4YTMA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 206
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytmA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytmA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytmA04
3H8LA 1TDOA 1JRXA 1H7WA 2OAMA 3UOYA 3CNSA 2YLRA 3F8DA 1NPXA 3UCLA 4OPLA 2R4JA 2YR4A 2C3CA 3NHOX 2VVMA 3L1RA 4J34A 2APGA 2XFOA 2YG4A 2NPXA 4JQ9A 3GRTA 3QVRA 2X99A 2B9YA 2CULA 1ZK7A 1O95A 2R46A 3DK4A 5ER0A 1DXLA 5M10A 3COXA 4FDCB 1JNZA 4GRTA 4UP3A 2HQMA 1CJCA 4U8LA 1FOHA 2RABA 3VRDB 1N4WA 3AE5A 4B65A 2YLZA 2BA9A 4U8OA 1RP0A 2XFUA 2BABA 1GRBA 1V59A 1YY5A 4EMWA 2C67A 4AP3A 1EL9A 4RG4A 1H6VA 2B9XA 3ZDNA 3LZXA 4JDRA 3CIRA 1DOBA 3Q6JA 4B68A 2CDUA 4EIQA 1XPQA 4H4YA 4BK1A 4NTEA 1K0IA 2R0PA 5BVAA 4A5LA 3LXDA 4J56A 3NRNA 5BUKA 3AE2A 1BWCA 3GDPA 4C5OA 2CFYA 3AE9A 1L0VA 2XVHA 2WEUA 3P4PA 2ZZ0A 2DKIA 3NIXA 2Q0LA 3RP6A 2GB0A 4A6NA 1FEAA 4GDPA 1DOEA 4EQXA 2YAUA 1GTHA 4IVOB 2IVEA 3RHAA 1RYIA 2XLRA 2YR5A 1ZMCA 1YQZA 1TDFA 4N9XA 4EM3A 1N1PA 1OJTA 1COYA 3KA7A 2ZZCA 4IV9A 2OA1A 2EQ6A 4YKFA 5U63A 4OPUA 4OPTA 4J2WA 2X8HA 1M64A 1NDAA 1PN0A 2PYXA 4H4UA 5J60A 2WOVA 5DBJA 2BCGG 1IUVA 3GWFA 3NYEA 3DMEA 4H2NA 1YQ4A 4IVMB 4RSLA 5TR3A 4B1BA 4BK3A 1FEBA 2WPEA 5BRTA 5FS9A 3ICRA 2JAEA 2E5VA 3LOVA 3ZYXA 1H84A 4U8JA 1Z6LA 2GVCA 4OCGA 4CNKA 3ALJA 3QSSA 4TM4A 3UP5A 4BJZA 4OPDA 4B67A 2V3BA 4WCTA 2FJDA 4TM3A 4U2SA 2OALA 4B69A 4ADWA 3REDA 4O5QA 4NTDA 3VR8A 1KSUA 3AD8B 3AE7A 3DJJA 4EMJA 4YKGA 2C73A 1Q9IA 1H86A 2WQYA 1BGJA 4MJWA 5KVIA 1N4VA 5U25A 4YSHA 1CF3A 1L9CA 3B3RA 2C7GA 1GREA 1JNRA 1D4EA 4DSHA 3P1WA 4B66A 4EQRA 2OLOA 3CGBA 1FL2A 1GESA 1JOAA 2WDVA 3SFDA 3IWAA 1YKJA 4EQSA 3SQPA 1DOCA 2C70A 2ZZBA 4GDEA 4X9NA 1GT8A 4NEWA 4U8NA 2BYBA 3NYFA 4OVIA 4JNAA 2VQBA 1MOKA 2C64A 3AXBA 4AP1A 5EOWA 2A87A 2R9ZA 1FCDA 3V76A 2I0ZA 4K22A 2V61A 5C3JA 1PBCA 2F5ZA 3AE3A 3L8KA 3AE6A 4YSYA 3GDNA 3M12A 4JY2A 1TYPA 2R4EA 3K30A 2GF3A 2X8GA 2GH5A 2B7RA 2XVFA 3IHGA 4DSGA 1QJDA 4U2LA 2GQFA 2VOUA 2BCPA 4D03A 2UZZA 2B76A 1TDKA 5KRQA 3ATQA 1KNPA 1MO9A 3KVEA 1OJAA 1XHCA 1OJDA 1XDIA 2VRMA 2YLSA 4UDRA 2AAQA 3UKHA 4NEVA 3S5WA 3NTDA 1D7YA 1Y56B 4IA6A 2ZBWA 1N4UA 2YLTA 4C3YA 2BXSA 2C72A 2GR3A 2A8XA 3BHFA 4H50A 4H7UA 4XWRA 1TDEA 3UP4A 1AOGA 4YTNA 4AT0A 1GXFA 2V3AA 3D8XA 3EAOA 4C74A 5KWFA 2AR8A 1GNDA 2ARDA 2YWLA 5IPYA 3P4QA 1H7XA 2GMHA 2YVJA 3BHKA 4H4TA 1ZOYA 3CGCA 3CNJA 4H4VA 5FS6A 4ZCDA 3CN8A 2GEWA 4CCRA 2XYOA 4CRTA 1H83A 3ISHA 3C4NA 4H4XA 4I59A 3UKAA 4LA1A 1CJ2A 3GRSA 1LJ1A 4O5UA 3ICSA 2WU5A 3M13A 4KX6A 4WX1A 1FECA 1CC6A 3UTGA 2YLWA 3C96A 3JSKA 1LTXR 4CNJA 4BV6A 3KLJA 4H4SA 1GOSA 4ECHA 2H89A 3RNMA 4D04A 2FJEA 3GD3A 1GRFA 4JNQA 3AYIA 3RP7A 3CGEA 3S61A 1VRQB 3NK1X 1UKVG 3BI5A 1TYTA 3H4KA 4XWZA 3ABVA 2JB2A 1E1LA 3GYXA 3DK8A 2O9ZA 2Q0KA 4A7AA 4Z44A 3VRBA 1LPFA 4H4QA 2Q7VA 3KKJA 4U8IA 1D7LA 4OPGA 2NVKX 2RGHA 3NK2X 1ZP0A 5CQFA 1YQ3A 2YM2A 1IUWA 1HYUA 4LIIA 4Y4MA 5BULA 2GAGB 3NK0X 1GRTA 5GRTA 5HYMA 2LFCA 4J57A 2XVEA 4TLXA 4USRA 1L9DA 4K7ZA 3CTYA 3GYJA 3UTHA 4EIPA 2J3NA 4NTCA 1VG9A 1OJCA 2GV8A 2QAEA 4Z43A 4DGKA 1ONFA 1LV0A 1B4VA 1Q1RA 1PJ6A 3FBSA 3O0HA 3UOVA 4FK1A 3UKQA 2BS2A 1PXBA 2E1MA 1F3PA 3CPIG 1S2YA 2QA2A 2VVLG 1PBFA 1BF3A 2GAHB 2Z5YA 1IUUA 3M0OA 1E39A 2IIDA 5KXJA 2IVDA 1NHQA 2Y6QA 1X31B 3AYJA 3G5SA 3B6DA 2WP9A 2BXRA 3SM8A 1M6IA 2Q6UA 2XLPA 2XFQA 5GSNA 2WDRA 3AE1A 2WU2A 1EBDA 3AWIA 4KPRA 1DJQA 3ITJA 5FS8A 5JCIA 2Y6RA 5LV9A 2YM1A 3UKPA 4U2TA 1EL5A 1LVLA 2YG5A 3K7TA 1JRZA 2OLNA 3NKSA 1IUSA 1KFYA 1D4DA 1K0LA 4E0VA 3FIMB 4Z24A 1CHUA 2BK5A 1IUXA 4JY3A 1L9EA 4FX9A 4EM4A 3UKFA 3AE4A 1IUTA 4X9MA 4Z2UA 1CC2A 4BJYA 3R9UA 4HA6A 1KNRA 2R45A 4BK2A 4ZCCA 2TMDA 3SFEA 2DKHA 3CGDA 3UKKA 2XFNA 3NN6X 5J7XA 4H2PA 4B64A 4EQWA 5HXIA 2GMJA 2V60A 4YWOA 4AT2A 5EB4A 3ADAB 3UTEA 3CPJG 2GRTA 3ICTA 2BC0A 3CNTA 3AEGA 2GR2A 2R0GA 2ACZA 3IC9A 2B9WA 1NG4A 3LZWA 1GRGA 4AOXA 2WDQA 2XFPA 4GCMA 4Z26A 1ZDLA 3ALLA 3G5QA 3QSEA 1B5QA 2QCUA 2V5ZA 5HY5A 4YTMA 5JCNA 1JRYA 1REOA 1VG0A 2B7SA 2WOIA 1GERA 5HHFA 3IHMA 4GUVA 4Y4NA 3GQHA 1JU2A 4REKA 2VRLA 3HZLA 4X4JA 3UTFA 3AEAA 1VDCA 1GPEA 1Q1WA 2EQ7A 1F8SA 2XVIA 4K8DA 3I3LA 3K7MX 1DNCA 4RG3A 2R0CA 3QFBA 2A89A 3AYLA 3WE0A 1QLBA 4A9WA 1GV4A 2WBAA 1B8SA 1DJNA 2YLXA 1GRHA 3OZ2A 4IA5A 4J33A 3KPFA 1B37A 1E1MA 2XLUA 4XXGA 5FS7A 3BNUA 3F8RA 4J36A 1E1KA 1DODA 3DJDA 3AEFA 1OJ9A 3LB8A 1EL7A 4U8MA 1CL0A 4YT0A 1NHSA 1VQWA 1Y56A 1EL8A 3D1CA 1S2QA 4ICYA 4LU6A 4CY8A 4Z25A 2WESA 5C2TA 3PVCA 3P4SA 2WS3A 3AEDA 1RSGA 2JB1A 2VZ2A 3OC4A 3RP8A 5KVHA 2X50A 4FK1C 4B63A 5IQ1A 4ZN0A 2AQJA 3FPZA 2W0HA 4NZHA 5KOWA 3T37A 2BACA 3FMWA 1LQUA 2FBWA 1E1NA 3NT6A 4Y4LA 2RGJA 1K0JA 3VQRA 1NG3A 3C4AA 3BI4A 2VQ7A 1PDHA 4H4PA 1K4QA 3NH3X 4H4RA 3G5RA 3DJGX 2XVJA 3AD7B 1KDGA 4GF7A 3CPHG 3GSIA 5L46A 3E1TA 3KU9A 1PJ5A 4YSXA 2C66A 2YG3A 4PABA 1W4XA 2GR0A 4BURA 3GYIA 2C65A 4K5SA 4TM1A 1BKWA 3AECA 4GR1A 1GALA 1O94A 1D4CA 2H88A 4OPCA 3K7QX 1P2EA 2BK3A 2WP6A 1D5TA 4CBQA 3ALMA 4A6NB 3EF6A 2X3NA 3CNDA 1MXTA 2BC1A 3UOXA 2V6OA 3LADA 4TLZA 1JEHA 2YR6A 4U8KA 2X8CA 4APNA 2GR1A 3PO7A 3AB1A 3DH9A 1GSNA 3FG2P 2YG7A 4H4ZA 1NENA 4DNAA 2FJBA 3NN0X 2YG6A 3BI2A 3VR9A 4YSZA 1LQTA 5EB5A 4CCQA 2JKCA 1NEKA 4A79A 2XLSA 2YVGA 4YXDA 3P4RA 1GETA 2Z5XA 1F6MA 3CNPA 1PXCA 1TRBA 2WETA 4OPIA 3V3NA 1NHPA 3VRAA 2CVJA 2EQ9A 2BK4A 2QA1A 4M52A 3DK9A 4A99A 4AOSA 4K5RA 5IQ4A 1PHHA 1S3EA 4H4WA 3DA1A 4UDQA 5U1OA 3GQKA 2EQ8A 2WP5A 3GMCA 3SUCA 1TDNA 1KF6A 5M0ZA 4Z2RA 3BNMA 1CC4A 2WOWA 4HB9A 2BS4A 2E4GA 3GWDA 2YVFA 3EPTA 4H2QA 1SEZA 3LJPA 1BGNA 3F8PA 1CJ4A 3AE8A 1E6EA 2WPCA 1P2HA 4C77A 4I58A 3DJEA 1PJ7A 3QJ4A 1ZOVA 2C3DA 5JCLA 4H2RA 1CBOA 5EBKA 3NYCA 3UOZA 5KOXA 1ZX9A 5FMHA 2YQUA 1F8WA 4EMIA 3PS9A 1GEUA 1ZMDA 3NTAA 2C75A 1H82A 4J31A 3DGZA 4YTPA 1H81A 1PXAA 3UKLA 1S3BA 3V3OA 1GTEA 3SGLA 3NGCX 3P9UA 4CY6A 3EANA 3IF9A 3NNEA 4U8PA 1KSSA 3NG7X 1E7PA 3DGHA 4JN9A 3AD9B 1ZY8A 2PHHA 2TPRA 3AEEA 3GD4A 1ZKQA 4C3XA 2XCGA 3ATRA 3URHA 1Y0PA 1F8RA 4A65A 1NHRA 1PBEA 3II4A 1NAAA 2JK6A 4USQA 3GMBA 5JCKA 1GRAA 1IJHA 4Z2TA 3I6DA 1ELIA 4TM0A 2WHDA 2JB3A 1QO8A 1PBBA 2WPFA 3AEBA 3QFAA 1CJ3A 5JCMA 4PAAA 1PBDA 3QSMA 5CKUA 1BZLA 3KD9A 2JBVA 3H8IA 1O5WA 3QVPA 2RGOA 2FJAA 4K2XA 2VVLA 3Q9TA 2C76A 4P9SA 1XANA 3NLCA 2XLTA 2GQWA 4UDPA 2BS3A 2XDOA 1PS9A
chains in the Genus database with same CATH superfamily
3K8PC 4KHZF 2OAMA 5EK3A 1VRH4 2YR4A 2XM1A 2VVMA 3L1RA 2YG4A 3QVRA 3ZCJA 3CX7B 3SY4A 2XPKA 1Z7S4 2CBIA 2BDEA 4GRTA 3PU3A 1CJCA 4U8LA 2G0UA 1AJ3A 5AQOB 2RABA 1N4WA 2C5JA 2XFUA 4EMWA 1YY5A 2C67A 1M7KA 1H6VA 3ZDNA 4JDRA 2W00A 3CIRA 3RGLA 3GMIA 1XPQA 1EZ3A 4H4YA 4BK1A 4PJLA 2RS34 5BUKA 4EV6A 3C4ZA 1OEDE 2CFYA 2PBIA 1L0VA 1RUF4 2NTXA 2ZZ0A 3RP6A 2GB0A 1FEAA 4IVOB 2JQHA 3QC9A 2IVEA 2YR5A 3LK42 4ISTA 1D0XA 3AA6B 2LM9A 2JPFA 1YQZA 4N9XA 5EK2A 4GYSA 5FY7A 2WB5A 4OPUA 1VBC4 4UV8B 3WAJA 2ZLYA 2YU1A 1NDAA 2WOVA 2QA7A 2WPEA 2V6XA 3ETUA 3ZYXA 4U8JA 1AR94 2GVCA 4CNKA 4TM4A 2UXXB 4B67A 2NWBA 2V26A 3UQ7A 2KWIB 3REDA 4BJNA 3AD8B 4EMJA 4H63H 4YLHA 5KVIA 2LEHA 4KHPT 2HHHT 2C7GA 1GREA 1D4EA 3BQLA 3FBZA 3T31A 4DSHA 4DV7T 1W9RA 4B66A 1FL2A 3OYZA 2K3WA 5HYAA 1IJ5A 3N5LA 3QK6A 1YKJA 3RX6A 4JLEA 4KI0F 1IAPA 2R044 4NEWA 4U8NA 5LB7B 3VHLA 4LF6T 4JNAA 3FZHB 2K5BB 5J2UE 2KNDA 2E8IA 5EOWA 2R9ZA 1R094 1PBCA 4WBOA 3GDNA 2YU2A 2X8GA 3SZCA 2B7RA 3IHGA 3RIAA 2LSJA 2VOUA 2BCPA 4D03A 3HR0A 4H63V 2B76A 4I55E 4OK0A 5ABHA 2R7FA 3RYIE 1XDIA 5IUXA 1PO24 1E1HB 2XQ3A 1D7YA 2D0UA 4C3YA 3UUXB 3F2EA 5FMNA 5M4YA 5DJQC 3BHFA 1TDEA 3D8XA 3G06A 2ARDA 5FS6A 4PK6A 3CGCA 3SX6A 4AKHA 4IHJE 3ZEFB 4NWZA 3ISHA 3C4NA 4ZOLE 4O5UA 2UXDT 4KX6A 4PFOA 1CC6A 4N78D 2YLWA 3JSKA 1LTXR 4CNJA 4MLKA 4BV6A 3C51A 3KLJA 3PUSA 4YHHT 4Z91A 3KBTA 4U2ZA 3GD3A 4LFAT 1VRQB 1UKVG 1TYTA 5LMNT 1BR1A 4DBQA 4J2CA 3PUWF 4H4QA 3T14A 1AR84 2R074 3KKJA 5L3DB 2BKOA 2NVKX 2VL0A 3NK2X 5CQFA 2YM2A 4AISA 4CXWA 5GRTA 1GRTA 2XVEA 4USRA 5J2TE 1L9DA 4K7ZA 3UTHA 4WNKA 4EIPA 5JDLA 1VG9A 4YJ2E 4AKIA 4Z43A 4DGKA 1MMNA 1ONFA 2UUCT 1B4VA 2JMHA 1PXBA 5J0ZA 3ANWB 2QA2A 5FKYA 2Z5YA 4PK5A 4HWFA 2IIDA 2Y6QA 3AYJA 3AAAB 4HTEA 3RRCA 4PDWD 2WP9A 2BXRA 4O4HE 3SM8A 2WU2A 3AWIA 4UELA 5IWAT 4KPRA 1DJQA 3ITJA 3MZKB 2XQ5A 3FXDB 2Y6RA 5LV9A 4CN1A 2YM1A 4U2TA 3K7TA 2YG5A 3EDUA 1HX8A 4Z24A 2BK5A 1L9EA 5EZYE 4EM4A 3UKFA 1VBA4 5L4HA 3AE4A 1IUTA 4X9MA 4Z2UA 1CC2A 3ZYKA 5JR9A 2QGSA 5JTGA 4BK2A 2DKHA 3CGDA 2SPCA 5HXIA 2V60A 3CPJG 2R6GF 4QXCB 1YW0A 3CNTA 3AEGA 1K5MD 2R0GA 3RLFF 4QHOA 4TWDA 3ZMZB 5HAXA 1GRGA 4Z26A 2XFPA 4IL9A 3QSEA 3WAKA 1LKXA 1JRYA 2LSGA 4GUVA 4EAHA 4REKA 4LMJA 4Z90A 3UTFA 5AQLB 1VDCA 1GPEA 2YDRA 2EQ7A 2CMRA 3I3LA 4WW0A 3AYLA 5JDNA 5AQFB 4A9WA 2W63A 3H3AA 3PDYA 4IE0A 2HWC4 1ZHCA 1OEDC 3HKCE 4GOUA 1PIV4 1B37A 1E1MA 4XXGA 2VURA 4EZ4A 3AA7B 1U4QA 3C64A 3D1CA 4Z25A 1YD8G 2BG9E 5KMRA 2WS3A 2JB1A 3OC4A 4B63A 2V5DA 3AAIA 4ZN0A 3ZCIA 3QB5K 3FPZA 4NZHA 5KOWA 3FMWA 2OV9A 2FBWA 1O3XA 2A9UA 4M1PA 2RGJA 1LRZA 2AE9A 2KT9A 3E0ZA 2VQ7A 5JQGE 4H4PA 2CPTA 5F5WA 3IF8B 1XNRT 3LBXA 5L3FB 3G5RA 3K3OA 3GSIA 4ZZCA 5L46A 2JJ9A 3KU9A 3VKHA 4X1KE 2GR0A 4UVBB 5ABFA 1BKWA 2L3LA 3ZC0A 1O94A 4MHCA 3MA9A 4NPPA 1P2EA 4ZZBA 2BK3A 2CXDA 3B5MA 1D5TA 4E7SA 1QSDA 1YKEB 5L3EB 5KMGP 2VK9A 3U78A 3LADA 4UIGA 4TLZA 4DIDB 1LVKA 4JUYA 2IIUA 2YR6A 1XDPA 2YDSA 2YG7A 1NENA 3L39A 4F6RC 2CLYB 4PFPA 3NN0X 1LQTA 1XI1A 2JKCA 2XY8B 1NEKA 3UU5A 1GETA 3O4XE 2Q9QA 5HEUA 1F6MA 3KV5A 4GB34 2WETA 3OBVE 4X64T 4Q4X4 1HF8A 3DK9A 3FXEB 2CRBA 4K5RA 5AQKB 3GQKA 2V6YA 3HYXA 4UDQA 2WP5A 3HA4A 3T0KA 3T2YA 3SUCA 3NVOA 5LOVE 3BNMA 2WOWA 4HB9A 4UF0A 1SEZA 1P2HA 4I58A 4Q4Y4 2LKGA 5KOXA 1ZX9A 1F8WA 1W09A 1ZMDA 3C98B 2V8SV 2C75A 1H81A 3UKLA 3PUQA 3EAMA 4DR3T 3CQGB 5TAOA 2ZM6T 3C50A 4GK0E 3CMLA 2D9DA 3ZT6A 1E7PA 4WZXA 1ZY8A 2TPRA 1ZKQA 4C3XA 2PLV4 2N1GA 1RUE4 3OVUA 1NHRA 4TV9E 4GYRA 3NKZA 2XQAA 5L3CB 1GRAA 3CX8B 2WHDA 4TZ4C 3SOLA 3QFAA 4ZEYA 1RUC4 4JI4T 3TLSA 2JBVA 1O5WA 1H7CA 2FJAA 4AKRB 3Q9TA 3AAEB 4P9SA 3NLCA 2GQWA 2XQ9A 5LHGB 1WR0A 1H7WA 2VKHA 3CNSA 1SHZC 2PW9A 2K48A 4OPLA 2RA1A 3ZT5A 4YFSA 5F8PA 2V7MA 1NCQD 4AQGA 4QH4A 2CULA 4G74A 3CWZB 2R46A 1AL24 1J5ET 5ER0A 2IMLA 4OFZA 1JNZA 3CKDA 4UP3A 4V1Av 4U3CA 4YHJA 3C4XA 2F4VT 2NW9A 4ILBA 1FOHA 2HN2A 2YK0A 2BBJA 3BQIA 3UULA 4B65A 2BA9A 4U8OA 2BABA 2V1DB 1V59A 3N2OA 3RQWA 4EGWA 3Q6JA 1BR4A 4EIQA 4G9KA 2CA5A 2I59A 3PURA 3RIUA 1YXRA 3NRNA 3AE2A 4AKGA 4PJNA 5FXXA 2V7LA 2XVHA 2WEUA 3P4PA 2ES0A 3NIXA 4ISSA 4GDPA 4JV5T 2YAUA 3VKGA 1GTHA 3RHAA 4FJOA 1POV0 3N9MA 3UFEA 4U33A 4G6HA 4JI0T 1N1PA 1COYA 4IV9A 2ZZCA 4O4JE 4H9QC 3DTOA 5LGUB 2J4GA 4J2WA 4H4UA 1M64A 3RC3A 2PYXA 4L0RA 3HYWA 3SS1A 3UTKA 5L4EA 2BCGG 5LP6E 3SZ0A 3NZQA 4KP3C 4IVMB 4B1BA 4BK3A 1FEBA 4BA9A 2H7OA 2JAEA 4HE8A 2RR14 2YDQA 1YKHB 2VKDA 2XZEA 3P8CD 3PTRB 1Z6LA 4LF7T 2WAUA 3H37A 5HXEA 3UP5A 4BJZA 1PVC4 1HCIA 4OPDA 3OKQA 5HXSA 3V5UA 4TM3A 2OALA 1WCRA 2KZ7B 3I0QA 2PG8A 3J9X1 4ADWA 4UVAB 3LSVA 4C91A 1KSUA 3QB5A 1FIOA 3AE7A 2C73A 1Q9IA 2WQYA 3I0OA 4MJWA 5JR9B 2LE8A 5AQPB 4DR4T 4TUYE 3LDQB 1BR0A 2OLOA 2BG9C 1GESA 2XQ4A 4E7ZA 5L2LA 4EQSA 5KMQA 4IE6A 4GDEA 2X9XA 1RHI4 1RUJ4 3EABA 5FXZA 2C64A 3AXBA 1HS7A 1UK5A 2XAGB 2VKOA 1FCDA 2A87A 3V76A 2I0ZA 3FHNA 4TV8E 2F5ZA 2M6BA 3AE6A 3M12A 1TYPA 2XUEA 2LHNA 2A3DA 2GH5A 2PZSA 4DSGA 1QJDA 4U2LA 2L8KA 2ZM0A 2UZZA 4HWDA 1KNPA 1MO9A 3HYVA 3KVEA 1OJAA 2VRMA 4P0AA 5AQQB 1G8XA 4JEUB 3CVRA 3UUNA 2C72A 4II3A 4XWRA 4EZHA 1GXFA 3EAOA 5AQTB 2YWLA 3P4QA 1H7XA 3BHKA 5CJ5A 1ZOYA 5CA0E 4L9IA 4F8HA 2GEWA 3LBXB 3UKAA 2ODUA 2ZM8A 3GRSA 4BAYB 3ICSA 1HRI4 2WU5A 4ZI3D 3EUHA 3A5XA 2LT3A 2H3RA 3GN5A 4C90A 5ABFB 2H89A 3MJXA 3RNMA 2FJEA 3RP7A 1U5PA 4ZHQE 4XZCA 3I9YA 3NK1X 3Q5XA 1D1CA 3H4KA 2JB2A 2DI4A 4CXXA 2IW5B 4X5TA 4LF5T 5HXCA 2Q0KA 4OYKA 4IE7A 2UU9T 3SWHA 2VB6A 3SRZA 3ONXA 1YQ3A 3TLTA 1IUWA 1UX4A 1HYUA 4LIIA 5BULA 3NK0X 4J57A 2XHEB 3GYJA 4NTCA 3SZFA 2WWVA 2QAEA 2X66A 1LV0A 3UKQA 1WLXA 2BS2A 2LHRA 2Q9QB 4ANJA 4DMWA 2XSAA 1GQEA 1PBFA 2GAHB 4Q4W4 4B3ST 1E39A 5KXJA 1X31B 2V6YB 1M6IA 2Q6UA 3Q5WA 2XLPA 5GSNA 1EBDA 5IHYA 2XJ7A 2XQ8A 3IA3A 4PNIA 2JQ9A 4UF0B 1G73A 3J8F4 4O2AE 1RMU4 3NKSA 2VASA 1IUSA 1KFYA 1D4DA 4B3TT 2QYWA 3FIMB 5CA1E 4JY3A 1IUXA 3RQUA 2H7VC 4FX9A 2IHR1 5LJMA 4ZI2D 5HEGA 4JI8T 3R9UA 2X5ID 1KNRA 3SFEA 4CZZB 4ILUA 3UKKA 2XFNA 3NN6X 4EQWA 4B64A 2GMJA 2X67A 5AQRB 3CQXC 5EB4A 3O1IA 3AB3B 4GAPA 1HX1B 3FZLB 3ICTA 2BC0A 1ASJ4 1UX5A 5AFUL 1N33T 2NR4A 1S94A 2WCAA 3I9WA 4AOXA 2E9XC 2DWGA 4AQFA 3G5QA 2NW8A 5HY5A 4I4TE 4TNWA 4ECHA 1VG0A 4LMKA 4H9PC 3KVBA 1GERA 2WOIA 4Y4NA 1KK7A 1JU2A 1Q1WA 4ILAA 4WYVA 2XVIA 4K8DA 3K3NA 1HTJF 1DNCA 2BBHA 3RRWA 2X0HA 2YLXA 3OZ2A 1XMQT 4J33A 2RS54 2N2NA 1DODA 3S4UA 3UU8A 1CL0A 2C0SA 1Y56A 1EL8A 4LU6A 1S2QA 5JREA 3P4SA 4JYAT 3IHRA 2X50A 4FK1C 5HEHA 2JIWA 2BACA 4IDPA 4QXHB 4DR5T 1K0JA 1RUI4 3ZJ2A 3ZMSB 5JH7E 1NG3A 3M65A 2WWUA 3C4AA 1PDHA 5CFBA 1K4QA 3NH3X 1VRBA 4H4RA 3DJGX 2XQ7A 3MXZA 1HNXT 1PJ5A 4EOZB 4U72A 4YSXA 1WR6A 1W4XA 3GYIA 2NP9A 1M62A 4Z8XA 1D4CA 2BVMA 2KSRA 3N9NA 3ALMA 3ZC1A 1J1JA 3ZMTB 4A5XA 3CNDA 3RYFE 2CHOA 2V6OA 5AQGB 1OEDB 4PK4A 5BMVE 4APNA 4TN7B 3AB1A 4H4ZA 4IE5A 2FJBA 5KNLA 3UQ4A 3VR9A 4YSZA 4CCQA 5KX5E 5GONE 4K0KT 1W0BA 2NOXA 2XLSA 2YVGA 4ILCA 4G73A 1PXCA 2BVLA 3V3NA 2EHOC 1NHPA 4QXBB 3LFMA 3TLUA 2EQ9A 1ZKEA 2BK4A 5JDGA 3AVSA 1S3EA 1RVF4 2CXFA 1IZNB 2GK9A 1EAH4 1CC4A 3ZYMA 3RYCE 5CB4E 2MTQA 2YVFA 1HNZT 4H2QA 3LJPA 3F8PA 5LA6E 1T72A 5DABA 1CJ4A 1E6EA 4PJJA 4C77A 3FZKB 4AXPA 1VCTA 3MACA 1QUUA 2J62A 3NBXX 1CBOA 2QVAA 2YQUA 2K24A 5FL0A 2MAWA 2ZM2A 3Q2MA 2MYSA 3JAEA 4J31A 4YTPA 5FY0A 3NGCX 2VL8A 4JBWF 3N2KE 4CY6A 3EANA 1T8BA 4U8PA 3RPUA 2YKSA 4UV9B 3AD9B 5LJNA 2XCGA 1HXS4 3ZSSA 3URHA 1S35A 1F8RA 4P0BA 2E2AA 1NAAA 3TLVA 1MIYA 4Z2TA 3I6DA 1ELIA 4TM0A 2RS14 2PY5A 1QO8A 4EIWA 1CJ3A 1N34T 5CKUA 3ZJ1A 3QSMA 3UU6A 3OTOT 4LFBT 3QVPA 3U3IA 2VVLA 5C8YE 2I6HA 2Q9QD 2XLTA 4UDPA 2BS3A 2W0GA 3KPKA 3H8LA 3F8DA 2YLRA 3UCLA 2R4JA 2DLRA 4WBNE 1US7B 2WY2A 4J34A 2APGA 2XFOA 5AQJB 3N2GE 4P09A 3JC6D 4JQ9A 3GRTA 2X99A 2XAFB 3VU7H 1ZK7A 3DK4A 3T2KA 3PUAA 2LLYA 4MALA 4FDCB 3VRDB 1XWMA 3AE5A 3D0TA 2YLZA 5LGNB 3GN5B 2M67A 1EL9A 4RG4A 4DV0T 2B9XA 2RP4A 3LK2B 2CE7A 4Q25A 1K0IA 2R0PA 4J56A 4IE4A 1BWCA 3GDPA 4LF8T 3M3ZB 4CI3B 1HFAA 2DKIA 2Q0LA 5DQWA 1DOEA 4EQXA 2LOPA 4IGUA 2HWB4 1RYIA 2XLRA 2W61A 1UGOA 4TNVA 1OJTA 2IC6A 3KA7A 3NRYA 2W67A 2OA1A 3UU3A 5U63A 3HI2A 4KUMB 1PN0A 5DBJA 3GWFA 2X68A 4H2NA 4IREA 5TR3A 3KV4A 5FS9A 2E5VA 3LOVA 2HN1A 4A97A 4OCGA 4DUYT 1WYCA 3ALJA 3RH3A 4NUUA 4WCTA 2FJDA 1N36T 1D0ZA 4KMCA 4O5QA 3CMMA 3VR8A 4COFA 4YKGA 1H86A 2JMKA 1BGJA 5U25A 2YOEA 3B3RA 1JNRA 2X9WA 3P1WA 3OJAA 4HWIB 4GK5E 4CN4A 4CN6A 3CGBA 1D1AA 3SFDA 3IWAA 1XZYA 1DOCA 3SQPA 3B57A 2C70A 4X9NA 2LKHA 1GT8A 2BKNA 4B3RT 2BYBA 2DWKA 3EVYA 4OVIA 4DR1T 2VQBA 4AI6A 1MOKA 4UXNB 4AP1A 4DBRA 3EDVA 1XMOT 4DV2T 3AE3A 3L8KA 4QX8B 5AQSB 4JY2A 2NW7A 2YEVC 3K30A 2GF3A 3NRXA 1I94T 5LBMA 3QUJA 1TDKA 5KRQA 2X51A 3BK9A 2C5IT 1CUNA 2YLSA 4HN9A 4NEVA 3S5WA 4X20E 3NTDA 3ZPOA 1Y56B 3IEEA 4IA6A 2J47A 1MNEA 2YLTA 3T1HT 2BXSA 3RC8A 1J5WA 4O2BE 4H50A 4HFHA 3UP4A 4AT0A 2CLYC 2V3AA 1GNDA 5IPYA 4H4VA 4H4TA 4ZCDA 3PJAJ 3JBG4 4CCRA 1VOMA 3JCFA 4H4XA 2RM24 4I59A 5H6RB 1ZEEA 3DP7A 1CJ2A 1LJ1A 1OOPD 3EI0A 4WX1A 3GA8A 5FYMA 1FECA 2WSSV 3C96A 5JRCA 2Z6EA 4G6GA 1H8TD 2VVNA 1GRFA 3CGEA 3S61A 4ZXLA 2BZBA 4GKJT 4XWZA 4Z44A 3VRBA 2E5LT 2R064 4ZI3C 1VBB4 1OEDA 5AQMB 2W2UA 4HFCA 4YJ3E 5AQHB 5KDMC 4OPGA 3MK7C 1D0YA 2GAGB 2LFCA 2J3NA 5LXTE 5LHHB 2GV8A 3O0HA 1Q1RA 1PJ6A 2QRXA 3FBSA 2D0TA 4DV1T 1Z0PA 4TWHA 1RUD4 1F3PA 1S2YA 2PTFA 1BF3A 5LYJE 3M0OA 5ETWA 2MPKA 3G5SA 5JDFA 2ACXA 3GWHA 4IL4A 3ZKRA 2XFQA 3AE1A 5JCIA 5IYZE 4IDZA 1T7SA 1LVLA 4G2AA 4HFDA 4DV4T 2LSKA 3V5SA 4QH5A 3NZPA 4JI5T 2IAKA 1X79A 2IC9A 3CPZA 2PJQA 3HKDE 1RUH4 2HH7A 4BJYA 4HA6A 2R45A 5FVKA 3UU4A 2TMDA 1AOGA 5LCYA 4H2PA 2LSYA 5H6QB 1Z8UA 4DNDA 3UTEA 2GRTA 2GR2A 3IC9A 2B9WA 2VKJA 2CCQA 1NG4A 4GCMA 3IBPA 1ZDLA 4ZI2C 3ALLA 3HL6A 2QCUA 3O9XA 2V5ZA 1D4M4 2IUBA 2B7SA 5HHFA 5L3BB 3RKOA 3GQHA 3JAFA 3HZLA 4OHFA 1F8SA 2VWAA 3P4WA 3K7MX 4RG3A 1VBE4 1XNQT 2A89A 3QFBA 3KBUA 2UXBT 1GV4A 1GRHA 1UUSA 3QNUA 4HWCA 3KPFA 5HEJA 5FS7A 4J36A 4QX7B 1FMVA 3LB8A 4U8MA 2J1DG 1VQWA 4EB6E 4UVCB 1NHSA 4K0UA 4U2YA 2WESA 5C2TA 4BJMA 1RSGA 3AEDA 3RP8A 2VZ2A 5KVHA 3RI5A 5IQ1A 5KMSA 3T37A 1LQUA 1E1NA 3NT6A 2HPLA 3VQRA 4XAXB 4B3MT 3L8RA 3FI7A 2V7KA 5LGTB 4GF7A 4QKNA 3TLWA 1KDGA 3CPHG 2E9XB 3LJCA 1OWAA 3ZN0B 2C66A 3KVAA 2YG3A 4IDOA 4PABA 4BURA 2C65A 2Y8DA 2LRLA 4OPCA 2H88A 3O1JA 2B1EA 1BEV4 2WZHA 1Y01A 4CBQA 2HPJA 1EV14 1IBMT 2CXLA 4AQYT 2X3NA 4X65T 3EF6A 1MXTA 2BC1A 5JR9C 4HEAA 2UUBT 2BRAA 2LRKA 2X8CA 4U8KA 4A98A 4UEMA 3DJBA 2GR1A 3PO7A 5BR8T 4TWFA 3P7IA 2DL1A 4AKLA 1OXZA 1IJ6A 3N9PA 4YXDA 2Z5XA 4OPIA 1VCSA 2FUPA 3KFWX 2QA1A 4OX9T 4M52A 3E08A 2C4CA 1LVFA 5IQ4A 1PHHA 4H4WA 3DA1A 3Q5DA 2XAHB 2IDOB 4NXMT 3GMCA 3OYXA 1UURA 1KF6A 1TDNA 4Z2RA 2BS4A 2E4GA 3EPTA 4G63A 3B13A 1BGNA 2VQET 4B6XA 2WPCA 2W4XA 3F31A 3DJEA 4A56A 2C3DA 1IBKT 3SYIA 3A8YC 4H2RA 3KINB 3NYCA 1KEYA 2DHRA 3PS9A 2LSIA 4ERRA 3NTAA 3H3MA 3DGZA 4CQIA 1FEWA 3SGLA 4EXTA 4CI1B 4HWHA 5LMUT 3L3PA 5HXRA 3IF9A 1KSSA 3NG7X 2Y6XA 4JN9A 1MIVA 3FB2A 2PHHA 4XBFB 3RIFA 3GD4A 2YN6A 2YINA 3N9LA 2EX3A 2KXPB 4X1IE 5JDMA 1Y0PA 4A65A 5J1GA 5JDQA 5AQNB 1I6ZA 3II4A 2EHOB 4USQA 5JCKA 3GMBA 1IJHA 1HRV4 4AIUA 3AEBA 3F57A 2WMNA 4PAAA 5FP3A 1PBDA 1N32T 4K2XA 4U7YA 1XANA 3ZMUB 2XDOA 1PS9A 4TLXA 1TDOA 1JRXA 1HG5A 4YY3T 3UOYA 2A2FX 2LOSA 1NPXA 5HEOA 2KWHA 2C3CA 3NHOX 3FZFB 5CGMA 2V7IA 4IIJE 2ODVA 5E0OA 2NPXA 3R6NA 4CI2B 2B9YA 2BG9A 1O95A 2Q9QC 1DXLA 4GAVA 5M10A 3COXA 5AQUB 2HQMA 2CHNA 4LFCT 1DU2A 1ZV4X 4PJMA 1RP0A 1GRBA 5JRCB 3I1AA 1FMWA 5HXHA 4PAGA 4AP3A 1NA1D 3LZXA 5EK4A 1DOBA 4B68A 2CDUA 4EYUA 1UCUA 3JC6C 5BVAA 4NTEA 2BRYA 3A7MA 4A5LA 2XASB 3LXDA 1XHXA 4L5GA 4H9OC 4C5OA 3AE9A 4RHV4 4DR6T 2UXNB 3ZT7A 2X9HA 4A6NA 3PUYF 4HFEA 4JI2T 1MMGA 1ZMCA 3Q9DA 1TDFA 5AQIB 4EM3A 3FZMB 4FI5A 1D1BA 4JEHB 2EQ6A 4YKFA 2MBGA 4OPTA 5FXWA 2X8HA 4NNJA 5J60A 3QOFA 1IUVA 3NYEA 3DMEA 1YQ4A 4RSLA 2PYLA 5BRTA 4I50E 2CM0A 2PYJA 1R084 3ICRA 1H84A 3QSSA 4DR7T 2DNXA 4DR2T 5A1LA 1B7TA 1RUG4 1XDOA 2V3BA 2WM9A 4U2SA 4B69A 3KV6A 1MMAA 4O4IE 4NTDA 2JRKA 2VQFT 3DJJA 2V5CA 4YSHA 2Y48B 1N4VA 3SXIA 1CF3A 1L9CA 3ESLA 2E9XD 3X1DA 2X9YA 4OYJA 5FNVE 2OA5A 4LF4T 4EQRA 1JOAA 2WDVA 4ZI7E 1AR74 3NWIA 3AXJB 1AR64 4U31A 1FJGT 3C4WA 2ZZBA 4P1NA 5F3JA 4DV6T 3NYFA 4DV3T 2D2SA 2XAQB 4K22A 3JD74 2V61A 5C3JA 3ZN1B 1WFDA 4YSYA 4I0UA 2R4EA 1MQTD 3RIUC 4JI6T 3O1HA 1SUMB 2XVFA 1Y64B 2GQFA 4JI3T 4DO0A 1PO14 4H9SE 4IDNA 3TKLB 3ATQA 3ZMVB 1XHCA 1OJDA 4UDRA 2AAQA 3UKHA 4II2A 4O8SA 2X0YA 2ZBWA 2L9QA 1N4UA 1W0AA 4ZS2A 4MFRA 2A8XA 2GR3A 4H7UA 4YTNA 4C74A 5KWFA 2AR8A 2RPAA 2GMHA 2YVJA 3CNJA 3PUZF 5L3GB 3OPCA 3CN8A 2XYOA 4X1YE 4CRTA 1H83A 4LA1A 2E9XA 1XHZA 4EEDA 3M13A 4H9NC 4TX5A 3R84B 1KNZA 3UTGA 3RF1A 4H4SA 5LG4A 1GOSA 4D04A 4JNQA 3AYIA 2CWOA 3BI5A 2D5UA 3T2ZA 1VBD4 3ABVA 1E1LA 3GYXA 3DK8A 2O9ZA 3HKEE 4A7AA 2XSBA 1T98A 1LPFA 2Q7VA 2XAJB 5LBQB 4U8IA 1D7LA 2VVSA 4U74A 2RGHA 1ZP0A 5HYMA 4Y4MA 3N9QA 4JI7T 2EHOD 3CTYA 1OJCA 3UOVA 4NXNT 4FK1A 2OLTA 2WMOA 3CQCB 2E1MA 3CPIG 1SE7A 5ABGA 5L47A 2VVLG 5DQVA 1IUUA 4O4LE 4LF9T 2IVDA 1NHQA 2C5KT 3B6DA 5ADXL 2JQKA 2WDRA 3ZSTA 2UXCT 5FS8A 4UR9A 3UKPA 3Q5EA 1WRDA 1EL5A 1JRZA 2OLNA 4NIQA 1K0LA 4EEBA 4E0VA 1COV4 1CHUA 2I0MA 4PW8A 4KBMB 2BKPA 4GKKT 5HWXA 3PUVF 4ZCCA 3AVRA 5J7XA 4YWOA 1SA0E 4AT2A 3ADAB 5FY1A 3CK6A 3EHZA 4I43B 3KDSE 2ACZA 5JDHA 3T8OA 3LZWA 3P50A 2JQQA 2WDQA 3JADA 1B5QA 2EHOA 2CEAA 4YTMA 1IBLT 1HNWT 5JCNA 1REOA 3ETVA 3IHMA 2KINB 2CBJA 4ASKA 5KMPA 2VRLA 4X4JA 2LJLA 3AEAA 4ZS3A 1WYBA 3WI3A 2R0CA 3WE0A 1QLBA 2WBAA 5LHIB 1B8SA 2PFVA 1DJNA 4CXYA 1V9DA 4IA5A 4HGAA 3CX6B 5AQVB 2XLUA 3L09A 2V7JA 4X66T 3K1SA 5HCMA 3BNUA 1E1KA 3F8RA 3AA0B 3DJDA 3AEFA 3PE0A 1OJ9A 1EL7A 2WZIA 4YT0A 5ABEA 4ICYA 4CY8A 4IDQA 2XQYA 3PVCA 3UUBA 3ONLC 3UFGA 3UUMA 2BG9B 2RMU4 2W62A 4HFVA 2AQJA 2W0HA 3HKBE 4Y4LA 4H9RC 2N9DA 2XTLA 1X9BA 3BI4A 3FBLA 3PV0F 2XVJA 3AD7B 3E1TA 3KV9A 2CWYA 1NAFA 3J7Yq 4DUZT 3K3QC 4K5SA 2AXDS 2DCFA 4TM1A 3AECA 4GR1A 1GALA 3K7QX 2WP6A 4A6NB 3T1YT 3PUGA 2W66A 3UOXA 3LG7A 4NUVA 4QH1A 4DMVA 4IT4A 1JEHA 4U7IA 3DH9A 1GSNA 3FG2P 2XQ6A 4DNAA 1NWMX 3MKDA 2YG6A 3BI2A 5EB5A 2M6IA 5HCJA 4QWNB 3ZYLA 1R8IA 4A79A 3P4RA 4AQFC 2XM2A 4DV5T 3CNPA 4DVDA 1TRBA 1BR2A 2LM2A 3ANWA 4Q4V4 3RYHE 3VRAA 2ZMAA 2CVJA 2NTYA 4HFBA 5JVDE 4A99A 4AOSA 5U1OA 1E2AA 3ZLIA 2EQ8A 1MMDA 1MIWA 3PU8A 2MOZA 5M0ZA 3PUXF 2A72A 3GWDA 3ONJA 2UUAT 4ADZA 3LK3B 4X62T 3AE8A 5LG3A 3QJ4A 4HKAA 3RHWA 1PJ7A 1ZOVA 5JCLA 5EBKA 3UOZA 5FMHA 4EMIA 2X0LB 1GEUA 5FVLA 2K9AA 4HFIA 1H82A 1MNDA 1PXAA 4JI1T 3UT5E 4GIWA 1S3BA 3V3OA 1GTEA 3AXJA 3BQKA 3P9UA 3PJAA 4LMLA 5HWYA 3NNEA 4MBQA 3DGHA 3W15B 2KLQA 3RKGA 3AEEA 1HR0T 3ATRA 5FXVA 3SZWA 1PBEA 2WBLA 2JK6A 5FL1A 2JB3A 1PBBA 2WPFA 5JCMA 1HG2A 3AA1B 1BZLA 3KD9A 3E22E 3H8IA 3N9OA 2RGOA 4EYYR 2KMFA 2C76A 2P9BA 5LNKA
chains in the Genus database with same CATH topology
3KPKA 3H8LA 1TDOA 1JRXA 1H7WA 2OAMA 3UOYA 3CNSA 2YLRA 3F8DA 1NPXA 3UCLA 4OPLA 2R4JA 2YR4A 2C3CA 3NHOX 2VVMA 3L1RA 4J34A 2APGA 2XFOA 2YG4A 2NPXA 4JQ9A 3GRTA 3QVRA 2X99A 2B9YA 2CULA 4G74A 1ZK7A 1O95A 2R46A 3DK4A 3SY4A 3T2KA 5ER0A 1DXLA 4GAVA 5M10A 3COXA 4FDCB 1JNZA 4GRTA 4UP3A 2HQMA 1CJCA 4U8LA 1FOHA 2RABA 3VRDB 1N4WA 3AE5A 4B65A 2YLZA 2BA9A 4U8OA 1RP0A 2XFUA 2BABA 1GRBA 1V59A 1YY5A 4EMWA 2C67A 4AP3A 1EL9A 4RG4A 1H6VA 2B9XA 3ZDNA 3LZXA 4JDRA 3CIRA 1DOBA 3Q6JA 4B68A 2CDUA 4EIQA 4G9KA 1XPQA 4H4YA 4BK1A 4NTEA 1K0IA 2BRYA 2R0PA 5BVAA 4A5LA 3LXDA 4J56A 3NRNA 5BUKA 3AE2A 1BWCA 3GDPA 4C5OA 2CFYA 3AE9A 1L0VA 2XVHA 2WEUA 3P4PA 2ZZ0A 2DKIA 3NIXA 2Q0LA 3RP6A 2GB0A 4A6NA 1FEAA 4GDPA 1DOEA 4EQXA 2YAUA 1GTHA 4IVOB 2IVEA 3RHAA 1RYIA 2XLRA 2YR5A 1ZMCA 4G6HA 1YQZA 1TDFA 4N9XA 4EM3A 1N1PA 1OJTA 1COYA 3KA7A 2ZZCA 4IV9A 2OA1A 2EQ6A 4YKFA 5U63A 4OPUA 4OPTA 4J2WA 2X8HA 1M64A 1NDAA 1PN0A 2PYXA 4H4UA 4NNJA 5J60A 2WOVA 3HYWA 5DBJA 2BCGG 1IUVA 3GWFA 3NYEA 3SZ0A 3DMEA 4H2NA 1YQ4A 4IVMB 4RSLA 5TR3A 4B1BA 4BK3A 1FEBA 2WPEA 5BRTA 5FS9A 3ICRA 2JAEA 2E5VA 3LOVA 3ZYXA 1H84A 4U8JA 1Z6LA 2GVCA 4OCGA 4CNKA 3ALJA 3QSSA 4TM4A 3UP5A 4BJZA 4OPDA 4B67A 2V3BA 4WCTA 2FJDA 4TM3A 4U2SA 2OALA 4B69A 4ADWA 3REDA 4O5QA 3CMMA 4NTDA 3VR8A 1KSUA 3AD8B 3AE7A 3DJJA 4EMJA 4YKGA 2C73A 1Q9IA 1H86A 2WQYA 1BGJA 4MJWA 5KVIA 1N4VA 5U25A 3SXIA 4YSHA 1CF3A 1L9CA 3B3RA 2C7GA 3T31A 1GREA 1JNRA 1D4EA 4DSHA 3P1WA 4B66A 4EQRA 2OLOA 3CGBA 1FL2A 1GESA 1JOAA 2WDVA 3SFDA 3IWAA 1YKJA 4EQSA 5KMQA 3SQPA 1DOCA 2C70A 2ZZBA 4GDEA 4X9NA 1GT8A 3GQKA 4NEWA 4U8NA 2BYBA 3NYFA 4OVIA 4JNAA 2VQBA 1MOKA 2C64A 3AXBA 4AP1A 5EOWA 2A87A 2R9ZA 1FCDA 3V76A 2I0ZA 4K22A 2V61A 5C3JA 1PBCA 2F5ZA 3AE3A 3L8KA 3AE6A 4YSYA 3GDNA 3M12A 4JY2A 1TYPA 2R4EA 3K30A 2GF3A 2X8GA 3SZCA 2GH5A 2B7RA 2XVFA 3IHGA 4DSGA 1QJDA 4U2LA 2GQFA 2VOUA 2BCPA 4D03A 2UZZA 2B76A 1TDKA 5KRQA 3ATQA 1KNPA 1MO9A 3HYVA 3KVEA 1OJAA 1XHCA 1OJDA 1XDIA 2VRMA 2YLSA 4UDRA 2AAQA 3UKHA 4NEVA 4II2A 3S5WA 3NTDA 1D7YA 1Y56B 4IA6A 2ZBWA 1N4UA 2YLTA 4C3YA 2BXSA 2C72A 4II3A 2GR3A 2A8XA 3BHFA 4H50A 4H7UA 4XWRA 1TDEA 3UP4A 1AOGA 4YTNA 4AT0A 1GXFA 2V3AA 3D8XA 3EAOA 4C74A 5KWFA 2AR8A 1GNDA 2ARDA 2YWLA 5IPYA 3P4QA 1H7XA 2GMHA 2YVJA 3BHKA 4H4TA 1ZOYA 3CGCA 3CNJA 4H4VA 5FS6A 4ZCDA 3SX6A 3CN8A 2GEWA 4CCRA 2XYOA 4CRTA 4NWZA 1H83A 3ISHA 3C4NA 4H4XA 4I59A 3UKAA 4LA1A 1CJ2A 3GRSA 1LJ1A 4O5UA 3ICSA 2WU5A 3M13A 4KX6A 4WX1A 1FECA 1CC6A 3UTGA 2YLWA 3C96A 3JSKA 1LTXR 4CNJA 4BV6A 3KLJA 4H4SA 4G6GA 1GOSA 4ECHA 2H89A 3RNMA 4D04A 2FJEA 3GD3A 1GRFA 4JNQA 3AYIA 3RP7A 3CGEA 3S61A 1VRQB 3NK1X 1UKVG 3BI5A 3T2ZA 1TYTA 3H4KA 4XWZA 3ABVA 2JB2A 1E1LA 3GYXA 3DK8A 2O9ZA 2Q0KA 4A7AA 4Z44A 3VRBA 1LPFA 4H4QA 3T14A 2Q7VA 3KKJA 4U8IA 1D7LA 4OPGA 2NVKX 2RGHA 3NK2X 1ZP0A 5CQFA 1YQ3A 2YM2A 1IUWA 1HYUA 4LIIA 4Y4MA 5BULA 2GAGB 3NK0X 1GRTA 5GRTA 5HYMA 2LFCA 4J57A 2XVEA 4TLXA 4USRA 1L9DA 4K7ZA 3CTYA 3GYJA 3UTHA 4EIPA 2J3NA 4NTCA 3SZFA 1VG9A 1OJCA 2GV8A 2QAEA 4Z43A 4DGKA 1ONFA 1LV0A 1B4VA 1Q1RA 1PJ6A 3FBSA 3O0HA 3UOVA 4FK1A 3UKQA 2BS2A 1PXBA 2E1MA 1F3PA 3CPIG 1S2YA 2QA2A 2VVLG 1PBFA 1BF3A 2GAHB 2Z5YA 1IUUA 3M0OA 1E39A 2IIDA 5KXJA 2IVDA 1NHQA 2Y6QA 1X31B 3AYJA 3G5SA 3B6DA 2WP9A 2BXRA 3SM8A 1M6IA 2Q6UA 2XLPA 2XFQA 5GSNA 2WDRA 3AE1A 2WU2A 1EBDA 3AWIA 4KPRA 1DJQA 3ITJA 5FS8A 5JCIA 2Y6RA 5LV9A 2YM1A 3UKPA 4U2TA 1EL5A 1LVLA 2YG5A 3K7TA 1JRZA 2OLNA 3NKSA 1IUSA 1KFYA 1D4DA 1K0LA 4E0VA 3FIMB 4Z24A 1CHUA 2BK5A 1IUXA 4JY3A 1L9EA 4FX9A 4EM4A 3UKFA 3AE4A 1IUTA 4X9MA 4Z2UA 1CC2A 4BJYA 3R9UA 4HA6A 1KNRA 2R45A 4BK2A 4ZCCA 2TMDA 3SFEA 2DKHA 3CGDA 3UKKA 2XFNA 3NN6X 5J7XA 4H2PA 4B64A 4EQWA 5HXIA 2GMJA 2V60A 4YWOA 4AT2A 5EB4A 3ADAB 4GAPA 3UTEA 3CPJG 2GRTA 3ICTA 2BC0A 3CNTA 3AEGA 2GR2A 2R0GA 2ACZA 3IC9A 2B9WA 1NG4A 3LZWA 1GRGA 4AOXA 2WDQA 2XFPA 4GCMA 4Z26A 1ZDLA 3ALLA 3G5QA 3QSEA 1B5QA 2QCUA 2V5ZA 5HY5A 4YTMA 5JCNA 1JRYA 1REOA 1VG0A 2B7SA 2WOIA 1GERA 5HHFA 3IHMA 4GUVA 4Y4NA 3GQHA 5KMPA 1JU2A 4REKA 2VRLA 3HZLA 4X4JA 3UTFA 3AEAA 1VDCA 1GPEA 1Q1WA 2EQ7A 1F8SA 2XVIA 4K8DA 3I3LA 3K7MX 1DNCA 4RG3A 2R0CA 3QFBA 2A89A 3AYLA 3WE0A 1QLBA 4A9WA 1GV4A 2WBAA 1B8SA 1DJNA 2YLXA 1GRHA 3OZ2A 4IA5A 4J33A 3KPFA 1B37A 1E1MA 2XLUA 4XXGA 5FS7A 3BNUA 3F8RA 4J36A 1E1KA 1DODA 3DJDA 3AEFA 1OJ9A 3LB8A 1EL7A 4U8MA 1CL0A 4YT0A 1NHSA 1VQWA 1Y56A 1EL8A 3D1CA 1S2QA 4ICYA 4LU6A 4CY8A 4Z25A 5KMRA 2WESA 5C2TA 3PVCA 3P4SA 2WS3A 3AEDA 1RSGA 2JB1A 2VZ2A 3OC4A 3RP8A 5KVHA 2X50A 4FK1C 4B63A 5IQ1A 4ZN0A 5KMSA 2AQJA 3FPZA 2W0HA 4NZHA 5KOWA 3T37A 2BACA 3FMWA 1LQUA 2FBWA 1E1NA 3NT6A 4Y4LA 2RGJA 1K0JA 3VQRA 1NG3A 3C4AA 3BI4A 2VQ7A 1PDHA 4H4PA 1K4QA 3NH3X 4H4RA 3G5RA 3DJGX 2XVJA 3AD7B 1KDGA 4GF7A 3CPHG 3GSIA 5L46A 3E1TA 3KU9A 1PJ5A 4YSXA 2C66A 2YG3A 4PABA 1W4XA 2GR0A 4BURA 3GYIA 2C65A 4K5SA 4TM1A 1BKWA 3AECA 4GR1A 1GALA 1O94A 1D4CA 2H88A 4OPCA 3K7QX 1P2EA 2BK3A 2WP6A 1D5TA 4CBQA 3ALMA 4A6NB 3EF6A 2X3NA 3CNDA 1MXTA 2BC1A 3UOXA 2V6OA 3LADA 4TLZA 1JEHA 2BRAA 2YR6A 4U8KA 2X8CA 4APNA 2GR1A 3PO7A 3AB1A 3DH9A 1GSNA 3FG2P 2YG7A 4H4ZA 1NENA 4DNAA 2FJBA 3NN0X 5KNLA 2YG6A 3BI2A 3VR9A 4YSZA 1LQTA 5EB5A 4CCQA 2JKCA 1NEKA 4A79A 2XLSA 2YVGA 4YXDA 3P4RA 1GETA 2Z5XA 1F6MA 3CNPA 1PXCA 1TRBA 4G73A 2WETA 4OPIA 3V3NA 1NHPA 3VRAA 2CVJA 2EQ9A 2BK4A 2QA1A 4M52A 3DK9A 2C4CA 4A99A 4AOSA 4K5RA 5IQ4A 1PHHA 1S3EA 4H4WA 3DA1A 3HYXA 4UDQA 5U1OA 2EQ8A 2WP5A 3T0KA 3GMCA 3T2YA 3SUCA 1TDNA 1KF6A 5M0ZA 4Z2RA 3BNMA 1CC4A 2WOWA 4HB9A 2BS4A 2E4GA 3GWDA 2YVFA 3EPTA 4H2QA 1SEZA 3LJPA 1BGNA 3F8PA 1CJ4A 3AE8A 1E6EA 2WPCA 1P2HA 4C77A 4I58A 3DJEA 1PJ7A 3QJ4A 1ZOVA 2C3DA 5JCLA 3SYIA 4H2RA 1CBOA 5EBKA 3NYCA 3UOZA 5KOXA 1ZX9A 5FMHA 2YQUA 1F8WA 4EMIA 3PS9A 1GEUA 1ZMDA 3NTAA 2C75A 1H82A 4J31A 3DGZA 4YTPA 1H81A 1PXAA 3UKLA 1S3BA 3V3OA 1GTEA 3SGLA 3NGCX 3P9UA 4CY6A 3EANA 3IF9A 3NNEA 4U8PA 1KSSA 3NG7X 1E7PA 3DGHA 4JN9A 3AD9B 1ZY8A 2PHHA 2TPRA 3AEEA 3GD4A 1ZKQA 4C3XA 2XCGA 3ATRA 3URHA 3SZWA 1Y0PA 1F8RA 4A65A 1NHRA 1PBEA 3II4A 1NAAA 2JK6A 4USQA 3GMBA 5JCKA 1GRAA 1IJHA 4Z2TA 3I6DA 1ELIA 4TM0A 2WHDA 2JB3A 1QO8A 1PBBA 2WPFA 3AEBA 3QFAA 1CJ3A 5JCMA 4PAAA 1PBDA 3QSMA 5CKUA 1BZLA 3KD9A 2JBVA 3H8IA 1O5WA 3QVPA 2RGOA 2FJAA 4K2XA 2VVLA 3Q9TA 2C76A 4P9SA 1XANA 3NLCA 2XLTA 2GQWA 4UDPA 2BS3A 2XDOA 1PS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8L A;  1TDO A;  1JRX A;  1H7W A;  2OAM A;  3UOY A;  3CNS A;  2YLR A;  3F8D A;  1NPX A;  3UCL A;  4OPL A;  2R4J A;  2YR4 A;  2C3C A;  3NHO X;  2VVM A;  3L1R A;  4J34 A;  2APG A;  2XFO A;  2YG4 A;  2NPX A;  4JQ9 A;  3GRT A;  3QVR A;  2X99 A;  2B9Y A;  2CUL A;  1ZK7 A;  1O95 A;  2R46 A;  3DK4 A;  5ER0 A;  1DXL A;  5M10 A;  3COX A;  4FDC B;  1JNZ A;  4GRT A;  4UP3 A;  2HQM A;  1CJC A;  4U8L A;  1FOH A;  2RAB A;  3VRD B;  1N4W A;  3AE5 A;  4B65 A;  2YLZ A;  2BA9 A;  4U8O A;  1RP0 A;  2XFU A;  2BAB A;  1GRB A;  1V59 A;  1YY5 A;  4EMW A;  2C67 A;  4AP3 A;  1EL9 A;  4RG4 A;  1H6V A;  2B9X A;  3ZDN A;  3LZX A;  4JDR A;  3CIR A;  1DOB A;  3Q6J A;  4B68 A;  2CDU A;  4EIQ A;  1XPQ A;  4H4Y A;  4BK1 A;  4NTE A;  1K0I A;  2R0P A;  5BVA A;  4A5L A;  3LXD A;  4J56 A;  3NRN A;  5BUK A;  3AE2 A;  1BWC A;  3GDP A;  4C5O A;  2CFY A;  3AE9 A;  1L0V A;  2XVH A;  2WEU A;  3P4P A;  2ZZ0 A;  2DKI A;  3NIX A;  2Q0L A;  3RP6 A;  2GB0 A;  4A6N A;  1FEA A;  4GDP A;  1DOE A;  4EQX A;  2YAU A;  1GTH A;  4IVO B;  2IVE A;  3RHA A;  1RYI A;  2XLR A;  2YR5 A;  1ZMC A;  1YQZ A;  1TDF A;  4N9X A;  4EM3 A;  1N1P A;  1OJT A;  1COY A;  3KA7 A;  2ZZC A;  4IV9 A;  2OA1 A;  2EQ6 A;  4YKF A;  5U63 A;  4OPU A;  4OPT A;  4J2W A;  2X8H A;  1M64 A;  1NDA A;  1PN0 A;  2PYX A;  4H4U A;  5J60 A;  2WOV A;  5DBJ A;  2BCG G;  1IUV A;  3GWF A;  3NYE A;  3DME A;  4H2N A;  1YQ4 A;  4IVM B;  4RSL A;  5TR3 A;  4B1B A;  4BK3 A;  1FEB A;  2WPE A;  5BRT A;  5FS9 A;  3ICR A;  2JAE A;  2E5V A;  3LOV A;  3ZYX A;  1H84 A;  4U8J A;  1Z6L A;  2GVC A;  4OCG A;  4CNK A;  3ALJ A;  3QSS A;  4TM4 A;  3UP5 A;  4BJZ A;  4OPD A;  4B67 A;  2V3B A;  4WCT A;  2FJD A;  4TM3 A;  4U2S A;  2OAL A;  4B69 A;  4ADW A;  3RED A;  4O5Q A;  4NTD A;  3VR8 A;  1KSU A;  3AD8 B;  3AE7 A;  3DJJ A;  4EMJ A;  4YKG A;  2C73 A;  1Q9I A;  1H86 A;  2WQY A;  1BGJ A;  4MJW A;  5KVI A;  1N4V A;  5U25 A;  4YSH A;  1CF3 A;  1L9C A;  3B3R A;  2C7G A;  1GRE A;  1JNR A;  1D4E A;  4DSH A;  3P1W A;  4B66 A;  4EQR A;  2OLO A;  3CGB A;  1FL2 A;  1GES A;  1JOA A;  2WDV A;  3SFD A;  3IWA A;  1YKJ A;  4EQS A;  3SQP A;  1DOC A;  2C70 A;  2ZZB A;  4GDE A;  4X9N A;  1GT8 A;  4NEW A;  4U8N A;  2BYB A;  3NYF A;  4OVI A;  4JNA A;  2VQB A;  1MOK A;  2C64 A;  3AXB A;  4AP1 A;  5EOW A;  2A87 A;  2R9Z A;  1FCD A;  3V76 A;  2I0Z A;  4K22 A;  2V61 A;  5C3J A;  1PBC A;  2F5Z A;  3AE3 A;  3L8K A;  3AE6 A;  4YSY A;  3GDN A;  3M12 A;  4JY2 A;  1TYP A;  2R4E A;  3K30 A;  2GF3 A;  2X8G A;  2GH5 A;  2B7R A;  2XVF A;  3IHG A;  4DSG A;  1QJD A;  4U2L A;  2GQF A;  2VOU A;  2BCP A;  4D03 A;  2UZZ A;  2B76 A;  1TDK A;  5KRQ A;  3ATQ A;  1KNP A;  1MO9 A;  3KVE A;  1OJA A;  1XHC A;  1OJD A;  1XDI A;  2VRM A;  2YLS A;  4UDR A;  2AAQ A;  3UKH A;  4NEV A;  3S5W A;  3NTD A;  1D7Y A;  1Y56 B;  4IA6 A;  2ZBW A;  1N4U A;  2YLT A;  4C3Y A;  2BXS A;  2C72 A;  2GR3 A;  2A8X A;  3BHF A;  4H50 A;  4H7U A;  4XWR A;  1TDE A;  3UP4 A;  1AOG A;  4YTN A;  4AT0 A;  1GXF A;  2V3A A;  3D8X A;  3EAO A;  4C74 A;  5KWF A;  2AR8 A;  1GND A;  2ARD A;  2YWL A;  5IPY A;  3P4Q A;  1H7X A;  2GMH A;  2YVJ A;  3BHK A;  4H4T A;  1ZOY A;  3CGC A;  3CNJ A;  4H4V A;  5FS6 A;  4ZCD A;  3CN8 A;  2GEW A;  4CCR A;  2XYO A;  4CRT A;  1H83 A;  3ISH A;  3C4N A;  4H4X A;  4I59 A;  3UKA A;  4LA1 A;  1CJ2 A;  3GRS A;  1LJ1 A;  4O5U A;  3ICS A;  2WU5 A;  3M13 A;  4KX6 A;  4WX1 A;  1FEC A;  1CC6 A;  3UTG A;  2YLW A;  3C96 A;  3JSK A;  1LTX R;  4CNJ A;  4BV6 A;  3KLJ A;  4H4S A;  1GOS A;  4ECH A;  2H89 A;  3RNM A;  4D04 A;  2FJE A;  3GD3 A;  1GRF A;  4JNQ A;  3AYI A;  3RP7 A;  3CGE A;  3S61 A;  1VRQ B;  3NK1 X;  1UKV G;  3BI5 A;  1TYT A;  3H4K A;  4XWZ A;  3ABV A;  2JB2 A;  1E1L A;  3GYX A;  3DK8 A;  2O9Z A;  2Q0K A;  4A7A A;  4Z44 A;  3VRB A;  1LPF A;  4H4Q A;  2Q7V A;  3KKJ A;  4U8I A;  1D7L A;  4OPG A;  2NVK X;  2RGH A;  3NK2 X;  1ZP0 A;  5CQF A;  1YQ3 A;  2YM2 A;  1IUW A;  1HYU A;  4LII A;  4Y4M A;  5BUL A;  2GAG B;  3NK0 X;  1GRT A;  5GRT A;  5HYM A;  2LFC A;  4J57 A;  2XVE A;  4TLX A;  4USR A;  1L9D A;  4K7Z A;  3CTY A;  3GYJ A;  3UTH A;  4EIP A;  2J3N A;  4NTC A;  1VG9 A;  1OJC A;  2GV8 A;  2QAE A;  4Z43 A;  4DGK A;  1ONF A;  1LV0 A;  1B4V A;  1Q1R A;  1PJ6 A;  3FBS A;  3O0H A;  3UOV A;  4FK1 A;  3UKQ A;  2BS2 A;  1PXB A;  2E1M A;  1F3P A;  3CPI G;  1S2Y A;  2QA2 A;  2VVL G;  1PBF A;  1BF3 A;  2GAH B;  2Z5Y A;  1IUU A;  3M0O A;  1E39 A;  2IID A;  5KXJ A;  2IVD A;  1NHQ A;  2Y6Q A;  1X31 B;  3AYJ A;  3G5S A;  3B6D A;  2WP9 A;  2BXR A;  3SM8 A;  1M6I A;  2Q6U A;  2XLP A;  2XFQ A;  5GSN A;  2WDR A;  3AE1 A;  2WU2 A;  1EBD A;  3AWI A;  4KPR A;  1DJQ A;  3ITJ A;  5FS8 A;  5JCI A;  2Y6R A;  5LV9 A;  2YM1 A;  3UKP A;  4U2T A;  1EL5 A;  1LVL A;  2YG5 A;  3K7T A;  1JRZ A;  2OLN A;  3NKS A;  1IUS A;  1KFY A;  1D4D A;  1K0L A;  4E0V A;  3FIM B;  4Z24 A;  1CHU A;  2BK5 A;  1IUX A;  4JY3 A;  1L9E A;  4FX9 A;  4EM4 A;  3UKF A;  3AE4 A;  1IUT A;  4X9M A;  4Z2U A;  1CC2 A;  4BJY A;  3R9U A;  4HA6 A;  1KNR A;  2R45 A;  4BK2 A;  4ZCC A;  2TMD A;  3SFE A;  2DKH A;  3CGD A;  3UKK A;  2XFN A;  3NN6 X;  5J7X A;  4H2P A;  4B64 A;  4EQW A;  5HXI A;  2GMJ A;  2V60 A;  4YWO A;  4AT2 A;  5EB4 A;  3ADA B;  3UTE A;  3CPJ G;  2GRT A;  3ICT A;  2BC0 A;  3CNT A;  3AEG A;  2GR2 A;  2R0G A;  2ACZ A;  3IC9 A;  2B9W A;  1NG4 A;  3LZW A;  1GRG A;  4AOX A;  2WDQ A;  2XFP A;  4GCM A;  4Z26 A;  1ZDL A;  3ALL A;  3G5Q A;  3QSE A;  1B5Q A;  2QCU A;  2V5Z A;  5HY5 A;  4YTM A;  5JCN A;  1JRY A;  1REO A;  1VG0 A;  2B7S A;  2WOI A;  1GER A;  5HHF A;  3IHM A;  4GUV A;  4Y4N A;  3GQH A;  1JU2 A;  4REK A;  2VRL A;  3HZL A;  4X4J A;  3UTF A;  3AEA A;  1VDC A;  1GPE A;  1Q1W A;  2EQ7 A;  1F8S A;  2XVI A;  4K8D A;  3I3L A;  3K7M X;  1DNC A;  4RG3 A;  2R0C A;  3QFB A;  2A89 A;  3AYL A;  3WE0 A;  1QLB A;  4A9W A;  1GV4 A;  2WBA A;  1B8S A;  1DJN A;  2YLX A;  1GRH A;  3OZ2 A;  4IA5 A;  4J33 A;  3KPF A;  1B37 A;  1E1M A;  2XLU A;  4XXG A;  5FS7 A;  3BNU A;  3F8R A;  4J36 A;  1E1K A;  1DOD A;  3DJD A;  3AEF A;  1OJ9 A;  3LB8 A;  1EL7 A;  4U8M A;  1CL0 A;  4YT0 A;  1NHS A;  1VQW A;  1Y56 A;  1EL8 A;  3D1C A;  1S2Q A;  4ICY A;  4LU6 A;  4CY8 A;  4Z25 A;  2WES A;  5C2T A;  3PVC A;  3P4S A;  2WS3 A;  3AED A;  1RSG A;  2JB1 A;  2VZ2 A;  3OC4 A;  3RP8 A;  5KVH A;  2X50 A;  4FK1 C;  4B63 A;  5IQ1 A;  4ZN0 A;  2AQJ A;  3FPZ A;  2W0H A;  4NZH A;  5KOW A;  3T37 A;  2BAC A;  3FMW A;  1LQU A;  2FBW A;  1E1N A;  3NT6 A;  4Y4L A;  2RGJ A;  1K0J A;  3VQR A;  1NG3 A;  3C4A A;  3BI4 A;  2VQ7 A;  1PDH A;  4H4P A;  1K4Q A;  3NH3 X;  4H4R A;  3G5R A;  3DJG X;  2XVJ A;  3AD7 B;  1KDG A;  4GF7 A;  3CPH G;  3GSI A;  5L46 A;  3E1T A;  3KU9 A;  1PJ5 A;  4YSX A;  2C66 A;  2YG3 A;  4PAB A;  1W4X A;  2GR0 A;  4BUR A;  3GYI A;  2C65 A;  4K5S A;  4TM1 A;  1BKW A;  3AEC A;  4GR1 A;  1GAL A;  1O94 A;  1D4C A;  2H88 A;  4OPC A;  3K7Q X;  1P2E A;  2BK3 A;  2WP6 A;  1D5T A;  4CBQ A;  3ALM A;  4A6N B;  3EF6 A;  2X3N A;  3CND A;  1MXT A;  2BC1 A;  3UOX A;  2V6O A;  3LAD A;  4TLZ A;  1JEH A;  2YR6 A;  4U8K A;  2X8C A;  4APN A;  2GR1 A;  3PO7 A;  3AB1 A;  3DH9 A;  1GSN A;  3FG2 P;  2YG7 A;  4H4Z A;  1NEN A;  4DNA A;  2FJB A;  3NN0 X;  2YG6 A;  3BI2 A;  3VR9 A;  4YSZ A;  1LQT A;  5EB5 A;  4CCQ A;  2JKC A;  1NEK A;  4A79 A;  2XLS A;  2YVG A;  4YXD A;  3P4R A;  1GET A;  2Z5X A;  1F6M A;  3CNP A;  1PXC A;  1TRB A;  2WET A;  4OPI A;  3V3N A;  1NHP A;  3VRA A;  2CVJ A;  2EQ9 A;  2BK4 A;  2QA1 A;  4M52 A;  3DK9 A;  4A99 A;  4AOS A;  4K5R A;  5IQ4 A;  1PHH A;  1S3E A;  4H4W A;  3DA1 A;  4UDQ A;  5U1O A;  3GQK A;  2EQ8 A;  2WP5 A;  3GMC A;  3SUC A;  1TDN A;  1KF6 A;  5M0Z A;  4Z2R A;  3BNM A;  1CC4 A;  2WOW A;  4HB9 A;  2BS4 A;  2E4G A;  3GWD A;  2YVF A;  3EPT A;  4H2Q A;  1SEZ A;  3LJP A;  1BGN A;  3F8P A;  1CJ4 A;  3AE8 A;  1E6E A;  2WPC A;  1P2H A;  4C77 A;  4I58 A;  3DJE A;  1PJ7 A;  3QJ4 A;  1ZOV A;  2C3D A;  5JCL A;  4H2R A;  1CBO A;  5EBK A;  3NYC A;  3UOZ A;  5KOX A;  1ZX9 A;  5FMH A;  2YQU A;  1F8W A;  4EMI A;  3PS9 A;  1GEU A;  1ZMD A;  3NTA A;  2C75 A;  1H82 A;  4J31 A;  3DGZ A;  4YTP A;  1H81 A;  1PXA A;  3UKL A;  1S3B A;  3V3O A;  1GTE A;  3SGL A;  3NGC X;  3P9U A;  4CY6 A;  3EAN A;  3IF9 A;  3NNE A;  4U8P A;  1KSS A;  3NG7 X;  1E7P A;  3DGH A;  4JN9 A;  3AD9 B;  1ZY8 A;  2PHH A;  2TPR A;  3AEE A;  3GD4 A;  1ZKQ A;  4C3X A;  2XCG A;  3ATR A;  3URH A;  1Y0P A;  1F8R A;  4A65 A;  1NHR A;  1PBE A;  3II4 A;  1NAA A;  2JK6 A;  4USQ A;  3GMB A;  5JCK A;  1GRA A;  1IJH A;  4Z2T A;  3I6D A;  1ELI A;  4TM0 A;  2WHD A;  2JB3 A;  1QO8 A;  1PBB A;  2WPF A;  3AEB A;  3QFA A;  1CJ3 A;  5JCM A;  4PAA A;  1PBD A;  3QSM A;  5CKU A;  1BZL A;  3KD9 A;  2JBV A;  3H8I A;  1O5W A;  3QVP A;  2RGO A;  2FJA A;  4K2X A;  2VVL A;  3Q9T A;  2C76 A;  4P9S A;  1XAN A;  3NLC A;  2XLT A;  2GQW A;  4UDP A;  2BS3 A;  2XDO A;  1PS9 A; 
#chains in the Genus database with same CATH topology
 3K8P C;  4KHZ F;  2OAM A;  5EK3 A;  1VRH 4;  2YR4 A;  2XM1 A;  2VVM A;  3L1R A;  2YG4 A;  3QVR A;  3ZCJ A;  3CX7 B;  3SY4 A;  2XPK A;  1Z7S 4;  2CBI A;  2BDE A;  4GRT A;  3PU3 A;  1CJC A;  4U8L A;  2G0U A;  1AJ3 A;  5AQO B;  2RAB A;  1N4W A;  2C5J A;  2XFU A;  4EMW A;  1YY5 A;  2C67 A;  1M7K A;  1H6V A;  3ZDN A;  4JDR A;  2W00 A;  3CIR A;  3RGL A;  3GMI A;  1XPQ A;  1EZ3 A;  4H4Y A;  4BK1 A;  4PJL A;  2RS3 4;  5BUK A;  4EV6 A;  3C4Z A;  1OED E;  2CFY A;  2PBI A;  1L0V A;  1RUF 4;  2NTX A;  2ZZ0 A;  3RP6 A;  2GB0 A;  1FEA A;  4IVO B;  2JQH A;  3QC9 A;  2IVE A;  2YR5 A;  3LK4 2;  4IST A;  1D0X A;  3AA6 B;  2LM9 A;  2JPF A;  1YQZ A;  4N9X A;  5EK2 A;  4GYS A;  5FY7 A;  2WB5 A;  4OPU A;  1VBC 4;  4UV8 B;  3WAJ A;  2ZLY A;  2YU1 A;  1NDA A;  2WOV A;  2QA7 A;  2WPE A;  2V6X A;  3ETU A;  3ZYX A;  4U8J A;  1AR9 4;  2GVC A;  4CNK A;  4TM4 A;  2UXX B;  4B67 A;  2NWB A;  2V26 A;  3UQ7 A;  2KWI B;  3RED A;  4BJN A;  3AD8 B;  4EMJ A;  4H63 H;  4YLH A;  5KVI A;  2LEH A;  4KHP T;  2HHH T;  2C7G A;  1GRE A;  1D4E A;  3BQL A;  3FBZ A;  3T31 A;  4DSH A;  4DV7 T;  1W9R A;  4B66 A;  1FL2 A;  3OYZ A;  2K3W A;  5HYA A;  1IJ5 A;  3N5L A;  3QK6 A;  1YKJ A;  3RX6 A;  4JLE A;  4KI0 F;  1IAP A;  2R04 4;  4NEW A;  4U8N A;  5LB7 B;  3VHL A;  4LF6 T;  4JNA A;  3FZH B;  2K5B B;  5J2U E;  2KND A;  2E8I A;  5EOW A;  2R9Z A;  1R09 4;  1PBC A;  4WBO A;  3GDN A;  2YU2 A;  2X8G A;  3SZC A;  2B7R A;  3IHG A;  3RIA A;  2LSJ A;  2VOU A;  2BCP A;  4D03 A;  3HR0 A;  4H63 V;  2B76 A;  4I55 E;  4OK0 A;  5ABH A;  2R7F A;  3RYI E;  1XDI A;  5IUX A;  1PO2 4;  1E1H B;  2XQ3 A;  1D7Y A;  2D0U A;  4C3Y A;  3UUX B;  3F2E A;  5FMN A;  5M4Y A;  5DJQ C;  3BHF A;  1TDE A;  3D8X A;  3G06 A;  2ARD A;  5FS6 A;  4PK6 A;  3CGC A;  3SX6 A;  4AKH A;  4IHJ E;  3ZEF B;  4NWZ A;  3ISH A;  3C4N A;  4ZOL E;  4O5U A;  2UXD T;  4KX6 A;  4PFO A;  1CC6 A;  4N78 D;  2YLW A;  3JSK A;  1LTX R;  4CNJ A;  4MLK A;  4BV6 A;  3C51 A;  3KLJ A;  3PUS A;  4YHH T;  4Z91 A;  3KBT A;  4U2Z A;  3GD3 A;  4LFA T;  1VRQ B;  1UKV G;  1TYT A;  5LMN T;  1BR1 A;  4DBQ A;  4J2C A;  3PUW F;  4H4Q A;  3T14 A;  1AR8 4;  2R07 4;  3KKJ A;  5L3D B;  2BKO A;  2NVK X;  2VL0 A;  3NK2 X;  5CQF A;  2YM2 A;  4AIS A;  4CXW A;  5GRT A;  1GRT A;  2XVE A;  4USR A;  5J2T E;  1L9D A;  4K7Z A;  3UTH A;  4WNK A;  4EIP A;  5JDL A;  1VG9 A;  4YJ2 E;  4AKI A;  4Z43 A;  4DGK A;  1MMN A;  1ONF A;  2UUC T;  1B4V A;  2JMH A;  1PXB A;  5J0Z A;  3ANW B;  2QA2 A;  5FKY A;  2Z5Y A;  4PK5 A;  4HWF A;  2IID A;  2Y6Q A;  3AYJ A;  3AAA B;  4HTE A;  3RRC A;  4PDW D;  2WP9 A;  2BXR A;  4O4H E;  3SM8 A;  2WU2 A;  3AWI A;  4UEL A;  5IWA T;  4KPR A;  1DJQ A;  3ITJ A;  3MZK B;  2XQ5 A;  3FXD B;  2Y6R A;  5LV9 A;  4CN1 A;  2YM1 A;  4U2T A;  3K7T A;  2YG5 A;  3EDU A;  1HX8 A;  4Z24 A;  2BK5 A;  1L9E A;  5EZY E;  4EM4 A;  3UKF A;  1VBA 4;  5L4H A;  3AE4 A;  1IUT A;  4X9M A;  4Z2U A;  1CC2 A;  3ZYK A;  5JR9 A;  2QGS A;  5JTG A;  4BK2 A;  2DKH A;  3CGD A;  2SPC A;  5HXI A;  2V60 A;  3CPJ G;  2R6G F;  4QXC B;  1YW0 A;  3CNT A;  3AEG A;  1K5M D;  2R0G A;  3RLF F;  4QHO A;  4TWD A;  3ZMZ B;  5HAX A;  1GRG A;  4Z26 A;  2XFP A;  4IL9 A;  3QSE A;  3WAK A;  1LKX A;  1JRY A;  2LSG A;  4GUV A;  4EAH A;  4REK A;  4LMJ A;  4Z90 A;  3UTF A;  5AQL B;  1VDC A;  1GPE A;  2YDR A;  2EQ7 A;  2CMR A;  3I3L A;  4WW0 A;  3AYL A;  5JDN A;  5AQF B;  4A9W A;  2W63 A;  3H3A A;  3PDY A;  4IE0 A;  2HWC 4;  1ZHC A;  1OED C;  3HKC E;  4GOU A;  1PIV 4;  1B37 A;  1E1M A;  4XXG A;  2VUR A;  4EZ4 A;  3AA7 B;  1U4Q A;  3C64 A;  3D1C A;  4Z25 A;  1YD8 G;  2BG9 E;  5KMR A;  2WS3 A;  2JB1 A;  3OC4 A;  4B63 A;  2V5D A;  3AAI A;  4ZN0 A;  3ZCI A;  3QB5 K;  3FPZ A;  4NZH A;  5KOW A;  3FMW A;  2OV9 A;  2FBW A;  1O3X A;  2A9U A;  4M1P A;  2RGJ A;  1LRZ A;  2AE9 A;  2KT9 A;  3E0Z A;  2VQ7 A;  5JQG E;  4H4P A;  2CPT A;  5F5W A;  3IF8 B;  1XNR T;  3LBX A;  5L3F B;  3G5R A;  3K3O A;  3GSI A;  4ZZC A;  5L46 A;  2JJ9 A;  3KU9 A;  3VKH A;  4X1K E;  2GR0 A;  4UVB B;  5ABF A;  1BKW A;  2L3L A;  3ZC0 A;  1O94 A;  4MHC A;  3MA9 A;  4NPP A;  1P2E A;  4ZZB A;  2BK3 A;  2CXD A;  3B5M A;  1D5T A;  4E7S A;  1QSD A;  1YKE B;  5L3E B;  5KMG P;  2VK9 A;  3U78 A;  3LAD A;  4UIG A;  4TLZ A;  4DID B;  1LVK A;  4JUY A;  2IIU A;  2YR6 A;  1XDP A;  2YDS A;  2YG7 A;  1NEN A;  3L39 A;  4F6R C;  2CLY B;  4PFP A;  3NN0 X;  1LQT A;  1XI1 A;  2JKC A;  2XY8 B;  1NEK A;  3UU5 A;  1GET A;  3O4X E;  2Q9Q A;  5HEU A;  1F6M A;  3KV5 A;  4GB3 4;  2WET A;  3OBV E;  4X64 T;  4Q4X 4;  1HF8 A;  3DK9 A;  3FXE B;  2CRB A;  4K5R A;  5AQK B;  3GQK A;  2V6Y A;  3HYX A;  4UDQ A;  2WP5 A;  3HA4 A;  3T0K A;  3T2Y A;  3SUC A;  3NVO A;  5LOV E;  3BNM A;  2WOW A;  4HB9 A;  4UF0 A;  1SEZ A;  1P2H A;  4I58 A;  4Q4Y 4;  2LKG A;  5KOX A;  1ZX9 A;  1F8W A;  1W09 A;  1ZMD A;  3C98 B;  2V8S V;  2C75 A;  1H81 A;  3UKL A;  3PUQ A;  3EAM A;  4DR3 T;  3CQG B;  5TAO A;  2ZM6 T;  3C50 A;  4GK0 E;  3CML A;  2D9D A;  3ZT6 A;  1E7P A;  4WZX A;  1ZY8 A;  2TPR A;  1ZKQ A;  4C3X A;  2PLV 4;  2N1G A;  1RUE 4;  3OVU A;  1NHR A;  4TV9 E;  4GYR A;  3NKZ A;  2XQA A;  5L3C B;  1GRA A;  3CX8 B;  2WHD A;  4TZ4 C;  3SOL A;  3QFA A;  4ZEY A;  1RUC 4;  4JI4 T;  3TLS A;  2JBV A;  1O5W A;  1H7C A;  2FJA A;  4AKR B;  3Q9T A;  3AAE B;  4P9S A;  3NLC A;  2GQW A;  2XQ9 A;  5LHG B;  1WR0 A;  1H7W A;  2VKH A;  3CNS A;  1SHZ C;  2PW9 A;  2K48 A;  4OPL A;  2RA1 A;  3ZT5 A;  4YFS A;  5F8P A;  2V7M A;  1NCQ D;  4AQG A;  4QH4 A;  2CUL A;  4G74 A;  3CWZ B;  2R46 A;  1AL2 4;  1J5E T;  5ER0 A;  2IML A;  4OFZ A;  1JNZ A;  3CKD A;  4UP3 A;  4V1A v;  4U3C A;  4YHJ A;  3C4X A;  2F4V T;  2NW9 A;  4ILB A;  1FOH A;  2HN2 A;  2YK0 A;  2BBJ A;  3BQI A;  3UUL A;  4B65 A;  2BA9 A;  4U8O A;  2BAB A;  2V1D B;  1V59 A;  3N2O A;  3RQW A;  4EGW A;  3Q6J A;  1BR4 A;  4EIQ A;  4G9K A;  2CA5 A;  2I59 A;  3PUR A;  3RIU A;  1YXR A;  3NRN A;  3AE2 A;  4AKG A;  4PJN A;  5FXX A;  2V7L A;  2XVH A;  2WEU A;  3P4P A;  2ES0 A;  3NIX A;  4ISS A;  4GDP A;  4JV5 T;  2YAU A;  3VKG A;  1GTH A;  3RHA A;  4FJO A;  1POV 0;  3N9M A;  3UFE A;  4U33 A;  4G6H A;  4JI0 T;  1N1P A;  1COY A;  4IV9 A;  2ZZC A;  4O4J E;  4H9Q C;  3DTO A;  5LGU B;  2J4G A;  4J2W A;  4H4U A;  1M64 A;  3RC3 A;  2PYX A;  4L0R A;  3HYW A;  3SS1 A;  3UTK A;  5L4E A;  2BCG G;  5LP6 E;  3SZ0 A;  3NZQ A;  4KP3 C;  4IVM B;  4B1B A;  4BK3 A;  1FEB A;  4BA9 A;  2H7O A;  2JAE A;  4HE8 A;  2RR1 4;  2YDQ A;  1YKH B;  2VKD A;  2XZE A;  3P8C D;  3PTR B;  1Z6L A;  4LF7 T;  2WAU A;  3H37 A;  5HXE A;  3UP5 A;  4BJZ A;  1PVC 4;  1HCI A;  4OPD A;  3OKQ A;  5HXS A;  3V5U A;  4TM3 A;  2OAL A;  1WCR A;  2KZ7 B;  3I0Q A;  2PG8 A;  3J9X 1;  4ADW A;  4UVA B;  3LSV A;  4C91 A;  1KSU A;  3QB5 A;  1FIO A;  3AE7 A;  2C73 A;  1Q9I A;  2WQY A;  3I0O A;  4MJW A;  5JR9 B;  2LE8 A;  5AQP B;  4DR4 T;  4TUY E;  3LDQ B;  1BR0 A;  2OLO A;  2BG9 C;  1GES A;  2XQ4 A;  4E7Z A;  5L2L A;  4EQS A;  5KMQ A;  4IE6 A;  4GDE A;  2X9X A;  1RHI 4;  1RUJ 4;  3EAB A;  5FXZ A;  2C64 A;  3AXB A;  1HS7 A;  1UK5 A;  2XAG B;  2VKO A;  1FCD A;  2A87 A;  3V76 A;  2I0Z A;  3FHN A;  4TV8 E;  2F5Z A;  2M6B A;  3AE6 A;  3M12 A;  1TYP A;  2XUE A;  2LHN A;  2A3D A;  2GH5 A;  2PZS A;  4DSG A;  1QJD A;  4U2L A;  2L8K A;  2ZM0 A;  2UZZ A;  4HWD A;  1KNP A;  1MO9 A;  3HYV A;  3KVE A;  1OJA A;  2VRM A;  4P0A A;  5AQQ B;  1G8X A;  4JEU B;  3CVR A;  3UUN A;  2C72 A;  4II3 A;  4XWR A;  4EZH A;  1GXF A;  3EAO A;  5AQT B;  2YWL A;  3P4Q A;  1H7X A;  3BHK A;  5CJ5 A;  1ZOY A;  5CA0 E;  4L9I A;  4F8H A;  2GEW A;  3LBX B;  3UKA A;  2ODU A;  2ZM8 A;  3GRS A;  4BAY B;  3ICS A;  1HRI 4;  2WU5 A;  4ZI3 D;  3EUH A;  3A5X A;  2LT3 A;  2H3R A;  3GN5 A;  4C90 A;  5ABF B;  2H89 A;  3MJX A;  3RNM A;  2FJE A;  3RP7 A;  1U5P A;  4ZHQ E;  4XZC A;  3I9Y A;  3NK1 X;  3Q5X A;  1D1C A;  3H4K A;  2JB2 A;  2DI4 A;  4CXX A;  2IW5 B;  4X5T A;  4LF5 T;  5HXC A;  2Q0K A;  4OYK A;  4IE7 A;  2UU9 T;  3SWH A;  2VB6 A;  3SRZ A;  3ONX A;  1YQ3 A;  3TLT A;  1IUW A;  1UX4 A;  1HYU A;  4LII A;  5BUL A;  3NK0 X;  4J57 A;  2XHE B;  3GYJ A;  4NTC A;  3SZF A;  2WWV A;  2QAE A;  2X66 A;  1LV0 A;  3UKQ A;  1WLX A;  2BS2 A;  2LHR A;  2Q9Q B;  4ANJ A;  4DMW A;  2XSA A;  1GQE A;  1PBF A;  2GAH B;  4Q4W 4;  4B3S T;  1E39 A;  5KXJ A;  1X31 B;  2V6Y B;  1M6I A;  2Q6U A;  3Q5W A;  2XLP A;  5GSN A;  1EBD A;  5IHY A;  2XJ7 A;  2XQ8 A;  3IA3 A;  4PNI A;  2JQ9 A;  4UF0 B;  1G73 A;  3J8F 4;  4O2A E;  1RMU 4;  3NKS A;  2VAS A;  1IUS A;  1KFY A;  1D4D A;  4B3T T;  2QYW A;  3FIM B;  5CA1 E;  4JY3 A;  1IUX A;  3RQU A;  2H7V C;  4FX9 A;  2IHR 1;  5LJM A;  4ZI2 D;  5HEG A;  4JI8 T;  3R9U A;  2X5I D;  1KNR A;  3SFE A;  4CZZ B;  4ILU A;  3UKK A;  2XFN A;  3NN6 X;  4EQW A;  4B64 A;  2GMJ A;  2X67 A;  5AQR B;  3CQX C;  5EB4 A;  3O1I A;  3AB3 B;  4GAP A;  1HX1 B;  3FZL B;  3ICT A;  2BC0 A;  1ASJ 4;  1UX5 A;  5AFU L;  1N33 T;  2NR4 A;  1S94 A;  2WCA A;  3I9W A;  4AOX A;  2E9X C;  2DWG A;  4AQF A;  3G5Q A;  2NW8 A;  5HY5 A;  4I4T E;  4TNW A;  4ECH A;  1VG0 A;  4LMK A;  4H9P C;  3KVB A;  1GER A;  2WOI A;  4Y4N A;  1KK7 A;  1JU2 A;  1Q1W A;  4ILA A;  4WYV A;  2XVI A;  4K8D A;  3K3N A;  1HTJ F;  1DNC A;  2BBH A;  3RRW A;  2X0H A;  2YLX A;  3OZ2 A;  1XMQ T;  4J33 A;  2RS5 4;  2N2N A;  1DOD A;  3S4U A;  3UU8 A;  1CL0 A;  2C0S A;  1Y56 A;  1EL8 A;  4LU6 A;  1S2Q A;  5JRE A;  3P4S A;  4JYA T;  3IHR A;  2X50 A;  4FK1 C;  5HEH A;  2JIW A;  2BAC A;  4IDP A;  4QXH B;  4DR5 T;  1K0J A;  1RUI 4;  3ZJ2 A;  3ZMS B;  5JH7 E;  1NG3 A;  3M65 A;  2WWU A;  3C4A A;  1PDH A;  5CFB A;  1K4Q A;  3NH3 X;  1VRB A;  4H4R A;  3DJG X;  2XQ7 A;  3MXZ A;  1HNX T;  1PJ5 A;  4EOZ B;  4U72 A;  4YSX A;  1WR6 A;  1W4X A;  3GYI A;  2NP9 A;  1M62 A;  4Z8X A;  1D4C A;  2BVM A;  2KSR A;  3N9N A;  3ALM A;  3ZC1 A;  1J1J A;  3ZMT B;  4A5X A;  3CND A;  3RYF E;  2CHO A;  2V6O A;  5AQG B;  1OED B;  4PK4 A;  5BMV E;  4APN A;  4TN7 B;  3AB1 A;  4H4Z A;  4IE5 A;  2FJB A;  5KNL A;  3UQ4 A;  3VR9 A;  4YSZ A;  4CCQ A;  5KX5 E;  5GON E;  4K0K T;  1W0B A;  2NOX A;  2XLS A;  2YVG A;  4ILC A;  4G73 A;  1PXC A;  2BVL A;  3V3N A;  2EHO C;  1NHP A;  4QXB B;  3LFM A;  3TLU A;  2EQ9 A;  1ZKE A;  2BK4 A;  5JDG A;  3AVS A;  1S3E A;  1RVF 4;  2CXF A;  1IZN B;  2GK9 A;  1EAH 4;  1CC4 A;  3ZYM A;  3RYC E;  5CB4 E;  2MTQ A;  2YVF A;  1HNZ T;  4H2Q A;  3LJP A;  3F8P A;  5LA6 E;  1T72 A;  5DAB A;  1CJ4 A;  1E6E A;  4PJJ A;  4C77 A;  3FZK B;  4AXP A;  1VCT A;  3MAC A;  1QUU A;  2J62 A;  3NBX X;  1CBO A;  2QVA A;  2YQU A;  2K24 A;  5FL0 A;  2MAW A;  2ZM2 A;  3Q2M A;  2MYS A;  3JAE A;  4J31 A;  4YTP A;  5FY0 A;  3NGC X;  2VL8 A;  4JBW F;  3N2K E;  4CY6 A;  3EAN A;  1T8B A;  4U8P A;  3RPU A;  2YKS A;  4UV9 B;  3AD9 B;  5LJN A;  2XCG A;  1HXS 4;  3ZSS A;  3URH A;  1S35 A;  1F8R A;  4P0B A;  2E2A A;  1NAA A;  3TLV A;  1MIY A;  4Z2T A;  3I6D A;  1ELI A;  4TM0 A;  2RS1 4;  2PY5 A;  1QO8 A;  4EIW A;  1CJ3 A;  1N34 T;  5CKU A;  3ZJ1 A;  3QSM A;  3UU6 A;  3OTO T;  4LFB T;  3QVP A;  3U3I A;  2VVL A;  5C8Y E;  2I6H A;  2Q9Q D;  2XLT A;  4UDP A;  2BS3 A;  2W0G A;  3KPK A;  3H8L A;  3F8D A;  2YLR A;  3UCL A;  2R4J A;  2DLR A;  4WBN E;  1US7 B;  2WY2 A;  4J34 A;  2APG A;  2XFO A;  5AQJ B;  3N2G E;  4P09 A;  3JC6 D;  4JQ9 A;  3GRT A;  2X99 A;  2XAF B;  3VU7 H;  1ZK7 A;  3DK4 A;  3T2K A;  3PUA A;  2LLY A;  4MAL A;  4FDC B;  3VRD B;  1XWM A;  3AE5 A;  3D0T A;  2YLZ A;  5LGN B;  3GN5 B;  2M67 A;  1EL9 A;  4RG4 A;  4DV0 T;  2B9X A;  2RP4 A;  3LK2 B;  2CE7 A;  4Q25 A;  1K0I A;  2R0P A;  4J56 A;  4IE4 A;  1BWC A;  3GDP A;  4LF8 T;  3M3Z B;  4CI3 B;  1HFA A;  2DKI A;  2Q0L A;  5DQW A;  1DOE A;  4EQX A;  2LOP A;  4IGU A;  2HWB 4;  1RYI A;  2XLR A;  2W61 A;  1UGO A;  4TNV A;  1OJT A;  2IC6 A;  3KA7 A;  3NRY A;  2W67 A;  2OA1 A;  3UU3 A;  5U63 A;  3HI2 A;  4KUM B;  1PN0 A;  5DBJ A;  3GWF A;  2X68 A;  4H2N A;  4IRE A;  5TR3 A;  3KV4 A;  5FS9 A;  2E5V A;  3LOV A;  2HN1 A;  4A97 A;  4OCG A;  4DUY T;  1WYC A;  3ALJ A;  3RH3 A;  4NUU A;  4WCT A;  2FJD A;  1N36 T;  1D0Z A;  4KMC A;  4O5Q A;  3CMM A;  3VR8 A;  4COF A;  4YKG A;  1H86 A;  2JMK A;  1BGJ A;  5U25 A;  2YOE A;  3B3R A;  1JNR A;  2X9W A;  3P1W A;  3OJA A;  4HWI B;  4GK5 E;  4CN4 A;  4CN6 A;  3CGB A;  1D1A A;  3SFD A;  3IWA A;  1XZY A;  1DOC A;  3SQP A;  3B57 A;  2C70 A;  4X9N A;  2LKH A;  1GT8 A;  2BKN A;  4B3R T;  2BYB A;  2DWK A;  3EVY A;  4OVI A;  4DR1 T;  2VQB A;  4AI6 A;  1MOK A;  4UXN B;  4AP1 A;  4DBR A;  3EDV A;  1XMO T;  4DV2 T;  3AE3 A;  3L8K A;  4QX8 B;  5AQS B;  4JY2 A;  2NW7 A;  2YEV C;  3K30 A;  2GF3 A;  3NRX A;  1I94 T;  5LBM A;  3QUJ A;  1TDK A;  5KRQ A;  2X51 A;  3BK9 A;  2C5I T;  1CUN A;  2YLS A;  4HN9 A;  4NEV A;  3S5W A;  4X20 E;  3NTD A;  3ZPO A;  1Y56 B;  3IEE A;  4IA6 A;  2J47 A;  1MNE A;  2YLT A;  3T1H T;  2BXS A;  3RC8 A;  1J5W A;  4O2B E;  4H50 A;  4HFH A;  3UP4 A;  4AT0 A;  2CLY C;  2V3A A;  1GND A;  5IPY A;  4H4V A;  4H4T A;  4ZCD A;  3PJA J;  3JBG 4;  4CCR A;  1VOM A;  3JCF A;  4H4X A;  2RM2 4;  4I59 A;  5H6R B;  1ZEE A;  3DP7 A;  1CJ2 A;  1LJ1 A;  1OOP D;  3EI0 A;  4WX1 A;  3GA8 A;  5FYM A;  1FEC A;  2WSS V;  3C96 A;  5JRC A;  2Z6E A;  4G6G A;  1H8T D;  2VVN A;  1GRF A;  3CGE A;  3S61 A;  4ZXL A;  2BZB A;  4GKJ T;  4XWZ A;  4Z44 A;  3VRB A;  2E5L T;  2R06 4;  4ZI3 C;  1VBB 4;  1OED A;  5AQM B;  2W2U A;  4HFC A;  4YJ3 E;  5AQH B;  5KDM C;  4OPG A;  3MK7 C;  1D0Y A;  2GAG B;  2LFC A;  2J3N A;  5LXT E;  5LHH B;  2GV8 A;  3O0H A;  1Q1R A;  1PJ6 A;  2QRX A;  3FBS A;  2D0T A;  4DV1 T;  1Z0P A;  4TWH A;  1RUD 4;  1F3P A;  1S2Y A;  2PTF A;  1BF3 A;  5LYJ E;  3M0O A;  5ETW A;  2MPK A;  3G5S A;  5JDF A;  2ACX A;  3GWH A;  4IL4 A;  3ZKR A;  2XFQ A;  3AE1 A;  5JCI A;  5IYZ E;  4IDZ A;  1T7S A;  1LVL A;  4G2A A;  4HFD A;  4DV4 T;  2LSK A;  3V5S A;  4QH5 A;  3NZP A;  4JI5 T;  2IAK A;  1X79 A;  2IC9 A;  3CPZ A;  2PJQ A;  3HKD E;  1RUH 4;  2HH7 A;  4BJY A;  4HA6 A;  2R45 A;  5FVK A;  3UU4 A;  2TMD A;  1AOG A;  5LCY A;  4H2P A;  2LSY A;  5H6Q B;  1Z8U A;  4DND A;  3UTE A;  2GRT A;  2GR2 A;  3IC9 A;  2B9W A;  2VKJ A;  2CCQ A;  1NG4 A;  4GCM A;  3IBP A;  1ZDL A;  4ZI2 C;  3ALL A;  3HL6 A;  2QCU A;  3O9X A;  2V5Z A;  1D4M 4;  2IUB A;  2B7S A;  5HHF A;  5L3B B;  3RKO A;  3GQH A;  3JAF A;  3HZL A;  4OHF A;  1F8S A;  2VWA A;  3P4W A;  3K7M X;  4RG3 A;  1VBE 4;  1XNQ T;  2A89 A;  3QFB A;  3KBU A;  2UXB T;  1GV4 A;  1GRH A;  1UUS A;  3QNU A;  4HWC A;  3KPF A;  5HEJ A;  5FS7 A;  4J36 A;  4QX7 B;  1FMV A;  3LB8 A;  4U8M A;  2J1D G;  1VQW A;  4EB6 E;  4UVC B;  1NHS A;  4K0U A;  4U2Y A;  2WES A;  5C2T A;  4BJM A;  1RSG A;  3AED A;  3RP8 A;  2VZ2 A;  5KVH A;  3RI5 A;  5IQ1 A;  5KMS A;  3T37 A;  1LQU A;  1E1N A;  3NT6 A;  2HPL A;  3VQR A;  4XAX B;  4B3M T;  3L8R A;  3FI7 A;  2V7K A;  5LGT B;  4GF7 A;  4QKN A;  3TLW A;  1KDG A;  3CPH G;  2E9X B;  3LJC A;  1OWA A;  3ZN0 B;  2C66 A;  3KVA A;  2YG3 A;  4IDO A;  4PAB A;  4BUR A;  2C65 A;  2Y8D A;  2LRL A;  4OPC A;  2H88 A;  3O1J A;  2B1E A;  1BEV 4;  2WZH A;  1Y01 A;  4CBQ A;  2HPJ A;  1EV1 4;  1IBM T;  2CXL A;  4AQY T;  2X3N A;  4X65 T;  3EF6 A;  1MXT A;  2BC1 A;  5JR9 C;  4HEA A;  2UUB T;  2BRA A;  2LRK A;  2X8C A;  4U8K A;  4A98 A;  4UEM A;  3DJB A;  2GR1 A;  3PO7 A;  5BR8 T;  4TWF A;  3P7I A;  2DL1 A;  4AKL A;  1OXZ A;  1IJ6 A;  3N9P A;  4YXD A;  2Z5X A;  4OPI A;  1VCS A;  2FUP A;  3KFW X;  2QA1 A;  4OX9 T;  4M52 A;  3E08 A;  2C4C A;  1LVF A;  5IQ4 A;  1PHH A;  4H4W A;  3DA1 A;  3Q5D A;  2XAH B;  2IDO B;  4NXM T;  3GMC A;  3OYX A;  1UUR A;  1KF6 A;  1TDN A;  4Z2R A;  2BS4 A;  2E4G A;  3EPT A;  4G63 A;  3B13 A;  1BGN A;  2VQE T;  4B6X A;  2WPC A;  2W4X A;  3F31 A;  3DJE A;  4A56 A;  2C3D A;  1IBK T;  3SYI A;  3A8Y C;  4H2R A;  3KIN B;  3NYC A;  1KEY A;  2DHR A;  3PS9 A;  2LSI A;  4ERR A;  3NTA A;  3H3M A;  3DGZ A;  4CQI A;  1FEW A;  3SGL A;  4EXT A;  4CI1 B;  4HWH A;  5LMU T;  3L3P A;  5HXR A;  3IF9 A;  1KSS A;  3NG7 X;  2Y6X A;  4JN9 A;  1MIV A;  3FB2 A;  2PHH A;  4XBF B;  3RIF A;  3GD4 A;  2YN6 A;  2YIN A;  3N9L A;  2EX3 A;  2KXP B;  4X1I E;  5JDM A;  1Y0P A;  4A65 A;  5J1G A;  5JDQ A;  5AQN B;  1I6Z A;  3II4 A;  2EHO B;  4USQ A;  5JCK A;  3GMB A;  1IJH A;  1HRV 4;  4AIU A;  3AEB A;  3F57 A;  2WMN A;  4PAA A;  5FP3 A;  1PBD A;  1N32 T;  4K2X A;  4U7Y A;  1XAN A;  3ZMU B;  2XDO A;  1PS9 A;  4TLX A;  1TDO A;  1JRX A;  1HG5 A;  4YY3 T;  3UOY A;  2A2F X;  2LOS A;  1NPX A;  5HEO A;  2KWH A;  2C3C A;  3NHO X;  3FZF B;  5CGM A;  2V7I A;  4IIJ E;  2ODV A;  5E0O A;  2NPX A;  3R6N A;  4CI2 B;  2B9Y A;  2BG9 A;  1O95 A;  2Q9Q C;  1DXL A;  4GAV A;  5M10 A;  3COX A;  5AQU B;  2HQM A;  2CHN A;  4LFC T;  1DU2 A;  1ZV4 X;  4PJM A;  1RP0 A;  1GRB A;  5JRC B;  3I1A A;  1FMW A;  5HXH A;  4PAG A;  4AP3 A;  1NA1 D;  3LZX A;  5EK4 A;  1DOB A;  4B68 A;  2CDU A;  4EYU A;  1UCU A;  3JC6 C;  5BVA A;  4NTE A;  2BRY A;  3A7M A;  4A5L A;  2XAS B;  3LXD A;  1XHX A;  4L5G A;  4H9O C;  4C5O A;  3AE9 A;  4RHV 4;  4DR6 T;  2UXN B;  3ZT7 A;  2X9H A;  4A6N A;  3PUY F;  4HFE A;  4JI2 T;  1MMG A;  1ZMC A;  3Q9D A;  1TDF A;  5AQI B;  4EM3 A;  3FZM B;  4FI5 A;  1D1B A;  4JEH B;  2EQ6 A;  4YKF A;  2MBG A;  4OPT A;  5FXW A;  2X8H A;  4NNJ A;  5J60 A;  3QOF A;  1IUV A;  3NYE A;  3DME A;  1YQ4 A;  4RSL A;  2PYL A;  5BRT A;  4I50 E;  2CM0 A;  2PYJ A;  1R08 4;  3ICR A;  1H84 A;  3QSS A;  4DR7 T;  2DNX A;  4DR2 T;  5A1L A;  1B7T A;  1RUG 4;  1XDO A;  2V3B A;  2WM9 A;  4U2S A;  4B69 A;  3KV6 A;  1MMA A;  4O4I E;  4NTD A;  2JRK A;  2VQF T;  3DJJ A;  2V5C A;  4YSH A;  2Y48 B;  1N4V A;  3SXI A;  1CF3 A;  1L9C A;  3ESL A;  2E9X D;  3X1D A;  2X9Y A;  4OYJ A;  5FNV E;  2OA5 A;  4LF4 T;  4EQR A;  1JOA A;  2WDV A;  4ZI7 E;  1AR7 4;  3NWI A;  3AXJ B;  1AR6 4;  4U31 A;  1FJG T;  3C4W A;  2ZZB A;  4P1N A;  5F3J A;  4DV6 T;  3NYF A;  4DV3 T;  2D2S A;  2XAQ B;  4K22 A;  3JD7 4;  2V61 A;  5C3J A;  3ZN1 B;  1WFD A;  4YSY A;  4I0U A;  2R4E A;  1MQT D;  3RIU C;  4JI6 T;  3O1H A;  1SUM B;  2XVF A;  1Y64 B;  2GQF A;  4JI3 T;  4DO0 A;  1PO1 4;  4H9S E;  4IDN A;  3TKL B;  3ATQ A;  3ZMV B;  1XHC A;  1OJD A;  4UDR A;  2AAQ A;  3UKH A;  4II2 A;  4O8S A;  2X0Y A;  2ZBW A;  2L9Q A;  1N4U A;  1W0A A;  4ZS2 A;  4MFR A;  2A8X A;  2GR3 A;  4H7U A;  4YTN A;  4C74 A;  5KWF A;  2AR8 A;  2RPA A;  2GMH A;  2YVJ A;  3CNJ A;  3PUZ F;  5L3G B;  3OPC A;  3CN8 A;  2XYO A;  4X1Y E;  4CRT A;  1H83 A;  4LA1 A;  2E9X A;  1XHZ A;  4EED A;  3M13 A;  4H9N C;  4TX5 A;  3R84 B;  1KNZ A;  3UTG A;  3RF1 A;  4H4S A;  5LG4 A;  1GOS A;  4D04 A;  4JNQ A;  3AYI A;  2CWO A;  3BI5 A;  2D5U A;  3T2Z A;  1VBD 4;  3ABV A;  1E1L A;  3GYX A;  3DK8 A;  2O9Z A;  3HKE E;  4A7A A;  2XSB A;  1T98 A;  1LPF A;  2Q7V A;  2XAJ B;  5LBQ B;  4U8I A;  1D7L A;  2VVS A;  4U74 A;  2RGH A;  1ZP0 A;  5HYM A;  4Y4M A;  3N9Q A;  4JI7 T;  2EHO D;  3CTY A;  1OJC A;  3UOV A;  4NXN T;  4FK1 A;  2OLT A;  2WMO A;  3CQC B;  2E1M A;  3CPI G;  1SE7 A;  5ABG A;  5L47 A;  2VVL G;  5DQV A;  1IUU A;  4O4L E;  4LF9 T;  2IVD A;  1NHQ A;  2C5K T;  3B6D A;  5ADX L;  2JQK A;  2WDR A;  3ZST A;  2UXC T;  5FS8 A;  4UR9 A;  3UKP A;  3Q5E A;  1WRD A;  1EL5 A;  1JRZ A;  2OLN A;  4NIQ A;  1K0L A;  4EEB A;  4E0V A;  1COV 4;  1CHU A;  2I0M A;  4PW8 A;  4KBM B;  2BKP A;  4GKK T;  5HWX A;  3PUV F;  4ZCC A;  3AVR A;  5J7X A;  4YWO A;  1SA0 E;  4AT2 A;  3ADA B;  5FY1 A;  3CK6 A;  3EHZ A;  4I43 B;  3KDS E;  2ACZ A;  5JDH A;  3T8O A;  3LZW A;  3P50 A;  2JQQ A;  2WDQ A;  3JAD A;  1B5Q A;  2EHO A;  2CEA A;  4YTM A;  1IBL T;  1HNW T;  5JCN A;  1REO A;  3ETV A;  3IHM A;  2KIN B;  2CBJ A;  4ASK A;  5KMP A;  2VRL A;  4X4J A;  2LJL A;  3AEA A;  4ZS3 A;  1WYB A;  3WI3 A;  2R0C A;  3WE0 A;  1QLB A;  2WBA A;  5LHI B;  1B8S A;  2PFV A;  1DJN A;  4CXY A;  1V9D A;  4IA5 A;  4HGA A;  3CX6 B;  5AQV B;  2XLU A;  3L09 A;  2V7J A;  4X66 T;  3K1S A;  5HCM A;  3BNU A;  1E1K A;  3F8R A;  3AA0 B;  3DJD A;  3AEF A;  3PE0 A;  1OJ9 A;  1EL7 A;  2WZI A;  4YT0 A;  5ABE A;  4ICY A;  4CY8 A;  4IDQ A;  2XQY A;  3PVC A;  3UUB A;  3ONL C;  3UFG A;  3UUM A;  2BG9 B;  2RMU 4;  2W62 A;  4HFV A;  2AQJ A;  2W0H A;  3HKB E;  4Y4L A;  4H9R C;  2N9D A;  2XTL A;  1X9B A;  3BI4 A;  3FBL A;  3PV0 F;  2XVJ A;  3AD7 B;  3E1T A;  3KV9 A;  2CWY A;  1NAF A;  3J7Y q;  4DUZ T;  3K3Q C;  4K5S A;  2AXD S;  2DCF A;  4TM1 A;  3AEC A;  4GR1 A;  1GAL A;  3K7Q X;  2WP6 A;  4A6N B;  3T1Y T;  3PUG A;  2W66 A;  3UOX A;  3LG7 A;  4NUV A;  4QH1 A;  4DMV A;  4IT4 A;  1JEH A;  4U7I A;  3DH9 A;  1GSN A;  3FG2 P;  2XQ6 A;  4DNA A;  1NWM X;  3MKD A;  2YG6 A;  3BI2 A;  5EB5 A;  2M6I A;  5HCJ A;  4QWN B;  3ZYL A;  1R8I A;  4A79 A;  3P4R A;  4AQF C;  2XM2 A;  4DV5 T;  3CNP A;  4DVD A;  1TRB A;  1BR2 A;  2LM2 A;  3ANW A;  4Q4V 4;  3RYH E;  3VRA A;  2ZMA A;  2CVJ A;  2NTY A;  4HFB A;  5JVD E;  4A99 A;  4AOS A;  5U1O A;  1E2A A;  3ZLI A;  2EQ8 A;  1MMD A;  1MIW A;  3PU8 A;  2MOZ A;  5M0Z A;  3PUX F;  2A72 A;  3GWD A;  3ONJ A;  2UUA T;  4ADZ A;  3LK3 B;  4X62 T;  3AE8 A;  5LG3 A;  3QJ4 A;  4HKA A;  3RHW A;  1PJ7 A;  1ZOV A;  5JCL A;  5EBK A;  3UOZ A;  5FMH A;  4EMI A;  2X0L B;  1GEU A;  5FVL A;  2K9A A;  4HFI A;  1H82 A;  1MND A;  1PXA A;  4JI1 T;  3UT5 E;  4GIW A;  1S3B A;  3V3O A;  1GTE A;  3AXJ A;  3BQK A;  3P9U A;  3PJA A;  4LML A;  5HWY A;  3NNE A;  4MBQ A;  3DGH A;  3W15 B;  2KLQ A;  3RKG A;  3AEE A;  1HR0 T;  3ATR A;  5FXV A;  3SZW A;  1PBE A;  2WBL A;  2JK6 A;  5FL1 A;  2JB3 A;  1PBB A;  2WPF A;  5JCM A;  1HG2 A;  3AA1 B;  1BZL A;  3KD9 A;  3E22 E;  3H8I A;  3N9O A;  2RGO A;  4EYY R;  2KMF A;  2C76 A;  2P9B A;  5LNK A; 
#chains in the Genus database with same CATH homology
 3KPK A;  3H8L A;  1TDO A;  1JRX A;  1H7W A;  2OAM A;  3UOY A;  3CNS A;  2YLR A;  3F8D A;  1NPX A;  3UCL A;  4OPL A;  2R4J A;  2YR4 A;  2C3C A;  3NHO X;  2VVM A;  3L1R A;  4J34 A;  2APG A;  2XFO A;  2YG4 A;  2NPX A;  4JQ9 A;  3GRT A;  3QVR A;  2X99 A;  2B9Y A;  2CUL A;  4G74 A;  1ZK7 A;  1O95 A;  2R46 A;  3DK4 A;  3SY4 A;  3T2K A;  5ER0 A;  1DXL A;  4GAV A;  5M10 A;  3COX A;  4FDC B;  1JNZ A;  4GRT A;  4UP3 A;  2HQM A;  1CJC A;  4U8L A;  1FOH A;  2RAB A;  3VRD B;  1N4W A;  3AE5 A;  4B65 A;  2YLZ A;  2BA9 A;  4U8O A;  1RP0 A;  2XFU A;  2BAB A;  1GRB A;  1V59 A;  1YY5 A;  4EMW A;  2C67 A;  4AP3 A;  1EL9 A;  4RG4 A;  1H6V A;  2B9X A;  3ZDN A;  3LZX A;  4JDR A;  3CIR A;  1DOB A;  3Q6J A;  4B68 A;  2CDU A;  4EIQ A;  4G9K A;  1XPQ A;  4H4Y A;  4BK1 A;  4NTE A;  1K0I A;  2BRY A;  2R0P A;  5BVA A;  4A5L A;  3LXD A;  4J56 A;  3NRN A;  5BUK A;  3AE2 A;  1BWC A;  3GDP A;  4C5O A;  2CFY A;  3AE9 A;  1L0V A;  2XVH A;  2WEU A;  3P4P A;  2ZZ0 A;  2DKI A;  3NIX A;  2Q0L A;  3RP6 A;  2GB0 A;  4A6N A;  1FEA A;  4GDP A;  1DOE A;  4EQX A;  2YAU A;  1GTH A;  4IVO B;  2IVE A;  3RHA A;  1RYI A;  2XLR A;  2YR5 A;  1ZMC A;  4G6H A;  1YQZ A;  1TDF A;  4N9X A;  4EM3 A;  1N1P A;  1OJT A;  1COY A;  3KA7 A;  2ZZC A;  4IV9 A;  2OA1 A;  2EQ6 A;  4YKF A;  5U63 A;  4OPU A;  4OPT A;  4J2W A;  2X8H A;  1M64 A;  1NDA A;  1PN0 A;  2PYX A;  4H4U A;  4NNJ A;  5J60 A;  2WOV A;  3HYW A;  5DBJ A;  2BCG G;  1IUV A;  3GWF A;  3NYE A;  3SZ0 A;  3DME A;  4H2N A;  1YQ4 A;  4IVM B;  4RSL A;  5TR3 A;  4B1B A;  4BK3 A;  1FEB A;  2WPE A;  5BRT A;  5FS9 A;  3ICR A;  2JAE A;  2E5V A;  3LOV A;  3ZYX A;  1H84 A;  4U8J A;  1Z6L A;  2GVC A;  4OCG A;  4CNK A;  3ALJ A;  3QSS A;  4TM4 A;  3UP5 A;  4BJZ A;  4OPD A;  4B67 A;  2V3B A;  4WCT A;  2FJD A;  4TM3 A;  4U2S A;  2OAL A;  4B69 A;  4ADW A;  3RED A;  4O5Q A;  3CMM A;  4NTD A;  3VR8 A;  1KSU A;  3AD8 B;  3AE7 A;  3DJJ A;  4EMJ A;  4YKG A;  2C73 A;  1Q9I A;  1H86 A;  2WQY A;  1BGJ A;  4MJW A;  5KVI A;  1N4V A;  5U25 A;  3SXI A;  4YSH A;  1CF3 A;  1L9C A;  3B3R A;  2C7G A;  3T31 A;  1GRE A;  1JNR A;  1D4E A;  4DSH A;  3P1W A;  4B66 A;  4EQR A;  2OLO A;  3CGB A;  1FL2 A;  1GES A;  1JOA A;  2WDV A;  3SFD A;  3IWA A;  1YKJ A;  4EQS A;  5KMQ A;  3SQP A;  1DOC A;  2C70 A;  2ZZB A;  4GDE A;  4X9N A;  1GT8 A;  3GQK A;  4NEW A;  4U8N A;  2BYB A;  3NYF A;  4OVI A;  4JNA A;  2VQB A;  1MOK A;  2C64 A;  3AXB A;  4AP1 A;  5EOW A;  2A87 A;  2R9Z A;  1FCD A;  3V76 A;  2I0Z A;  4K22 A;  2V61 A;  5C3J A;  1PBC A;  2F5Z A;  3AE3 A;  3L8K A;  3AE6 A;  4YSY A;  3GDN A;  3M12 A;  4JY2 A;  1TYP A;  2R4E A;  3K30 A;  2GF3 A;  2X8G A;  3SZC A;  2GH5 A;  2B7R A;  2XVF A;  3IHG A;  4DSG A;  1QJD A;  4U2L A;  2GQF A;  2VOU A;  2BCP A;  4D03 A;  2UZZ A;  2B76 A;  1TDK A;  5KRQ A;  3ATQ A;  1KNP A;  1MO9 A;  3HYV A;  3KVE A;  1OJA A;  1XHC A;  1OJD A;  1XDI A;  2VRM A;  2YLS A;  4UDR A;  2AAQ A;  3UKH A;  4NEV A;  4II2 A;  3S5W A;  3NTD A;  1D7Y A;  1Y56 B;  4IA6 A;  2ZBW A;  1N4U A;  2YLT A;  4C3Y A;  2BXS A;  2C72 A;  4II3 A;  2GR3 A;  2A8X A;  3BHF A;  4H50 A;  4H7U A;  4XWR A;  1TDE A;  3UP4 A;  1AOG A;  4YTN A;  4AT0 A;  1GXF A;  2V3A A;  3D8X A;  3EAO A;  4C74 A;  5KWF A;  2AR8 A;  1GND A;  2ARD A;  2YWL A;  5IPY A;  3P4Q A;  1H7X A;  2GMH A;  2YVJ A;  3BHK A;  4H4T A;  1ZOY A;  3CGC A;  3CNJ A;  4H4V A;  5FS6 A;  4ZCD A;  3SX6 A;  3CN8 A;  2GEW A;  4CCR A;  2XYO A;  4CRT A;  4NWZ A;  1H83 A;  3ISH A;  3C4N A;  4H4X A;  4I59 A;  3UKA A;  4LA1 A;  1CJ2 A;  3GRS A;  1LJ1 A;  4O5U A;  3ICS A;  2WU5 A;  3M13 A;  4KX6 A;  4WX1 A;  1FEC A;  1CC6 A;  3UTG A;  2YLW A;  3C96 A;  3JSK A;  1LTX R;  4CNJ A;  4BV6 A;  3KLJ A;  4H4S A;  4G6G A;  1GOS A;  4ECH A;  2H89 A;  3RNM A;  4D04 A;  2FJE A;  3GD3 A;  1GRF A;  4JNQ A;  3AYI A;  3RP7 A;  3CGE A;  3S61 A;  1VRQ B;  3NK1 X;  1UKV G;  3BI5 A;  3T2Z A;  1TYT A;  3H4K A;  4XWZ A;  3ABV A;  2JB2 A;  1E1L A;  3GYX A;  3DK8 A;  2O9Z A;  2Q0K A;  4A7A A;  4Z44 A;  3VRB A;  1LPF A;  4H4Q A;  3T14 A;  2Q7V A;  3KKJ A;  4U8I A;  1D7L A;  4OPG A;  2NVK X;  2RGH A;  3NK2 X;  1ZP0 A;  5CQF A;  1YQ3 A;  2YM2 A;  1IUW A;  1HYU A;  4LII A;  4Y4M A;  5BUL A;  2GAG B;  3NK0 X;  1GRT A;  5GRT A;  5HYM A;  2LFC A;  4J57 A;  2XVE A;  4TLX A;  4USR A;  1L9D A;  4K7Z A;  3CTY A;  3GYJ A;  3UTH A;  4EIP A;  2J3N A;  4NTC A;  3SZF A;  1VG9 A;  1OJC A;  2GV8 A;  2QAE A;  4Z43 A;  4DGK A;  1ONF A;  1LV0 A;  1B4V A;  1Q1R A;  1PJ6 A;  3FBS A;  3O0H A;  3UOV A;  4FK1 A;  3UKQ A;  2BS2 A;  1PXB A;  2E1M A;  1F3P A;  3CPI G;  1S2Y A;  2QA2 A;  2VVL G;  1PBF A;  1BF3 A;  2GAH B;  2Z5Y A;  1IUU A;  3M0O A;  1E39 A;  2IID A;  5KXJ A;  2IVD A;  1NHQ A;  2Y6Q A;  1X31 B;  3AYJ A;  3G5S A;  3B6D A;  2WP9 A;  2BXR A;  3SM8 A;  1M6I A;  2Q6U A;  2XLP A;  2XFQ A;  5GSN A;  2WDR A;  3AE1 A;  2WU2 A;  1EBD A;  3AWI A;  4KPR A;  1DJQ A;  3ITJ A;  5FS8 A;  5JCI A;  2Y6R A;  5LV9 A;  2YM1 A;  3UKP A;  4U2T A;  1EL5 A;  1LVL A;  2YG5 A;  3K7T A;  1JRZ A;  2OLN A;  3NKS A;  1IUS A;  1KFY A;  1D4D A;  1K0L A;  4E0V A;  3FIM B;  4Z24 A;  1CHU A;  2BK5 A;  1IUX A;  4JY3 A;  1L9E A;  4FX9 A;  4EM4 A;  3UKF A;  3AE4 A;  1IUT A;  4X9M A;  4Z2U A;  1CC2 A;  4BJY A;  3R9U A;  4HA6 A;  1KNR A;  2R45 A;  4BK2 A;  4ZCC A;  2TMD A;  3SFE A;  2DKH A;  3CGD A;  3UKK A;  2XFN A;  3NN6 X;  5J7X A;  4H2P A;  4B64 A;  4EQW A;  5HXI A;  2GMJ A;  2V60 A;  4YWO A;  4AT2 A;  5EB4 A;  3ADA B;  4GAP A;  3UTE A;  3CPJ G;  2GRT A;  3ICT A;  2BC0 A;  3CNT A;  3AEG A;  2GR2 A;  2R0G A;  2ACZ A;  3IC9 A;  2B9W A;  1NG4 A;  3LZW A;  1GRG A;  4AOX A;  2WDQ A;  2XFP A;  4GCM A;  4Z26 A;  1ZDL A;  3ALL A;  3G5Q A;  3QSE A;  1B5Q A;  2QCU A;  2V5Z A;  5HY5 A;  4YTM A;  5JCN A;  1JRY A;  1REO A;  1VG0 A;  2B7S A;  2WOI A;  1GER A;  5HHF A;  3IHM A;  4GUV A;  4Y4N A;  3GQH A;  5KMP A;  1JU2 A;  4REK A;  2VRL A;  3HZL A;  4X4J A;  3UTF A;  3AEA A;  1VDC A;  1GPE A;  1Q1W A;  2EQ7 A;  1F8S A;  2XVI A;  4K8D A;  3I3L A;  3K7M X;  1DNC A;  4RG3 A;  2R0C A;  3QFB A;  2A89 A;  3AYL A;  3WE0 A;  1QLB A;  4A9W A;  1GV4 A;  2WBA A;  1B8S A;  1DJN A;  2YLX A;  1GRH A;  3OZ2 A;  4IA5 A;  4J33 A;  3KPF A;  1B37 A;  1E1M A;  2XLU A;  4XXG A;  5FS7 A;  3BNU A;  3F8R A;  4J36 A;  1E1K A;  1DOD A;  3DJD A;  3AEF A;  1OJ9 A;  3LB8 A;  1EL7 A;  4U8M A;  1CL0 A;  4YT0 A;  1NHS A;  1VQW A;  1Y56 A;  1EL8 A;  3D1C A;  1S2Q A;  4ICY A;  4LU6 A;  4CY8 A;  4Z25 A;  5KMR A;  2WES A;  5C2T A;  3PVC A;  3P4S A;  2WS3 A;  3AED A;  1RSG A;  2JB1 A;  2VZ2 A;  3OC4 A;  3RP8 A;  5KVH A;  2X50 A;  4FK1 C;  4B63 A;  5IQ1 A;  4ZN0 A;  5KMS A;  2AQJ A;  3FPZ A;  2W0H A;  4NZH A;  5KOW A;  3T37 A;  2BAC A;  3FMW A;  1LQU A;  2FBW A;  1E1N A;  3NT6 A;  4Y4L A;  2RGJ A;  1K0J A;  3VQR A;  1NG3 A;  3C4A A;  3BI4 A;  2VQ7 A;  1PDH A;  4H4P A;  1K4Q A;  3NH3 X;  4H4R A;  3G5R A;  3DJG X;  2XVJ A;  3AD7 B;  1KDG A;  4GF7 A;  3CPH G;  3GSI A;  5L46 A;  3E1T A;  3KU9 A;  1PJ5 A;  4YSX A;  2C66 A;  2YG3 A;  4PAB A;  1W4X A;  2GR0 A;  4BUR A;  3GYI A;  2C65 A;  4K5S A;  4TM1 A;  1BKW A;  3AEC A;  4GR1 A;  1GAL A;  1O94 A;  1D4C A;  2H88 A;  4OPC A;  3K7Q X;  1P2E A;  2BK3 A;  2WP6 A;  1D5T A;  4CBQ A;  3ALM A;  4A6N B;  3EF6 A;  2X3N A;  3CND A;  1MXT A;  2BC1 A;  3UOX A;  2V6O A;  3LAD A;  4TLZ A;  1JEH A;  2BRA A;  2YR6 A;  4U8K A;  2X8C A;  4APN A;  2GR1 A;  3PO7 A;  3AB1 A;  3DH9 A;  1GSN A;  3FG2 P;  2YG7 A;  4H4Z A;  1NEN A;  4DNA A;  2FJB A;  3NN0 X;  5KNL A;  2YG6 A;  3BI2 A;  3VR9 A;  4YSZ A;  1LQT A;  5EB5 A;  4CCQ A;  2JKC A;  1NEK A;  4A79 A;  2XLS A;  2YVG A;  4YXD A;  3P4R A;  1GET A;  2Z5X A;  1F6M A;  3CNP A;  1PXC A;  1TRB A;  4G73 A;  2WET A;  4OPI A;  3V3N A;  1NHP A;  3VRA A;  2CVJ A;  2EQ9 A;  2BK4 A;  2QA1 A;  4M52 A;  3DK9 A;  2C4C A;  4A99 A;  4AOS A;  4K5R A;  5IQ4 A;  1PHH A;  1S3E A;  4H4W A;  3DA1 A;  3HYX A;  4UDQ A;  5U1O A;  2EQ8 A;  2WP5 A;  3T0K A;  3GMC A;  3T2Y A;  3SUC A;  1TDN A;  1KF6 A;  5M0Z A;  4Z2R A;  3BNM A;  1CC4 A;  2WOW A;  4HB9 A;  2BS4 A;  2E4G A;  3GWD A;  2YVF A;  3EPT A;  4H2Q A;  1SEZ A;  3LJP A;  1BGN A;  3F8P A;  1CJ4 A;  3AE8 A;  1E6E A;  2WPC A;  1P2H A;  4C77 A;  4I58 A;  3DJE A;  1PJ7 A;  3QJ4 A;  1ZOV A;  2C3D A;  5JCL A;  3SYI A;  4H2R A;  1CBO A;  5EBK A;  3NYC A;  3UOZ A;  5KOX A;  1ZX9 A;  5FMH A;  2YQU A;  1F8W A;  4EMI A;  3PS9 A;  1GEU A;  1ZMD A;  3NTA A;  2C75 A;  1H82 A;  4J31 A;  3DGZ A;  4YTP A;  1H81 A;  1PXA A;  3UKL A;  1S3B A;  3V3O A;  1GTE A;  3SGL A;  3NGC X;  3P9U A;  4CY6 A;  3EAN A;  3IF9 A;  3NNE A;  4U8P A;  1KSS A;  3NG7 X;  1E7P A;  3DGH A;  4JN9 A;  3AD9 B;  1ZY8 A;  2PHH A;  2TPR A;  3AEE A;  3GD4 A;  1ZKQ A;  4C3X A;  2XCG A;  3ATR A;  3URH A;  3SZW A;  1Y0P A;  1F8R A;  4A65 A;  1NHR A;  1PBE A;  3II4 A;  1NAA A;  2JK6 A;  4USQ A;  3GMB A;  5JCK A;  1GRA A;  1IJH A;  4Z2T A;  3I6D A;  1ELI A;  4TM0 A;  2WHD A;  2JB3 A;  1QO8 A;  1PBB A;  2WPF A;  3AEB A;  3QFA A;  1CJ3 A;  5JCM A;  4PAA A;  1PBD A;  3QSM A;  5CKU A;  1BZL A;  3KD9 A;  2JBV A;  3H8I A;  1O5W A;  3QVP A;  2RGO A;  2FJA A;  4K2X A;  2VVL A;  3Q9T A;  2C76 A;  4P9S A;  1XAN A;  3NLC A;  2XLT A;  2GQW A;  4UDP A;  2BS3 A;  2XDO A;  1PS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...