5C2TA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c2tA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c2tA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c2tA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c2tA04
1KDGA 1GETA 2VRMA 2V6OA 3V76A 2XFPA 3RNMA 4ECHA 3VRDB 2YAUA 4H4RA 2DKHA 2FJAA 1DODA 3AWIA 1H84A 3EF6A 1L9EA 4U2SA 2PYXA 3H8LA 3QSMA 1GRTA 4AT2A 3UKHA 2YG5A 1BGNA 3KKJA 4EMIA 1PXCA 1D4CA 2LFCA 3AXBA 4BK2A 2R9ZA 3P4SA 2WOIA 2C76A 2XFQA 2GAHB 2BS3A 3AEAA 3AE1A 3BHKA 5IPYA 4EMJA 2V61A 2Y6RA 2YVFA 2E4GA 2ZZCA 2BABA 2QCUA 4CNJA 1Q9IA 4O5QA 4H4VA 4TM4A 4EQWA 4A6NB 1CF3A 2JKCA 3C4AA 1GRFA 4TM0A 2O9ZA 2ACZA 1LVLA 2GR0A 1H86A 1F3PA 4K2XA 1ZMDA 5KRQA 4H4TA 3KVEA 2VQBA 1ZK7A 4XXGA 4WCTA 4FDCB 4U2TA 3IF9A 1NG4A 2GQWA 3EANA 4C5OA 5J60A 1QLBA 3I3LA 2WOWA 2JB1A 3AEFA 2WETA 5FS9A 4EQXA 2YG3A 1XPQA 4H2QA 1IUXA 1H81A 4H4PA 4ADWA 2JB3A 3V3OA 5KXJA 5LV9A 3NHOX 2C70A 1GTHA 4ZN0A 1Y0PA 2IIDA 4XWRA 4WX1A 2XVFA 3CNDA 5FS7A 1JRZA 4D03A 3ALMA 3L8KA 1PBFA 1CC4A 4JNQA 3FMWA 2XYOA 3DK4A 1JEHA 3CIRA 1H83A 3ADAB 4JN9A 3NGCX 3UOYA 1RSGA 1TDFA 5FS6A 4DNAA 2FBWA 4UDPA 2IVEA 4IVOB 1N4VA 2YM2A 4U8OA 2GB0A 2VRLA 2VVMA 2ZZBA 3M13A 5IQ1A 4NTDA 1PJ5A 3P4PA 2WP6A 2YLRA 4J2WA 5GRTA 2OLNA 1GRBA 1DOBA 2Q0LA 2V5ZA 2X8GA 3E1TA 4GDEA 3UTHA 2FJEA 5KWFA 1Y56A 2Z5YA 4U8IA 3UOZA 1VDCA 3NK2X 3VR8A 1GOSA 1L0VA 3VR9A 4PABA 3QSEA 2H88A 4OPGA 3CGEA 1H7WA 4P9SA 3DA1A 2XLUA 2V3AA 2C3DA 4EIQA 1NHRA 1PHHA 1F8RA 2OLOA 2V3BA 1S2YA 1LJ1A 4Z43A 4Z2UA 4YTNA 2XVEA 3DMEA 3QVRA 3CNJA 1K0IA 1H6VA 4EM4A 2FJDA 1PDHA 1VRQB 3AEBA 4EM3A 3KPFA 3GRSA 2YM1A 3LXDA 2RABA 3QFBA 4GUVA 1NHQA 3SGLA 4X9NA 4JNAA 1V59A 1JNZA 4JY3A 4CY8A 4BK3A 1H82A 4B1BA 2WHDA 4FX9A 1GPEA 1MXTA 1OJTA 1TDNA 4Y4MA 2B76A 1JRXA 2BACA 2XDOA 4BJYA 4H4WA 5KVHA 2H89A 1L9DA 1AOGA 5M0ZA 1IUUA 1GESA 3DJJA 4H4XA 4U8KA 2C7GA 2NVKX 3C96A 3GSIA 2C66A 4B68A 4MJWA 3LZWA 4NEWA 1FEBA 4EQSA 2R0PA 2EQ7A 2C75A 4B69A 4D04A 2CFYA 1NHSA 5U63A 5ER0A 2YLXA 2Q0KA 2Z5XA 2GRTA 2E5VA 4BK1A 3RP6A 4TM1A 3NN0X 1JRYA 2OALA 3F8PA 1GALA 1LQUA 3BI4A 4LA1A 4U8LA 4OPIA 2YLSA 4FK1C 1PBDA 3NG7X 1RP0A 2BK4A 1ZP0A 4E0VA 2BS4A 3DJEA 4LU6A 1NAAA 3DJDA 2C72A 3Q9TA 4YSXA 1OJDA 3DH9A 3DJGX 2CULA 2YLWA 2R46A 1M6IA 3GDNA 4IV9A 5HXIA 1CC6A 2R4EA 3F8RA 4Z2TA 1D5TA 1OJCA 1Q1RA 1GRAA 1LV0A 2X50A 3IC9A 4GF7A 4A65A 2UZZA 3AE8A 3CN8A 2WPFA 4I59A 4ZCCA 3ATQA 4DSGA 2B9XA 1TDOA 4GRTA 3LOVA 4OPTA 4GR1A 4YSYA 5DBJA 4JY2A 3ZDNA 4U8JA 1D7YA 3CPHG 2BA9A 3COXA 1E1NA 1ZX9A 2ZZ0A 1K4QA 1JOAA 1NENA 3NKSA 1PBBA 2A89A 4N9XA 4Z24A 1CJ3A 3H8IA 2JAEA 2GVCA 3NRNA 4YSHA 1L9CA 1NHPA 3AE5A 2A8XA 2GR3A 1TDEA 4H7UA 3AD8B 4ZCDA 3IHMA 4CBQA 3NTAA 1VG9A 2BK5A 3AE9A 2WQYA 2GV8A 3QSSA 5IQ4A 3GQKA 3UKAA 2YR6A 5EBKA 3NN6X 3ISHA 3PVCA 3O0HA 3OZ2A 1CJ4A 1ZOVA 2YG6A 3NLCA 3NYFA 3GDPA 1KFYA 4U8PA 4A99A 4UP3A 2WP9A 4B63A 2BC0A 3OC4A 2R4JA 1BGJA 1DNCA 1CJ2A 2C3CA 3AD9B 3SM8A 4APNA 3GYIA 2I0ZA 3T37A 4GDPA 3VRBA 1OJ9A 1LPFA 3I6DA 4A6NA 4JQ9A 4B66A 2WPEA 3CNTA 4C3XA 4J36A 4NZHA 4YT0A 4IVMB 1GTEA 3FBSA 4AOSA 4USQA 4XWZA 2YVJA 3ALJA 1B5QA 2EQ9A 4B64A 3P9UA 2XVHA 1Z6LA 3C4NA 4X4JA 2AQJA 4YSZA 2OAMA 1DOEA 1GRGA 4TLXA 1KF6A 4AP3A 4K8DA 2R0GA 2XCGA 2B7SA 4J56A 1E1KA 3CNSA 1CHUA 3HZLA 1FOHA 2ARDA 2BK3A 3QJ4A 3AE2A 3AYIA 1PJ7A 3AYJA 3AEGA 3GYXA 2XFOA 4J31A 2JK6A 4Y4NA 2XLRA 1GERA 4OPCA 1EL7A 4M52A 4NEVA 1TYPA 4YKFA 1YQ3A 2C67A 3URHA 4YTPA 5EB4A 5KVIA 2VQ7A 2X3NA 3CGCA 2WS3A 3LZXA 4AT0A 2E1MA 3ICRA 4I58A 1FCDA 1PJ6A 2X99A 3B3RA 4AOXA 5HHFA 3FIMB 1E39A 3QVPA 3GMBA 4A9WA 4A79A 4H4SA 1TYTA 3UCLA 4C3YA 2W0HA 3BHFA 2GMJA 4J33A 1GV4A 3DGZA 3UOVA 3PO7A 3VQRA 1UKVG 1EBDA 1SEZA 1GREA 1CJCA 1IUWA 1YKJA 3ALLA 1PBCA 3BNUA 1IUVA 2VVLG 3KU9A 1IUTA 3EPTA 3NIXA 2WU2A 2XLPA 3RP7A 2C65A 2DKIA 1ZKQA 4YKGA 1BZLA 2WDVA 3II4A 4YWOA 3AE6A 3M0OA 4H2NA 3K7QX 5CQFA 4OPDA 1N1PA 3L1RA 2WDRA 1GEUA 1P2HA 4U8NA 4FK1A 3UP5A 1KSUA 2VOUA 1KNRA 1H7XA 3JSKA 5HY5A 1GT8A 2X8CA 3DGHA 3KLJA 2WESA 2F5ZA 3K7MX 4OCGA 3UKPA 3AEDA 3FG2P 4Z26A 1D7LA 5EB5A 1MO9A 1CL0A 2PHHA 3UKFA 4EIPA 4B65A 3KD9A 4KPRA 3WE0A 4RG3A 2AAQA 3EAOA 2YG7A 4Z2RA 3IWAA 1W4XA 2BCPA 1REOA 3P4QA 2YWLA 1D4EA 4YXDA 4H4QA 3AEEA 1IUSA 1BWCA 3AYLA 3PS9A 5KOXA 2GAGB 1F8SA 3UTEA 1K0LA 2WP5A 2YG4A 1F8WA 1GNDA 2YR5A 2B7RA 1PBEA 5JCMA 1KSSA 2EQ8A 4GCMA 3NNEA 3ZYXA 1PXBA 3GWFA 3CGDA 3KA7A 1K0JA 3UTFA 4Z25A 3REDA 3V3NA 3RHAA 2OA1A 1TDKA 3D1CA 4OPLA 2NPXA 3IHGA 3K7TA 4REKA 3SFDA 5TR3A 1NEKA 1F6MA 5FMHA 3CPIG 4H4ZA 1DJQA 3UKLA 5C2TA 1N4UA 1LTXR 3NTDA 1TRBA 1CC2A 1P2EA 1LQTA 1YQZA 3NH3X 4USRA 4H2PA 4A5LA 2QA1A 3AECA 1XANA 2WDQA 1ZY8A 1B4VA 4K5RA 1N4WA 2CVJA 1M64A 1GSNA 1E1LA 2C64A 4B67A 3AD7B 4BV6A 4Z44A 2XVJA 3ICTA 4K7ZA 4JDRA 4UDQA 3AB1A 4U8MA 1E7PA 5HYMA 1VG0A 1ELIA 3LJPA 5GSNA 1EL9A 1YY5A 3GWDA 1ZMCA 5M10A 4Y4LA 2APGA 4EQRA 4C77A 2WPCA 1GRHA 1O5WA 1B8SA 2R45A 4DSHA 2YVGA 3QFAA 5L46A 4K22A 4LIIA 4O5UA 2Q7VA 3NT6A 2AR8A 1EL8A 1BKWA 1QO8A 2B9YA 2JBVA 4K5SA 4X9MA 2EQ6A 2GR2A 2GH5A 2TPRA 3D8XA 1XDIA 2JB2A 3K30A 2HQMA 2BC1A 4CY6A 3GRTA 2XFNA 4CRTA 3SQPA 2X8HA 1YQ4A 2WEUA 2YR4A 1QJDA 2R0CA 2V60A 4H2RA 4BJZA 5BULA 4NTEA 1IJHA 4J57A 2WU5A 1E6EA 3B6DA 5FS8A 2XLTA 3DK9A 5U1OA 1Q1WA 1EL5A 2FJBA 3NYCA 4OVIA 3G5SA 5BVAA 4KX6A 2YLTA 3UTGA 1NPXA 2BCGG 4J34A 4UDRA 2GR1A 3BI5A 4NTCA 1E1MA 1FL2A 2TMDA 3UKKA 1S3BA 5BRTA 3ITJA 4CCRA 5JCKA 1ZOYA 1ZDLA 5U25A 4IA5A 2GMHA 3CGBA 2C73A 3LADA 1PN0A 4C74A 3UP4A 1KNPA 3UKQA 2XFUA 5KOWA 4H4UA 4H50A 4EMWA 5JCIA 3GYJA 5C3JA 1VQWA 5CKUA 3P1WA 2RGOA 2XLSA 2YQUA 3DK8A 3ICSA 3AE7A 1S3EA 3BNMA 1OJAA 1XHCA 4HB9A 4A7AA 3G5RA 4RG4A 2GEWA 3NK0X 2VZ2A 1RYIA 5JCNA 1MOKA 3NK1X 2XVIA 1COYA 1O94A 1S2QA 3S5WA 2RGJA 2IVDA 2B9WA 1FECA 3SUCA 2CDUA 3NYEA 3CNPA 2BXSA 3S61A 4BURA 5JCLA 1JU2A 4OPUA 5J7XA 4HA6A 4CCQA 3VRAA 2Y6QA 3ATRA 2QA2A 1NDAA 3AE3A 2VVLA 3F8DA 2GF3A 4RSLA 4DGKA 2BS2A 3AE4A 1X31B 1GXFA 3RP8A 1JNRA 2ZBWA 2YLZA 4U2LA 2BXRA 3R9UA 1DJNA 1NG3A 2WBAA 4PAAA 2GQFA 3GD3A 2J3NA 1DXLA 3CPJG 1PS9A 5EOWA 3GQHA 1HYUA 3FPZA 2QAEA 2A87A 4IA6A 3P4RA 4YTMA 1CBOA 3GD4A 3BI2A 4H4YA 5BUKA 3G5QA 1D4DA 4TM3A 4AP1A 1Y56B 1BF3A 3M12A 1PXAA 4CNKA 2RGHA 2WOVA 1FEAA 4TLZA 3SFEA 1ONFA 1O95A 3CTYA 2BYBA 2Q6UA 3GMCA 3UOXA 3ABVA 3Q6JA 1DOCA 3H4KA 3LB8A 4ICYA 1B37A
chains in the Genus database with same CATH superfamily
4ECHA 3VRDB 4H4RA 4NNJA 4DV1T 1G73A 3OKQA 5FXVA 4AT2A 2R7FA 2YG5A 2YDQA 1BGNA 1PXCA 2R9ZA 4BJNA 2EHOD 4DBRA 2WOIA 2C76A 4DR3T 2C5IT 4IE0A 4EMJA 3CVRA 3NWIA 4HFHA 2E4GA 1YKHB 3MA9A 4O4JE 1BR2A 1VBA4 2QCUA 4CNJA 1Q9IA 4EQWA 3RQWA 2JKCA 3C4AA 1GRFA 2OV9A 2V1DB 1F3PA 5ABFA 5KRQA 2C5KT 3KVEA 2VQBA 1ZK7A 5JH7E 1NCQD 1IJ5A 3SRZA 3EANA 1QLBA 3AEFA 2WETA 3CX8B 4EQXA 4H2QA 4ADWA 2VL0A 3QB5A 4ZN0A 4WX1A 2LJLA 5FS7A 4D03A 2XYOA 3DK4A 1W0BA 4Q4W4 5JTGA 3RIUA 5J2TE 4AKLA 4DNAA 4K0KT 2W00A 2IVEA 2VKJA 2GB0A 3M13A 1PJ5A 4II3A 2WP6A 4J2WA 4HFDA 2AE9A 4GYSA 1GRBA 2V5ZA 2WZIA 1VCSA 1AR74 3KV4A 2NWBA 3UTHA 1Y56A 2Z5YA 3NK2X 2LT3A 3VR9A 2EX3A 2H88A 1H7WA 2IDOB 2XLUA 2V3AA 3DA1A 2V3BA 2OLOA 1YKEB 4ZS3A 4J2CA 1S2YA 2V7LA 2XVEA 3CNJA 1XDOA 2CWYA 1H6VA 2LRLA 1PDHA 1VRQB 3AEBA 2YINA 3ZKRA 1VOMA 4X9NA 1V59A 1JNZA 4BK3A 1H82A 4U33A 3ZJ2A 3ZLIA 3K8PC 1JRXA 2BACA 2XDOA 4BJYA 2PLV4 3TLSA 4TWDA 1IUUA 1GESA 4U8KA 5M0ZA 4LF6T 2NVKX 4MJWA 4NEWA 4EYUA 1FEBA 4NPPA 2YKSA 3PUZF 4Q4Y4 4H9RC 2XM2A 2YLXA 1HNZT 2JMHA 1UX5A 5AQIB 3RP6A 1JRYA 3BI4A 4JI1T 3P8CD 4JI4T 3C4XA 3CX7B 4LMLA 3DJDA 2C72A 4PJMA 3V5SA 4YSXA 3DH9A 2XY8B 1SE7A 2R46A 2CBJA 3TLUA 2RS54 3AA1B 4QX7B 4Z2TA 4BJMA 4NXMT 3T2ZA 4MHCA 3VU7H 4AQFA 5LOVE 5AQOB 1OEDB 4ILCA 4ZCCA 1T72A 3LOVA 4YSYA 4JY2A 3ZDNA 4U8JA 3RI5A 1E1NA 1ZX9A 1NENA 3QNUA 4A98A 1WRDA 3H8IA 4JBWF 2JAEA 1WR6A 3AE5A 2KMFA 2GR3A 1D1BA 3RKGA 2PYJA 1TDEA 4B3ST 4ZCDA 5AQNB 5AQSB 2GV8A 2ODVA 3UKAA 5EBKA 3NN6X 3ISHA 3OZ2A 2B1EA 3NLCA 3GDPA 1KFYA 1WCRA 4QWNB 3D0TA 2X0LB 4A99A 4U72A 2V7JA 3J7Yq 3OC4A 3N9QA 1DNCA 2I0MA 4APNA 3GYIA 1H8TD 2H7OA 3Q5XA 4A6NA 4JQ9A 4WBOA 4NZHA 4IVMB 4CN6A 1IBMT 5BMVE 4USQA 2P9BA 2YVJA 3ALJA 4B64A 2XVHA 3A5XA 4HE8A 1COV4 4TLXA 1AR64 3UUBA 1T98A 2PG8A 2BK3A 3VHLA 2VK9A 4Y4NA 2K24A 3WI3A 4OPCA 5KDMC 5FY0A 3CQCB 3T31A 1TYPA 3URHA 5FY1A 3DTOA 2C67A 5KVIA 2X3NA 2X0YA 4CXWA 1YW0A 1XZYA 4A56A 2X99A 5JDHA 4IREA 2LRKA 5FXXA 2CWOA 4A9WA 2XQYA 3TLWA 4PDWD 2CXLA 2VKDA 5AQTB 1TYTA 3T1YT 4JI7T 3DGZA 3UOVA 1VBE4 1N34T 3Q2MA 1EBDA 1SEZA 4IE7A 4DR1T 3ALLA 1PBCA 4JLEA 3BNUA 2KWIB 4PW8A 3KU9A 1IUTA 3EPTA 2LKHA 3RP7A 4TX5A 2NW9A 1RUH4 2KINB 1D1CA 3C4ZA 2GK9A 1P2HA 4U8NA 4AKHA 2VOUA 1KNRA 2CLYB 1H7XA 3JSKA 1GT8A 4GYRA 4G74A 4Z26A 3AEDA 1MO9A 1FIOA 3UKFA 5LBMA 2NTXA 2RA1A 4B65A 1B7TA 2AAQA 2YG7A 4Z2RA 4C91A 2JRKA 2HPJA 4WNKA 4HTEA 3N9MA 1NWMX 5JREA 4DR2T 3AYLA 1K0LA 2X9WA 2VL8A 4KI0F 1F8WA 2YR5A 5JCMA 1VBD4 2XJ7A 3JAEA 4GCMA 3ZYXA 3CGDA 2OA1A 1TDKA 1U4QA 3D1CA 4TNWA 3IHGA 4DMVA 4JV5T 1D0ZA 4REKA 3SFDA 5TR3A 5F8PA 1DJQA 1CC2A 1TRBA 1YQZA 4A5LA 2PW9A 4EAHA 2WDQA 1ZY8A 1B4VA 2I59A 4K5RA 1QUUA 1GSNA 2C64A 2PY5A 3AD7B 4Z44A 2XVJA 4JDRA 5FKYA 2I6HA 1ELIA 3LJPA 1RUD4 5M10A 3GWDA 4Y4LA 5H6QB 4JEUB 1RUG4 4ILUA 2WPCA 1O5WA 3PDYA 5L46A 3L09A 4LIIA 2ACXA 4O5UA 2XSBA 1PVC4 1QO8A 1QSDA 2K9AA 4QXBB 2L8KA 3D8XA 2NR4A 2VQFT 2XFNA 3SQPA 2X8HA 1QJDA 2R0CA 2W62A 4BJZA 4Z91A 5BULA 3I9WA 5LJNA 1IJHA 4ZHQE 3B6DA 4J57A 4NTEA 5U1OA 1HNWT 4DNDA 4QHOA 2FJBA 3NYCA 4OVIA 4TZ4C 4IDZA 3A8YC 4X66T 2ZM6T 1WLXA 2YLTA 4J34A 4UDRA 3UKKA 2CXFA 5BRTA 3ITJA 5AQQB 4O2AE 3MK7C 3OJAA 3CGBA 3LADA 1RUI4 1WFDA 4H4UA 5HXCA 3EDVA 3ICSA 4AI6A 3OPCA 3BNMA 3SZCA 4HB9A 1BR0A 2DL1A 1RYIA 5JCNA 3PUSA 1COYA 2HH7A 2CDUA 3NYEA 3CNPA 3S61A 5JCLA 2HN2A 5J7XA 4HA6A 3VRAA 3EDUA 3QB5K 3ZSTA 3AE3A 2D2SA 4EYYR 2VVLA 2GF3A 1CUNA 4RSLA 1GXFA 3AE4A 4EMWA 1JNRA 3IEEA 4U2LA 2XAHB 3MXZA 3HA4A 3PV0F 1PS9A 3EHZA 3HI2A 1HNXT 2QAEA 1IJ6A 3GD4A 1Y56B 2WOVA 1FEAA 4X1YE 4KHPT 2Q6UA 4GOUA 3RYIE 3P7IA 5AQGB 1DOCA 3K7MX 3H4KA 5LG4A 5ABEA 1KDGA 3RNMA 4LF7T 2MPKA 4AKIA 1DODA 5JDGA 1XNRT 5DABA 1SHZC 3EF6A 1L9EA 4O2BE 4U2SA 3H8LA 3UKHA 2PZSA 3KKJA 4GKJT 4EMIA 4BK2A 5JR9A 2BS3A 3SOLA 2XQ6A 3AE1A 3UQ4A 3X1DA 3BHKA 2L3LA 4DV6T 2Y6RA 5LHHB 3NZQA 2IC9A 2BABA 4O5QA 4TM4A 4A6NB 2ACZA 1LVLA 3PUXF 4K2XA 1ZMDA 3N5LA 2C4CA 4FDCB 5HCMA 2GQWA 2DWKA 2ZM8A 4TUYE 5J60A 4C5OA 3I3LA 3ZYLA 2JB1A 4LFAT 4DBQA 1WYCA 4P0AA 2YG3A 1XPQA 1H81A 2JB3A 5KXJA 1D4M4 3BQKA 4XWRA 3ZC0A 3CNDA 2E9XD 5CA0E 1PBFA 2XPKA 4HN9A 1CC4A 1MIVA 3JBG4 1BEV4 3ADAB 2E2AA 3MJXA 3ONLC 3NGCX 1RSGA 1OEDA 4MFRA 1N4VA 2VRLA 3PURA 3JADA 4EV6A 4NTDA 5GRTA 1EAH4 1LVFA 2OLNA 2Q0LA 1VRBA 2X8GA 4GDEA 1J5ET 3UFGA 4QXHB 2FJEA 4U8IA 1BR4A 5CA1E 4OPGA 3CGEA 4JYAT 4DV4T 1F8RA 1Z0PA 1LJ1A 4FI5A 2KXPB 4YTNA 3DMEA 2UXBT 1G8XA 1K0IA 4H9QC 3BQIA 4ZI7E 2YM1A 4G9KA 5FL0A 3SGLA 3ANWB 2XQAA 3UULA 4JY3A 1FMVA 4CY8A 2WHDA 3Q9DA 4H4WA 2H89A 3DJJA 1MNDA 3GSIA 3LZWA 4QH5A 3RIAA 3OBVE 1HS7A 5U63A 2W4XA 1M7KA 3RX6A 2JQ9A 4BK1A 3NN0X 1GALA 1Y64B 4OPIA 3O1JA 4FK1C 2X51A 4O8SA 2BK4A 4QXCB 3UQ7A 1HTJF 3ZMVB 2OLTA 3Q9TA 4PJNA 4DO0A 1OJDA 2IC6A 2BKOA 3Q5EA 2QA7A 3PUVF 1M6IA 4IV9A 2R4EA 3F8RA 3RPUA 1OJCA 5J1GA 3AA0B 3T8OA 1GRAA 1UURA 2XM1A 2ES0A 3IC9A 3ZJ1A 3W15B 4GF7A 3ESLA 3VKGA 4A65A 3O9XA 1ZHCA 3AE8A 3LDQB 2VASA 2WPFA 3ZSSA 3KDSE 5JRCB 3C64A 4U2ZA 3P50A 5AFUL 5L3GB 2E9XA 3CPHG 5L4HA 2BA9A 3HYWA 3LJCA 4P09A 3ZT6A 3J9X1 4B3RT 1JOAA 5HAXA 4UVCB 4N9XA 2MAWA 4Z24A 5IWAT 5FVLA 2GVCA 4YSHA 3U3IA 4H9OC 2WB5A 3JC6C 3AD8B 3SZFA 1J5WA 3NTAA 1VG9A 3KPKA 2BK5A 2WQYA 3RRWA 4TV8E 1FJGT 3O0HA 3IBPA 1CJ4A 3NYFA 1IZNB 2EHOB 1BGJA 3OVUA 5LCYA 2BVLA 4BA9A 2XQ5A 2VWAA 1VBC4 2A72A 4ANJA 3EUHA 4C3XA 3PU3A 2LM9A 4U2YA 1HFAA 3FBSA 3ZT5A 4XWZA 2E8IA 3P9UA 2WWUA 3ZN1B 2AQJA 1KF6A 2R0GA 2XQ4A 1E1KA 3HZLA 1FOHA 3S4UA 4ADZA 3QJ4A 2WSSV 3PUWF 3FI7A 2JMKA 2XFOA 4J31A 2N2NA 2LSYA 4NEVA 3LK2B 4Q4X4 4MALA 2VQ7A 2WS3A 2V6YA 3N2GE 4I58A 1EV14 1FCDA 3PE0A 1PJ6A 4AOXA 1E39A 2HWC4 4M1PA 3QVPA 4CN4A 5HWYA 5E0OA 4HFIA 4H4SA 5IYZE 5J0ZA 5L3BB 4C3YA 3EVYA 2GMJA 4J33A 1GV4A 1GQEA 2YU1A 3QK6A 5JQGE 2CE7A 1GREA 2LKGA 1CJCA 1YKJA 2D0TA 2VVLG 3GWHA 3NIXA 2WU2A 1N32T 5HXSA 3NVOA 5L4EA 1BZLA 4UEMA 5L3DB 4U7YA 5ADXL 3T14A 4DUZT 2J1DG 4KHZF 3L1RA 3UP5A 3RHWA 5JDFA 4FK1A 5LBQB 4GKKT 2Y6XA 5F5WA 2BZBA 2WMOA 3ZMSB 2V7KA 4IDQA 2AXDS 2R044 3RIUC 3WE0A 4KPRA 5LGUB 4LMJA 4RG3A 1OOPD 2LHRA 1FEWA 2BCPA 4JI2T 2ZMAA 4YXDA 2C5JA 5CJ5A 4H4QA 3AEEA 4L0RA 2ZM2A 5L47A 1WR0A 1J1JA 4KP3C 2GAGB 5KOXA 1F8SA 2CHNA 4HWFA 2YOEA 1W09A 1DU2A 2NP9A 1KSSA 1K0JA 2XQ7A 3L3PA 4OPLA 2W63A 5HEGA 3ZMTB 3K7TA 3CPIG 4HKAA 3NTDA 2W0GA 3NH3X 3IA3A 2R074 5L3FB 2A9UA 2QA1A 4DIDB 3UUXB 3B13A 2YN6A 1M64A 2LSIA 4JEHB 1HRV4 4B3MT 4YFSA 3R6NA 1LRZA 5FXZA 5HYMA 4AQGA 4U8MA 3SWHA 4QKNA 1AL24 1HRI4 5HCJA 2LSGA 2APGA 1GRHA 3KV5A 2W67A 1MMAA 3FZHB 5HEUA 1MNEA 4K22A 5JRCA 2Q7VA 3NT6A 4QX8B 3MZKB 1EL8A 2B9YA 2JBVA 4K5SA 1Z7S4 2EQ6A 4CI1B 2PBIA 2GH5A 3O1IA 2HQMA 2BC1A 3GRTA 4JI5T 4CRTA 3KVBA 2V26A 4B3TT 2YR4A 2WU5A 5FS8A 3PUQA 4CQIA 1EL5A 2BKPA 1RUF4 4MLKA 5KNLA 2BRAA 1S94A 3QOFA 4HFBA 1KNZA 1LVKA 2ODUA 5ABFB 2BCGG 3CQGB 3EAMA 5FYMA 2GR1A 4IE4A 1S3BA 2DI4A 4X20E 1ZDLA 4O4HE 4ZZBA 3LSVA 5FP3A 4EGWA 4G2AA 2GMHA 1PN0A 5KOWA 2XFUA 3GYJA 3N2OA 5H6RB 4B6XA 2LM2A 2XLSA 3KVAA 1S3EA 3KINB 4HWCA 1XHCA 4A7AA 4RG4A 3T0KA 5LGTB 3NK0X 2VZ2A 3OYXA 1MOKA 3F31A 4CI2B 3EI0A 2B9WA 1FECA 2IVDA 4TN7B 1RHI4 2BXSA 1MQTD 1JU2A 3K3OA 4DMWA 3RYHE 4U74A 3C50A 2BVMA 3RP8A 2YLZA 3PJAA 1DJNA 1NG3A 3GD3A 2J3NA 1DXLA 3CPJG 1XHXA 5EOWA 3GQHA 1HYUA 3FPZA 3P4RA 3M65A 4YTMA 5BUKA 2W61A 1V9DA 4TM3A 4F8HA 1UX4A 2RGHA 3SFEA 2NW7A 4XAXB 1O95A 4IE6A 2E9XB 3ABVA 5JVDE 4IIJE 5DQVA 3Q6JA 2VRMA 1GETA 3V76A 2V6OA 2XFPA 3GN5A 4FJOA 1IBKT 4EB6E 2WCAA 3AWIA 1OXZA 4XBFB 1GRTA 3QSMA 2BKNA 2CA5A 1D4CA 2LFCA 4TWFA 3UUMA 3P4SA 1UUSA 2XFQA 3I0OA 3LG7A 2GAHB 4ZEYA 4ISTA 3AEAA 5IPYA 4YHHT 5L3EB 2ZZCA 3CMLA 4H4VA 1CF3A 2O9ZA 3CX6B 2GR0A 1H86A 3IHRA 1XI1A 4U2TA 4PFPA 1RUC4 3C4WA 2XZEA 2WOWA 3HYVA 5FS9A 2WBLA 2RP4A 4DV2T 4H4PA 3V3OA 4EZHA 2DWGA 3NHOX 1HX8A 4HGAA 1GTHA 1Y0PA 2DLRA 4KBMB 3FXDB 4I0UA 4U3CA 5FXWA 4L5GA 1JRZA 3ZYMA 3L8KA 4JNQA 3KBTA 3FMWA 2KT9A 3TLTA 4Z8XA 4YLHA 4WW0A 3J8F4 1X9BA 2XAGB 3PUYF 4HFEA 1H83A 2D5UA 4JN9A 5KMGP 4G63A 3UOYA 1TDFA 4Z90A 2X5ID 2VVMA 2ZZBA 5EK3A 5LP6E 2CM0A 2XUEA 3P4PA 2YLRA 3E1TA 1MMGA 3SXIA 2VVNA 1HR0T 1AJ3A 3UOZA 3ZCJA 5KMPA 3VR8A 4LFBT 5L2LA 5CGMA 4LFCT 2C3DA 4EIQA 1NHRA 1PHHA 4H9SE 2JIWA 2XASB 1US7B 3QVRA 5KMQA 5ABHA 2FJDA 3FB2A 3BK9A 3RGLA 4OHFA 4GUVA 1RUE4 3P4WA 4JNAA 2OA5A 2WM9A 4B1BA 1VRH4 5JR9B 1MXTA 1TDNA 4Y4MA 2J47A 3JCFA 3RKOA 2B76A 3I0QA 1AOGA 1L9DA 4HFVA 3FXEB 5DQWA 2C7GA 4N78D 3C96A 2C66A 3ZCIA 1RMU4 4DV3T 2W66A 1EZ3A 2CMRA 3MKDA 5ER0A 3K3QC 2Q0KA 2Z5XA 2E5VA 3KBUA 1HCIA 4TM1A 2XAJB 1LQUA 4LA1A 4U8LA 1W0AA 2YLSA 1T7SA 2VVSA 3NG7X 4BAYB 1ZP0A 1PO24 4X1KE 4UVAB 4E0VA 2BS4A 2DHRA 4LF5T 1XDPA 2IMLA 2UXCT 1ZKEA 2IUBA 4X62T 3TKLB 5HXIA 1CC6A 3FZLB 3RQUA 1D5TA 4F6RC 2JQQA 1Q1RA 1LV0A 3RC3A 4XZCA 5M4YA 2Y48B 2DNXA 2UU9T 3CWZB 2PYLA 4DR4T 5FY7A 4I59A 1UCUA 4Q4V4 4O4LE 4ILBA 4GRTA 4TV9E 2BBJA 4GR1A 4AIUA 5DBJA 3ETUA 2LHNA 1D7YA 3KFWX 4GK0E 4PNIA 1K4QA 3CQXC 3NZPA 5JDLA 4I43B 5AQLB 1CJ3A 4DUYT 1L9CA 3ZT7A 4DV7T 4DR7T 1N33T 4X1IE 4H7UA 4GK5E 3LFMA 3LK42 4CBQA 3QSSA 4I4TE 4A97A 2YR6A 2CBIA 1ZOVA 2YG6A 4U8PA 1H7CA 4UP3A 2WP9A 2BC0A 2R4JA 3Q5DA 1CJ2A 3N9NA 2C3CA 4ZZCA 3AD9B 3SM8A 3AAAB 4GDPA 1OJ9A 1LPFA 3I6DA 1HG5A 4B66A 2WPEA 4LMKA 3CNTA 4YT0A 1GTEA 4AOSA 3HYXA 1B5QA 3KV6A 2QYWA 3E0ZA 4X4JA 3C4NA 2PTFA 4YSZA 2V5CA 1GRGA 4AP3A 5LYJE 4K8DA 2H3RA 3CNSA 1CHUA 3AVRA 2ARDA 1MMDA 3AYIA 1PJ7A 3RC8A 3GYXA 4HWDA 5CB4E 2JK6A 1VCTA 1GERA 1O3XA 4M52A 2WMNA 2H7VC 4YKFA 1YQ3A 3HKDE 1OEDE 5EB4A 3CGCA 2XQ8A 2BDEA 4AT0A 5JR9C 3ICRA 5HHFA 3FIMB 5AQHB 4NXNT 4ZXLA 2VURA 2BG9A 3LK3B 5LNKA 3UCLA 3N2KE 3N9PA 2W0HA 4TNVA 3BHFA 4H9NC 4IE5A 3VQRA 5LMNT 4K0UA 3LBXB 2LLYA 3ZN0B 1XNQT 2M67A 3U78A 5LGNB 2XLPA 3Q5WA 5AQFB 2DKIA 5LMUT 2WDVA 2CXDA 4UV9B 4YWOA 3K7QX 5CQFA 3NRYA 3UFEA 2WDRA 4GAVA 5KMSA 5HY5A 2X8CA 4UF0A 3DGHA 2F4VT 2X0HA 2MYSA 3FG2P 5FNVE 1D7LA 5EB5A 4OYKA 3AXJB 4EIPA 3EAOA 5AQPB 3IWAA 1W4XA 3P4QA 2Q9QB 2EHOC 2CEAA 2LOSA 4QH4A 4PK4A 1IUSA 2VKOA 1BWCA 2WWVA 1YD8G 3UU3A 2NTYA 2MBGA 2BBHA 2V7MA 2WP5A 1GNDA 2B7RA 1PBEA 2EQ8A 2G0UA 3O1HA 2KNDA 3GWFA 4JUYA 4WBNE 3K1SA 3REDA 3H37A 2XAFB 3AB3B 2RR14 2NPXA 2JPFA 3AA7B 1NEKA 2UXDT 3UKLA 4UXNB 4USRA 2HN1A 1HXS4 3AECA 4ZOLE 1AR94 1N4WA 2CVJA 5HWXA 3ZC1A 3ZEFB 3HKBE 5DJQC 5CFBA 4UDQA 4K7ZA 2LE8A 3AB1A 1E7PA 1VG0A 5EK4A 1IAPA 5GSNA 1EL9A 4X5TA 1YY5A 1I94T 4C77A 2Y8DA 3H3AA 2Q9QD 4ISSA 3FZFB 2YVGA 3QFAA 2ZLYA 2R6GF 4IDOA 2AR8A 3A7MA 4EZ4A 1NAFA 2X67A 5FVKA 4CZZB 4X9MA 2TPRA 3K30A 1YQ4A 3RLFF 2WEUA 2V8SV 4ZS2A 3DK9A 4ZI3D 3B57A 2VQET 1XWMA 3GMIA 3ANWA 4YJ3E 2W2UA 2RM24 4YHJA 3B5MA 2L9QA 2C0SA 5F3JA 4HWHA 3BI5A 1E1MA 3SZWA 1ZOYA 3AXJA 5U25A 3EABA 3MACA 4H9PC 2C73A 3UKQA 1R8IA 2IIUA 5A1LA 5JCIA 2XHEB 1VQWA 2WY2A 5HEJA 4NUUA 3T1HT 2RGOA 4RHV4 2YQUA 1HG2A 4HWIB 1OJAA 3C98B 4CXXA 3G5RA 3I9YA 2GEWA 3DJBA 4TWHA 2XVIA 3ONXA 2UUBT 3NRXA 4ASKA 4DV5T 3FBZA 4CCQA 3PUGA 2XTLA 1ZEEA 2K3WA 2YDSA 2QA2A 1NDAA 2UXNB 2ZM0A 4DGKA 2K5BB 2BXRA 3R9UA 2WBAA 2QRXA 2GQFA 4PAAA 1D0XA 3L8RA 2A87A 4IA6A 5AQMB 5AQUB 3UUNA 4EEBA 3G5QA 1D4DA 4AQFC 2YDRA 1BF3A 4KUMB 4H63V 4COFA 4TLZA 1RVF4 3IF8B 2UUCT 2BYBA 1S35A 1XMQT 2BG9C 4PJJA 4IHJE 3UTFA 3LB8A 3UU5A 3G06A 3O4XE 2YAUA 2DKHA 2FJAA 3E22E 1H84A 3QC9A 2PYXA 1Z8UA 4GB34 1T8BA 3UU8A 3AXBA 4PAGA 4DVDA 3FZKB 3E08A 1MIYA 2V61A 2YVFA 3SS1A 4TM0A 4ZI2D 4H4TA 3F2EA 2N9DA 1U5PA 3GA8A 4XXGA 5IUXA 4EOZB 4Q25A 2LSJA 4WCTA 3RYFE 3IF9A 1NG4A 4IGUA 2QVAA 4G6GA 2X66A 2HHHT 3JC6D 4CXYA 3WAKA 2VKHA 2WAUA 1IUXA 4DV0T 5FL1A 5LV9A 1IBLT 2IHR1 3QUJA 2C70A 2IIDA 3RYCE 3RF1A 5HXHA 2XVFA 2V5DA 2XSAA 3ALMA 1ASJ4 2YEVC 1D1AA 5JDNA 3V5UA 3CIRA 1JEHA 3PJAJ 3L39A 5HXRA 2X68A 3ZPOA 5FS6A 1HX1B 2FBWA 1MIWA 2M6IA 4UDPA 4IVOB 4IL4A 2YM2A 4U8OA 5JDQA 5IQ1A 4AXPA 3RIFA 4OFZA 4I55E 2KLQA 3ZYKA 1DOBA 3FZMB 5KWFA 1X79A 4U31A 1VDCA 1GOSA 4PABA 1L0VA 3QSEA 4G6HA 4P9SA 1I6ZA 2Z6EA 4C90A 4Z43A 4Z2UA 4L9IA 3SX6A 2CRBA 3GN5B 4EM4A 3CMMA 4EM3A 3KPFA 3GRSA 4AISA 2RABA 3QFBA 1NHQA 4PK5A 4JI3T 4YY3T 3CPZA 4CI3B 2V7IA 3HKCE 4FX9A 1GPEA 1OJTA 4GAPA 5KVHA 4H4XA 1NA1D 5AQJB 2IAKA 2XQ3A 4B68A 1OEDC 3ZMZB 3RRCA 4EQSA 3ETVA 2R0PA 1POV0 2EQ7A 2C75A 4B69A 3HR0A 1FMWA 4D04A 2CFYA 2LOPA 1NHSA 2KWHA 3OYZA 2GRTA 3N9LA 2OALA 3F8PA 2M6BA 4PK6A 5AQKB 3WAJA 2RS34 4IDNA 5TAOA 1PBDA 4UELA 4UR9A 1RP0A 4A5XA 2V6YB 2E5LT 4EIWA 3DJEA 4LU6A 1NAAA 5J2UE 2PFVA 3DJGX 2CULA 2YLWA 4AKGA 3GDNA 5GONE 5LB7B 2X50A 2UZZA 2D0UA 3LBXA 3CN8A 2X9YA 3ATQA 4H63H 3T2KA 3TLVA 2B9XA 4DSGA 1TDOA 3CKDA 4OPTA 1E1HB 2E9XC 2J62A 4P0BA 1BR1A 3COXA 2ZZ0A 4JI8T 3UU6A 3NKSA 4HFCA 1PBBA 2A89A 3HKEE 4JI0T 4IT4A 1PO14 3NRNA 2A3DA 4LF9T 1NHPA 2A8XA 1Y01A 3IHMA 3AE9A 5IQ4A 3ONJA 2PJQA 3PUAA 3GQKA 2FUPA 4DR5T 3PVCA 2Q9QA 4OX9T 5EZYE 4B63A 2NOXA 1SA0E 2SPCA 2YK0A 1D0YA 2I0ZA 3T37A 1PIV4 1AR84 2MTQA 5IHYA 3VRBA 2HWB4 4IL9A 3AAIA 2V6XA 2KSRA 4J36A 1R084 4UV8B 4OYJA 4DR6T 2RPAA 2HPLA 2EQ9A 1Z6LA 1UGOA 3ZMUB 2OAMA 1DOEA 2MOZA 3VKHA 3SY4A 4I50E 2XCGA 2B7SA 1SUMB 4J56A 3R84B 1OWAA 2LSKA 3AE2A 1MMNA 2XQ9A 4MBQA 3AYJA 3AEGA 4OK0A 4E7SA 5FMNA 3AAEB 2XLRA 1EL7A 5EK2A 2R064 2CLYC 1YXRA 4YTPA 4JI6T 4X65T 2LEHA 4X64T 2J4GA 3LZXA 2E1MA 3B3RA 5HYAA 3GMBA 4P1NA 1ZV4X 4A79A 5ABGA 4EEDA 5LHGB 2CHOA 2UXXB 4ZI2C 3PO7A 3JAFA 1UKVG 4AQYT 1IUWA 4O4IE 1IUVA 5HEHA 2JQKA 2JJ9A 3RH3A 2WZHA 1XHZA 2C65A 5LG3A 1ZKQA 4YKGA 1WYBA 2UUAT 3II4A 3SYIA 2KZ7B 3AE6A 3M0OA 4H2NA 4LF4T 4OPDA 1N1PA 1GEUA 3AVSA 1KSUA 4E7ZA 5AQRB 2X9XA 5KX5E 3KLJA 2WESA 2F5ZA 5BR8T 4OCGA 3UKPA 2VB6A 1CL0A 2PHHA 3FHNA 3UU4A 1W9RA 4UIGA 3T2YA 3KD9A 5KMRA 3NKZA 3BQLA 1REOA 2IW5B 2YWLA 1D4EA 2X9HA 2EHOA 5AQVB 4HEAA 2DCFA 3PS9A 3UTEA 4NUVA 2YG4A 1E2AA 5LXTE 3NNEA 4V1Av 1PXBA 4NIQA 3KA7A 2D9DA 4Z25A 4PFOA 3V3NA 3RHAA 2XAQB 4QH1A 3C51A 1F6MA 5FMHA 5ETWA 4H4ZA 5C2TA 1N4UA 1LTXR 1P2EA 2RS14 1LQTA 4NWZA 2RMU4 4YJ2E 4H2PA 1XANA 1LKXA 1E1LA 4B67A 2JQHA 3PTRB 3DP7A 4BV6A 3ICTA 2YU2A 5LJMA 3H3MA 1ZMCA 4WYVA 4EQRA 2K48A 1B8SA 2R45A 4DSHA 2BG9B 3HL6A 1KK7A 1BKWA 4UVBB 1K5MD 2GR2A 1XDIA 2JB2A 3CK6A 3PU8A 4CY6A 4ZI3C 3KV9A 4KMCA 2V60A 4H2RA 1XMOT 1E6EA 3NBXX 3OTOT 2XLTA 1Q1WA 5JDMA 3JD74 5LHIB 3G5SA 5BVAA 4KX6A 3UTGA 1NPXA 4II2A 4UF0B 4G73A 4NTCA 1FL2A 2TMDA 2A2FX 5C8YE 4AKRB 3M3ZB 4CCRA 5JCKA 4ERRA 3UT5E 3N9OA 4IA5A 2Q9QC 2CCQA 3FBLA 2BG9E 4C74A 1VBB4 3UP4A 1KNPA 4H50A 5C3JA 5LA6E 1KEYA 5CKUA 1R094 4IDPA 3P1WA 2CPTA 3DK8A 3AE7A 3I1AA 3NK1X 2N1GA 1O94A 1S2QA 3S5WA 2RGJA 4U7IA 3AA6B 5HXEA 1N36T 3SUCA 4BURA 4OPUA 5HEOA 2Y6QA 3ATRA 4LF8T 4CN1A 3UTKA 3F8DA 1HF8A 2BS2A 1X31B 2ZBWA 5L3CB 3K3NA 4WZXA 3F57A 1CBOA 4H4YA 3BI2A 1RUJ4 4AP1A 2QGSA 3M12A 1PXAA 3SZ0A 4CNKA 1UK5A 2BRYA 1ONFA 3CTYA 4GIWA 4ILAA 3GMCA 3UOXA 4EXTA 4PJLA 1M62A 2NW8A 3LXDA 4ICYA 1B37A
chains in the Genus database with same CATH topology
1KDGA 1GETA 2VRMA 2V6OA 3V76A 2XFPA 3RNMA 4ECHA 3VRDB 2YAUA 4H4RA 2DKHA 4NNJA 2FJAA 1DODA 3AWIA 1H84A 3EF6A 1L9EA 4U2SA 2PYXA 3H8LA 3QSMA 1GRTA 4AT2A 3UKHA 2YG5A 1BGNA 3KKJA 4EMIA 1PXCA 1D4CA 2LFCA 3AXBA 4BK2A 2R9ZA 3P4SA 2WOIA 2C76A 2XFQA 2GAHB 2BS3A 3AEAA 3AE1A 3BHKA 5IPYA 4EMJA 2V61A 2Y6RA 2YVFA 2E4GA 2ZZCA 2BABA 2QCUA 4CNJA 1Q9IA 4O5QA 4H4VA 4TM4A 4EQWA 4A6NB 1CF3A 2JKCA 3C4AA 1GRFA 4TM0A 2O9ZA 2ACZA 1LVLA 2GR0A 1H86A 1F3PA 4K2XA 1ZMDA 5KRQA 4H4TA 3KVEA 2VQBA 1ZK7A 4XXGA 2C4CA 4FDCB 4WCTA 4U2TA 3IF9A 1NG4A 2GQWA 4G6GA 3EANA 4C5OA 5J60A 1QLBA 3I3LA 2WOWA 2JB1A 3AEFA 2WETA 3HYVA 5FS9A 4EQXA 2YG3A 1XPQA 4H2QA 1IUXA 1H81A 4H4PA 4ADWA 2JB3A 3V3OA 5KXJA 5LV9A 3NHOX 2C70A 1GTHA 4ZN0A 1Y0PA 2IIDA 4XWRA 4WX1A 2XVFA 3CNDA 5FS7A 1JRZA 4D03A 3ALMA 3L8KA 1PBFA 1CC4A 4JNQA 3FMWA 2XYOA 3DK4A 1JEHA 3CIRA 1H83A 3ADAB 4JN9A 3NGCX 3UOYA 1RSGA 1TDFA 5FS6A 4DNAA 2FBWA 4UDPA 2IVEA 4IVOB 1N4VA 2YM2A 4U8OA 2GB0A 2VRLA 2VVMA 2ZZBA 3M13A 5IQ1A 4NTDA 1PJ5A 3P4PA 2WP6A 2YLRA 4J2WA 4II3A 5GRTA 2OLNA 1GRBA 1DOBA 2Q0LA 2V5ZA 2X8GA 3E1TA 4GDEA 3UTHA 2FJEA 3SXIA 5KWFA 1Y56A 2Z5YA 4U8IA 3UOZA 5KMPA 1VDCA 3NK2X 3VR8A 1GOSA 1L0VA 3VR9A 4PABA 3QSEA 2H88A 4G6HA 4OPGA 3CGEA 1H7WA 4P9SA 3DA1A 2XLUA 2V3AA 2C3DA 4EIQA 1NHRA 1PHHA 1F8RA 2OLOA 2V3BA 1S2YA 1LJ1A 4Z43A 4Z2UA 4YTNA 2XVEA 3DMEA 3QVRA 3CNJA 3SX6A 5KMQA 1K0IA 1H6VA 4EM4A 2FJDA 1PDHA 1VRQB 3CMMA 3AEBA 4EM3A 3KPFA 3GRSA 2YM1A 3LXDA 4G9KA 2RABA 3QFBA 4GUVA 1NHQA 3SGLA 4X9NA 4JNAA 1V59A 1JNZA 4JY3A 4CY8A 4BK3A 1H82A 4B1BA 2WHDA 4FX9A 1GPEA 1MXTA 1OJTA 1TDNA 4Y4MA 4GAPA 2B76A 1JRXA 2BACA 2XDOA 4BJYA 4H4WA 5KVHA 2H89A 1L9DA 1AOGA 5M0ZA 1IUUA 1GESA 3DJJA 4H4XA 4U8KA 2C7GA 2NVKX 3C96A 3GSIA 2C66A 4B68A 4MJWA 3LZWA 4NEWA 1FEBA 4EQSA 2R0PA 2EQ7A 2C75A 4B69A 4D04A 2CFYA 1NHSA 5U63A 5ER0A 2YLXA 2Q0KA 2Z5XA 2GRTA 2E5VA 4BK1A 3RP6A 4TM1A 3NN0X 1JRYA 2OALA 3F8PA 1GALA 1LQUA 3BI4A 4LA1A 4U8LA 4OPIA 2YLSA 4FK1C 1PBDA 3NG7X 1RP0A 2BK4A 1ZP0A 4E0VA 2BS4A 3DJEA 4LU6A 1NAAA 3DJDA 2C72A 3Q9TA 4YSXA 1OJDA 3DH9A 3DJGX 2CULA 2YLWA 2R46A 1M6IA 3GDNA 4IV9A 5HXIA 1CC6A 2R4EA 3F8RA 4Z2TA 1D5TA 1OJCA 3T2ZA 1Q1RA 1GRAA 1LV0A 2X50A 3IC9A 4GF7A 4A65A 2UZZA 3AE8A 3CN8A 2WPFA 4I59A 4ZCCA 3ATQA 3T2KA 2B9XA 4DSGA 1TDOA 4GRTA 3LOVA 4OPTA 4GR1A 4YSYA 5DBJA 4JY2A 3ZDNA 4U8JA 1D7YA 3CPHG 2BA9A 3COXA 3HYWA 1E1NA 1ZX9A 2ZZ0A 1K4QA 1JOAA 1NENA 3NKSA 1PBBA 2A89A 4N9XA 4Z24A 1CJ3A 3H8IA 2JAEA 2GVCA 3NRNA 4YSHA 1L9CA 1NHPA 3AE5A 2A8XA 2GR3A 1TDEA 4H7UA 3AD8B 3SZFA 4ZCDA 3IHMA 4CBQA 3NTAA 1VG9A 3KPKA 2BK5A 3AE9A 2WQYA 2GV8A 3QSSA 5IQ4A 3GQKA 3UKAA 2YR6A 5EBKA 3NN6X 3ISHA 3PVCA 3O0HA 3OZ2A 1CJ4A 1ZOVA 2YG6A 3NLCA 3NYFA 3GDPA 1KFYA 4U8PA 4A99A 4UP3A 2WP9A 4B63A 2BC0A 3OC4A 2R4JA 1BGJA 1DNCA 1CJ2A 2C3CA 3AD9B 3SM8A 4APNA 3GYIA 2I0ZA 3T37A 4GDPA 3VRBA 1OJ9A 1LPFA 3I6DA 4A6NA 4JQ9A 4B66A 2WPEA 3CNTA 4C3XA 4J36A 4NZHA 4YT0A 4IVMB 1GTEA 3FBSA 3HYXA 4AOSA 4USQA 4XWZA 2YVJA 3ALJA 1B5QA 2EQ9A 4B64A 3P9UA 2XVHA 1Z6LA 3C4NA 4X4JA 2AQJA 4YSZA 2OAMA 1DOEA 1GRGA 4TLXA 1KF6A 4AP3A 4K8DA 3SY4A 2R0GA 2XCGA 2B7SA 4J56A 1E1KA 3CNSA 1CHUA 3HZLA 1FOHA 2ARDA 2BK3A 3QJ4A 3AE2A 3AYIA 1PJ7A 3AYJA 3AEGA 3GYXA 2XFOA 4J31A 2JK6A 4Y4NA 2XLRA 1GERA 4OPCA 1EL7A 4M52A 3T31A 4NEVA 1TYPA 4YKFA 1YQ3A 2C67A 3URHA 4YTPA 5EB4A 5KVIA 2VQ7A 2X3NA 3CGCA 2WS3A 3LZXA 4AT0A 2E1MA 3ICRA 4I58A 1FCDA 1PJ6A 2X99A 3B3RA 4AOXA 5HHFA 3FIMB 1E39A 3QVPA 3GMBA 4A9WA 4A79A 4H4SA 1TYTA 3UCLA 4C3YA 2W0HA 3BHFA 2GMJA 4J33A 1GV4A 3DGZA 3UOVA 3PO7A 3VQRA 1UKVG 1EBDA 1SEZA 1GREA 1CJCA 1IUWA 1YKJA 3ALLA 1PBCA 3BNUA 1IUVA 2VVLG 3KU9A 1IUTA 3EPTA 3NIXA 2WU2A 2XLPA 3RP7A 2C65A 2DKIA 1ZKQA 4YKGA 1BZLA 2WDVA 3II4A 3SYIA 4YWOA 3AE6A 3M0OA 4H2NA 3K7QX 5CQFA 4OPDA 3T14A 1N1PA 3L1RA 2WDRA 1GEUA 1P2HA 4GAVA 4FK1A 4U8NA 3UP5A 5KMSA 1KSUA 2VOUA 1KNRA 1H7XA 3JSKA 5HY5A 1GT8A 2X8CA 3DGHA 3KLJA 2WESA 2F5ZA 3K7MX 4G74A 4OCGA 3UKPA 3AEDA 3FG2P 4Z26A 1D7LA 5EB5A 1MO9A 1CL0A 2PHHA 3UKFA 4EIPA 3T2YA 3KD9A 4KPRA 3WE0A 4B65A 4RG3A 2AAQA 3EAOA 5KMRA 2YG7A 4Z2RA 3IWAA 1W4XA 2BCPA 1REOA 3P4QA 2YWLA 1D4EA 4YXDA 4H4QA 3AEEA 1IUSA 1BWCA 3AYLA 3PS9A 5KOXA 2GAGB 1F8SA 3UTEA 1K0LA 2WP5A 2YG4A 1F8WA 1GNDA 2YR5A 2B7RA 1PBEA 5JCMA 1KSSA 2EQ8A 4GCMA 3NNEA 3ZYXA 1PXBA 3GWFA 3CGDA 3KA7A 1K0JA 3UTFA 4Z25A 3REDA 3V3NA 3RHAA 2OA1A 1TDKA 3D1CA 4OPLA 2NPXA 3IHGA 3K7TA 4REKA 3SFDA 5TR3A 1NEKA 1F6MA 5FMHA 3CPIG 4H4ZA 1DJQA 3UKLA 5C2TA 1N4UA 1LTXR 3NTDA 1TRBA 1CC2A 1P2EA 1LQTA 1YQZA 3NH3X 4NWZA 4USRA 4H2PA 4A5LA 2QA1A 3AECA 1XANA 2WDQA 1ZY8A 1B4VA 4K5RA 1N4WA 2CVJA 1M64A 1GSNA 1E1LA 2C64A 4B67A 3AD7B 4BV6A 4Z44A 2XVJA 3ICTA 4K7ZA 4JDRA 4UDQA 3AB1A 4U8MA 1E7PA 5HYMA 1VG0A 1ELIA 3LJPA 5GSNA 1EL9A 1YY5A 3GWDA 1ZMCA 5M10A 4Y4LA 2APGA 4EQRA 4C77A 2WPCA 1GRHA 1O5WA 1B8SA 2R45A 4DSHA 2YVGA 3QFAA 5L46A 4K22A 4LIIA 4O5UA 2Q7VA 3NT6A 2AR8A 1EL8A 1BKWA 1QO8A 2B9YA 2JBVA 4K5SA 4X9MA 2EQ6A 2GR2A 2GH5A 2TPRA 3D8XA 1XDIA 2JB2A 3K30A 2HQMA 2BC1A 4CY6A 3GRTA 2XFNA 4CRTA 3SQPA 2X8HA 1YQ4A 2WEUA 2YR4A 1QJDA 2R0CA 2V60A 4H2RA 4BJZA 5BULA 4NTEA 1IJHA 4J57A 2WU5A 1E6EA 3B6DA 5FS8A 2XLTA 3DK9A 5U1OA 1Q1WA 1EL5A 2FJBA 3NYCA 4OVIA 5KNLA 2BRAA 3G5SA 5BVAA 4KX6A 2YLTA 3UTGA 1NPXA 4II2A 2BCGG 4G73A 4J34A 4UDRA 2GR1A 3BI5A 4NTCA 1E1MA 1FL2A 2TMDA 3UKKA 1S3BA 5BRTA 3ITJA 4CCRA 3SZWA 5JCKA 1ZOYA 1ZDLA 5U25A 4IA5A 2GMHA 3CGBA 2C73A 3LADA 1PN0A 4C74A 3UP4A 1KNPA 3UKQA 2XFUA 5KOWA 4H4UA 4H50A 4EMWA 5JCIA 3GYJA 5C3JA 1VQWA 5CKUA 3P1WA 2RGOA 2XLSA 2YQUA 3DK8A 3ICSA 3AE7A 1S3EA 3BNMA 3SZCA 1OJAA 1XHCA 4HB9A 4A7AA 3G5RA 4RG4A 2GEWA 3T0KA 3NK0X 2VZ2A 1RYIA 5JCNA 1MOKA 3NK1X 2XVIA 1COYA 1O94A 1S2QA 3S5WA 2RGJA 2IVDA 2B9WA 1FECA 3SUCA 2CDUA 3NYEA 3CNPA 2BXSA 3S61A 4BURA 5JCLA 1JU2A 4OPUA 5J7XA 4HA6A 4CCQA 3VRAA 2Y6QA 3ATRA 2QA2A 1NDAA 3AE3A 2VVLA 3F8DA 2GF3A 4RSLA 4DGKA 2BS2A 3AE4A 1X31B 1GXFA 3RP8A 1JNRA 2ZBWA 2YLZA 4U2LA 2BXRA 3R9UA 1DJNA 1NG3A 2WBAA 4PAAA 2GQFA 3GD3A 2J3NA 1DXLA 3CPJG 1PS9A 5EOWA 3GQHA 1HYUA 3FPZA 2QAEA 2A87A 4IA6A 3P4RA 4YTMA 1CBOA 3GD4A 3BI2A 4H4YA 5BUKA 3G5QA 1D4DA 4TM3A 4AP1A 1Y56B 1BF3A 3M12A 1PXAA 3SZ0A 4CNKA 2RGHA 2WOVA 1FEAA 4TLZA 3SFEA 2BRYA 1ONFA 1O95A 3CTYA 2BYBA 2Q6UA 3GMCA 3UOXA 3ABVA 3Q6JA 1DOCA 3H4KA 3LB8A 4ICYA 1B37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDG A;  1GET A;  2VRM A;  2V6O A;  3V76 A;  2XFP A;  3RNM A;  4ECH A;  3VRD B;  2YAU A;  4H4R A;  2DKH A;  2FJA A;  1DOD A;  3AWI A;  1H84 A;  3EF6 A;  1L9E A;  4U2S A;  2PYX A;  3H8L A;  3QSM A;  1GRT A;  4AT2 A;  3UKH A;  2YG5 A;  1BGN A;  3KKJ A;  4EMI A;  1PXC A;  1D4C A;  2LFC A;  3AXB A;  4BK2 A;  2R9Z A;  3P4S A;  2WOI A;  2C76 A;  2XFQ A;  2GAH B;  2BS3 A;  3AEA A;  3AE1 A;  3BHK A;  5IPY A;  4EMJ A;  2V61 A;  2Y6R A;  2YVF A;  2E4G A;  2ZZC A;  2BAB A;  2QCU A;  4CNJ A;  1Q9I A;  4O5Q A;  4H4V A;  4TM4 A;  4EQW A;  4A6N B;  1CF3 A;  2JKC A;  3C4A A;  1GRF A;  4TM0 A;  2O9Z A;  2ACZ A;  1LVL A;  2GR0 A;  1H86 A;  1F3P A;  4K2X A;  1ZMD A;  5KRQ A;  4H4T A;  3KVE A;  2VQB A;  1ZK7 A;  4XXG A;  4WCT A;  4FDC B;  4U2T A;  3IF9 A;  1NG4 A;  2GQW A;  3EAN A;  4C5O A;  5J60 A;  1QLB A;  3I3L A;  2WOW A;  2JB1 A;  3AEF A;  2WET A;  5FS9 A;  4EQX A;  2YG3 A;  1XPQ A;  4H2Q A;  1IUX A;  1H81 A;  4H4P A;  4ADW A;  2JB3 A;  3V3O A;  5KXJ A;  5LV9 A;  3NHO X;  2C70 A;  1GTH A;  4ZN0 A;  1Y0P A;  2IID A;  4XWR A;  4WX1 A;  2XVF A;  3CND A;  5FS7 A;  1JRZ A;  4D03 A;  3ALM A;  3L8K A;  1PBF A;  1CC4 A;  4JNQ A;  3FMW A;  2XYO A;  3DK4 A;  1JEH A;  3CIR A;  1H83 A;  3ADA B;  4JN9 A;  3NGC X;  3UOY A;  1RSG A;  1TDF A;  5FS6 A;  4DNA A;  2FBW A;  4UDP A;  2IVE A;  4IVO B;  1N4V A;  2YM2 A;  4U8O A;  2GB0 A;  2VRL A;  2VVM A;  2ZZB A;  3M13 A;  5IQ1 A;  4NTD A;  1PJ5 A;  3P4P A;  2WP6 A;  2YLR A;  4J2W A;  5GRT A;  2OLN A;  1GRB A;  1DOB A;  2Q0L A;  2V5Z A;  2X8G A;  3E1T A;  4GDE A;  3UTH A;  2FJE A;  5KWF A;  1Y56 A;  2Z5Y A;  4U8I A;  3UOZ A;  1VDC A;  3NK2 X;  3VR8 A;  1GOS A;  1L0V A;  3VR9 A;  4PAB A;  3QSE A;  2H88 A;  4OPG A;  3CGE A;  1H7W A;  4P9S A;  3DA1 A;  2XLU A;  2V3A A;  2C3D A;  4EIQ A;  1NHR A;  1PHH A;  1F8R A;  2OLO A;  2V3B A;  1S2Y A;  1LJ1 A;  4Z43 A;  4Z2U A;  4YTN A;  2XVE A;  3DME A;  3QVR A;  3CNJ A;  1K0I A;  1H6V A;  4EM4 A;  2FJD A;  1PDH A;  1VRQ B;  3AEB A;  4EM3 A;  3KPF A;  3GRS A;  2YM1 A;  3LXD A;  2RAB A;  3QFB A;  4GUV A;  1NHQ A;  3SGL A;  4X9N A;  4JNA A;  1V59 A;  1JNZ A;  4JY3 A;  4CY8 A;  4BK3 A;  1H82 A;  4B1B A;  2WHD A;  4FX9 A;  1GPE A;  1MXT A;  1OJT A;  1TDN A;  4Y4M A;  2B76 A;  1JRX A;  2BAC A;  2XDO A;  4BJY A;  4H4W A;  5KVH A;  2H89 A;  1L9D A;  1AOG A;  5M0Z A;  1IUU A;  1GES A;  3DJJ A;  4H4X A;  4U8K A;  2C7G A;  2NVK X;  3C96 A;  3GSI A;  2C66 A;  4B68 A;  4MJW A;  3LZW A;  4NEW A;  1FEB A;  4EQS A;  2R0P A;  2EQ7 A;  2C75 A;  4B69 A;  4D04 A;  2CFY A;  1NHS A;  5U63 A;  5ER0 A;  2YLX A;  2Q0K A;  2Z5X A;  2GRT A;  2E5V A;  4BK1 A;  3RP6 A;  4TM1 A;  3NN0 X;  1JRY A;  2OAL A;  3F8P A;  1GAL A;  1LQU A;  3BI4 A;  4LA1 A;  4U8L A;  4OPI A;  2YLS A;  4FK1 C;  1PBD A;  3NG7 X;  1RP0 A;  2BK4 A;  1ZP0 A;  4E0V A;  2BS4 A;  3DJE A;  4LU6 A;  1NAA A;  3DJD A;  2C72 A;  3Q9T A;  4YSX A;  1OJD A;  3DH9 A;  3DJG X;  2CUL A;  2YLW A;  2R46 A;  1M6I A;  3GDN A;  4IV9 A;  5HXI A;  1CC6 A;  2R4E A;  3F8R A;  4Z2T A;  1D5T A;  1OJC A;  1Q1R A;  1GRA A;  1LV0 A;  2X50 A;  3IC9 A;  4GF7 A;  4A65 A;  2UZZ A;  3AE8 A;  3CN8 A;  2WPF A;  4I59 A;  4ZCC A;  3ATQ A;  4DSG A;  2B9X A;  1TDO A;  4GRT A;  3LOV A;  4OPT A;  4GR1 A;  4YSY A;  5DBJ A;  4JY2 A;  3ZDN A;  4U8J A;  1D7Y A;  3CPH G;  2BA9 A;  3COX A;  1E1N A;  1ZX9 A;  2ZZ0 A;  1K4Q A;  1JOA A;  1NEN A;  3NKS A;  1PBB A;  2A89 A;  4N9X A;  4Z24 A;  1CJ3 A;  3H8I A;  2JAE A;  2GVC A;  3NRN A;  4YSH A;  1L9C A;  1NHP A;  3AE5 A;  2A8X A;  2GR3 A;  1TDE A;  4H7U A;  3AD8 B;  4ZCD A;  3IHM A;  4CBQ A;  3NTA A;  1VG9 A;  2BK5 A;  3AE9 A;  2WQY A;  2GV8 A;  3QSS A;  5IQ4 A;  3GQK A;  3UKA A;  2YR6 A;  5EBK A;  3NN6 X;  3ISH A;  3PVC A;  3O0H A;  3OZ2 A;  1CJ4 A;  1ZOV A;  2YG6 A;  3NLC A;  3NYF A;  3GDP A;  1KFY A;  4U8P A;  4A99 A;  4UP3 A;  2WP9 A;  4B63 A;  2BC0 A;  3OC4 A;  2R4J A;  1BGJ A;  1DNC A;  1CJ2 A;  2C3C A;  3AD9 B;  3SM8 A;  4APN A;  3GYI A;  2I0Z A;  3T37 A;  4GDP A;  3VRB A;  1OJ9 A;  1LPF A;  3I6D A;  4A6N A;  4JQ9 A;  4B66 A;  2WPE A;  3CNT A;  4C3X A;  4J36 A;  4NZH A;  4YT0 A;  4IVM B;  1GTE A;  3FBS A;  4AOS A;  4USQ A;  4XWZ A;  2YVJ A;  3ALJ A;  1B5Q A;  2EQ9 A;  4B64 A;  3P9U A;  2XVH A;  1Z6L A;  3C4N A;  4X4J A;  2AQJ A;  4YSZ A;  2OAM A;  1DOE A;  1GRG A;  4TLX A;  1KF6 A;  4AP3 A;  4K8D A;  2R0G A;  2XCG A;  2B7S A;  4J56 A;  1E1K A;  3CNS A;  1CHU A;  3HZL A;  1FOH A;  2ARD A;  2BK3 A;  3QJ4 A;  3AE2 A;  3AYI A;  1PJ7 A;  3AYJ A;  3AEG A;  3GYX A;  2XFO A;  4J31 A;  2JK6 A;  4Y4N A;  2XLR A;  1GER A;  4OPC A;  1EL7 A;  4M52 A;  4NEV A;  1TYP A;  4YKF A;  1YQ3 A;  2C67 A;  3URH A;  4YTP A;  5EB4 A;  5KVI A;  2VQ7 A;  2X3N A;  3CGC A;  2WS3 A;  3LZX A;  4AT0 A;  2E1M A;  3ICR A;  4I58 A;  1FCD A;  1PJ6 A;  2X99 A;  3B3R A;  4AOX A;  5HHF A;  3FIM B;  1E39 A;  3QVP A;  3GMB A;  4A9W A;  4A79 A;  4H4S A;  1TYT A;  3UCL A;  4C3Y A;  2W0H A;  3BHF A;  2GMJ A;  4J33 A;  1GV4 A;  3DGZ A;  3UOV A;  3PO7 A;  3VQR A;  1UKV G;  1EBD A;  1SEZ A;  1GRE A;  1CJC A;  1IUW A;  1YKJ A;  3ALL A;  1PBC A;  3BNU A;  1IUV A;  2VVL G;  3KU9 A;  1IUT A;  3EPT A;  3NIX A;  2WU2 A;  2XLP A;  3RP7 A;  2C65 A;  2DKI A;  1ZKQ A;  4YKG A;  1BZL A;  2WDV A;  3II4 A;  4YWO A;  3AE6 A;  3M0O A;  4H2N A;  3K7Q X;  5CQF A;  4OPD A;  1N1P A;  3L1R A;  2WDR A;  1GEU A;  1P2H A;  4U8N A;  4FK1 A;  3UP5 A;  1KSU A;  2VOU A;  1KNR A;  1H7X A;  3JSK A;  5HY5 A;  1GT8 A;  2X8C A;  3DGH A;  3KLJ A;  2WES A;  2F5Z A;  3K7M X;  4OCG A;  3UKP A;  3AED A;  3FG2 P;  4Z26 A;  1D7L A;  5EB5 A;  1MO9 A;  1CL0 A;  2PHH A;  3UKF A;  4EIP A;  4B65 A;  3KD9 A;  4KPR A;  3WE0 A;  4RG3 A;  2AAQ A;  3EAO A;  2YG7 A;  4Z2R A;  3IWA A;  1W4X A;  2BCP A;  1REO A;  3P4Q A;  2YWL A;  1D4E A;  4YXD A;  4H4Q A;  3AEE A;  1IUS A;  1BWC A;  3AYL A;  3PS9 A;  5KOX A;  2GAG B;  1F8S A;  3UTE A;  1K0L A;  2WP5 A;  2YG4 A;  1F8W A;  1GND A;  2YR5 A;  2B7R A;  1PBE A;  5JCM A;  1KSS A;  2EQ8 A;  4GCM A;  3NNE A;  3ZYX A;  1PXB A;  3GWF A;  3CGD A;  3KA7 A;  1K0J A;  3UTF A;  4Z25 A;  3RED A;  3V3N A;  3RHA A;  2OA1 A;  1TDK A;  3D1C A;  4OPL A;  2NPX A;  3IHG A;  3K7T A;  4REK A;  3SFD A;  5TR3 A;  1NEK A;  1F6M A;  5FMH A;  3CPI G;  4H4Z A;  1DJQ A;  3UKL A;  5C2T A;  1N4U A;  1LTX R;  3NTD A;  1TRB A;  1CC2 A;  1P2E A;  1LQT A;  1YQZ A;  3NH3 X;  4USR A;  4H2P A;  4A5L A;  2QA1 A;  3AEC A;  1XAN A;  2WDQ A;  1ZY8 A;  1B4V A;  4K5R A;  1N4W A;  2CVJ A;  1M64 A;  1GSN A;  1E1L A;  2C64 A;  4B67 A;  3AD7 B;  4BV6 A;  4Z44 A;  2XVJ A;  3ICT A;  4K7Z A;  4JDR A;  4UDQ A;  3AB1 A;  4U8M A;  1E7P A;  5HYM A;  1VG0 A;  1ELI A;  3LJP A;  5GSN A;  1EL9 A;  1YY5 A;  3GWD A;  1ZMC A;  5M10 A;  4Y4L A;  2APG A;  4EQR A;  4C77 A;  2WPC A;  1GRH A;  1O5W A;  1B8S A;  2R45 A;  4DSH A;  2YVG A;  3QFA A;  5L46 A;  4K22 A;  4LII A;  4O5U A;  2Q7V A;  3NT6 A;  2AR8 A;  1EL8 A;  1BKW A;  1QO8 A;  2B9Y A;  2JBV A;  4K5S A;  4X9M A;  2EQ6 A;  2GR2 A;  2GH5 A;  2TPR A;  3D8X A;  1XDI A;  2JB2 A;  3K30 A;  2HQM A;  2BC1 A;  4CY6 A;  3GRT A;  2XFN A;  4CRT A;  3SQP A;  2X8H A;  1YQ4 A;  2WEU A;  2YR4 A;  1QJD A;  2R0C A;  2V60 A;  4H2R A;  4BJZ A;  5BUL A;  4NTE A;  1IJH A;  4J57 A;  2WU5 A;  1E6E A;  3B6D A;  5FS8 A;  2XLT A;  3DK9 A;  5U1O A;  1Q1W A;  1EL5 A;  2FJB A;  3NYC A;  4OVI A;  3G5S A;  5BVA A;  4KX6 A;  2YLT A;  3UTG A;  1NPX A;  2BCG G;  4J34 A;  4UDR A;  2GR1 A;  3BI5 A;  4NTC A;  1E1M A;  1FL2 A;  2TMD A;  3UKK A;  1S3B A;  5BRT A;  3ITJ A;  4CCR A;  5JCK A;  1ZOY A;  1ZDL A;  5U25 A;  4IA5 A;  2GMH A;  3CGB A;  2C73 A;  3LAD A;  1PN0 A;  4C74 A;  3UP4 A;  1KNP A;  3UKQ A;  2XFU A;  5KOW A;  4H4U A;  4H50 A;  4EMW A;  5JCI A;  3GYJ A;  5C3J A;  1VQW A;  5CKU A;  3P1W A;  2RGO A;  2XLS A;  2YQU A;  3DK8 A;  3ICS A;  3AE7 A;  1S3E A;  3BNM A;  1OJA A;  1XHC A;  4HB9 A;  4A7A A;  3G5R A;  4RG4 A;  2GEW A;  3NK0 X;  2VZ2 A;  1RYI A;  5JCN A;  1MOK A;  3NK1 X;  2XVI A;  1COY A;  1O94 A;  1S2Q A;  3S5W A;  2RGJ A;  2IVD A;  2B9W A;  1FEC A;  3SUC A;  2CDU A;  3NYE A;  3CNP A;  2BXS A;  3S61 A;  4BUR A;  5JCL A;  1JU2 A;  4OPU A;  5J7X A;  4HA6 A;  4CCQ A;  3VRA A;  2Y6Q A;  3ATR A;  2QA2 A;  1NDA A;  3AE3 A;  2VVL A;  3F8D A;  2GF3 A;  4RSL A;  4DGK A;  2BS2 A;  3AE4 A;  1X31 B;  1GXF A;  3RP8 A;  1JNR A;  2ZBW A;  2YLZ A;  4U2L A;  2BXR A;  3R9U A;  1DJN A;  1NG3 A;  2WBA A;  4PAA A;  2GQF A;  3GD3 A;  2J3N A;  1DXL A;  3CPJ G;  1PS9 A;  5EOW A;  3GQH A;  1HYU A;  3FPZ A;  2QAE A;  2A87 A;  4IA6 A;  3P4R A;  4YTM A;  1CBO A;  3GD4 A;  3BI2 A;  4H4Y A;  5BUK A;  3G5Q A;  1D4D A;  4TM3 A;  4AP1 A;  1Y56 B;  1BF3 A;  3M12 A;  1PXA A;  4CNK A;  2RGH A;  2WOV A;  1FEA A;  4TLZ A;  3SFE A;  1ONF A;  1O95 A;  3CTY A;  2BYB A;  2Q6U A;  3GMC A;  3UOX A;  3ABV A;  3Q6J A;  1DOC A;  3H4K A;  3LB8 A;  4ICY A;  1B37 A; 
#chains in the Genus database with same CATH topology
 4ECH A;  3VRD B;  4H4R A;  4NNJ A;  4DV1 T;  1G73 A;  3OKQ A;  5FXV A;  4AT2 A;  2R7F A;  2YG5 A;  2YDQ A;  1BGN A;  1PXC A;  2R9Z A;  4BJN A;  2EHO D;  4DBR A;  2WOI A;  2C76 A;  4DR3 T;  2C5I T;  4IE0 A;  4EMJ A;  3CVR A;  3NWI A;  4HFH A;  2E4G A;  1YKH B;  3MA9 A;  4O4J E;  1BR2 A;  1VBA 4;  2QCU A;  4CNJ A;  1Q9I A;  4EQW A;  3RQW A;  2JKC A;  3C4A A;  1GRF A;  2OV9 A;  2V1D B;  1F3P A;  5ABF A;  5KRQ A;  2C5K T;  3KVE A;  2VQB A;  1ZK7 A;  5JH7 E;  1NCQ D;  1IJ5 A;  3SRZ A;  3EAN A;  1QLB A;  3AEF A;  2WET A;  3CX8 B;  4EQX A;  4H2Q A;  4ADW A;  2VL0 A;  3QB5 A;  4ZN0 A;  4WX1 A;  2LJL A;  5FS7 A;  4D03 A;  2XYO A;  3DK4 A;  1W0B A;  4Q4W 4;  5JTG A;  3RIU A;  5J2T E;  4AKL A;  4DNA A;  4K0K T;  2W00 A;  2IVE A;  2VKJ A;  2GB0 A;  3M13 A;  1PJ5 A;  4II3 A;  2WP6 A;  4J2W A;  4HFD A;  2AE9 A;  4GYS A;  1GRB A;  2V5Z A;  2WZI A;  1VCS A;  1AR7 4;  3KV4 A;  2NWB A;  3UTH A;  1Y56 A;  2Z5Y A;  3NK2 X;  2LT3 A;  3VR9 A;  2EX3 A;  2H88 A;  1H7W A;  2IDO B;  2XLU A;  2V3A A;  3DA1 A;  2V3B A;  2OLO A;  1YKE B;  4ZS3 A;  4J2C A;  1S2Y A;  2V7L A;  2XVE A;  3CNJ A;  1XDO A;  2CWY A;  1H6V A;  2LRL A;  1PDH A;  1VRQ B;  3AEB A;  2YIN A;  3ZKR A;  1VOM A;  4X9N A;  1V59 A;  1JNZ A;  4BK3 A;  1H82 A;  4U33 A;  3ZJ2 A;  3ZLI A;  3K8P C;  1JRX A;  2BAC A;  2XDO A;  4BJY A;  2PLV 4;  3TLS A;  4TWD A;  1IUU A;  1GES A;  4U8K A;  5M0Z A;  4LF6 T;  2NVK X;  4MJW A;  4NEW A;  4EYU A;  1FEB A;  4NPP A;  2YKS A;  3PUZ F;  4Q4Y 4;  4H9R C;  2XM2 A;  2YLX A;  1HNZ T;  2JMH A;  1UX5 A;  5AQI B;  3RP6 A;  1JRY A;  3BI4 A;  4JI1 T;  3P8C D;  4JI4 T;  3C4X A;  3CX7 B;  4LML A;  3DJD A;  2C72 A;  4PJM A;  3V5S A;  4YSX A;  3DH9 A;  2XY8 B;  1SE7 A;  2R46 A;  2CBJ A;  3TLU A;  2RS5 4;  3AA1 B;  4QX7 B;  4Z2T A;  4BJM A;  4NXM T;  3T2Z A;  4MHC A;  3VU7 H;  4AQF A;  5LOV E;  5AQO B;  1OED B;  4ILC A;  4ZCC A;  1T72 A;  3LOV A;  4YSY A;  4JY2 A;  3ZDN A;  4U8J A;  3RI5 A;  1E1N A;  1ZX9 A;  1NEN A;  3QNU A;  4A98 A;  1WRD A;  3H8I A;  4JBW F;  2JAE A;  1WR6 A;  3AE5 A;  2KMF A;  2GR3 A;  1D1B A;  3RKG A;  2PYJ A;  1TDE A;  4B3S T;  4ZCD A;  5AQN B;  5AQS B;  2GV8 A;  2ODV A;  3UKA A;  5EBK A;  3NN6 X;  3ISH A;  3OZ2 A;  2B1E A;  3NLC A;  3GDP A;  1KFY A;  1WCR A;  4QWN B;  3D0T A;  2X0L B;  4A99 A;  4U72 A;  2V7J A;  3J7Y q;  3OC4 A;  3N9Q A;  1DNC A;  2I0M A;  4APN A;  3GYI A;  1H8T D;  2H7O A;  3Q5X A;  4A6N A;  4JQ9 A;  4WBO A;  4NZH A;  4IVM B;  4CN6 A;  1IBM T;  5BMV E;  4USQ A;  2P9B A;  2YVJ A;  3ALJ A;  4B64 A;  2XVH A;  3A5X A;  4HE8 A;  1COV 4;  4TLX A;  1AR6 4;  3UUB A;  1T98 A;  2PG8 A;  2BK3 A;  3VHL A;  2VK9 A;  4Y4N A;  2K24 A;  3WI3 A;  4OPC A;  5KDM C;  5FY0 A;  3CQC B;  3T31 A;  1TYP A;  3URH A;  5FY1 A;  3DTO A;  2C67 A;  5KVI A;  2X3N A;  2X0Y A;  4CXW A;  1YW0 A;  1XZY A;  4A56 A;  2X99 A;  5JDH A;  4IRE A;  2LRK A;  5FXX A;  2CWO A;  4A9W A;  2XQY A;  3TLW A;  4PDW D;  2CXL A;  2VKD A;  5AQT B;  1TYT A;  3T1Y T;  4JI7 T;  3DGZ A;  3UOV A;  1VBE 4;  1N34 T;  3Q2M A;  1EBD A;  1SEZ A;  4IE7 A;  4DR1 T;  3ALL A;  1PBC A;  4JLE A;  3BNU A;  2KWI B;  4PW8 A;  3KU9 A;  1IUT A;  3EPT A;  2LKH A;  3RP7 A;  4TX5 A;  2NW9 A;  1RUH 4;  2KIN B;  1D1C A;  3C4Z A;  2GK9 A;  1P2H A;  4U8N A;  4AKH A;  2VOU A;  1KNR A;  2CLY B;  1H7X A;  3JSK A;  1GT8 A;  4GYR A;  4G74 A;  4Z26 A;  3AED A;  1MO9 A;  1FIO A;  3UKF A;  5LBM A;  2NTX A;  2RA1 A;  4B65 A;  1B7T A;  2AAQ A;  2YG7 A;  4Z2R A;  4C91 A;  2JRK A;  2HPJ A;  4WNK A;  4HTE A;  3N9M A;  1NWM X;  5JRE A;  4DR2 T;  3AYL A;  1K0L A;  2X9W A;  2VL8 A;  4KI0 F;  1F8W A;  2YR5 A;  5JCM A;  1VBD 4;  2XJ7 A;  3JAE A;  4GCM A;  3ZYX A;  3CGD A;  2OA1 A;  1TDK A;  1U4Q A;  3D1C A;  4TNW A;  3IHG A;  4DMV A;  4JV5 T;  1D0Z A;  4REK A;  3SFD A;  5TR3 A;  5F8P A;  1DJQ A;  1CC2 A;  1TRB A;  1YQZ A;  4A5L A;  2PW9 A;  4EAH A;  2WDQ A;  1ZY8 A;  1B4V A;  2I59 A;  4K5R A;  1QUU A;  1GSN A;  2C64 A;  2PY5 A;  3AD7 B;  4Z44 A;  2XVJ A;  4JDR A;  5FKY A;  2I6H A;  1ELI A;  3LJP A;  1RUD 4;  5M10 A;  3GWD A;  4Y4L A;  5H6Q B;  4JEU B;  1RUG 4;  4ILU A;  2WPC A;  1O5W A;  3PDY A;  5L46 A;  3L09 A;  4LII A;  2ACX A;  4O5U A;  2XSB A;  1PVC 4;  1QO8 A;  1QSD A;  2K9A A;  4QXB B;  2L8K A;  3D8X A;  2NR4 A;  2VQF T;  2XFN A;  3SQP A;  2X8H A;  1QJD A;  2R0C A;  2W62 A;  4BJZ A;  4Z91 A;  5BUL A;  3I9W A;  5LJN A;  1IJH A;  4ZHQ E;  3B6D A;  4J57 A;  4NTE A;  5U1O A;  1HNW T;  4DND A;  4QHO A;  2FJB A;  3NYC A;  4OVI A;  4TZ4 C;  4IDZ A;  3A8Y C;  4X66 T;  2ZM6 T;  1WLX A;  2YLT A;  4J34 A;  4UDR A;  3UKK A;  2CXF A;  5BRT A;  3ITJ A;  5AQQ B;  4O2A E;  3MK7 C;  3OJA A;  3CGB A;  3LAD A;  1RUI 4;  1WFD A;  4H4U A;  5HXC A;  3EDV A;  3ICS A;  4AI6 A;  3OPC A;  3BNM A;  3SZC A;  4HB9 A;  1BR0 A;  2DL1 A;  1RYI A;  5JCN A;  3PUS A;  1COY A;  2HH7 A;  2CDU A;  3NYE A;  3CNP A;  3S61 A;  5JCL A;  2HN2 A;  5J7X A;  4HA6 A;  3VRA A;  3EDU A;  3QB5 K;  3ZST A;  3AE3 A;  2D2S A;  4EYY R;  2VVL A;  2GF3 A;  1CUN A;  4RSL A;  1GXF A;  3AE4 A;  4EMW A;  1JNR A;  3IEE A;  4U2L A;  2XAH B;  3MXZ A;  3HA4 A;  3PV0 F;  1PS9 A;  3EHZ A;  3HI2 A;  1HNX T;  2QAE A;  1IJ6 A;  3GD4 A;  1Y56 B;  2WOV A;  1FEA A;  4X1Y E;  4KHP T;  2Q6U A;  4GOU A;  3RYI E;  3P7I A;  5AQG B;  1DOC A;  3K7M X;  3H4K A;  5LG4 A;  5ABE A;  1KDG A;  3RNM A;  4LF7 T;  2MPK A;  4AKI A;  1DOD A;  5JDG A;  1XNR T;  5DAB A;  1SHZ C;  3EF6 A;  1L9E A;  4O2B E;  4U2S A;  3H8L A;  3UKH A;  2PZS A;  3KKJ A;  4GKJ T;  4EMI A;  4BK2 A;  5JR9 A;  2BS3 A;  3SOL A;  2XQ6 A;  3AE1 A;  3UQ4 A;  3X1D A;  3BHK A;  2L3L A;  4DV6 T;  2Y6R A;  5LHH B;  3NZQ A;  2IC9 A;  2BAB A;  4O5Q A;  4TM4 A;  4A6N B;  2ACZ A;  1LVL A;  3PUX F;  4K2X A;  1ZMD A;  3N5L A;  2C4C A;  4FDC B;  5HCM A;  2GQW A;  2DWK A;  2ZM8 A;  4TUY E;  5J60 A;  4C5O A;  3I3L A;  3ZYL A;  2JB1 A;  4LFA T;  4DBQ A;  1WYC A;  4P0A A;  2YG3 A;  1XPQ A;  1H81 A;  2JB3 A;  5KXJ A;  1D4M 4;  3BQK A;  4XWR A;  3ZC0 A;  3CND A;  2E9X D;  5CA0 E;  1PBF A;  2XPK A;  4HN9 A;  1CC4 A;  1MIV A;  3JBG 4;  1BEV 4;  3ADA B;  2E2A A;  3MJX A;  3ONL C;  3NGC X;  1RSG A;  1OED A;  4MFR A;  1N4V A;  2VRL A;  3PUR A;  3JAD A;  4EV6 A;  4NTD A;  5GRT A;  1EAH 4;  1LVF A;  2OLN A;  2Q0L A;  1VRB A;  2X8G A;  4GDE A;  1J5E T;  3UFG A;  4QXH B;  2FJE A;  4U8I A;  1BR4 A;  5CA1 E;  4OPG A;  3CGE A;  4JYA T;  4DV4 T;  1F8R A;  1Z0P A;  1LJ1 A;  4FI5 A;  2KXP B;  4YTN A;  3DME A;  2UXB T;  1G8X A;  1K0I A;  4H9Q C;  3BQI A;  4ZI7 E;  2YM1 A;  4G9K A;  5FL0 A;  3SGL A;  3ANW B;  2XQA A;  3UUL A;  4JY3 A;  1FMV A;  4CY8 A;  2WHD A;  3Q9D A;  4H4W A;  2H89 A;  3DJJ A;  1MND A;  3GSI A;  3LZW A;  4QH5 A;  3RIA A;  3OBV E;  1HS7 A;  5U63 A;  2W4X A;  1M7K A;  3RX6 A;  2JQ9 A;  4BK1 A;  3NN0 X;  1GAL A;  1Y64 B;  4OPI A;  3O1J A;  4FK1 C;  2X51 A;  4O8S A;  2BK4 A;  4QXC B;  3UQ7 A;  1HTJ F;  3ZMV B;  2OLT A;  3Q9T A;  4PJN A;  4DO0 A;  1OJD A;  2IC6 A;  2BKO A;  3Q5E A;  2QA7 A;  3PUV F;  1M6I A;  4IV9 A;  2R4E A;  3F8R A;  3RPU A;  1OJC A;  5J1G A;  3AA0 B;  3T8O A;  1GRA A;  1UUR A;  2XM1 A;  2ES0 A;  3IC9 A;  3ZJ1 A;  3W15 B;  4GF7 A;  3ESL A;  3VKG A;  4A65 A;  3O9X A;  1ZHC A;  3AE8 A;  3LDQ B;  2VAS A;  2WPF A;  3ZSS A;  3KDS E;  5JRC B;  3C64 A;  4U2Z A;  3P50 A;  5AFU L;  5L3G B;  2E9X A;  3CPH G;  5L4H A;  2BA9 A;  3HYW A;  3LJC A;  4P09 A;  3ZT6 A;  3J9X 1;  4B3R T;  1JOA A;  5HAX A;  4UVC B;  4N9X A;  2MAW A;  4Z24 A;  5IWA T;  5FVL A;  2GVC A;  4YSH A;  3U3I A;  4H9O C;  2WB5 A;  3JC6 C;  3AD8 B;  3SZF A;  1J5W A;  3NTA A;  1VG9 A;  3KPK A;  2BK5 A;  2WQY A;  3RRW A;  4TV8 E;  1FJG T;  3O0H A;  3IBP A;  1CJ4 A;  3NYF A;  1IZN B;  2EHO B;  1BGJ A;  3OVU A;  5LCY A;  2BVL A;  4BA9 A;  2XQ5 A;  2VWA A;  1VBC 4;  2A72 A;  4ANJ A;  3EUH A;  4C3X A;  3PU3 A;  2LM9 A;  4U2Y A;  1HFA A;  3FBS A;  3ZT5 A;  4XWZ A;  2E8I A;  3P9U A;  2WWU A;  3ZN1 B;  2AQJ A;  1KF6 A;  2R0G A;  2XQ4 A;  1E1K A;  3HZL A;  1FOH A;  3S4U A;  4ADZ A;  3QJ4 A;  2WSS V;  3PUW F;  3FI7 A;  2JMK A;  2XFO A;  4J31 A;  2N2N A;  2LSY A;  4NEV A;  3LK2 B;  4Q4X 4;  4MAL A;  2VQ7 A;  2WS3 A;  2V6Y A;  3N2G E;  4I58 A;  1EV1 4;  1FCD A;  3PE0 A;  1PJ6 A;  4AOX A;  1E39 A;  2HWC 4;  4M1P A;  3QVP A;  4CN4 A;  5HWY A;  5E0O A;  4HFI A;  4H4S A;  5IYZ E;  5J0Z A;  5L3B B;  4C3Y A;  3EVY A;  2GMJ A;  4J33 A;  1GV4 A;  1GQE A;  2YU1 A;  3QK6 A;  5JQG E;  2CE7 A;  1GRE A;  2LKG A;  1CJC A;  1YKJ A;  2D0T A;  2VVL G;  3GWH A;  3NIX A;  2WU2 A;  1N32 T;  5HXS A;  3NVO A;  5L4E A;  1BZL A;  4UEM A;  5L3D B;  4U7Y A;  5ADX L;  3T14 A;  4DUZ T;  2J1D G;  4KHZ F;  3L1R A;  3UP5 A;  3RHW A;  5JDF A;  4FK1 A;  5LBQ B;  4GKK T;  2Y6X A;  5F5W A;  2BZB A;  2WMO A;  3ZMS B;  2V7K A;  4IDQ A;  2AXD S;  2R04 4;  3RIU C;  3WE0 A;  4KPR A;  5LGU B;  4LMJ A;  4RG3 A;  1OOP D;  2LHR A;  1FEW A;  2BCP A;  4JI2 T;  2ZMA A;  4YXD A;  2C5J A;  5CJ5 A;  4H4Q A;  3AEE A;  4L0R A;  2ZM2 A;  5L47 A;  1WR0 A;  1J1J A;  4KP3 C;  2GAG B;  5KOX A;  1F8S A;  2CHN A;  4HWF A;  2YOE A;  1W09 A;  1DU2 A;  2NP9 A;  1KSS A;  1K0J A;  2XQ7 A;  3L3P A;  4OPL A;  2W63 A;  5HEG A;  3ZMT B;  3K7T A;  3CPI G;  4HKA A;  3NTD A;  2W0G A;  3NH3 X;  3IA3 A;  2R07 4;  5L3F B;  2A9U A;  2QA1 A;  4DID B;  3UUX B;  3B13 A;  2YN6 A;  1M64 A;  2LSI A;  4JEH B;  1HRV 4;  4B3M T;  4YFS A;  3R6N A;  1LRZ A;  5FXZ A;  5HYM A;  4AQG A;  4U8M A;  3SWH A;  4QKN A;  1AL2 4;  1HRI 4;  5HCJ A;  2LSG A;  2APG A;  1GRH A;  3KV5 A;  2W67 A;  1MMA A;  3FZH B;  5HEU A;  1MNE A;  4K22 A;  5JRC A;  2Q7V A;  3NT6 A;  4QX8 B;  3MZK B;  1EL8 A;  2B9Y A;  2JBV A;  4K5S A;  1Z7S 4;  2EQ6 A;  4CI1 B;  2PBI A;  2GH5 A;  3O1I A;  2HQM A;  2BC1 A;  3GRT A;  4JI5 T;  4CRT A;  3KVB A;  2V26 A;  4B3T T;  2YR4 A;  2WU5 A;  5FS8 A;  3PUQ A;  4CQI A;  1EL5 A;  2BKP A;  1RUF 4;  4MLK A;  5KNL A;  2BRA A;  1S94 A;  3QOF A;  4HFB A;  1KNZ A;  1LVK A;  2ODU A;  5ABF B;  2BCG G;  3CQG B;  3EAM A;  5FYM A;  2GR1 A;  4IE4 A;  1S3B A;  2DI4 A;  4X20 E;  1ZDL A;  4O4H E;  4ZZB A;  3LSV A;  5FP3 A;  4EGW A;  4G2A A;  2GMH A;  1PN0 A;  5KOW A;  2XFU A;  3GYJ A;  3N2O A;  5H6R B;  4B6X A;  2LM2 A;  2XLS A;  3KVA A;  1S3E A;  3KIN B;  4HWC A;  1XHC A;  4A7A A;  4RG4 A;  3T0K A;  5LGT B;  3NK0 X;  2VZ2 A;  3OYX A;  1MOK A;  3F31 A;  4CI2 B;  3EI0 A;  2B9W A;  1FEC A;  2IVD A;  4TN7 B;  1RHI 4;  2BXS A;  1MQT D;  1JU2 A;  3K3O A;  4DMW A;  3RYH E;  4U74 A;  3C50 A;  2BVM A;  3RP8 A;  2YLZ A;  3PJA A;  1DJN A;  1NG3 A;  3GD3 A;  2J3N A;  1DXL A;  3CPJ G;  1XHX A;  5EOW A;  3GQH A;  1HYU A;  3FPZ A;  3P4R A;  3M65 A;  4YTM A;  5BUK A;  2W61 A;  1V9D A;  4TM3 A;  4F8H A;  1UX4 A;  2RGH A;  3SFE A;  2NW7 A;  4XAX B;  1O95 A;  4IE6 A;  2E9X B;  3ABV A;  5JVD E;  4IIJ E;  5DQV A;  3Q6J A;  2VRM A;  1GET A;  3V76 A;  2V6O A;  2XFP A;  3GN5 A;  4FJO A;  1IBK T;  4EB6 E;  2WCA A;  3AWI A;  1OXZ A;  4XBF B;  1GRT A;  3QSM A;  2BKN A;  2CA5 A;  1D4C A;  2LFC A;  4TWF A;  3UUM A;  3P4S A;  1UUS A;  2XFQ A;  3I0O A;  3LG7 A;  2GAH B;  4ZEY A;  4IST A;  3AEA A;  5IPY A;  4YHH T;  5L3E B;  2ZZC A;  3CML A;  4H4V A;  1CF3 A;  2O9Z A;  3CX6 B;  2GR0 A;  1H86 A;  3IHR A;  1XI1 A;  4U2T A;  4PFP A;  1RUC 4;  3C4W A;  2XZE A;  2WOW A;  3HYV A;  5FS9 A;  2WBL A;  2RP4 A;  4DV2 T;  4H4P A;  3V3O A;  4EZH A;  2DWG A;  3NHO X;  1HX8 A;  4HGA A;  1GTH A;  1Y0P A;  2DLR A;  4KBM B;  3FXD B;  4I0U A;  4U3C A;  5FXW A;  4L5G A;  1JRZ A;  3ZYM A;  3L8K A;  4JNQ A;  3KBT A;  3FMW A;  2KT9 A;  3TLT A;  4Z8X A;  4YLH A;  4WW0 A;  3J8F 4;  1X9B A;  2XAG B;  3PUY F;  4HFE A;  1H83 A;  2D5U A;  4JN9 A;  5KMG P;  4G63 A;  3UOY A;  1TDF A;  4Z90 A;  2X5I D;  2VVM A;  2ZZB A;  5EK3 A;  5LP6 E;  2CM0 A;  2XUE A;  3P4P A;  2YLR A;  3E1T A;  1MMG A;  3SXI A;  2VVN A;  1HR0 T;  1AJ3 A;  3UOZ A;  3ZCJ A;  5KMP A;  3VR8 A;  4LFB T;  5L2L A;  5CGM A;  4LFC T;  2C3D A;  4EIQ A;  1NHR A;  1PHH A;  4H9S E;  2JIW A;  2XAS B;  1US7 B;  3QVR A;  5KMQ A;  5ABH A;  2FJD A;  3FB2 A;  3BK9 A;  3RGL A;  4OHF A;  4GUV A;  1RUE 4;  3P4W A;  4JNA A;  2OA5 A;  2WM9 A;  4B1B A;  1VRH 4;  5JR9 B;  1MXT A;  1TDN A;  4Y4M A;  2J47 A;  3JCF A;  3RKO A;  2B76 A;  3I0Q A;  1AOG A;  1L9D A;  4HFV A;  3FXE B;  5DQW A;  2C7G A;  4N78 D;  3C96 A;  2C66 A;  3ZCI A;  1RMU 4;  4DV3 T;  2W66 A;  1EZ3 A;  2CMR A;  3MKD A;  5ER0 A;  3K3Q C;  2Q0K A;  2Z5X A;  2E5V A;  3KBU A;  1HCI A;  4TM1 A;  2XAJ B;  1LQU A;  4LA1 A;  4U8L A;  1W0A A;  2YLS A;  1T7S A;  2VVS A;  3NG7 X;  4BAY B;  1ZP0 A;  1PO2 4;  4X1K E;  4UVA B;  4E0V A;  2BS4 A;  2DHR A;  4LF5 T;  1XDP A;  2IML A;  2UXC T;  1ZKE A;  2IUB A;  4X62 T;  3TKL B;  5HXI A;  1CC6 A;  3FZL B;  3RQU A;  1D5T A;  4F6R C;  2JQQ A;  1Q1R A;  1LV0 A;  3RC3 A;  4XZC A;  5M4Y A;  2Y48 B;  2DNX A;  2UU9 T;  3CWZ B;  2PYL A;  4DR4 T;  5FY7 A;  4I59 A;  1UCU A;  4Q4V 4;  4O4L E;  4ILB A;  4GRT A;  4TV9 E;  2BBJ A;  4GR1 A;  4AIU A;  5DBJ A;  3ETU A;  2LHN A;  1D7Y A;  3KFW X;  4GK0 E;  4PNI A;  1K4Q A;  3CQX C;  3NZP A;  5JDL A;  4I43 B;  5AQL B;  1CJ3 A;  4DUY T;  1L9C A;  3ZT7 A;  4DV7 T;  4DR7 T;  1N33 T;  4X1I E;  4H7U A;  4GK5 E;  3LFM A;  3LK4 2;  4CBQ A;  3QSS A;  4I4T E;  4A97 A;  2YR6 A;  2CBI A;  1ZOV A;  2YG6 A;  4U8P A;  1H7C A;  4UP3 A;  2WP9 A;  2BC0 A;  2R4J A;  3Q5D A;  1CJ2 A;  3N9N A;  2C3C A;  4ZZC A;  3AD9 B;  3SM8 A;  3AAA B;  4GDP A;  1OJ9 A;  1LPF A;  3I6D A;  1HG5 A;  4B66 A;  2WPE A;  4LMK A;  3CNT A;  4YT0 A;  1GTE A;  4AOS A;  3HYX A;  1B5Q A;  3KV6 A;  2QYW A;  3E0Z A;  4X4J A;  3C4N A;  2PTF A;  4YSZ A;  2V5C A;  1GRG A;  4AP3 A;  5LYJ E;  4K8D A;  2H3R A;  3CNS A;  1CHU A;  3AVR A;  2ARD A;  1MMD A;  3AYI A;  1PJ7 A;  3RC8 A;  3GYX A;  4HWD A;  5CB4 E;  2JK6 A;  1VCT A;  1GER A;  1O3X A;  4M52 A;  2WMN A;  2H7V C;  4YKF A;  1YQ3 A;  3HKD E;  1OED E;  5EB4 A;  3CGC A;  2XQ8 A;  2BDE A;  4AT0 A;  5JR9 C;  3ICR A;  5HHF A;  3FIM B;  5AQH B;  4NXN T;  4ZXL A;  2VUR A;  2BG9 A;  3LK3 B;  5LNK A;  3UCL A;  3N2K E;  3N9P A;  2W0H A;  4TNV A;  3BHF A;  4H9N C;  4IE5 A;  3VQR A;  5LMN T;  4K0U A;  3LBX B;  2LLY A;  3ZN0 B;  1XNQ T;  2M67 A;  3U78 A;  5LGN B;  2XLP A;  3Q5W A;  5AQF B;  2DKI A;  5LMU T;  2WDV A;  2CXD A;  4UV9 B;  4YWO A;  3K7Q X;  5CQF A;  3NRY A;  3UFE A;  2WDR A;  4GAV A;  5KMS A;  5HY5 A;  2X8C A;  4UF0 A;  3DGH A;  2F4V T;  2X0H A;  2MYS A;  3FG2 P;  5FNV E;  1D7L A;  5EB5 A;  4OYK A;  3AXJ B;  4EIP A;  3EAO A;  5AQP B;  3IWA A;  1W4X A;  3P4Q A;  2Q9Q B;  2EHO C;  2CEA A;  2LOS A;  4QH4 A;  4PK4 A;  1IUS A;  2VKO A;  1BWC A;  2WWV A;  1YD8 G;  3UU3 A;  2NTY A;  2MBG A;  2BBH A;  2V7M A;  2WP5 A;  1GND A;  2B7R A;  1PBE A;  2EQ8 A;  2G0U A;  3O1H A;  2KND A;  3GWF A;  4JUY A;  4WBN E;  3K1S A;  3RED A;  3H37 A;  2XAF B;  3AB3 B;  2RR1 4;  2NPX A;  2JPF A;  3AA7 B;  1NEK A;  2UXD T;  3UKL A;  4UXN B;  4USR A;  2HN1 A;  1HXS 4;  3AEC A;  4ZOL E;  1AR9 4;  1N4W A;  2CVJ A;  5HWX A;  3ZC1 A;  3ZEF B;  3HKB E;  5DJQ C;  5CFB A;  4UDQ A;  4K7Z A;  2LE8 A;  3AB1 A;  1E7P A;  1VG0 A;  5EK4 A;  1IAP A;  5GSN A;  1EL9 A;  4X5T A;  1YY5 A;  1I94 T;  4C77 A;  2Y8D A;  3H3A A;  2Q9Q D;  4ISS A;  3FZF B;  2YVG A;  3QFA A;  2ZLY A;  2R6G F;  4IDO A;  2AR8 A;  3A7M A;  4EZ4 A;  1NAF A;  2X67 A;  5FVK A;  4CZZ B;  4X9M A;  2TPR A;  3K30 A;  1YQ4 A;  3RLF F;  2WEU A;  2V8S V;  4ZS2 A;  3DK9 A;  4ZI3 D;  3B57 A;  2VQE T;  1XWM A;  3GMI A;  3ANW A;  4YJ3 E;  2W2U A;  2RM2 4;  4YHJ A;  3B5M A;  2L9Q A;  2C0S A;  5F3J A;  4HWH A;  3BI5 A;  1E1M A;  3SZW A;  1ZOY A;  3AXJ A;  5U25 A;  3EAB A;  3MAC A;  4H9P C;  2C73 A;  3UKQ A;  1R8I A;  2IIU A;  5A1L A;  5JCI A;  2XHE B;  1VQW A;  2WY2 A;  5HEJ A;  4NUU A;  3T1H T;  2RGO A;  4RHV 4;  2YQU A;  1HG2 A;  4HWI B;  1OJA A;  3C98 B;  4CXX A;  3G5R A;  3I9Y A;  2GEW A;  3DJB A;  4TWH A;  2XVI A;  3ONX A;  2UUB T;  3NRX A;  4ASK A;  4DV5 T;  3FBZ A;  4CCQ A;  3PUG A;  2XTL A;  1ZEE A;  2K3W A;  2YDS A;  2QA2 A;  1NDA A;  2UXN B;  2ZM0 A;  4DGK A;  2K5B B;  2BXR A;  3R9U A;  2WBA A;  2QRX A;  2GQF A;  4PAA A;  1D0X A;  3L8R A;  2A87 A;  4IA6 A;  5AQM B;  5AQU B;  3UUN A;  4EEB A;  3G5Q A;  1D4D A;  4AQF C;  2YDR A;  1BF3 A;  4KUM B;  4H63 V;  4COF A;  4TLZ A;  1RVF 4;  3IF8 B;  2UUC T;  2BYB A;  1S35 A;  1XMQ T;  2BG9 C;  4PJJ A;  4IHJ E;  3UTF A;  3LB8 A;  3UU5 A;  3G06 A;  3O4X E;  2YAU A;  2DKH A;  2FJA A;  3E22 E;  1H84 A;  3QC9 A;  2PYX A;  1Z8U A;  4GB3 4;  1T8B A;  3UU8 A;  3AXB A;  4PAG A;  4DVD A;  3FZK B;  3E08 A;  1MIY A;  2V61 A;  2YVF A;  3SS1 A;  4TM0 A;  4ZI2 D;  4H4T A;  3F2E A;  2N9D A;  1U5P A;  3GA8 A;  4XXG A;  5IUX A;  4EOZ B;  4Q25 A;  2LSJ A;  4WCT A;  3RYF E;  3IF9 A;  1NG4 A;  4IGU A;  2QVA A;  4G6G A;  2X66 A;  2HHH T;  3JC6 D;  4CXY A;  3WAK A;  2VKH A;  2WAU A;  1IUX A;  4DV0 T;  5FL1 A;  5LV9 A;  1IBL T;  2IHR 1;  3QUJ A;  2C70 A;  2IID A;  3RYC E;  3RF1 A;  5HXH A;  2XVF A;  2V5D A;  2XSA A;  3ALM A;  1ASJ 4;  2YEV C;  1D1A A;  5JDN A;  3V5U A;  3CIR A;  1JEH A;  3PJA J;  3L39 A;  5HXR A;  2X68 A;  3ZPO A;  5FS6 A;  1HX1 B;  2FBW A;  1MIW A;  2M6I A;  4UDP A;  4IVO B;  4IL4 A;  2YM2 A;  4U8O A;  5JDQ A;  5IQ1 A;  4AXP A;  3RIF A;  4OFZ A;  4I55 E;  2KLQ A;  3ZYK A;  1DOB A;  3FZM B;  5KWF A;  1X79 A;  4U31 A;  1VDC A;  1GOS A;  4PAB A;  1L0V A;  3QSE A;  4G6H A;  4P9S A;  1I6Z A;  2Z6E A;  4C90 A;  4Z43 A;  4Z2U A;  4L9I A;  3SX6 A;  2CRB A;  3GN5 B;  4EM4 A;  3CMM A;  4EM3 A;  3KPF A;  3GRS A;  4AIS A;  2RAB A;  3QFB A;  1NHQ A;  4PK5 A;  4JI3 T;  4YY3 T;  3CPZ A;  4CI3 B;  2V7I A;  3HKC E;  4FX9 A;  1GPE A;  1OJT A;  4GAP A;  5KVH A;  4H4X A;  1NA1 D;  5AQJ B;  2IAK A;  2XQ3 A;  4B68 A;  1OED C;  3ZMZ B;  3RRC A;  4EQS A;  3ETV A;  2R0P A;  1POV 0;  2EQ7 A;  2C75 A;  4B69 A;  3HR0 A;  1FMW A;  4D04 A;  2CFY A;  2LOP A;  1NHS A;  2KWH A;  3OYZ A;  2GRT A;  3N9L A;  2OAL A;  3F8P A;  2M6B A;  4PK6 A;  5AQK B;  3WAJ A;  2RS3 4;  4IDN A;  5TAO A;  1PBD A;  4UEL A;  4UR9 A;  1RP0 A;  4A5X A;  2V6Y B;  2E5L T;  4EIW A;  3DJE A;  4LU6 A;  1NAA A;  5J2U E;  2PFV A;  3DJG X;  2CUL A;  2YLW A;  4AKG A;  3GDN A;  5GON E;  5LB7 B;  2X50 A;  2UZZ A;  2D0U A;  3LBX A;  3CN8 A;  2X9Y A;  3ATQ A;  4H63 H;  3T2K A;  3TLV A;  2B9X A;  4DSG A;  1TDO A;  3CKD A;  4OPT A;  1E1H B;  2E9X C;  2J62 A;  4P0B A;  1BR1 A;  3COX A;  2ZZ0 A;  4JI8 T;  3UU6 A;  3NKS A;  4HFC A;  1PBB A;  2A89 A;  3HKE E;  4JI0 T;  4IT4 A;  1PO1 4;  3NRN A;  2A3D A;  4LF9 T;  1NHP A;  2A8X A;  1Y01 A;  3IHM A;  3AE9 A;  5IQ4 A;  3ONJ A;  2PJQ A;  3PUA A;  3GQK A;  2FUP A;  4DR5 T;  3PVC A;  2Q9Q A;  4OX9 T;  5EZY E;  4B63 A;  2NOX A;  1SA0 E;  2SPC A;  2YK0 A;  1D0Y A;  2I0Z A;  3T37 A;  1PIV 4;  1AR8 4;  2MTQ A;  5IHY A;  3VRB A;  2HWB 4;  4IL9 A;  3AAI A;  2V6X A;  2KSR A;  4J36 A;  1R08 4;  4UV8 B;  4OYJ A;  4DR6 T;  2RPA A;  2HPL A;  2EQ9 A;  1Z6L A;  1UGO A;  3ZMU B;  2OAM A;  1DOE A;  2MOZ A;  3VKH A;  3SY4 A;  4I50 E;  2XCG A;  2B7S A;  1SUM B;  4J56 A;  3R84 B;  1OWA A;  2LSK A;  3AE2 A;  1MMN A;  2XQ9 A;  4MBQ A;  3AYJ A;  3AEG A;  4OK0 A;  4E7S A;  5FMN A;  3AAE B;  2XLR A;  1EL7 A;  5EK2 A;  2R06 4;  2CLY C;  1YXR A;  4YTP A;  4JI6 T;  4X65 T;  2LEH A;  4X64 T;  2J4G A;  3LZX A;  2E1M A;  3B3R A;  5HYA A;  3GMB A;  4P1N A;  1ZV4 X;  4A79 A;  5ABG A;  4EED A;  5LHG B;  2CHO A;  2UXX B;  4ZI2 C;  3PO7 A;  3JAF A;  1UKV G;  4AQY T;  1IUW A;  4O4I E;  1IUV A;  5HEH A;  2JQK A;  2JJ9 A;  3RH3 A;  2WZH A;  1XHZ A;  2C65 A;  5LG3 A;  1ZKQ A;  4YKG A;  1WYB A;  2UUA T;  3II4 A;  3SYI A;  2KZ7 B;  3AE6 A;  3M0O A;  4H2N A;  4LF4 T;  4OPD A;  1N1P A;  1GEU A;  3AVS A;  1KSU A;  4E7Z A;  5AQR B;  2X9X A;  5KX5 E;  3KLJ A;  2WES A;  2F5Z A;  5BR8 T;  4OCG A;  3UKP A;  2VB6 A;  1CL0 A;  2PHH A;  3FHN A;  3UU4 A;  1W9R A;  4UIG A;  3T2Y A;  3KD9 A;  5KMR A;  3NKZ A;  3BQL A;  1REO A;  2IW5 B;  2YWL A;  1D4E A;  2X9H A;  2EHO A;  5AQV B;  4HEA A;  2DCF A;  3PS9 A;  3UTE A;  4NUV A;  2YG4 A;  1E2A A;  5LXT E;  3NNE A;  4V1A v;  1PXB A;  4NIQ A;  3KA7 A;  2D9D A;  4Z25 A;  4PFO A;  3V3N A;  3RHA A;  2XAQ B;  4QH1 A;  3C51 A;  1F6M A;  5FMH A;  5ETW A;  4H4Z A;  5C2T A;  1N4U A;  1LTX R;  1P2E A;  2RS1 4;  1LQT A;  4NWZ A;  2RMU 4;  4YJ2 E;  4H2P A;  1XAN A;  1LKX A;  1E1L A;  4B67 A;  2JQH A;  3PTR B;  3DP7 A;  4BV6 A;  3ICT A;  2YU2 A;  5LJM A;  3H3M A;  1ZMC A;  4WYV A;  4EQR A;  2K48 A;  1B8S A;  2R45 A;  4DSH A;  2BG9 B;  3HL6 A;  1KK7 A;  1BKW A;  4UVB B;  1K5M D;  2GR2 A;  1XDI A;  2JB2 A;  3CK6 A;  3PU8 A;  4CY6 A;  4ZI3 C;  3KV9 A;  4KMC A;  2V60 A;  4H2R A;  1XMO T;  1E6E A;  3NBX X;  3OTO T;  2XLT A;  1Q1W A;  5JDM A;  3JD7 4;  5LHI B;  3G5S A;  5BVA A;  4KX6 A;  3UTG A;  1NPX A;  4II2 A;  4UF0 B;  4G73 A;  4NTC A;  1FL2 A;  2TMD A;  2A2F X;  5C8Y E;  4AKR B;  3M3Z B;  4CCR A;  5JCK A;  4ERR A;  3UT5 E;  3N9O A;  4IA5 A;  2Q9Q C;  2CCQ A;  3FBL A;  2BG9 E;  4C74 A;  1VBB 4;  3UP4 A;  1KNP A;  4H50 A;  5C3J A;  5LA6 E;  1KEY A;  5CKU A;  1R09 4;  4IDP A;  3P1W A;  2CPT A;  3DK8 A;  3AE7 A;  3I1A A;  3NK1 X;  2N1G A;  1O94 A;  1S2Q A;  3S5W A;  2RGJ A;  4U7I A;  3AA6 B;  5HXE A;  1N36 T;  3SUC A;  4BUR A;  4OPU A;  5HEO A;  2Y6Q A;  3ATR A;  4LF8 T;  4CN1 A;  3UTK A;  3F8D A;  1HF8 A;  2BS2 A;  1X31 B;  2ZBW A;  5L3C B;  3K3N A;  4WZX A;  3F57 A;  1CBO A;  4H4Y A;  3BI2 A;  1RUJ 4;  4AP1 A;  2QGS A;  3M12 A;  1PXA A;  3SZ0 A;  4CNK A;  1UK5 A;  2BRY A;  1ONF A;  3CTY A;  4GIW A;  4ILA A;  3GMC A;  3UOX A;  4EXT A;  4PJL A;  1M62 A;  2NW8 A;  3LXD A;  4ICY A;  1B37 A; 
#chains in the Genus database with same CATH homology
 1KDG A;  1GET A;  2VRM A;  2V6O A;  3V76 A;  2XFP A;  3RNM A;  4ECH A;  3VRD B;  2YAU A;  4H4R A;  2DKH A;  4NNJ A;  2FJA A;  1DOD A;  3AWI A;  1H84 A;  3EF6 A;  1L9E A;  4U2S A;  2PYX A;  3H8L A;  3QSM A;  1GRT A;  4AT2 A;  3UKH A;  2YG5 A;  1BGN A;  3KKJ A;  4EMI A;  1PXC A;  1D4C A;  2LFC A;  3AXB A;  4BK2 A;  2R9Z A;  3P4S A;  2WOI A;  2C76 A;  2XFQ A;  2GAH B;  2BS3 A;  3AEA A;  3AE1 A;  3BHK A;  5IPY A;  4EMJ A;  2V61 A;  2Y6R A;  2YVF A;  2E4G A;  2ZZC A;  2BAB A;  2QCU A;  4CNJ A;  1Q9I A;  4O5Q A;  4H4V A;  4TM4 A;  4EQW A;  4A6N B;  1CF3 A;  2JKC A;  3C4A A;  1GRF A;  4TM0 A;  2O9Z A;  2ACZ A;  1LVL A;  2GR0 A;  1H86 A;  1F3P A;  4K2X A;  1ZMD A;  5KRQ A;  4H4T A;  3KVE A;  2VQB A;  1ZK7 A;  4XXG A;  2C4C A;  4FDC B;  4WCT A;  4U2T A;  3IF9 A;  1NG4 A;  2GQW A;  4G6G A;  3EAN A;  4C5O A;  5J60 A;  1QLB A;  3I3L A;  2WOW A;  2JB1 A;  3AEF A;  2WET A;  3HYV A;  5FS9 A;  4EQX A;  2YG3 A;  1XPQ A;  4H2Q A;  1IUX A;  1H81 A;  4H4P A;  4ADW A;  2JB3 A;  3V3O A;  5KXJ A;  5LV9 A;  3NHO X;  2C70 A;  1GTH A;  4ZN0 A;  1Y0P A;  2IID A;  4XWR A;  4WX1 A;  2XVF A;  3CND A;  5FS7 A;  1JRZ A;  4D03 A;  3ALM A;  3L8K A;  1PBF A;  1CC4 A;  4JNQ A;  3FMW A;  2XYO A;  3DK4 A;  1JEH A;  3CIR A;  1H83 A;  3ADA B;  4JN9 A;  3NGC X;  3UOY A;  1RSG A;  1TDF A;  5FS6 A;  4DNA A;  2FBW A;  4UDP A;  2IVE A;  4IVO B;  1N4V A;  2YM2 A;  4U8O A;  2GB0 A;  2VRL A;  2VVM A;  2ZZB A;  3M13 A;  5IQ1 A;  4NTD A;  1PJ5 A;  3P4P A;  2WP6 A;  2YLR A;  4J2W A;  4II3 A;  5GRT A;  2OLN A;  1GRB A;  1DOB A;  2Q0L A;  2V5Z A;  2X8G A;  3E1T A;  4GDE A;  3UTH A;  2FJE A;  3SXI A;  5KWF A;  1Y56 A;  2Z5Y A;  4U8I A;  3UOZ A;  5KMP A;  1VDC A;  3NK2 X;  3VR8 A;  1GOS A;  1L0V A;  3VR9 A;  4PAB A;  3QSE A;  2H88 A;  4G6H A;  4OPG A;  3CGE A;  1H7W A;  4P9S A;  3DA1 A;  2XLU A;  2V3A A;  2C3D A;  4EIQ A;  1NHR A;  1PHH A;  1F8R A;  2OLO A;  2V3B A;  1S2Y A;  1LJ1 A;  4Z43 A;  4Z2U A;  4YTN A;  2XVE A;  3DME A;  3QVR A;  3CNJ A;  3SX6 A;  5KMQ A;  1K0I A;  1H6V A;  4EM4 A;  2FJD A;  1PDH A;  1VRQ B;  3CMM A;  3AEB A;  4EM3 A;  3KPF A;  3GRS A;  2YM1 A;  3LXD A;  4G9K A;  2RAB A;  3QFB A;  4GUV A;  1NHQ A;  3SGL A;  4X9N A;  4JNA A;  1V59 A;  1JNZ A;  4JY3 A;  4CY8 A;  4BK3 A;  1H82 A;  4B1B A;  2WHD A;  4FX9 A;  1GPE A;  1MXT A;  1OJT A;  1TDN A;  4Y4M A;  4GAP A;  2B76 A;  1JRX A;  2BAC A;  2XDO A;  4BJY A;  4H4W A;  5KVH A;  2H89 A;  1L9D A;  1AOG A;  5M0Z A;  1IUU A;  1GES A;  3DJJ A;  4H4X A;  4U8K A;  2C7G A;  2NVK X;  3C96 A;  3GSI A;  2C66 A;  4B68 A;  4MJW A;  3LZW A;  4NEW A;  1FEB A;  4EQS A;  2R0P A;  2EQ7 A;  2C75 A;  4B69 A;  4D04 A;  2CFY A;  1NHS A;  5U63 A;  5ER0 A;  2YLX A;  2Q0K A;  2Z5X A;  2GRT A;  2E5V A;  4BK1 A;  3RP6 A;  4TM1 A;  3NN0 X;  1JRY A;  2OAL A;  3F8P A;  1GAL A;  1LQU A;  3BI4 A;  4LA1 A;  4U8L A;  4OPI A;  2YLS A;  4FK1 C;  1PBD A;  3NG7 X;  1RP0 A;  2BK4 A;  1ZP0 A;  4E0V A;  2BS4 A;  3DJE A;  4LU6 A;  1NAA A;  3DJD A;  2C72 A;  3Q9T A;  4YSX A;  1OJD A;  3DH9 A;  3DJG X;  2CUL A;  2YLW A;  2R46 A;  1M6I A;  3GDN A;  4IV9 A;  5HXI A;  1CC6 A;  2R4E A;  3F8R A;  4Z2T A;  1D5T A;  1OJC A;  3T2Z A;  1Q1R A;  1GRA A;  1LV0 A;  2X50 A;  3IC9 A;  4GF7 A;  4A65 A;  2UZZ A;  3AE8 A;  3CN8 A;  2WPF A;  4I59 A;  4ZCC A;  3ATQ A;  3T2K A;  2B9X A;  4DSG A;  1TDO A;  4GRT A;  3LOV A;  4OPT A;  4GR1 A;  4YSY A;  5DBJ A;  4JY2 A;  3ZDN A;  4U8J A;  1D7Y A;  3CPH G;  2BA9 A;  3COX A;  3HYW A;  1E1N A;  1ZX9 A;  2ZZ0 A;  1K4Q A;  1JOA A;  1NEN A;  3NKS A;  1PBB A;  2A89 A;  4N9X A;  4Z24 A;  1CJ3 A;  3H8I A;  2JAE A;  2GVC A;  3NRN A;  4YSH A;  1L9C A;  1NHP A;  3AE5 A;  2A8X A;  2GR3 A;  1TDE A;  4H7U A;  3AD8 B;  3SZF A;  4ZCD A;  3IHM A;  4CBQ A;  3NTA A;  1VG9 A;  3KPK A;  2BK5 A;  3AE9 A;  2WQY A;  2GV8 A;  3QSS A;  5IQ4 A;  3GQK A;  3UKA A;  2YR6 A;  5EBK A;  3NN6 X;  3ISH A;  3PVC A;  3O0H A;  3OZ2 A;  1CJ4 A;  1ZOV A;  2YG6 A;  3NLC A;  3NYF A;  3GDP A;  1KFY A;  4U8P A;  4A99 A;  4UP3 A;  2WP9 A;  4B63 A;  2BC0 A;  3OC4 A;  2R4J A;  1BGJ A;  1DNC A;  1CJ2 A;  2C3C A;  3AD9 B;  3SM8 A;  4APN A;  3GYI A;  2I0Z A;  3T37 A;  4GDP A;  3VRB A;  1OJ9 A;  1LPF A;  3I6D A;  4A6N A;  4JQ9 A;  4B66 A;  2WPE A;  3CNT A;  4C3X A;  4J36 A;  4NZH A;  4YT0 A;  4IVM B;  1GTE A;  3FBS A;  3HYX A;  4AOS A;  4USQ A;  4XWZ A;  2YVJ A;  3ALJ A;  1B5Q A;  2EQ9 A;  4B64 A;  3P9U A;  2XVH A;  1Z6L A;  3C4N A;  4X4J A;  2AQJ A;  4YSZ A;  2OAM A;  1DOE A;  1GRG A;  4TLX A;  1KF6 A;  4AP3 A;  4K8D A;  3SY4 A;  2R0G A;  2XCG A;  2B7S A;  4J56 A;  1E1K A;  3CNS A;  1CHU A;  3HZL A;  1FOH A;  2ARD A;  2BK3 A;  3QJ4 A;  3AE2 A;  3AYI A;  1PJ7 A;  3AYJ A;  3AEG A;  3GYX A;  2XFO A;  4J31 A;  2JK6 A;  4Y4N A;  2XLR A;  1GER A;  4OPC A;  1EL7 A;  4M52 A;  3T31 A;  4NEV A;  1TYP A;  4YKF A;  1YQ3 A;  2C67 A;  3URH A;  4YTP A;  5EB4 A;  5KVI A;  2VQ7 A;  2X3N A;  3CGC A;  2WS3 A;  3LZX A;  4AT0 A;  2E1M A;  3ICR A;  4I58 A;  1FCD A;  1PJ6 A;  2X99 A;  3B3R A;  4AOX A;  5HHF A;  3FIM B;  1E39 A;  3QVP A;  3GMB A;  4A9W A;  4A79 A;  4H4S A;  1TYT A;  3UCL A;  4C3Y A;  2W0H A;  3BHF A;  2GMJ A;  4J33 A;  1GV4 A;  3DGZ A;  3UOV A;  3PO7 A;  3VQR A;  1UKV G;  1EBD A;  1SEZ A;  1GRE A;  1CJC A;  1IUW A;  1YKJ A;  3ALL A;  1PBC A;  3BNU A;  1IUV A;  2VVL G;  3KU9 A;  1IUT A;  3EPT A;  3NIX A;  2WU2 A;  2XLP A;  3RP7 A;  2C65 A;  2DKI A;  1ZKQ A;  4YKG A;  1BZL A;  2WDV A;  3II4 A;  3SYI A;  4YWO A;  3AE6 A;  3M0O A;  4H2N A;  3K7Q X;  5CQF A;  4OPD A;  3T14 A;  1N1P A;  3L1R A;  2WDR A;  1GEU A;  1P2H A;  4GAV A;  4FK1 A;  4U8N A;  3UP5 A;  5KMS A;  1KSU A;  2VOU A;  1KNR A;  1H7X A;  3JSK A;  5HY5 A;  1GT8 A;  2X8C A;  3DGH A;  3KLJ A;  2WES A;  2F5Z A;  3K7M X;  4G74 A;  4OCG A;  3UKP A;  3AED A;  3FG2 P;  4Z26 A;  1D7L A;  5EB5 A;  1MO9 A;  1CL0 A;  2PHH A;  3UKF A;  4EIP A;  3T2Y A;  3KD9 A;  4KPR A;  3WE0 A;  4B65 A;  4RG3 A;  2AAQ A;  3EAO A;  5KMR A;  2YG7 A;  4Z2R A;  3IWA A;  1W4X A;  2BCP A;  1REO A;  3P4Q A;  2YWL A;  1D4E A;  4YXD A;  4H4Q A;  3AEE A;  1IUS A;  1BWC A;  3AYL A;  3PS9 A;  5KOX A;  2GAG B;  1F8S A;  3UTE A;  1K0L A;  2WP5 A;  2YG4 A;  1F8W A;  1GND A;  2YR5 A;  2B7R A;  1PBE A;  5JCM A;  1KSS A;  2EQ8 A;  4GCM A;  3NNE A;  3ZYX A;  1PXB A;  3GWF A;  3CGD A;  3KA7 A;  1K0J A;  3UTF A;  4Z25 A;  3RED A;  3V3N A;  3RHA A;  2OA1 A;  1TDK A;  3D1C A;  4OPL A;  2NPX A;  3IHG A;  3K7T A;  4REK A;  3SFD A;  5TR3 A;  1NEK A;  1F6M A;  5FMH A;  3CPI G;  4H4Z A;  1DJQ A;  3UKL A;  5C2T A;  1N4U A;  1LTX R;  3NTD A;  1TRB A;  1CC2 A;  1P2E A;  1LQT A;  1YQZ A;  3NH3 X;  4NWZ A;  4USR A;  4H2P A;  4A5L A;  2QA1 A;  3AEC A;  1XAN A;  2WDQ A;  1ZY8 A;  1B4V A;  4K5R A;  1N4W A;  2CVJ A;  1M64 A;  1GSN A;  1E1L A;  2C64 A;  4B67 A;  3AD7 B;  4BV6 A;  4Z44 A;  2XVJ A;  3ICT A;  4K7Z A;  4JDR A;  4UDQ A;  3AB1 A;  4U8M A;  1E7P A;  5HYM A;  1VG0 A;  1ELI A;  3LJP A;  5GSN A;  1EL9 A;  1YY5 A;  3GWD A;  1ZMC A;  5M10 A;  4Y4L A;  2APG A;  4EQR A;  4C77 A;  2WPC A;  1GRH A;  1O5W A;  1B8S A;  2R45 A;  4DSH A;  2YVG A;  3QFA A;  5L46 A;  4K22 A;  4LII A;  4O5U A;  2Q7V A;  3NT6 A;  2AR8 A;  1EL8 A;  1BKW A;  1QO8 A;  2B9Y A;  2JBV A;  4K5S A;  4X9M A;  2EQ6 A;  2GR2 A;  2GH5 A;  2TPR A;  3D8X A;  1XDI A;  2JB2 A;  3K30 A;  2HQM A;  2BC1 A;  4CY6 A;  3GRT A;  2XFN A;  4CRT A;  3SQP A;  2X8H A;  1YQ4 A;  2WEU A;  2YR4 A;  1QJD A;  2R0C A;  2V60 A;  4H2R A;  4BJZ A;  5BUL A;  4NTE A;  1IJH A;  4J57 A;  2WU5 A;  1E6E A;  3B6D A;  5FS8 A;  2XLT A;  3DK9 A;  5U1O A;  1Q1W A;  1EL5 A;  2FJB A;  3NYC A;  4OVI A;  5KNL A;  2BRA A;  3G5S A;  5BVA A;  4KX6 A;  2YLT A;  3UTG A;  1NPX A;  4II2 A;  2BCG G;  4G73 A;  4J34 A;  4UDR A;  2GR1 A;  3BI5 A;  4NTC A;  1E1M A;  1FL2 A;  2TMD A;  3UKK A;  1S3B A;  5BRT A;  3ITJ A;  4CCR A;  3SZW A;  5JCK A;  1ZOY A;  1ZDL A;  5U25 A;  4IA5 A;  2GMH A;  3CGB A;  2C73 A;  3LAD A;  1PN0 A;  4C74 A;  3UP4 A;  1KNP A;  3UKQ A;  2XFU A;  5KOW A;  4H4U A;  4H50 A;  4EMW A;  5JCI A;  3GYJ A;  5C3J A;  1VQW A;  5CKU A;  3P1W A;  2RGO A;  2XLS A;  2YQU A;  3DK8 A;  3ICS A;  3AE7 A;  1S3E A;  3BNM A;  3SZC A;  1OJA A;  1XHC A;  4HB9 A;  4A7A A;  3G5R A;  4RG4 A;  2GEW A;  3T0K A;  3NK0 X;  2VZ2 A;  1RYI A;  5JCN A;  1MOK A;  3NK1 X;  2XVI A;  1COY A;  1O94 A;  1S2Q A;  3S5W A;  2RGJ A;  2IVD A;  2B9W A;  1FEC A;  3SUC A;  2CDU A;  3NYE A;  3CNP A;  2BXS A;  3S61 A;  4BUR A;  5JCL A;  1JU2 A;  4OPU A;  5J7X A;  4HA6 A;  4CCQ A;  3VRA A;  2Y6Q A;  3ATR A;  2QA2 A;  1NDA A;  3AE3 A;  2VVL A;  3F8D A;  2GF3 A;  4RSL A;  4DGK A;  2BS2 A;  3AE4 A;  1X31 B;  1GXF A;  3RP8 A;  1JNR A;  2ZBW A;  2YLZ A;  4U2L A;  2BXR A;  3R9U A;  1DJN A;  1NG3 A;  2WBA A;  4PAA A;  2GQF A;  3GD3 A;  2J3N A;  1DXL A;  3CPJ G;  1PS9 A;  5EOW A;  3GQH A;  1HYU A;  3FPZ A;  2QAE A;  2A87 A;  4IA6 A;  3P4R A;  4YTM A;  1CBO A;  3GD4 A;  3BI2 A;  4H4Y A;  5BUK A;  3G5Q A;  1D4D A;  4TM3 A;  4AP1 A;  1Y56 B;  1BF3 A;  3M12 A;  1PXA A;  3SZ0 A;  4CNK A;  2RGH A;  2WOV A;  1FEA A;  4TLZ A;  3SFE A;  2BRY A;  1ONF A;  1O95 A;  3CTY A;  2BYB A;  2Q6U A;  3GMC A;  3UOX A;  3ABV A;  3Q6J A;  1DOC A;  3H4K A;  3LB8 A;  4ICY A;  1B37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...