D A;  2C64 A;  1GRG A;  1BGJ A;  3P4R A;  1IUW A;  2WHD A;  3B3R A;  3NTA A;  3JSK A;  4I59 A;  2R9Z A;  3FPZ A;  4JQ9 A;  4EMW A;  1BF3 A;  1RP0 A;  5KMS A;  2C4C A;  1Q1R A;  3NK2 X;  2JAE A;  3H8L A;  2Q0L A;  3KLJ A;  2CFY A;  2WU5 A;  3V3N A;  1Y56 A;  2YR4 A;  4EQR A;  4CNJ A;  2AR8 A;  1N4W A;  2YLR A;  4K5S A;  3L1R A;  4U8L A;  1B4V A;  3HYW A;  2C72 A;  4EMI A;  3M12 A;  3K7T A;  2BCP A;  2R4J A;  2V61 A;  3F8R A;  5CKU A;  2Z5Y A;  4U8I A;  2Q6U A;  1OJ9 A;  1TDE A;  2GR2 A;  2YM2 A;  1TDO A;  4KPR A;  2AAQ A;  4FK1 C;  1P2H A;  4K7Z A;  1JU2 A;  1QJD A;  1D7Y A;  3AE3 A;  1F8R A;  2XLP A;  1ZDL A;  4ICY A;  3NN6 X;  3IHM A;  4OPC A;  3NHO X;  3DME A;  4CCQ A;  2XLR A;  3ALL A;  1D7L A;  4BK2 A;  4B69 A;  3DGH A;  5FS9 A;  4H4S A;  4EMJ A;  3IC9 A;  3LJP A;  5GSN A;  2Y6Q A;  4YTN A;  4IVO B;  5J60 A;  2PYX A;  1RSG A;  4IV9 A;  1ZOY A;  3SXI A;  1GRH A;  4GUV A;  1CC4 A;  4DSG A;  2GR3 A;  2VRM A;  4H4X A;  3T2Y A;  4H2P A;  2FJA A;  1MO9 A;  2GMJ A;  2H89 A;  4II3 A;  4Z43 A;  2WBA A;  2VOU A;  1DXL A;  3T37 A;  3CNJ A;  2GVC A;  5CQF A;  2YVG A;  3GD4 A;  4OPG A;  4C3Y A;  1GES A;  3V3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...