5C2TA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
b'SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c2tA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c2tA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c2tA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c2tA04
1IJHA 1ZDLA 4GRTA 5JCIA 3AB1A 3GSIA 1D7YA 1K0LA 2YLZA 2BK4A 2WP6A 3H4KA 4IA6A 2R0GA 4NZHA 2WPEA 1P2HA 3IF9A 1YQZA 4GF7A 2WBAA 4U8MA 5KOWA 2FBWA 2GR0A 1O5WA 2B9WA 5CKUA 1Y56A 2Q6UA 3CNSA 3DJGX 5HHFA 3RNMA 1NDAA 1K4QA 5JCMA 5KWFA 1EL9A 4YTMA 1FCDA 4FX9A 4GDEA 3Q6JA 5HYMA 4BV6A 1CC6A 1D4DA 1MO9A 5JCLA 1NPXA 3URHA 5KXJA 4H4TA 2OALA 3F8RA 4TM1A 1JOAA 2BA9A 2WOVA 1KDGA 2GVCA 1OJAA 4H2PA 1LVLA 4CRTA 4H2QA 2C3CA 4U2SA 2WDRA 4CNKA 1TDOA 2ZBWA 2Q0LA 1XDIA 2BC0A 4Z44A 1PBDA 3SFDA 2XVEA 3C96A 3UP4A 3NG7X 3NTAA 4IA5A 4NEVA 1S3EA 2PYXA 1YKJA 2V6OA 1ZKQA 4EQRA 1COYA 2QA1A 3GD4A 4XWRA 4PABA 2IIDA 5BUKA 4DGKA 1H86A 3BI2A 1Q9IA 1F8RA 3NHOX 1K0IA 1N1PA 4USQA 2B9YA 3NTDA 5GSNA 3KA7A 4PAAA 3ATRA 1TDNA 4H4VA 3SGLA 1JU2A 2WU5A 4H4UA 2FJBA 3CGBA 2LFCA 4RSLA 4YTNA 2GQFA 1E1MA 1RSGA 3P4SA 3FBSA 3QSMA 1GTHA 4U2LA 2V5ZA 3E1TA 4OCGA 3AEEA 2X8HA 4AOSA 1GRBA 1RYIA 1NHQA 5JCNA 3UKPA 1REOA 3S61A 2C64A 1B5QA 4NTEA 1Y56B 5J7XA 4GR1A 5J60A 2WQYA 3AD7B 4YSZA 3DGZA 4BJZA 2EQ9A 3V3OA 5ER0A 4EM3A 2JB1A 3NGCX 1ZOYA 2H89A 3GMCA 4E0VA 2XLUA 1LPFA 4BK1A 2WHDA 2XFQA 3GYXA 2IVDA 4AT0A 3QVPA 2C76A 3VR9A 3BNUA 4LIIA 2WU2A 2YR5A 2YG4A 1GERA 3BNMA 1GOSA 1LJ1A 1MOKA 2C66A 2YVFA 2BK3A 1KNRA 3DK8A 4B64A 2GQWA 2GMJA 3NT6A 3IC9A 1L9EA 4DSHA 5EOWA 3L1RA 1M6IA 3K7MX 3AWIA 1E7PA 2VZ2A 4M52A 5C2TA 4JQ9A 3QVRA 2WOIA 1XANA 1ONFA 4EQWA 1S2YA 4EMWA 4KPRA 3QSEA 1LTXR 2E5VA 3L8KA 5JCKA 4A99A 3LJPA 4FK1A 1MXTA 1X31B 4U8OA 4LU6A 4OPIA 4X4JA 1GALA 2XFNA 4AOXA 4GUVA 4YKGA 3IHGA 1GV4A 3I3LA 2TPRA 3IHMA 3UOXA 4CNJA 1D4EA 2C72A 2VVLA 2GAHB 2YLTA 3P4RA 4ZCCA 3AE2A 2WDVA 1B4VA 2XVHA 1KSSA 3ATQA 3UKKA 1GRTA 2ZZBA 4ZCDA 1KNPA 3PO7A 2V61A 5BVAA 2Y6QA 2XLTA 1PBBA 4J57A 1CJ3A 2W0HA 1GT8A 3QSSA 2AQJA 2WETA 3Q9TA 1BGNA 1TDFA 3PVCA 1F3PA 4B66A 2DKHA 5FMHA 1E6EA 1PXBA 1PXAA 3B3RA 1QLBA 2C7GA 4K8DA 4IV9A 2YLSA 1V59A 2TMDA 4YWOA 4C74A 3UKLA 2YG6A 3ABVA 4GDPA 3QFBA 4K5SA 3DK9A 2YLRA 4JY3A 5HY5A 1CL0A 2X3NA 1LV0A 2RGHA 3EF6A 3SQPA 2WEUA 3UKAA 3FMWA 3G5RA 4N9XA 4UP3A 1CF3A 2WESA 1GEUA 2OLNA 4HB9A 1GESA 3GDNA 3H8IA 3ICSA 4OPGA 4U8KA 4U8IA 3RP7A 4EMIA 4I58A 1NG4A 4XWZA 2GV8A 1H82A 1Y0PA 4CCRA 4AP3A 5KVIA 4OVIA 1E1LA 4XXGA 3GQHA 4AT2A 1H84A 2PHHA 2C75A 1OJ9A 3CNTA 4USRA 4ICYA 1PBFA 1YY5A 4EQSA 1PS9A 1HYUA 3GWFA 4BJYA 2YM2A 4WCTA 3UKQA 4EIPA 2R45A 4U8JA 1UKVG 5U63A 4OPCA 3KD9A 3REDA 1BF3A 3GD3A 2YLWA 2VVMA 2YVGA 3CPJG 1ELIA 1BKWA 2ACZA 5EB4A 1F8SA 4NTCA 3IWAA 1VRQB 1QJDA 3NK2X 1TDEA 3AXBA 1F6MA 3G5SA 3LZWA 3DJEA 1NHRA 1FEBA 4B68A 2VOUA 2YWLA 1GRAA 2YR6A 1NHPA 4Y4LA 3VRAA 4YKFA 4H4PA 1IUWA 3S5WA 1CHUA 5HXIA 3GRSA 1DJNA 3M12A 1E1NA 2WPCA 1EL5A 5KOXA 4YSYA 1VQWA 2BS4A 3AECA 1KFYA 1LQUA 2GR1A 2WOWA 2XLRA 3NYCA 4TLZA 4UDPA 1NAAA 2J3NA 1NENA 3ALMA 3ALJA 1ZMDA 1GREA 2V3BA 3AD8B 3NH3X 4B69A 2QA2A 3ZYXA 3CNJA 3AEAA 3BHKA 4NTDA 4P9SA 3KVEA 2V60A 1QO8A 2YLXA 2XVFA 1JRZA 1D7LA 3UKHA 4B67A 2OA1A 4GCMA 1H7WA 4A79A 1GETA 1PN0A 4J33A 5GRTA 1E1KA 3QFAA 4IVMB 4JDRA 1FOHA 4I59A 2WP5A 1XPQA 4JNQA 4D04A 1BZLA 2YG5A 2Y6RA 2B7SA 1NG3A 2YG3A 5CQFA 3UOYA 2BABA 2A89A 1DODA 3GRTA 2AR8A 3NLCA 4OPTA 2YR4A 1ZY8A 2YM1A 1LQTA 3R9UA 1PJ5A 1PHHA 3GYJA 1OJDA 1CC4A 3CGDA 4D03A 1H6VA 5BULA 2X8GA 1KSUA 4B63A 2RGOA 4NEWA 2YAUA 3NN6X 4YTPA 1GNDA 2JB2A 2OAMA 5L46A 2RABA 4KX6A 3FPZA 1Q1RA 2E1MA 5FS7A 1NEKA 3ICRA 3NYEA 4UDRA 3AE6A 4ADWA 1H83A 4H2RA 2B9XA 4Z2TA 3EPTA 5FS8A 1YQ3A 4O5UA 3AE5A 3OZ2A 2GAGB 3D8XA 2GR3A 5LV9A 3DGHA 1EBDA 5KRQA 4C3XA 2C67A 3ADAB 4H2NA 3JSKA 4OPDA 1RP0A 3UCLA 2B76A 3DK4A 3EAOA 4FK1C 4C3YA 1IUUA 3ICTA 2ARDA 4H4WA 4Z25A 3V76A 2O9ZA 2I0ZA 2X8CA 3ITJA 3VR8A 1DXLA 1JRXA 2XLPA 3CTYA 4Z2UA 1VG9A 4H7UA 3AEFA 4RG3A 4Z43A 4OPLA 4Z26A 4RG4A 2R4JA 4OPUA 2BYBA 5C3JA 2XYOA 5U25A 3ZDNA 3LOVA 5U1OA 2H88A 5BRTA 1OJTA 2BXSA 3II4A 4J36A 1ZK7A 2C73A 3AYIA 3CIRA 3GYIA 1F8WA 2VVLG 4H4ZA 4WX1A 3UTEA 1M64A 3DMEA 3O0HA 1E39A 4J2WA 3VRDB 2XFUA 1Q1WA 3DJJA 4A9WA 1VDCA 1ZP0A 2JAEA 3BI4A 1S3BA 5IQ1A 3UTFA 3AEDA 4Y4MA 2WP9A 1CJ2A 2C70A 2XVJA 2FJAA 2BCPA 1DNCA 3C4AA 2ZZ0A 4K22A 1B37A 1FECA 2GB0A 2XVIA 1EL7A 4H4SA 4REKA 3T37A 3UOZA 3CPIG 5FS9A 4A5LA 4C5OA 5KVHA 3COXA 2YG7A 1H7XA 1CC2A 1B8SA 2EQ6A 2NVKX 3UTHA 1DOBA 2V3AA 2FJEA 3GDPA 3M13A 4APNA 3DA1A 3F8DA 2XFOA 1IUTA 2VRLA 2XFPA 2APGA 2CULA 3AYLA 3AD9B 4CY6A 2JK6A 3WE0A 2JBVA 3AE3A 2BS2A 4TM0A 4K7ZA 2BC1A 4TM3A 1GRFA 1N4VA 2IVEA 3CNPA 3CNDA 3F8PA 1ZMCA 5IPYA 3UKFA 2GRTA 2UZZA 1EL8A 3G5QA 2CVJA 4J34A 2Q0KA 1JRYA 2BK5A 4J56A 1JNZA 1BWCA 2WPFA 1PXCA 2CFYA 3CN8A 1DJQA 1PDHA 1XHCA 4J31A 3D1CA 3NKSA 4MJWA 4YSHA 2BXRA 1ZX9A 4ZN0A 3BI5A 4A7AA 1K0JA 2WS3A 3HZLA 4X9MA 2R4EA 3VRBA 1PBCA 2QCUA 2XCGA 1PBEA 3LADA 3AYJA 5M0ZA 3SUCA 4H4RA 1H81A 1L9DA 1TYTA 3FIMB 4Y4NA 5EBKA 1GRHA 3P4PA 4AP1A 3H8LA 4X9NA 2GR2A 1AOGA 4JY2A 2QAEA 1KF6A 3LZXA 1CJ4A 4BURA 3NYFA 3NK1X 4FDCB 3K7TA 3NRNA 4UDQA 2F5ZA 3CPHG 1JNRA 3UTGA 4BK2A 4LA1A 4EM4A 3CGEA 4CCQA 4IVOB 3AE1A 3KLJA 4CBQA 3LB8A 2C3DA 3M0OA 2BS3A 1L0VA 1P2EA 3LXDA 2DKIA 2X99A 2BACA 2Z5YA 5TR3A 5M10A 3PS9A 4CY8A 2B7RA 2XLSA 3RHAA 1FEAA 1BGJA 3NIXA 1GRGA 2EQ8A 4B1BA 3AE7A 2FJDA 4DSGA 4JNAA 2GH5A 2Q7VA 3VQRA 3P9UA 4B65A 1GXFA 1CJCA 4EIQA 1DOEA 3EANA 2YQUA 1D5TA 1W4XA 3K30A 1GPEA 4U8LA 1S2QA 1TYPA 2OLOA 4K5RA 1NHSA 1GTEA 3RP8A 3P4QA 4H4YA 1IUSA 3AE9A 2R0PA 3UP5A 3QJ4A 4A65A 3OC4A 2R9ZA 4O5QA 4H4XA 3NN0X 2C65A 2GMHA 1L9CA 1CBOA 4TLXA 5EB5A 4Z24A 4U8PA 2AAQA 3CGCA 5IQ4A 1FL2A 1SEZA 1PJ6A 5FS6A 3AE8A 1N4WA 3P1WA 2E4GA 3SFEA 2A87A 2R0CA 2CDUA 2X50A 2YVJA 1ZOVA 3DH9A 3AEBA 4JN9A 2VQ7A 4YT0A 4H50A 1PJ7A 2NPXA 1GSNA 1Z6LA 2WDQA 4A6NB 1OJCA 1DOCA 4Z2RA 2GF3A 2ZZCA 4TM4A 4ECHA 3KKJA 3ISHA 3RP6A 1TDKA 5DBJA 3GMBA 1O94A 4BK3A 3B6DA 4EQXA 3V3NA 4H4QA 2JB3A 3I6DA 3NNEA 1JEHA 1D4CA 2EQ7A 3KU9A 1YQ4A 2JKCA 1N4UA 1TRBA 3C4NA 3AEGA 2VQBA 3KPFA 4YSXA 1VG0A 4DNAA 2VRMA 4EMJA 2R46A 2Z5XA 3K7QX 4U2TA 3FG2P 3NK0X 4A6NA 2RGJA 2A8XA 3SM8A 3AE4A 4YXDA 1IUVA 2XDOA 1IUXA 4K2XA 4HA6A 4U8NA 2BCGG 3UOVA 4C77A 3GWDA 2GEWA 3ALLA 3DJDA 1O95A 3BHFA 2HQMA 3GQKA
chains in the Genus database with same CATH superfamily
3PUSA 1ZDLA 3ZN1B 2YLZA 2BK4A 1LKXA 4IA6A 3N9MA 1P2HA 3ONJA 2E5LT 4GF7A 4U8MA 3OVUA 1Y56A 5HHFA 3CNSA 1NDAA 1K4QA 5JCMA 4LF6T 5KWFA 3RIAA 4O8SA 4HFDA 4HWIB 4FX9A 4ZI3D 1MO9A 2C5KT 3URHA 2JPFA 4H4TA 2XQ3A 3F8RA 4OX9T 3B5MA 1JOAA 2WOVA 4PJLA 1OJAA 3OJAA 4CNKA 1TDOA 4DR5T 1PBDA 1U5PA 3QB5A 4QWNB 5J2TE 3NG7X 4NEVA 1S3EA 3LBXA 4IL9A 2VKHA 4EQRA 4WYVA 4PABA 5LJNA 4RHV4 4DGKA 1H86A 1Q9IA 2Q9QD 1F8RA 3N9QA 3RF1A 4CZZB 3EI0A 2JMKA 5JVDE 3KFWX 1WYCA 4USQA 4X20E 4V1Av 2WU5A 4O4JE 2LFCA 1E1MA 4NIQA 4OCGA 3O1HA 3AEEA 4AOSA 3C64A 2LKGA 1NHQA 5JCNA 3HKCE 4NTEA 3NZPA 3V3OA 5ER0A 3GMCA 1D1AA 2XLUA 2HWB4 4AT0A 2ZM6T 1YXRA 4EZHA 3BNMA 1GOSA 1LJ1A 2IW5B 5LYJE 1KNRA 5AQRB 5EK4A 3W15B 3DK8A 3NT6A 3LK2B 4U31A 5JR9A 5JDFA 2BRYA 3L1RA 3K7MX 3AA7B 3AWIA 4X1IE 4JQ9A 3F2EA 5M4YA 5EK3A 5ABHA 2X66A 4I43B 2H7VC 4TNWA 4FK1A 5LHGB 2XFNA 3EUHA 3IHMA 1D4EA 2VVLA 2WDVA 5HEUA 4UXNB 1KNPA 2V61A 4J57A 1CJ3A 1ASJ4 2VWAA 1GT8A 3QSSA 1TDFA 4EYUA 2R6GF 2DKHA 3ZMTB 3I0QA 4CXXA 4DO0A 5DABA 3RRCA 1QLBA 5LHHB 4K8DA 2TMDA 3LSVA 2D2SA 5AQQB 2XQ9A 3ABVA 2X67A 4AKGA 4K5SA 1D4M4 3CMLA 4QXBB 1LV0A 2XM1A 4DV6T 4N9XA 4UP3A 2ZM8A 1GEUA 4EMIA 1GESA 4U8KA 3SZWA 4ANJA 1NG4A 4HGAA 4XWZA 3AXJB 1Y0PA 3KV5A 3UT5E 5KVIA 2ODUA 4AT2A 1OWAA 1WRDA 5HAXA 5IWAT 5JDMA 4JYAT 3QB5K 1PS9A 4BJYA 2PTFA 2LEHA 3PURA 4EIPA 2DI4A 2HH7A 4TNVA 3UTKA 2YLWA 1D0XA 2YVGA 1ELIA 1BKWA 3NK2X 1XHZA 1TDEA 2LSIA 2UXNB 1NHRA 1FEBA 4B68A 4Q4Y4 2YR6A 3J7Yq 1HCIA 3OYZA 1N32T 4YKFA 2I59A 1DJNA 2W66A 4YSYA 5ABGA 2RA1A 2GR1A 2QGSA 2XLRA 4ZS2A 4ZOLE 3DJDA 3RGLA 1GREA 3VU7H 2QA2A 2HN2A 4NTDA 4P0AA 4HE8A 2YN6A 5L3CB 1HS7A 1PN0A 5GRTA 1E1KA 2CA5A 3PTRB 3PUXF 1XPQA 3TLWA 1N36T 4QH4A 4ILBA 2YG3A 5CQFA 2BABA 2A89A 3PUVF 5L2LA 3GRTA 4KHPT 2JQQA 4BJMA 3NLCA 3NZQA 2YR4A 4OPTA 4FI5A 2LLYA 3FBLA 3CQXC 3U78A 5LGUB 5BULA 3N2GE 4NEWA 1BR1A 2YAUA 4LF4T 3ETVA 2JB2A 5LA6E 2E1MA 5J0ZA 4DV7T 4TN7B 1ZKEA 3NYEA 4UDRA 3AE6A 4ADWA 4H2RA 1XDOA 5ABEA 5HWXA 5FS8A 4ZI2D 2L3LA 3OZ2A 4HEAA 1KEYA 4H2NA 3RYFE 3FZMB 3UCLA 5AQMB 2PYJA 3DK4A 2IMLA 2RMU4 2NW7A 2ARDA 3EABA 2I0ZA 2X8CA 4Z2UA 1JRXA 5LNKA 2E9XB 4Z26A 4OK0A 4RG4A 2R4JA 2BYBA 2XYOA 5HYAA 3ZMSB 3UQ7A 5U25A 3HA4A 5U1OA 4QXHB 3ZT6A 2BZBA 4PNIA 3RIFA 3AAEB 3AYIA 3CIRA 4GAVA 2VVSA 4WX1A 1WFDA 2NOXA 5HCMA 3NRXA 2X0LB 2N2NA 3DJJA 4LMLA 1VDCA 1ZP0A 5IQ1A 3UTFA 3AEDA 4A56A 4JI3T 4HTEA 2BCPA 5EK2A 4A5LA 3UUNA 2CRBA 2J47A 1PIV4 3UTHA 1DOBA 5C8YE 1I94T 4U7IA 3QOFA 1IUTA 1VBE4 2XFPA 2CULA 4CY6A 2Y6XA 4KBMB 3KVAA 4TM0A 1UURA 3UU8A 3T0KA 1NCQD 5AQLB 2IVEA 3F8PA 1ZMCA 2UXBT 3UKFA 2GRTA 4K0KT 3ONLC 1OXZA 2IC6A 2BK5A 3HKEE 1MIWA 2CFYA 3FZHB 4ZI3C 5KDMC 5KMPA 4MJWA 2E2AA 2DNXA 4G6HA 1ZEEA 3ANWB 1X9BA 3HZLA 4X9MA 2CWYA 4Q4W4 3SZFA 4A98A 5H6QB 2XCGA 4HWCA 5KX5E 4EB6E 4H4RA 1H81A 1TYTA 3FIMB 5HEOA 3P4PA 3H8LA 1AOGA 1XWMA 3HYVA 3C4WA 2LHNA 2F5ZA 1JNRA 4XAXB 3UTGA 4BK2A 1HXS4 4LA1A 4HKAA 4O2BE 3AE1A 2YU2A 2E9XD 1MIYA 4CBQA 1SE7A 3T2ZA 2ZMAA 3GMIA 1P2EA 2X99A 1ZHCA 3KPKA 4A5XA 3PS9A 5CJ5A 5FXWA 1FEAA 3NIXA 1GRGA 5JTGA 4B1BA 1LRZA 3AE7A 3BK9A 2GH5A 3VQRA 3P9UA 4B65A 5AQJB 1DOEA 5HXEA 3RPUA 2J62A 3CX7B 4U72A 4K5RA 4ZI7E 4IIJE 1GTEA 1IJ5A 2UUCT 3EDVA 4H4XA 3JD74 3LFMA 3FB2A 4U8PA 3P1WA 3AAIA 2X50A 2CXFA 4JUYA 3KINB 2VQ7A 1Z6LA 4Z2RA 3NVOA 2VURA 4BK3A 2JB3A 1JEHA 1D4CA 4CI3B 4Z90A 2VQBA 5LG4A 4IREA 4EMJA 2N9DA 3PE0A 3C50A 5FKYA 4A6NA 3AE4A 3RIUA 1IUVA 2XY8B 5JQGE 4HWDA 4U8NA 2YDSA 2BCGG 1XHXA 5F5WA 3DJBA 3CK6A 1BR2A 2HQMA 3BHFA 3GQKA 4MFRA 4CQIA 1IJHA 2ACXA 4GRTA 5BR8T 1PVC4 4QX7B 3AB1A 4U2ZA 3GSIA 2X5ID 5FY1A 3H4KA 4BJNA 2WPEA 3ANWA 4KMCA 2JIWA 2V7MA 2WSSV 3UULA 2W61A 5KOWA 2FBWA 1O5WA 5CKUA 2Q6UA 4JV5T 3RYIE 2W4XA 4GYRA 3JC6D 1EL9A 5HXCA 1LVFA 4JI4T 2V6YB 2VL0A 2WZIA 3TLSA 1MNEA 4TM1A 2HWC4 2BA9A 4CRTA 1KDGA 4H2QA 4IE4A 5AQNB 2Q0LA 1XDIA 4YLHA 4LF7T 3NTAA 4IA5A 3F31A 2VL8A 2PYXA 1YKJA 2ZM2A 3O1IA 4NWZA 1ZKQA 4PW8A 1COYA 2LKHA 4H9RC 4HFVA 4XWRA 1AJ3A 4GYSA 2IIDA 5BUKA 4GB34 4BAYB 3BI2A 4X1YE 3I9YA 4DMWA 4PJMA 1Y64B 4O4LE 1N1PA 3UUXB 5GSNA 1Z8UA 3L3PA 1MMNA 2CXDA 1AR74 2LSKA 2RS54 2GQFA 3P4SA 2A2FX 4DR3T 3QSMA 1GTHA 2X0HA 4U2LA 2V5ZA 2OLTA 3UKPA 1REOA 3UU5A 1Y56B 2LRKA 2WQYA 3DGZA 3PUGA 4YSZA 4ZS3A 3V5UA 1UK5A 3EAMA 4UVAB 3N9PA 4E0VA 1LPFA 5DJQC 5KMRA 2IVDA 3QVPA 2C76A 2AE9A 2YG4A 1GERA 2YR5A 1VBA4 4DVDA 1MOKA 2C66A 1E1HB 4EZ4A 2R044 2R074 2PFVA 2GQWA 1FMVA 4DSHA 5EOWA 1YD8G 3RC8A 1T8BA 3SOLA 3RKOA 1XANA 1ONFA 4EMWA 4KPRA 5JCKA 4A99A 3EVYA 2UXCT 4U8OA 2KZ7B 4OPIA 4X4JA 4AOXA 1FMWA 4LF8T 1GV4A 3I3LA 3UOXA 2NP9A 1G73A 4ZCCA 3AE2A 1B4VA 2JRKA 2XVHA 3ATQA 2L8KA 4U2YA 4ZCDA 2XSAA 5L3EB 2KNDA 1NWMX 3N2OA 1LVKA 1F3PA 2CXLA 3GN5B 4UVBB 4UV9B 3KV9A 5LB7B 1PXAA 3H37A 5L3FB 4AKRB 4IV9A 4HFCA 2MYSA 1S94A 2CBIA 2WMNA 2A72A 4GDPA 4LFAT 2XAQB 2X3NA 3Q2MA 2M6BA 2RGHA 3SQPA 2V6YA 4YY3T 3FHNA 3N2KE 4U8IA 3RRWA 1MIVA 1R094 2GV8A 4CCRA 3PU8A 3Q9DA 1XNRT 3GQHA 4DV1T 1H84A 2PHHA 2C75A 2LRLA 1OJ9A 1YY5A 4XBFB 1HYUA 2YM2A 2R45A 4U8JA 3NWIA 3OBVE 1HR0T 5U63A 1D1BA 1OEDC 3AB3B 3KD9A 3GD3A 2VVMA 3CPJG 2GK9A 2VVNA 2ACZA 1F8SA 1PO14 5CFBA 1VRQB 4ILUA 4ZHQE 3D0TA 2HHHT 2BG9B 2YWLA 1SHZC 4JI1T 3VRAA 4AQYT 1IUWA 4ZZCA 1CHUA 2X0YA 2EHOC 3GRSA 4LFCT 2WPCA 1K5MD 1X79A 1EL5A 1VBD4 3K3OA 1Z0PA 2WOWA 3NYCA 4TLZA 5TAOA 4UDPA 2XQYA 1NAAA 3GA8A 3T14A 4EEDA 2J4GA 2I6HA 4ADZA 3AD8B 3SXIA 3ZYXA 2JJ9A 3OTOT 3CNJA 3BHKA 4F6RC 3FXEB 4P9SA 2V60A 2WZHA 1QO8A 2YLXA 1D7LA 1JRZA 1EZ3A 1XZYA 1H7WA 1M62A 4ERRA 4DV3T 1GETA 4IVMB 3K8PC 3LDQB 5LMUT 2LHRA 4EIWA 1BZLA 2YG5A 3SRZA 2Y6RA 3CMMA 3UOYA 5ETWA 5J1GA 1DODA 2AR8A 2Y8DA 1N33T 4JI0T 5LHIB 1PJ5A 4UF0B 2DWGA 1J1JA 4KHZF 2A9UA 3P50A 1H6VA 4KP3C 4LF5T 1KSUA 2RGOA 4U3CA 2BVMA 3HR0A 4AISA 1WR0A 2XM2A 4YTPA 1GNDA 4KX6A 3FPZA 1D0YA 1VCSA 2XQ5A 2PW9A 2V1DB 5CA1E 3VKGA 4UVCB 2M6IA 1V9DA 5H6RB 4Z2TA 4HFEA 4O5UA 3J8F4 2W2UA 3N5LA 3D8XA 4B3MT 3JSKA 4OPDA 2B76A 3UU4A 3EAOA 4FK1C 1IUUA 3ICTA 3VR8A 4QHOA 1RMU4 4H7UA 4Z43A 2YINA 5C3JA 5HEJA 4TV8E 1US7B 1FIOA 3LOVA 5BRTA 2H88A 1F8WA 4FJOA 1IZNB 4AQFC 1M64A 3DMEA 3UTEA 2XFUA 1Q1WA 2LSYA 1UUSA 4CXYA 1RUE4 3BI4A 4G74A 3ZPOA 2SPCA 1CJ2A 2C70A 2FJAA 4WZXA 3C4AA 3UU6A 5ABFA 4H4SA 3T37A 1EL7A 5KVHA 5IHYA 3CPIG 2CLYC 1EV14 4MALA 1CC2A 1B8SA 4MLKA 3RX6A 4DR7T 4APNA 4Q4V4 3DA1A 1POV0 4ISSA 3IF8B 2APGA 2K48A 5F3JA 2KT9A 2JK6A 1RUG4 3AE3A 2XQAA 2BS2A 1BR4A 2BC1A 1CUNA 1IBKT 4TM3A 5IPYA 1MNDA 2Q0KA 4O4HE 2WPFA 4CN4A 4YHHT 4P09A 1PDHA 5FL1A 4F8HA 3NKSA 4IDPA 2BXRA 2KLQA 1OOPD 1ZX9A 4A7AA 1K0JA 4MHCA 3NBXX 3VRBA 5JDLA 2QCUA 3LADA 1D0ZA 4JI2T 1L9DA 4NUVA 1GRHA 4X9NA 2GR2A 3LZXA 3CVRA 1CJ4A 3L09A 2W00A 2NTXA 3NRNA 4UDQA 5IUXA 3RIUC 3AXJA 4TWHA 4QH1A 4CCQA 4IVOB 3RQWA 4QKNA 4II2A 3LB8A 4EGWA 3MK7C 3ZYMA 5TR3A 2JQ9A 3P8CD 2B7RA 4CY8A 2XLSA 3RHAA 1BGJA 2EQ8A 2XAFB 3EDUA 2FJDA 4JNAA 2I0MA 4ILCA 1GXFA 3EANA 4EIQA 4AQGA 1W4XA 2XJ7A 4DBRA 2XAHB 2R0PA 4G6GA 1HNWT 2IAKA 4A65A 3OC4A 4DR2T 5AQUB 2C65A 2Q9QA 2BKNA 4TLXA 2AAQA 3CGCA 4H63V 2P9BA 3C4XA 4GKJT 1ZOVA 3DH9A 4JN9A 1PJ7A 4U74A 4EEBA 4TM4A 1RUF4 4GAPA 1HX8A 4PFPA 2WB5A 5DBJA 3GMBA 1O94A 3B6DA 1R8IA 4H4QA 4PK6A 3ZEFB 3I6DA 2K3WA 3HI2A 3KU9A 3C4NA 4YSXA 1VG0A 4DNAA 3DP7A 2Z5XA 4U2TA 2KMFA 2ODVA 5AFUL 3IBPA 3TLVA 2RGJA 2V8SV 4OHFA 1IUXA 1O95A 3ZSSA 3NRYA 1KK7A 2VQFT 3OKQA 3JAEA 3RYCE 3UOVA 4C77A 1UX4A 3SY4A 3E22E 3ZKRA 2VQET 5CA0E 1D7YA 1K0LA 2R0GA 4NZHA 4UF0A 3IF9A 4ISTA 1YQZA 3FBZA 2Q9QC 3AA6B 2PBIA 4I50E 1BEV4 1MQTD 3FI7A 2B9WA 3RNMA 3PUWF 4B3TT 5LG3A 3IA3A 2PLV4 3T8OA 3N9LA 4GDEA 1OEDE 4AQFA 4BV6A 1CC6A 1D4DA 3MJXA 5JCLA 1NPXA 3T2YA 5JDHA 2H7OA 2W67A 2GVCA 2VKOA 4U2SA 2PZSA 2FUPA 4Z44A 3SFDA 2XVEA 5CB4E 2QA1A 3GD4A 1RUD4 4CN6A 3PJAJ 3NHOX 2K24A 4TWDA 1COV4 2B9YA 2YU1A 3KA7A 2WWUA 4PAAA 5CGMA 4QH5A 4HWHA 4AIUA 4AXPA 3DTOA 2FJBA 2KSRA 1QSDA 3UUMA 2AXDS 3CKDA 2V7JA 3Q5EA 3FBSA 4ASKA 3E1TA 2LSGA 2V5CA 3SX6A 2EX3A 4G73A 2WMOA 4IE5A 1RYIA 1B5QA 4GR1A 4DNDA 3AD7B 4P1NA 4EM3A 3TLUA 3HYWA 2XSBA 3JCFA 3PDYA 4DIDB 5FY0A 4IDQA 3GYXA 4OYKA 5AQSB 2CPTA 3N9NA 2BKOA 4TX5A 2BK3A 4EAHA 3T1HT 2DWKA 3MA9A 4CI1B 3AA0B 1L9EA 3KDSE 1WCRA 4CXWA 3EHZA 2PY5A 1E7PA 2VZ2A 5C2TA 1MMDA 2WOIA 4EQWA 1HTJF 3QSEA 1LTXR 4UELA 1X31B 3RYHE 4LU6A 1GALA 1YKHB 3J9X1 1E2AA 4GUVA 4JI7T 4YKGA 4EV6A 4J2CA 5ADXL 4GK0E 2GAHB 3ZT5A 4LMJA 3UKKA 3ONXA 1KSSA 1GRTA 4G63A 5FXXA 5L3DB 5BVAA 4E7SA 1D1CA 1IJ6A 2XLTA 3RH3A 2W0HA 1QUUA 1BGNA 1XNQT 4UIGA 1RUH4 4I4TE 3ZMZB 1PXBA 3X1DA 2YLSA 5JRCA 1V59A 4YWOA 2Z6EA 4M1PA 1Y01A 3DK9A 1HG2A 5HY5A 1UCUA 3EF6A 3CQCB 3UKAA 3GWHA 4HB9A 3ICSA 4H9PC 3FXDB 4AI6A 2DL1A 3KV4A 4I58A 1XMOT 1H82A 2M67A 4AP3A 5AQOB 3IEEA 2CM0A 4XXGA 5FY7A 3A7MA 3CNTA 4USRA 4ICYA 5L47A 1PBFA 2XZEA 1O3XA 3PJAA 4L5GA 3GWFA 3SYIA 4IE0A 5L4EA 2BRAA 2UXXB 3Q5DA 4OPCA 3ZN0B 3REDA 1BF3A 1SUMB 3SZCA 3MACA 5EB4A 1RVF4 3IWAA 1QJDA 3AXBA 1F6MA 3B13A 3LZWA 3O4XE 4PDWD 2VOUA 1GRAA 1NHPA 2JQHA 1HRI4 4H63H 4DMVA 3C4ZA 5AQKB 4H4PA 3S5WA 1OEDB 2BVLA 2LSJA 2XUEA 1E1NA 2KWHA 3A8YC 3LG7A 5KOXA 1LQUA 2BS4A 5FVLA 2NR4A 1NENA 3ALMA 2IDOB 2MBGA 1ZMDA 1AR84 5FYMA 4B69A 2NTYA 3AEAA 1H7CA 3QNUA 3KVEA 2XVFA 3UKHA 4B67A 2WWVA 1T98A 2OA1A 4A79A 5LCYA 4XZCA 4DV4T 1HNXT 3QFAA 4JDRA 4I59A 2LOSA 4JNQA 4IHJE 4JLEA 4D04A 1NAFA 2WCAA 1NG3A 3M3ZB 4H9SE 2VASA 1HFAA 2RS14 1U4QA 3R84B 1ZY8A 2C5JA 1LQTA 5HXSA 3LK42 2X8GA 4JEUB 3RI5A 4O4IE 2RABA 3MXZA 2A3DA 5AQHB 2QRXA 3K3NA 1H83A 1G8XA 5LMNT 2LM2A 4YHJA 5L3BB 2WY2A 2B9XA 1YQ3A 2YOEA 4UR9A 2GR3A 4HFHA 4U7YA 5KRQA 5LV9A 3FZLB 4DR4T 2CWOA 1RP0A 5E0OA 1DU2A 4C3YA 2VB6A 5LGNB 2VKJA 2O9ZA 3ITJA 2D0TA 1DXLA 3CTYA 5DQWA 1VG9A 3AEFA 4RG3A 4KI0F 4OPLA 3LBXB 1I6ZA 3QK6A 4OPUA 3MZKB 3K3QC 1OJTA 3II4A 2C73A 3MKDA 3GYIA 4H4ZA 5JDGA 2BG9A 3VRDB 3O0HA 4WBOA 2EHOB 2JAEA 2UUBT 1DNCA 4G2AA 4K22A 1FECA 2XVIA 5FS9A 1IBLT 2YG7A 3KBUA 4GIWA 1H7XA 2EQ6A 2NVKX 3KVBA 2V3AA 3GDPA 2FJEA 2K9AA 1ZV4X 3F8DA 3AYLA 3AD9B 3ZLIA 3WE0A 2JBVA 4OYJA 4IL4A 4DUZT 5FNVE 1GRFA 1N4VA 3CNDA 1R084 4WW0A 2G0UA 2QVAA 4NPPA 2UZZA 2R7FA 1EL8A 2XQ8A 4PK5A 2BBJA 2XAGB 2CVJA 4J34A 1BWCA 1PXCA 3CN8A 4JI6T 4ILAA 1XHCA 1VBB4 4H9OC 4ZN0A 4H9QC 2RS34 1WLXA 5FP3A 1PBEA 3P7IA 5LGTB 3LK3B 4AP1A 4YJ3E 1OEDA 4JY2A 1KF6A 5A1LA 2L9QA 3O9XA 3PU3A 3T1YT 2CCQA 3BQIA 3KLJA 1KNZA 2BS3A 1L0VA 3LXDA 4DR1T 3ZC1A 2BACA 1UGOA 5M10A 4EXTA 2CHNA 2YDRA 3TKLB 1PO24 2Q7VA 3KV6A 1CJCA 1W9RA 2F4VT 2V5DA 2EHOD 2YQUA 4U8LA 1GPEA 2OLOA 3OPCA 1NHSA 1UX5A 3AE9A 2YKSA 3CWZB 2R9ZA 3H3MA 1CBOA 2LOPA 4Z24A 5IQ4A 1FL2A 1SEZA 1PJ6A 3AE8A 1N4WA 4O2AE 2R0CA 2A87A 2YVJA 1W0AA 2IC9A 4DBQA 4H50A 4GOUA 1GSNA 4A6NB 2WDQA 4HWFA 5JRCB 1OJCA 2GF3A 2ZZCA 4ECHA 3PUAA 4IT4A 1TDKA 3LJCA 5IYZE 4EQXA 3GN5A 3NNEA 2C5IT 4YFSA 2XHEB 2EQ7A 2JKCA 3AEGA 2D0UA 3WAJA 4WNKA 2VRMA 2R46A 3K7QX 3NK0X 3SM8A 1WR6A 2A8XA 4YXDA 4PK4A 4LMKA 2XDOA 4X66T 4JEHB 4DV2T 2XQ4A 2GEWA 2RPAA 3HYXA 5HXRA 3CX8B 5JCIA 1VRBA 1VBC4 2WP6A 2WAUA 1MMAA 2XAJB 3PUZF 1XDPA 2WBAA 2YK0A 2GR0A 3DJGX 2HN1A 3FZFB 2BBHA 4YTMA 1FCDA 5HYMA 3Q6JA 3P4WA 5KXJA 2OALA 4UV8B 2V7IA 4H2PA 1LVLA 2E8IA 2C3CA 2WDRA 2ZBWA 2BC0A 3C96A 1NA1D 2ZLYA 4IE6A 2J1DG 2V6OA 1AR64 5ABFB 2CHOA 4DV0T 2LJLA 3N9OA 1RUC4 2MPKA 1K0IA 2HPJA 3NTDA 2WBLA 3T2KA 4OFZA 3SGLA 3PV0F 1TDNA 3ATRA 4H4VA 1JU2A 4HFIA 3JC6C 4H4UA 3CGBA 2PYLA 4RSLA 4YTNA 3HKBE 5FXVA 3ZC0A 1RSGA 2VKDA 4IE7A 2Q9QB 4B6XA 2X8HA 1GRBA 5LOVE 4COFA 4G9KA 4TUYE 3S61A 2C64A 2B1EA 3E0ZA 3ZSTA 4P0BA 5J7XA 2ES0A 3AA1B 5J60A 5KMSA 4BJZA 2R064 2EQ9A 2JB1A 3NGCX 4II3A 1ZOYA 2CBJA 2H89A 5DQVA 2HPLA 4BK1A 2WHDA 2XFQA 4NNJA 1HRV4 4Q4X4 3ZJ2A 3VR9A 3BNUA 4LIIA 2WU2A 4Q25A 2YVFA 2UXDT 1GQEA 1H8TD 4B64A 2GMJA 1M7KA 4TV9E 2VK9A 4CN1A 3IC9A 3WI3A 2DHRA 4LFBT 1M6IA 4M52A 3JADA 3HL6A 3QVRA 2W0GA 2PG8A 2X9YA 2XQ6A 3AVRA 3U3IA 1S2YA 3ZYKA 2E5VA 3L8KA 3RLFF 5FMNA 3LJPA 1MXTA 3ZCIA 3Q5XA 1FEWA 5HCJA 3IHGA 2TPRA 1VCTA 4EOZB 4CNJA 2OV9A 1FJGT 2C72A 2YLTA 3UKQA 3P4RA 5JR9B 2LE8A 1HF8A 2ZZBA 4JBWF 4B3ST 3PO7A 4AKIA 2Y6QA 1W0BA 1PBBA 5KNLA 2AQJA 2WETA 3Q9TA 5L4HA 3PVCA 4B66A 3CPZA 2X9XA 5FMHA 2OA5A 5LP6E 1E6EA 3BQKA 3B3RA 2C7GA 1Z7S4 3G06A 3F57A 3RQUA 1RHI4 4C74A 2X68A 3UKLA 2YG6A 1S35A 3QFBA 2K5BB 2C4CA 2YLRA 2MOZA 2H3RA 2UU9T 4JY3A 5JR9C 4IDNA 1CL0A 2WEUA 1RUJ4 3FMWA 3G5RA 4KUMB 1CF3A 2OLNA 2WESA 3GDNA 3H8IA 4ZXLA 1BR0A 4OPGA 3RP7A 2KXPB 5AQGB 2KWIB 4OVIA 1E1LA 2XQ7A 2CEAA 4EQSA 3JAFA 5HWYA 5JDQA 3T31A 2XTLA 4Z8XA 3TLTA 4WCTA 3FZKB 2E9XA 4BA9A 1UKVG 2V6XA 4TZ4C 2QYWA 1VOMA 2BG9E 1B7TA 5LJMA 3QUJA 5HEHA 4NTCA 4TWFA 3G5SA 3ZT7A 3DJEA 4U33A 2V26A 4Y4LA 4NXMT 4LF9T 5AQVB 5HXIA 2WM9A 3M12A 2PJQA 3PUQA 1VQWA 3AECA 2NWBA 1KFYA 4DUYT 3SZ0A 2J3NA 5AQPB 3ALJA 3RC3A 4PAGA 2BKPA 2V3BA 3NH3X 1IBMT 3AAAB 4WBNE 2QA7A 3VHLA 1VRH4 3AVSA 4Z91A 2Y48B 4GCMA 4J33A 3SWHA 1J5WA 4I55E 1FOHA 4IDOA 4HFBA 2WP5A 2YEVC 4JI8T 2B7SA 4X65T 4GK5E 3IHRA 3ZMVB 2YM1A 3C51A 3R9UA 3M65A 1PHHA 2BG9C 2JQKA 3GYJA 5EZYE 1OJDA 2V7KA 1CC4A 3CGDA 4D03A 4X5TA 1J5ET 3B57A 5AQIB 4B63A 4E7ZA 5LBMA 2XPKA 1EAH4 3UFGA 2D5UA 4ZI2C 3V5SA 2CMRA 4ZZBA 3NN6X 2OAMA 5L46A 1Q1RA 5FS7A 1AR94 3ZYLA 2LM9A 1NEKA 3ICRA 2IHR1 1N34T 4C90A 1HNZT 3EPTA 2RM24 3A5XA 3AE5A 3UUBA 3WAKA 3VKHA 2RP4A 2GAGB 5L3GB 1EBDA 3DGHA 4GKKT 3RKGA 2C67A 3ADAB 4C3XA 1MMGA 4H4WA 4K0UA 4Z25A 3V76A 4AKLA 2BDEA 2XLPA 1IAPA 3RHWA 5LBQB 5AQFB 3I0OA 4N78D 3ZDNA 2BXSA 4J36A 3L8RA 1ZK7A 3UP4A 2VVLG 5LXTE 4JI5T 3R6NA 4J2WA 2EHOA 1E39A 2XASB 3BQLA 4A9WA 2E9XC 5HXHA 2CE7A 5FL0A 4HN9A 4UEMA 1S3BA 3I1AA 4Y4MA 2WP9A 3CQGB 2XVJA 4B3RT 2ZZ0A 2KINB 1B37A 2GB0A 4REKA 4EYYR 2N1GA 4IDZA 3UOZA 4C5OA 3COXA 2NW8A 3PUYF 2IIUA 3M13A 4YJ2E 1RUI4 2XFOA 2VRLA 5AQTB 3UFEA 2X9HA 3NKZA 5FXZA 5KMGP 3JBG4 4K7ZA 1AL24 2CLYB 2YDQA 3CNPA 4L0RA 4PJNA 5JH7E 3G5QA 3HKDE 1SA0E 2RR14 1JRYA 4J56A 1JNZA 2NW9A 2DCFA 5FVKA 1DJQA 5J2UE 4J31A 3D1CA 2JMHA 4YSHA 2X51A 5KMQA 3BI5A 4PJJA 2WS3A 4X1KE 3H3AA 4AKHA 3CX6B 3ZMUB 2R4EA 4QXCB 2IUBA 1PBCA 4A97A 1T7SA 1HG5A 3AYJA 5M0ZA 3SUCA 1YW0A 3L39A 5EBKA 4Y4NA 4X62T 4I0UA 3I9WA 2QAEA 4BURA 3NYFA 3NK1X 4FDCB 3K7TA 3CPHG 3O1JA 4EM4A 3CGEA 3C98B 4NUUA 5BMVE 1XMQT 3M0OA 2C3DA 1YKEB 3UU3A 2DKIA 1T72A 2Z5YA 1XI1A 1W09A 4DSGA 4DR6T 4CI2B 5JREA 1D5TA 3K30A 1WYBA 5F8PA 3KBTA 1S2QA 1TYPA 3RP8A 3P4QA 4H4YA 1IUSA 2X9WA 2ZM0A 3UP5A 3QJ4A 2MAWA 2MTQA 4H9NC 4O5QA 3NN0X 2LT3A 2GMHA 1L9CA 5EB5A 3Q5WA 4QX8B 4NXNT 4C91A 5FS6A 4X64T 4IGUA 2D9DA 2E4GA 3SFEA 3ZCJA 2CDUA 4ZEYA 4DV5T 3AEBA 4YT0A 3E08A 2NPXA 2UUAT 1DOCA 2W62A 5GONE 3KKJA 3S4UA 4L9IA 3QC9A 3ISHA 3RP6A 5JDNA 3UQ4A 3ESLA 3K1SA 3ZJ1A 2DLRA 3V3NA 3SS1A 4PFOA 5HEGA 2V7LA 1YQ4A 1N4UA 1TRBA 3KPFA 2C0SA 3FG2P 4K2XA 4HA6A 4MBQA 3GWDA 2W63A 3ALLA 3ETUA 3OYXA 1HX1B
chains in the Genus database with same CATH topology
3SY4A 1IJHA 1ZDLA 4GRTA 5JCIA 3AB1A 3GSIA 1D7YA 1K0LA 2YLZA 2BK4A 2WP6A 3H4KA 4IA6A 2R0GA 4NZHA 2WPEA 1P2HA 3IF9A 1YQZA 4GF7A 2WBAA 4U8MA 5KOWA 2FBWA 2GR0A 1O5WA 2B9WA 5CKUA 1Y56A 2Q6UA 3CNSA 3DJGX 5HHFA 3RNMA 1NDAA 1K4QA 5JCMA 5KWFA 1EL9A 4YTMA 1FCDA 4FX9A 4GDEA 3Q6JA 5HYMA 4BV6A 1CC6A 1D4DA 1MO9A 5JCLA 1NPXA 3URHA 5KXJA 3T2YA 4H4TA 2OALA 3F8RA 4TM1A 1JOAA 2BA9A 2WOVA 1KDGA 2GVCA 1OJAA 4H2PA 1LVLA 4CRTA 4H2QA 2C3CA 4U2SA 2WDRA 4CNKA 1TDOA 2ZBWA 2Q0LA 1XDIA 2BC0A 4Z44A 1PBDA 3SFDA 2XVEA 3C96A 3UP4A 3NG7X 3NTAA 4IA5A 4NEVA 1S3EA 2PYXA 1YKJA 4NWZA 2V6OA 1ZKQA 4EQRA 1COYA 2QA1A 3GD4A 4XWRA 4PABA 2IIDA 5BUKA 4DGKA 1H86A 3BI2A 1Q9IA 1F8RA 3NHOX 1K0IA 1N1PA 4USQA 2B9YA 3NTDA 3T2KA 5GSNA 3KA7A 4PAAA 3ATRA 1TDNA 4H4VA 3SGLA 1JU2A 2WU5A 4H4UA 2FJBA 3CGBA 2LFCA 4RSLA 4YTNA 2GQFA 1E1MA 1RSGA 3P4SA 3FBSA 3QSMA 1GTHA 4U2LA 2V5ZA 3E1TA 4OCGA 3SX6A 3AEEA 2X8HA 4AOSA 1GRBA 4G9KA 4G73A 1RYIA 1NHQA 5JCNA 3UKPA 1REOA 3S61A 2C64A 1B5QA 4NTEA 1Y56B 5J7XA 4GR1A 5J60A 2WQYA 3AD7B 4YSZA 3DGZA 4BJZA 2EQ9A 3V3OA 5ER0A 4EM3A 2JB1A 3HYWA 3NGCX 1ZOYA 2H89A 3GMCA 4II3A 4E0VA 2XLUA 1LPFA 4BK1A 2WHDA 5KMRA 2XFQA 3GYXA 4NNJA 2IVDA 4AT0A 3QVPA 2C76A 3VR9A 3BNUA 4LIIA 2WU2A 2YR5A 2YG4A 1GERA 3BNMA 1GOSA 1LJ1A 1MOKA 2C66A 2YVFA 2BK3A 1KNRA 3DK8A 4B64A 2GQWA 2GMJA 3NT6A 3IC9A 1L9EA 4DSHA 5EOWA 2BRYA 3L1RA 1M6IA 3K7MX 3AWIA 1E7PA 2VZ2A 4M52A 5C2TA 4JQ9A 3QVRA 2WOIA 1XANA 1ONFA 4EQWA 1S2YA 4EMWA 4KPRA 3QSEA 1LTXR 2E5VA 3L8KA 5JCKA 4A99A 3LJPA 4FK1A 1MXTA 1X31B 4U8OA 4LU6A 4OPIA 4X4JA 1GALA 2XFNA 4AOXA 4GUVA 4YKGA 3IHGA 1GV4A 3I3LA 2TPRA 3IHMA 3UOXA 4CNJA 1D4EA 2C72A 2VVLA 2GAHB 2YLTA 3P4RA 4ZCCA 3AE2A 2WDVA 1B4VA 2XVHA 1KSSA 3ATQA 3UKKA 1GRTA 2ZZBA 4ZCDA 1KNPA 3PO7A 2V61A 5BVAA 2Y6QA 2XLTA 1PBBA 4J57A 1CJ3A 2W0HA 1GT8A 3QSSA 2AQJA 2WETA 3Q9TA 1BGNA 1TDFA 5KNLA 3PVCA 1F3PA 4B66A 2DKHA 5FMHA 1E6EA 1PXBA 1PXAA 3B3RA 1QLBA 2C7GA 4K8DA 4IV9A 2YLSA 1V59A 2TMDA 4YWOA 4C74A 3UKLA 2YG6A 3ABVA 4GDPA 3QFBA 4K5SA 2C4CA 3DK9A 2YLRA 4JY3A 5HY5A 1CL0A 2X3NA 1LV0A 2RGHA 3EF6A 3SQPA 2WEUA 3UKAA 3FMWA 3G5RA 4N9XA 4UP3A 1CF3A 2WESA 1GEUA 2OLNA 4HB9A 1GESA 3GDNA 3H8IA 3ICSA 4OPGA 4U8KA 4U8IA 3RP7A 3SZWA 4I58A 1NG4A 4XWZA 5KMSA 2GV8A 1H82A 1Y0PA 4CCRA 4AP3A 5KVIA 4OVIA 1E1LA 4XXGA 3GQHA 4AT2A 1H84A 2PHHA 2C75A 1OJ9A 3CNTA 4USRA 4ICYA 1PBFA 1YY5A 4EQSA 1PS9A 3T31A 1HYUA 3GWFA 4BJYA 2YM2A 3SYIA 4WCTA 3UKQA 4EIPA 2R45A 2BRAA 4U8JA 1UKVG 5U63A 4OPCA 3KD9A 3REDA 1BF3A 3GD3A 2YLWA 2VVMA 2YVGA 3CPJG 3SZCA 1ELIA 1BKWA 2ACZA 5EB4A 1F8SA 4NTCA 3IWAA 1VRQB 1QJDA 3NK2X 1TDEA 3AXBA 1F6MA 3G5SA 3LZWA 3DJEA 1NHRA 1FEBA 4B68A 2VOUA 2YWLA 1GRAA 2YR6A 1NHPA 4Y4LA 3VRAA 4YKFA 4H4PA 1IUWA 3S5WA 1CHUA 5HXIA 3GRSA 1DJNA 3M12A 1E1NA 2WPCA 1EL5A 5KOXA 4YSYA 1VQWA 2BS4A 3AECA 1KFYA 1LQUA 2GR1A 2WOWA 2XLRA 3NYCA 4TLZA 4UDPA 3SZ0A 3T14A 1NAAA 2J3NA 1NENA 3ALMA 3ALJA 1ZMDA 1GREA 2V3BA 3AD8B 3NH3X 3SXIA 4B69A 2QA2A 3ZYXA 3CNJA 3AEAA 3BHKA 4NTDA 4P9SA 3KVEA 2V60A 1QO8A 2YLXA 2XVFA 1JRZA 1D7LA 3UKHA 4B67A 2OA1A 4GCMA 1H7WA 4A79A 1GETA 1PN0A 4J33A 5GRTA 1E1KA 3QFAA 4IVMB 4JDRA 1FOHA 4I59A 2WP5A 1XPQA 4JNQA 4D04A 1BZLA 2YG5A 2Y6RA 2B7SA 1NG3A 2YG3A 5CQFA 3CMMA 3UOYA 2BABA 2A89A 1DODA 3GRTA 2AR8A 3NLCA 4OPTA 2YR4A 1ZY8A 2YM1A 1LQTA 3R9UA 1PJ5A 1PHHA 3GYJA 1OJDA 1CC4A 3CGDA 4D03A 1H6VA 5BULA 2X8GA 1KSUA 4B63A 2RGOA 4NEWA 2YAUA 3NN6X 4YTPA 1GNDA 2JB2A 2OAMA 5L46A 2RABA 4KX6A 3FPZA 1Q1RA 2E1MA 5FS7A 1NEKA 3ICRA 3NYEA 4UDRA 3AE6A 4ADWA 1H83A 4H2RA 2B9XA 4Z2TA 3EPTA 5FS8A 1YQ3A 4O5UA 3AE5A 3OZ2A 2GAGB 3D8XA 2GR3A 5LV9A 3DGHA 1EBDA 5KRQA 4C3XA 2C67A 4EMIA 3ADAB 4H2NA 3JSKA 4OPDA 1RP0A 3UCLA 2B76A 3DK4A 3EAOA 4FK1C 4C3YA 1IUUA 3ICTA 2ARDA 4H4WA 4Z25A 3V76A 2O9ZA 2I0ZA 2X8CA 3ITJA 3VR8A 1DXLA 1JRXA 2XLPA 3CTYA 4Z2UA 1VG9A 4H7UA 3AEFA 4RG3A 4Z43A 4OPLA 4Z26A 4RG4A 2R4JA 4OPUA 2BYBA 5C3JA 2XYOA 5U25A 3ZDNA 3LOVA 5U1OA 2H88A 5BRTA 1OJTA 2BXSA 3II4A 4GAVA 1ZK7A 2C73A 3AYIA 3CIRA 3GYIA 1F8WA 2VVLG 4H4ZA 4WX1A 3UTEA 1M64A 3DMEA 3O0HA 1E39A 4J2WA 3VRDB 2XFUA 1Q1WA 3DJJA 4A9WA 1VDCA 1ZP0A 2JAEA 3BI4A 1S3BA 4G74A 5IQ1A 3AEDA 3UTFA 4Y4MA 2WP9A 1CJ2A 2C70A 2XVJA 2FJAA 2BCPA 1DNCA 3C4AA 2ZZ0A 4K22A 1B37A 1FECA 2GB0A 2XVIA 1EL7A 4H4SA 4REKA 3T37A 3UOZA 3CPIG 5FS9A 4A5LA 4C5OA 5KVHA 3COXA 2YG7A 1H7XA 1CC2A 1B8SA 2EQ6A 2NVKX 3UTHA 1DOBA 2V3AA 2FJEA 3GDPA 3M13A 4APNA 3DA1A 3F8DA 2XFOA 1IUTA 2VRLA 2XFPA 2APGA 2CULA 3AYLA 3AD9B 4CY6A 2JK6A 3WE0A 2JBVA 3AE3A 2BS2A 4TM0A 4K7ZA 2BC1A 4TM3A 1GRFA 3T0KA 1N4VA 2IVEA 3CNPA 3CNDA 3F8PA 1ZMCA 5IPYA 3UKFA 2GRTA 2UZZA 1EL8A 3G5QA 2CVJA 4J34A 2Q0KA 1JRYA 2BK5A 4J56A 1JNZA 1BWCA 2WPFA 1PXCA 2CFYA 3CN8A 1DJQA 5KMPA 1PDHA 1XHCA 4J31A 3D1CA 3NKSA 4MJWA 4YSHA 2BXRA 4G6HA 1ZX9A 5KMQA 4ZN0A 3BI5A 4A7AA 1K0JA 2WS3A 3HZLA 4X9MA 2R4EA 3SZFA 3VRBA 1PBCA 2QCUA 2XCGA 1PBEA 3LADA 3AYJA 5M0ZA 3SUCA 4H4RA 1H81A 1L9DA 1TYTA 3FIMB 4Y4NA 5EBKA 1GRHA 3P4PA 4AP1A 3H8LA 4X9NA 2GR2A 1AOGA 4JY2A 2QAEA 1KF6A 3LZXA 3HYVA 1CJ4A 4BURA 3NYFA 3NK1X 4FDCB 3K7TA 3NRNA 4UDQA 2F5ZA 3CPHG 1JNRA 3UTGA 4BK2A 4LA1A 4EM4A 3CGEA 4CCQA 4IVOB 3AE1A 3KLJA 4J36A 4CBQA 3T2ZA 4II2A 3LB8A 2C3DA 3M0OA 2BS3A 1L0VA 1P2EA 3LXDA 2DKIA 2X99A 2BACA 3KPKA 2Z5YA 5TR3A 5M10A 3PS9A 4CY8A 2B7RA 2XLSA 3RHAA 1FEAA 1BGJA 3NIXA 1GRGA 2EQ8A 4B1BA 3AE7A 2FJDA 4DSGA 4JNAA 2GH5A 2Q7VA 3VQRA 3P9UA 4B65A 1GXFA 1CJCA 4EIQA 1DOEA 3EANA 2YQUA 1D5TA 1W4XA 3K30A 1GPEA 4U8LA 1S2QA 1TYPA 2OLOA 4K5RA 1NHSA 1GTEA 3RP8A 3P4QA 4H4YA 1IUSA 3AE9A 2R0PA 4G6GA 3QJ4A 3UP5A 4A65A 3OC4A 2R9ZA 4O5QA 4H4XA 3NN0X 2C65A 2GMHA 1L9CA 1CBOA 4TLXA 5EB5A 4Z24A 4U8PA 2AAQA 3CGCA 5IQ4A 1FL2A 1SEZA 1PJ6A 5FS6A 3AE8A 1N4WA 3P1WA 2E4GA 3SFEA 2A87A 2R0CA 2CDUA 2X50A 2YVJA 1ZOVA 3DH9A 3AEBA 4JN9A 2VQ7A 4YT0A 4H50A 1PJ7A 2NPXA 1GSNA 1Z6LA 2WDQA 4A6NB 1OJCA 1DOCA 4Z2RA 2GF3A 2ZZCA 4TM4A 4ECHA 3KKJA 4GAPA 3ISHA 3RP6A 1TDKA 5DBJA 3GMBA 1O94A 4BK3A 3B6DA 4EQXA 3V3NA 4H4QA 2JB3A 3I6DA 3NNEA 1JEHA 1D4CA 2EQ7A 3KU9A 1YQ4A 2JKCA 1N4UA 1TRBA 3C4NA 3AEGA 2VQBA 3KPFA 4YSXA 1VG0A 4DNAA 2VRMA 4EMJA 2R46A 2Z5XA 3K7QX 4U2TA 3FG2P 3NK0X 4A6NA 2RGJA 2A8XA 3SM8A 3AE4A 4YXDA 1IUVA 2XDOA 1IUXA 4K2XA 4HA6A 4U8NA 2BCGG 3UOVA 4C77A 3GWDA 2GEWA 3ALLA 3DJDA 1O95A 3HYXA 3BHFA 2HQMA 3GQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJH A;  1ZDL A;  4GRT A;  5JCI A;  3AB1 A;  3GSI A;  1D7Y A;  1K0L A;  2YLZ A;  2BK4 A;  2WP6 A;  3H4K A;  4IA6 A;  2R0G A;  4NZH A;  2WPE A;  1P2H A;  3IF9 A;  1YQZ A;  4GF7 A;  2WBA A;  4U8M A;  5KOW A;  2FBW A;  2GR0 A;  1O5W A;  2B9W A;  5CKU A;  1Y56 A;  2Q6U A;  3CNS A;  3DJG X;  5HHF A;  3RNM A;  1NDA A;  1K4Q A;  5JCM A;  5KWF A;  1EL9 A;  4YTM A;  1FCD A;  4FX9 A;  4GDE A;  3Q6J A;  5HYM A;  4BV6 A;  1CC6 A;  1D4D A;  1MO9 A;  5JCL A;  1NPX A;  3URH A;  5KXJ A;  4H4T A;  2OAL A;  3F8R A;  4TM1 A;  1JOA A;  2BA9 A;  2WOV A;  1KDG A;  2GVC A;  1OJA A;  4H2P A;  1LVL A;  4CRT A;  4H2Q A;  2C3C A;  4U2S A;  2WDR A;  4CNK A;  1TDO A;  2ZBW A;  2Q0L A;  1XDI A;  2BC0 A;  4Z44 A;  1PBD A;  3SFD A;  2XVE A;  3C96 A;  3UP4 A;  3NG7 X;  3NTA A;  4IA5 A;  4NEV A;  1S3E A;  2PYX A;  1YKJ A;  2V6O A;  1ZKQ A;  4EQR A;  1COY A;  2QA1 A;  3GD4 A;  4XWR A;  4PAB A;  2IID A;  5BUK A;  4DGK A;  1H86 A;  3BI2 A;  1Q9I A;  1F8R A;  3NHO X;  1K0I A;  1N1P A;  4USQ A;  2B9Y A;  3NTD A;  5GSN A;  3KA7 A;  4PAA A;  3ATR A;  1TDN A;  4H4V A;  3SGL A;  1JU2 A;  2WU5 A;  4H4U A;  2FJB A;  3CGB A;  2LFC A;  4RSL A;  4YTN A;  2GQF A;  1E1M A;  1RSG A;  3P4S A;  3FBS A;  3QSM A;  1GTH A;  4U2L A;  2V5Z A;  3E1T A;  4OCG A;  3AEE A;  2X8H A;  4AOS A;  1GRB A;  1RYI A;  1NHQ A;  5JCN A;  3UKP A;  1REO A;  3S61 A;  2C64 A;  1B5Q A;  4NTE A;  1Y56 B;  5J7X A;  4GR1 A;  5J60 A;  2WQY A;  3AD7 B;  4YSZ A;  3DGZ A;  4BJZ A;  2EQ9 A;  3V3O A;  5ER0 A;  4EM3 A;  2JB1 A;  3NGC X;  1ZOY A;  2H89 A;  3GMC A;  4E0V A;  2XLU A;  1LPF A;  4BK1 A;  2WHD A;  2XFQ A;  3GYX A;  2IVD A;  4AT0 A;  3QVP A;  2C76 A;  3VR9 A;  3BNU A;  4LII A;  2WU2 A;  2YR5 A;  2YG4 A;  1GER A;  3BNM A;  1GOS A;  1LJ1 A;  1MOK A;  2C66 A;  2YVF A;  2BK3 A;  1KNR A;  3DK8 A;  4B64 A;  2GQW A;  2GMJ A;  3NT6 A;  3IC9 A;  1L9E A;  4DSH A;  5EOW A;  3L1R A;  1M6I A;  3K7M X;  3AWI A;  1E7P A;  2VZ2 A;  4M52 A;  5C2T A;  4JQ9 A;  3QVR A;  2WOI A;  1XAN A;  1ONF A;  4EQW A;  1S2Y A;  4EMW A;  4KPR A;  3QSE A;  1LTX R;  2E5V A;  3L8K A;  5JCK A;  4A99 A;  3LJP A;  4FK1 A;  1MXT A;  1X31 B;  4U8O A;  4LU6 A;  4OPI A;  4X4J A;  1GAL A;  2XFN A;  4AOX A;  4GUV A;  4YKG A;  3IHG A;  1GV4 A;  3I3L A;  2TPR A;  3IHM A;  3UOX A;  4CNJ A;  1D4E A;  2C72 A;  2VVL A;  2GAH B;  2YLT A;  3P4R A;  4ZCC A;  3AE2 A;  2WDV A;  1B4V A;  2XVH A;  1KSS A;  3ATQ A;  3UKK A;  1GRT A;  2ZZB A;  4ZCD A;  1KNP A;  3PO7 A;  2V61 A;  5BVA A;  2Y6Q A;  2XLT A;  1PBB A;  4J57 A;  1CJ3 A;  2W0H A;  1GT8 A;  3QSS A;  2AQJ A;  2WET A;  3Q9T A;  1BGN A;  1TDF A;  3PVC A;  1F3P A;  4B66 A;  2DKH A;  5FMH A;  1E6E A;  1PXB A;  1PXA A;  3B3R A;  1QLB A;  2C7G A;  4K8D A;  4IV9 A;  2YLS A;  1V59 A;  2TMD A;  4YWO A;  4C74 A;  3UKL A;  2YG6 A;  3ABV A;  4GDP A;  3QFB A;  4K5S A;  3DK9 A;  2YLR A;  4JY3 A;  5HY5 A;  1CL0 A;  2X3N A;  1LV0 A;  2RGH A;  3EF6 A;  3SQP A;  2WEU A;  3UKA A;  3FMW A;  3G5R A;  4N9X A;  4UP3 A;  1CF3 A;  2WES A;  1GEU A;  2OLN A;  4HB9 A;  1GES A;  3GDN A;  3H8I A;  3ICS A;  4OPG A;  4U8K A;  4U8I A;  3RP7 A;  4EMI A;  4I58 A;  1NG4 A;  4XWZ A;  2GV8 A;  1H82 A;  1Y0P A;  4CCR A;  4AP3 A;  5KVI A;  4OVI A;  1E1L A;  4XXG A;  3GQH A;  4AT2 A;  1H84 A;  2PHH A;  2C75 A;  1OJ9 A;  3CNT A;  4USR A;  4ICY A;  1PBF A;  1YY5 A;  4EQS A;  1PS9 A;  1HYU A;  3GWF A;  4BJY A;  2YM2 A;  4WCT A;  3UKQ A;  4EIP A;  2R45 A;  4U8J A;  1UKV G;  5U63 A;  4OPC A;  3KD9 A;  3RED A;  1BF3 A;  3GD3 A;  2YLW A;  2VVM A;  2YVG A;  3CPJ G;  1ELI A;  1BKW A;  2ACZ A;  5EB4 A;  1F8S A;  4NTC A;  3IWA A;  1VRQ B;  1QJD A;  3NK2 X;  1TDE A;  3AXB A;  1F6M A;  3G5S A;  3LZW A;  3DJE A;  1NHR A;  1FEB A;  4B68 A;  2VOU A;  2YWL A;  1GRA A;  2YR6 A;  1NHP A;  4Y4L A;  3VRA A;  4YKF A;  4H4P A;  1IUW A;  3S5W A;  1CHU A;  5HXI A;  3GRS A;  1DJN A;  3M12 A;  1E1N A;  2WPC A;  1EL5 A;  5KOX A;  4YSY A;  1VQW A;  2BS4 A;  3AEC A;  1KFY A;  1LQU A;  2GR1 A;  2WOW A;  2XLR A;  3NYC A;  4TLZ A;  4UDP A;  1NAA A;  2J3N A;  1NEN A;  3ALM A;  3ALJ A;  1ZMD A;  1GRE A;  2V3B A;  3AD8 B;  3NH3 X;  4B69 A;  2QA2 A;  3ZYX A;  3CNJ A;  3AEA A;  3BHK A;  4NTD A;  4P9S A;  3KVE A;  2V60 A;  1QO8 A;  2YLX A;  2XVF A;  1JRZ A;  1D7L A;  3UKH A;  4B67 A;  2OA1 A;  4GCM A;  1H7W A;  4A79 A;  1GET A;  1PN0 A;  4J33 A;  5GRT A;  1E1K A;  3QFA A;  4IVM B;  4JDR A;  1FOH A;  4I59 A;  2WP5 A;  1XPQ A;  4JNQ A;  4D04 A;  1BZL A;  2YG5 A;  2Y6R A;  2B7S A;  1NG3 A;  2YG3 A;  5CQF A;  3UOY A;  2BAB A;  2A89 A;  1DOD A;  3GRT A;  2AR8 A;  3NLC A;  4OPT A;  2YR4 A;  1ZY8 A;  2YM1 A;  1LQT A;  3R9U A;  1PJ5 A;  1PHH A;  3GYJ A;  1OJD A;  1CC4 A;  3CGD A;  4D03 A;  1H6V A;  5BUL A;  2X8G A;  1KSU A;  4B63 A;  2RGO A;  4NEW A;  2YAU A;  3NN6 X;  4YTP A;  1GND A;  2JB2 A;  2OAM A;  5L46 A;  2RAB A;  4KX6 A;  3FPZ A;  1Q1R A;  2E1M A;  5FS7 A;  1NEK A;  3ICR A;  3NYE A;  4UDR A;  3AE6 A;  4ADW A;  1H83 A;  4H2R A;  2B9X A;  4Z2T A;  3EPT A;  5FS8 A;  1YQ3 A;  4O5U A;  3AE5 A;  3OZ2 A;  2GAG B;  3D8X A;  2GR3 A;  5LV9 A;  3DGH A;  1EBD A;  5KRQ A;  4C3X A;  2C67 A;  3ADA B;  4H2N A;  3JSK A;  4OPD A;  1RP0 A;  3UCL A;  2B76 A;  3DK4 A;  3EAO A;  4FK1 C;  4C3Y A;  1IUU A;  3ICT A;  2ARD A;  4H4W A;  4Z25 A;  3V76 A;  2O9Z A;  2I0Z A;  2X8C A;  3ITJ A;  3VR8 A;  1DXL A;  1JRX A;  2XLP A;  3CTY A;  4Z2U A;  1VG9 A;  4H7U A;  3AEF A;  4RG3 A;  4Z43 A;  4OPL A;  4Z26 A;  4RG4 A;  2R4J A;  4OPU A;  2BYB A;  5C3J A;  2XYO A;  5U25 A;  3ZDN A;  3LOV A;  5U1O A;  2H88 A;  5BRT A;  1OJT A;  2BXS A;  3II4 A;  4J36 A;  1ZK7 A;  2C73 A;  3AYI A;  3CIR A;  3GYI A;  1F8W A;  2VVL G;  4H4Z A;  4WX1 A;  3UTE A;  1M64 A;  3DME A;  3O0H A;  1E39 A;  4J2W A;  3VRD B;  2XFU A;  1Q1W A;  3DJJ A;  4A9W A;  1VDC A;  1ZP0 A;  2JAE A;  3BI4 A;  1S3B A;  5IQ1 A;  3UTF A;  3AED A;  4Y4M A;  2WP9 A;  1CJ2 A;  2C70 A;  2XVJ A;  2FJA A;  2BCP A;  1DNC A;  3C4A A;  2ZZ0 A;  4K22 A;  1B37 A;  1FEC A;  2GB0 A;  2XVI A;  1EL7 A;  4H4S A;  4REK A;  3T37 A;  3UOZ A;  3CPI G;  5FS9 A;  4A5L A;  4C5O A;  5KVH A;  3COX A;  2YG7 A;  1H7X A;  1CC2 A;  1B8S A;  2EQ6 A;  2NVK X;  3UTH A;  1DOB A;  2V3A A;  2FJE A;  3GDP A;  3M13 A;  4APN A;  3DA1 A;  3F8D A;  2XFO A;  1IUT A;  2VRL A;  2XFP A;  2APG A;  2CUL A;  3AYL A;  3AD9 B;  4CY6 A;  2JK6 A;  3WE0 A;  2JBV A;  3AE3 A;  2BS2 A;  4TM0 A;  4K7Z A;  2BC1 A;  4TM3 A;  1GRF A;  1N4V A;  2IVE A;  3CNP A;  3CND A;  3F8P A;  1ZMC A;  5IPY A;  3UKF A;  2GRT A;  2UZZ A;  1EL8 A;  3G5Q A;  2CVJ A;  4J34 A;  2Q0K A;  1JRY A;  2BK5 A;  4J56 A;  1JNZ A;  1BWC A;  2WPF A;  1PXC A;  2CFY A;  3CN8 A;  1DJQ A;  1PDH A;  1XHC A;  4J31 A;  3D1C A;  3NKS A;  4MJW A;  4YSH A;  2BXR A;  1ZX9 A;  4ZN0 A;  3BI5 A;  4A7A A;  1K0J A;  2WS3 A;  3HZL A;  4X9M A;  2R4E A;  3VRB A;  1PBC A;  2QCU A;  2XCG A;  1PBE A;  3LAD A;  3AYJ A;  5M0Z A;  3SUC A;  4H4R A;  1H81 A;  1L9D A;  1TYT A;  3FIM B;  4Y4N A;  5EBK A;  1GRH A;  3P4P A;  4AP1 A;  3H8L A;  4X9N A;  2GR2 A;  1AOG A;  4JY2 A;  2QAE A;  1KF6 A;  3LZX A;  1CJ4 A;  4BUR A;  3NYF A;  3NK1 X;  4FDC B;  3K7T A;  3NRN A;  4UDQ A;  2F5Z A;  3CPH G;  1JNR A;  3UTG A;  4BK2 A;  4LA1 A;  4EM4 A;  3CGE A;  4CCQ A;  4IVO B;  3AE1 A;  3KLJ A;  4CBQ A;  3LB8 A;  2C3D A;  3M0O A;  2BS3 A;  1L0V A;  1P2E A;  3LXD A;  2DKI A;  2X99 A;  2BAC A;  2Z5Y A;  5TR3 A;  5M10 A;  3PS9 A;  4CY8 A;  2B7R A;  2XLS A;  3RHA A;  1FEA A;  1BGJ A;  3NIX A;  1GRG A;  2EQ8 A;  4B1B A;  3AE7 A;  2FJD A;  4DSG A;  4JNA A;  2GH5 A;  2Q7V A;  3VQR A;  3P9U A;  4B65 A;  1GXF A;  1CJC A;  4EIQ A;  1DOE A;  3EAN A;  2YQU A;  1D5T A;  1W4X A;  3K30 A;  1GPE A;  4U8L A;  1S2Q A;  1TYP A;  2OLO A;  4K5R A;  1NHS A;  1GTE A;  3RP8 A;  3P4Q A;  4H4Y A;  1IUS A;  3AE9 A;  2R0P A;  3UP5 A;  3QJ4 A;  4A65 A;  3OC4 A;  2R9Z A;  4O5Q A;  4H4X A;  3NN0 X;  2C65 A;  2GMH A;  1L9C A;  1CBO A;  4TLX A;  5EB5 A;  4Z24 A;  4U8P A;  2AAQ A;  3CGC A;  5IQ4 A;  1FL2 A;  1SEZ A;  1PJ6 A;  5FS6 A;  3AE8 A;  1N4W A;  3P1W A;  2E4G A;  3SFE A;  2A87 A;  2R0C A;  2CDU A;  2X50 A;  2YVJ A;  1ZOV A;  3DH9 A;  3AEB A;  4JN9 A;  2VQ7 A;  4YT0 A;  4H50 A;  1PJ7 A;  2NPX A;  1GSN A;  1Z6L A;  2WDQ A;  4A6N B;  1OJC A;  1DOC A;  4Z2R A;  2GF3 A;  2ZZC A;  4TM4 A;  4ECH A;  3KKJ A;  3ISH A;  3RP6 A;  1TDK A;  5DBJ A;  3GMB A;  1O94 A;  4BK3 A;  3B6D A;  4EQX A;  3V3N A;  4H4Q A;  2JB3 A;  3I6D A;  3NNE A;  1JEH A;  1D4C A;  2EQ7 A;  3KU9 A;  1YQ4 A;  2JKC A;  1N4U A;  1TRB A;  3C4N A;  3AEG A;  2VQB A;  3KPF A;  4YSX A;  1VG0 A;  4DNA A;  2VRM A;  4EMJ A;  2R46 A;  2Z5X A;  3K7Q X;  4U2T A;  3FG2 P;  3NK0 X;  4A6N A;  2RGJ A;  2A8X A;  3SM8 A;  3AE4 A;  4YXD A;  1IUV A;  2XDO A;  1IUX A;  4K2X A;  4HA6 A;  4U8N A;  2BCG G;  3UOV A;  4C77 A;  3GWD A;  2GEW A;  3ALL A;  3DJD A;  1O95 A;  3BHF A;  2HQM A;  3GQK A; 
#chains in the Genus database with same CATH topology
 3PUS A;  1ZDL A;  3ZN1 B;  2YLZ A;  2BK4 A;  1LKX A;  4IA6 A;  3N9M A;  1P2H A;  3ONJ A;  2E5L T;  4GF7 A;  4U8M A;  3OVU A;  1Y56 A;  5HHF A;  3CNS A;  1NDA A;  1K4Q A;  5JCM A;  4LF6 T;  5KWF A;  3RIA A;  4O8S A;  4HFD A;  4HWI B;  4FX9 A;  4ZI3 D;  1MO9 A;  2C5K T;  3URH A;  2JPF A;  4H4T A;  2XQ3 A;  3F8R A;  4OX9 T;  3B5M A;  1JOA A;  2WOV A;  4PJL A;  1OJA A;  3OJA A;  4CNK A;  1TDO A;  4DR5 T;  1PBD A;  1U5P A;  3QB5 A;  4QWN B;  5J2T E;  3NG7 X;  4NEV A;  1S3E A;  3LBX A;  4IL9 A;  2VKH A;  4EQR A;  4WYV A;  4PAB A;  5LJN A;  4RHV 4;  4DGK A;  1H86 A;  1Q9I A;  2Q9Q D;  1F8R A;  3N9Q A;  3RF1 A;  4CZZ B;  3EI0 A;  2JMK A;  5JVD E;  3KFW X;  1WYC A;  4USQ A;  4X20 E;  4V1A v;  2WU5 A;  4O4J E;  2LFC A;  1E1M A;  4NIQ A;  4OCG A;  3O1H A;  3AEE A;  4AOS A;  3C64 A;  2LKG A;  1NHQ A;  5JCN A;  3HKC E;  4NTE A;  3NZP A;  3V3O A;  5ER0 A;  3GMC A;  1D1A A;  2XLU A;  2HWB 4;  4AT0 A;  2ZM6 T;  1YXR A;  4EZH A;  3BNM A;  1GOS A;  1LJ1 A;  2IW5 B;  5LYJ E;  1KNR A;  5AQR B;  5EK4 A;  3W15 B;  3DK8 A;  3NT6 A;  3LK2 B;  4U31 A;  5JR9 A;  5JDF A;  2BRY A;  3L1R A;  3K7M X;  3AA7 B;  3AWI A;  4X1I E;  4JQ9 A;  3F2E A;  5M4Y A;  5EK3 A;  5ABH A;  2X66 A;  4I43 B;  2H7V C;  4TNW A;  4FK1 A;  5LHG B;  2XFN A;  3EUH A;  3IHM A;  1D4E A;  2VVL A;  2WDV A;  5HEU A;  4UXN B;  1KNP A;  2V61 A;  4J57 A;  1CJ3 A;  1ASJ 4;  2VWA A;  1GT8 A;  3QSS A;  1TDF A;  4EYU A;  2R6G F;  2DKH A;  3ZMT B;  3I0Q A;  4CXX A;  4DO0 A;  5DAB A;  3RRC A;  1QLB A;  5LHH B;  4K8D A;  2TMD A;  3LSV A;  2D2S A;  5AQQ B;  2XQ9 A;  3ABV A;  2X67 A;  4AKG A;  4K5S A;  1D4M 4;  3CML A;  4QXB B;  1LV0 A;  2XM1 A;  4DV6 T;  4N9X A;  4UP3 A;  2ZM8 A;  1GEU A;  4EMI A;  1GES A;  4U8K A;  3SZW A;  4ANJ A;  1NG4 A;  4HGA A;  4XWZ A;  3AXJ B;  1Y0P A;  3KV5 A;  3UT5 E;  5KVI A;  2ODU A;  4AT2 A;  1OWA A;  1WRD A;  5HAX A;  5IWA T;  5JDM A;  4JYA T;  3QB5 K;  1PS9 A;  4BJY A;  2PTF A;  2LEH A;  3PUR A;  4EIP A;  2DI4 A;  2HH7 A;  4TNV A;  3UTK A;  2YLW A;  1D0X A;  2YVG A;  1ELI A;  1BKW A;  3NK2 X;  1XHZ A;  1TDE A;  2LSI A;  2UXN B;  1NHR A;  1FEB A;  4B68 A;  4Q4Y 4;  2YR6 A;  3J7Y q;  1HCI A;  3OYZ A;  1N32 T;  4YKF A;  2I59 A;  1DJN A;  2W66 A;  4YSY A;  5ABG A;  2RA1 A;  2GR1 A;  2QGS A;  2XLR A;  4ZS2 A;  4ZOL E;  3DJD A;  3RGL A;  1GRE A;  3VU7 H;  2QA2 A;  2HN2 A;  4NTD A;  4P0A A;  4HE8 A;  2YN6 A;  5L3C B;  1HS7 A;  1PN0 A;  5GRT A;  1E1K A;  2CA5 A;  3PTR B;  3PUX F;  1XPQ A;  3TLW A;  1N36 T;  4QH4 A;  4ILB A;  2YG3 A;  5CQF A;  2BAB A;  2A89 A;  3PUV F;  5L2L A;  3GRT A;  4KHP T;  2JQQ A;  4BJM A;  3NLC A;  3NZQ A;  2YR4 A;  4OPT A;  4FI5 A;  2LLY A;  3FBL A;  3CQX C;  3U78 A;  5LGU B;  5BUL A;  3N2G E;  4NEW A;  1BR1 A;  2YAU A;  4LF4 T;  3ETV A;  2JB2 A;  5LA6 E;  2E1M A;  5J0Z A;  4DV7 T;  4TN7 B;  1ZKE A;  3NYE A;  4UDR A;  3AE6 A;  4ADW A;  4H2R A;  1XDO A;  5ABE A;  5HWX A;  5FS8 A;  4ZI2 D;  2L3L A;  3OZ2 A;  4HEA A;  1KEY A;  4H2N A;  3RYF E;  3FZM B;  3UCL A;  5AQM B;  2PYJ A;  3DK4 A;  2IML A;  2RMU 4;  2NW7 A;  2ARD A;  3EAB A;  2I0Z A;  2X8C A;  4Z2U A;  1JRX A;  5LNK A;  2E9X B;  4Z26 A;  4OK0 A;  4RG4 A;  2R4J A;  2BYB A;  2XYO A;  5HYA A;  3ZMS B;  3UQ7 A;  5U25 A;  3HA4 A;  5U1O A;  4QXH B;  3ZT6 A;  2BZB A;  4PNI A;  3RIF A;  3AAE B;  3AYI A;  3CIR A;  4GAV A;  2VVS A;  4WX1 A;  1WFD A;  2NOX A;  5HCM A;  3NRX A;  2X0L B;  2N2N A;  3DJJ A;  4LML A;  1VDC A;  1ZP0 A;  5IQ1 A;  3UTF A;  3AED A;  4A56 A;  4JI3 T;  4HTE A;  2BCP A;  5EK2 A;  4A5L A;  3UUN A;  2CRB A;  2J47 A;  1PIV 4;  3UTH A;  1DOB A;  5C8Y E;  1I94 T;  4U7I A;  3QOF A;  1IUT A;  1VBE 4;  2XFP A;  2CUL A;  4CY6 A;  2Y6X A;  4KBM B;  3KVA A;  4TM0 A;  1UUR A;  3UU8 A;  3T0K A;  1NCQ D;  5AQL B;  2IVE A;  3F8P A;  1ZMC A;  2UXB T;  3UKF A;  2GRT A;  4K0K T;  3ONL C;  1OXZ A;  2IC6 A;  2BK5 A;  3HKE E;  1MIW A;  2CFY A;  3FZH B;  4ZI3 C;  5KDM C;  5KMP A;  4MJW A;  2E2A A;  2DNX A;  4G6H A;  1ZEE A;  3ANW B;  1X9B A;  3HZL A;  4X9M A;  2CWY A;  4Q4W 4;  3SZF A;  4A98 A;  5H6Q B;  2XCG A;  4HWC A;  5KX5 E;  4EB6 E;  4H4R A;  1H81 A;  1TYT A;  3FIM B;  5HEO A;  3P4P A;  3H8L A;  1AOG A;  1XWM A;  3HYV A;  3C4W A;  2LHN A;  2F5Z A;  1JNR A;  4XAX B;  3UTG A;  4BK2 A;  1HXS 4;  4LA1 A;  4HKA A;  4O2B E;  3AE1 A;  2YU2 A;  2E9X D;  1MIY A;  4CBQ A;  1SE7 A;  3T2Z A;  2ZMA A;  3GMI A;  1P2E A;  2X99 A;  1ZHC A;  3KPK A;  4A5X A;  3PS9 A;  5CJ5 A;  5FXW A;  1FEA A;  3NIX A;  1GRG A;  5JTG A;  4B1B A;  1LRZ A;  3AE7 A;  3BK9 A;  2GH5 A;  3VQR A;  3P9U A;  4B65 A;  5AQJ B;  1DOE A;  5HXE A;  3RPU A;  2J62 A;  3CX7 B;  4U72 A;  4K5R A;  4ZI7 E;  4IIJ E;  1GTE A;  1IJ5 A;  2UUC T;  3EDV A;  4H4X A;  3JD7 4;  3LFM A;  3FB2 A;  4U8P A;  3P1W A;  3AAI A;  2X50 A;  2CXF A;  4JUY A;  3KIN B;  2VQ7 A;  1Z6L A;  4Z2R A;  3NVO A;  2VUR A;  4BK3 A;  2JB3 A;  1JEH A;  1D4C A;  4CI3 B;  4Z90 A;  2VQB A;  5LG4 A;  4IRE A;  4EMJ A;  2N9D A;  3PE0 A;  3C50 A;  5FKY A;  4A6N A;  3AE4 A;  3RIU A;  1IUV A;  2XY8 B;  5JQG E;  4HWD A;  4U8N A;  2YDS A;  2BCG G;  1XHX A;  5F5W A;  3DJB A;  3CK6 A;  1BR2 A;  2HQM A;  3BHF A;  3GQK A;  4MFR A;  4CQI A;  1IJH A;  2ACX A;  4GRT A;  5BR8 T;  1PVC 4;  4QX7 B;  3AB1 A;  4U2Z A;  3GSI A;  2X5I D;  5FY1 A;  3H4K A;  4BJN A;  2WPE A;  3ANW A;  4KMC A;  2JIW A;  2V7M A;  2WSS V;  3UUL A;  2W61 A;  5KOW A;  2FBW A;  1O5W A;  5CKU A;  2Q6U A;  4JV5 T;  3RYI E;  2W4X A;  4GYR A;  3JC6 D;  1EL9 A;  5HXC A;  1LVF A;  4JI4 T;  2V6Y B;  2VL0 A;  2WZI A;  3TLS A;  1MNE A;  4TM1 A;  2HWC 4;  2BA9 A;  4CRT A;  1KDG A;  4H2Q A;  4IE4 A;  5AQN B;  2Q0L A;  1XDI A;  4YLH A;  4LF7 T;  3NTA A;  4IA5 A;  3F31 A;  2VL8 A;  2PYX A;  1YKJ A;  2ZM2 A;  3O1I A;  4NWZ A;  1ZKQ A;  4PW8 A;  1COY A;  2LKH A;  4H9R C;  4HFV A;  4XWR A;  1AJ3 A;  4GYS A;  2IID A;  5BUK A;  4GB3 4;  4BAY B;  3BI2 A;  4X1Y E;  3I9Y A;  4DMW A;  4PJM A;  1Y64 B;  4O4L E;  1N1P A;  3UUX B;  5GSN A;  1Z8U A;  3L3P A;  1MMN A;  2CXD A;  1AR7 4;  2LSK A;  2RS5 4;  2GQF A;  3P4S A;  2A2F X;  4DR3 T;  3QSM A;  1GTH A;  2X0H A;  4U2L A;  2V5Z A;  2OLT A;  3UKP A;  1REO A;  3UU5 A;  1Y56 B;  2LRK A;  2WQY A;  3DGZ A;  3PUG A;  4YSZ A;  4ZS3 A;  3V5U A;  1UK5 A;  3EAM A;  4UVA B;  3N9P A;  4E0V A;  1LPF A;  5DJQ C;  5KMR A;  2IVD A;  3QVP A;  2C76 A;  2AE9 A;  2YG4 A;  1GER A;  2YR5 A;  1VBA 4;  4DVD A;  1MOK A;  2C66 A;  1E1H B;  4EZ4 A;  2R04 4;  2R07 4;  2PFV A;  2GQW A;  1FMV A;  4DSH A;  5EOW A;  1YD8 G;  3RC8 A;  1T8B A;  3SOL A;  3RKO A;  1XAN A;  1ONF A;  4EMW A;  4KPR A;  5JCK A;  4A99 A;  3EVY A;  2UXC T;  4U8O A;  2KZ7 B;  4OPI A;  4X4J A;  4AOX A;  1FMW A;  4LF8 T;  1GV4 A;  3I3L A;  3UOX A;  2NP9 A;  1G73 A;  4ZCC A;  3AE2 A;  1B4V A;  2JRK A;  2XVH A;  3ATQ A;  2L8K A;  4U2Y A;  4ZCD A;  2XSA A;  5L3E B;  2KND A;  1NWM X;  3N2O A;  1LVK A;  1F3P A;  2CXL A;  3GN5 B;  4UVB B;  4UV9 B;  3KV9 A;  5LB7 B;  1PXA A;  3H37 A;  5L3F B;  4AKR B;  4IV9 A;  4HFC A;  2MYS A;  1S94 A;  2CBI A;  2WMN A;  2A72 A;  4GDP A;  4LFA T;  2XAQ B;  2X3N A;  3Q2M A;  2M6B A;  2RGH A;  3SQP A;  2V6Y A;  4YY3 T;  3FHN A;  3N2K E;  4U8I A;  3RRW A;  1MIV A;  1R09 4;  2GV8 A;  4CCR A;  3PU8 A;  3Q9D A;  1XNR T;  3GQH A;  4DV1 T;  1H84 A;  2PHH A;  2C75 A;  2LRL A;  1OJ9 A;  1YY5 A;  4XBF B;  1HYU A;  2YM2 A;  2R45 A;  4U8J A;  3NWI A;  3OBV E;  1HR0 T;  5U63 A;  1D1B A;  1OED C;  3AB3 B;  3KD9 A;  3GD3 A;  2VVM A;  3CPJ G;  2GK9 A;  2VVN A;  2ACZ A;  1F8S A;  1PO1 4;  5CFB A;  1VRQ B;  4ILU A;  4ZHQ E;  3D0T A;  2HHH T;  2BG9 B;  2YWL A;  1SHZ C;  4JI1 T;  3VRA A;  4AQY T;  1IUW A;  4ZZC A;  1CHU A;  2X0Y A;  2EHO C;  3GRS A;  4LFC T;  2WPC A;  1K5M D;  1X79 A;  1EL5 A;  1VBD 4;  3K3O A;  1Z0P A;  2WOW A;  3NYC A;  4TLZ A;  5TAO A;  4UDP A;  2XQY A;  1NAA A;  3GA8 A;  3T14 A;  4EED A;  2J4G A;  2I6H A;  4ADZ A;  3AD8 B;  3SXI A;  3ZYX A;  2JJ9 A;  3OTO T;  3CNJ A;  3BHK A;  4F6R C;  3FXE B;  4P9S A;  2V60 A;  2WZH A;  1QO8 A;  2YLX A;  1D7L A;  1JRZ A;  1EZ3 A;  1XZY A;  1H7W A;  1M62 A;  4ERR A;  4DV3 T;  1GET A;  4IVM B;  3K8P C;  3LDQ B;  5LMU T;  2LHR A;  4EIW A;  1BZL A;  2YG5 A;  3SRZ A;  2Y6R A;  3CMM A;  3UOY A;  5ETW A;  5J1G A;  1DOD A;  2AR8 A;  2Y8D A;  1N33 T;  4JI0 T;  5LHI B;  1PJ5 A;  4UF0 B;  2DWG A;  1J1J A;  4KHZ F;  2A9U A;  3P50 A;  1H6V A;  4KP3 C;  4LF5 T;  1KSU A;  2RGO A;  4U3C A;  2BVM A;  3HR0 A;  4AIS A;  1WR0 A;  2XM2 A;  4YTP A;  1GND A;  4KX6 A;  3FPZ A;  1D0Y A;  1VCS A;  2XQ5 A;  2PW9 A;  2V1D B;  5CA1 E;  3VKG A;  4UVC B;  2M6I A;  1V9D A;  5H6R B;  4Z2T A;  4HFE A;  4O5U A;  3J8F 4;  2W2U A;  3N5L A;  3D8X A;  4B3M T;  3JSK A;  4OPD A;  2B76 A;  3UU4 A;  3EAO A;  4FK1 C;  1IUU A;  3ICT A;  3VR8 A;  4QHO A;  1RMU 4;  4H7U A;  4Z43 A;  2YIN A;  5C3J A;  5HEJ A;  4TV8 E;  1US7 B;  1FIO A;  3LOV A;  5BRT A;  2H88 A;  1F8W A;  4FJO A;  1IZN B;  4AQF C;  1M64 A;  3DME A;  3UTE A;  2XFU A;  1Q1W A;  2LSY A;  1UUS A;  4CXY A;  1RUE 4;  3BI4 A;  4G74 A;  3ZPO A;  2SPC A;  1CJ2 A;  2C70 A;  2FJA A;  4WZX A;  3C4A A;  3UU6 A;  5ABF A;  4H4S A;  3T37 A;  1EL7 A;  5KVH A;  5IHY A;  3CPI G;  2CLY C;  1EV1 4;  4MAL A;  1CC2 A;  1B8S A;  4MLK A;  3RX6 A;  4DR7 T;  4APN A;  4Q4V 4;  3DA1 A;  1POV 0;  4ISS A;  3IF8 B;  2APG A;  2K48 A;  5F3J A;  2KT9 A;  2JK6 A;  1RUG 4;  3AE3 A;  2XQA A;  2BS2 A;  1BR4 A;  2BC1 A;  1CUN A;  1IBK T;  4TM3 A;  5IPY A;  1MND A;  2Q0K A;  4O4H E;  2WPF A;  4CN4 A;  4YHH T;  4P09 A;  1PDH A;  5FL1 A;  4F8H A;  3NKS A;  4IDP A;  2BXR A;  2KLQ A;  1OOP D;  1ZX9 A;  4A7A A;  1K0J A;  4MHC A;  3NBX X;  3VRB A;  5JDL A;  2QCU A;  3LAD A;  1D0Z A;  4JI2 T;  1L9D A;  4NUV A;  1GRH A;  4X9N A;  2GR2 A;  3LZX A;  3CVR A;  1CJ4 A;  3L09 A;  2W00 A;  2NTX A;  3NRN A;  4UDQ A;  5IUX A;  3RIU C;  3AXJ A;  4TWH A;  4QH1 A;  4CCQ A;  4IVO B;  3RQW A;  4QKN A;  4II2 A;  3LB8 A;  4EGW A;  3MK7 C;  3ZYM A;  5TR3 A;  2JQ9 A;  3P8C D;  2B7R A;  4CY8 A;  2XLS A;  3RHA A;  1BGJ A;  2EQ8 A;  2XAF B;  3EDU A;  2FJD A;  4JNA A;  2I0M A;  4ILC A;  1GXF A;  3EAN A;  4EIQ A;  4AQG A;  1W4X A;  2XJ7 A;  4DBR A;  2XAH B;  2R0P A;  4G6G A;  1HNW T;  2IAK A;  4A65 A;  3OC4 A;  4DR2 T;  5AQU B;  2C65 A;  2Q9Q A;  2BKN A;  4TLX A;  2AAQ A;  3CGC A;  4H63 V;  2P9B A;  3C4X A;  4GKJ T;  1ZOV A;  3DH9 A;  4JN9 A;  1PJ7 A;  4U74 A;  4EEB A;  4TM4 A;  1RUF 4;  4GAP A;  1HX8 A;  4PFP A;  2WB5 A;  5DBJ A;  3GMB A;  1O94 A;  3B6D A;  1R8I A;  4H4Q A;  4PK6 A;  3ZEF B;  3I6D A;  2K3W A;  3HI2 A;  3KU9 A;  3C4N A;  4YSX A;  1VG0 A;  4DNA A;  3DP7 A;  2Z5X A;  4U2T A;  2KMF A;  2ODV A;  5AFU L;  3IBP A;  3TLV A;  2RGJ A;  2V8S V;  4OHF A;  1IUX A;  1O95 A;  3ZSS A;  3NRY A;  1KK7 A;  2VQF T;  3OKQ A;  3JAE A;  3RYC E;  3UOV A;  4C77 A;  1UX4 A;  3SY4 A;  3E22 E;  3ZKR A;  2VQE T;  5CA0 E;  1D7Y A;  1K0L A;  2R0G A;  4NZH A;  4UF0 A;  3IF9 A;  4IST A;  1YQZ A;  3FBZ A;  2Q9Q C;  3AA6 B;  2PBI A;  4I50 E;  1BEV 4;  1MQT D;  3FI7 A;  2B9W A;  3RNM A;  3PUW F;  4B3T T;  5LG3 A;  3IA3 A;  2PLV 4;  3T8O A;  3N9L A;  4GDE A;  1OED E;  4AQF A;  4BV6 A;  1CC6 A;  1D4D A;  3MJX A;  5JCL A;  1NPX A;  3T2Y A;  5JDH A;  2H7O A;  2W67 A;  2GVC A;  2VKO A;  4U2S A;  2PZS A;  2FUP A;  4Z44 A;  3SFD A;  2XVE A;  5CB4 E;  2QA1 A;  3GD4 A;  1RUD 4;  4CN6 A;  3PJA J;  3NHO X;  2K24 A;  4TWD A;  1COV 4;  2B9Y A;  2YU1 A;  3KA7 A;  2WWU A;  4PAA A;  5CGM A;  4QH5 A;  4HWH A;  4AIU A;  4AXP A;  3DTO A;  2FJB A;  2KSR A;  1QSD A;  3UUM A;  2AXD S;  3CKD A;  2V7J A;  3Q5E A;  3FBS A;  4ASK A;  3E1T A;  2LSG A;  2V5C A;  3SX6 A;  2EX3 A;  4G73 A;  2WMO A;  4IE5 A;  1RYI A;  1B5Q A;  4GR1 A;  4DND A;  3AD7 B;  4P1N A;  4EM3 A;  3TLU A;  3HYW A;  2XSB A;  3JCF A;  3PDY A;  4DID B;  5FY0 A;  4IDQ A;  3GYX A;  4OYK A;  5AQS B;  2CPT A;  3N9N A;  2BKO A;  4TX5 A;  2BK3 A;  4EAH A;  3T1H T;  2DWK A;  3MA9 A;  4CI1 B;  3AA0 B;  1L9E A;  3KDS E;  1WCR A;  4CXW A;  3EHZ A;  2PY5 A;  1E7P A;  2VZ2 A;  5C2T A;  1MMD A;  2WOI A;  4EQW A;  1HTJ F;  3QSE A;  1LTX R;  4UEL A;  1X31 B;  3RYH E;  4LU6 A;  1GAL A;  1YKH B;  3J9X 1;  1E2A A;  4GUV A;  4JI7 T;  4YKG A;  4EV6 A;  4J2C A;  5ADX L;  4GK0 E;  2GAH B;  3ZT5 A;  4LMJ A;  3UKK A;  3ONX A;  1KSS A;  1GRT A;  4G63 A;  5FXX A;  5L3D B;  5BVA A;  4E7S A;  1D1C A;  1IJ6 A;  2XLT A;  3RH3 A;  2W0H A;  1QUU A;  1BGN A;  1XNQ T;  4UIG A;  1RUH 4;  4I4T E;  3ZMZ B;  1PXB A;  3X1D A;  2YLS A;  5JRC A;  1V59 A;  4YWO A;  2Z6E A;  4M1P A;  1Y01 A;  3DK9 A;  1HG2 A;  5HY5 A;  1UCU A;  3EF6 A;  3CQC B;  3UKA A;  3GWH A;  4HB9 A;  3ICS A;  4H9P C;  3FXD B;  4AI6 A;  2DL1 A;  3KV4 A;  4I58 A;  1XMO T;  1H82 A;  2M67 A;  4AP3 A;  5AQO B;  3IEE A;  2CM0 A;  4XXG A;  5FY7 A;  3A7M A;  3CNT A;  4USR A;  4ICY A;  5L47 A;  1PBF A;  2XZE A;  1O3X A;  3PJA A;  4L5G A;  3GWF A;  3SYI A;  4IE0 A;  5L4E A;  2BRA A;  2UXX B;  3Q5D A;  4OPC A;  3ZN0 B;  3RED A;  1BF3 A;  1SUM B;  3SZC A;  3MAC A;  5EB4 A;  1RVF 4;  3IWA A;  1QJD A;  3AXB A;  1F6M A;  3B13 A;  3LZW A;  3O4X E;  4PDW D;  2VOU A;  1GRA A;  1NHP A;  2JQH A;  1HRI 4;  4H63 H;  4DMV A;  3C4Z A;  5AQK B;  4H4P A;  3S5W A;  1OED B;  2BVL A;  2LSJ A;  2XUE A;  1E1N A;  2KWH A;  3A8Y C;  3LG7 A;  5KOX A;  1LQU A;  2BS4 A;  5FVL A;  2NR4 A;  1NEN A;  3ALM A;  2IDO B;  2MBG A;  1ZMD A;  1AR8 4;  5FYM A;  4B69 A;  2NTY A;  3AEA A;  1H7C A;  3QNU A;  3KVE A;  2XVF A;  3UKH A;  4B67 A;  2WWV A;  1T98 A;  2OA1 A;  4A79 A;  5LCY A;  4XZC A;  4DV4 T;  1HNX T;  3QFA A;  4JDR A;  4I59 A;  2LOS A;  4JNQ A;  4IHJ E;  4JLE A;  4D04 A;  1NAF A;  2WCA A;  1NG3 A;  3M3Z B;  4H9S E;  2VAS A;  1HFA A;  2RS1 4;  1U4Q A;  3R84 B;  1ZY8 A;  2C5J A;  1LQT A;  5HXS A;  3LK4 2;  2X8G A;  4JEU B;  3RI5 A;  4O4I E;  2RAB A;  3MXZ A;  2A3D A;  5AQH B;  2QRX A;  3K3N A;  1H83 A;  1G8X A;  5LMN T;  2LM2 A;  4YHJ A;  5L3B B;  2WY2 A;  2B9X A;  1YQ3 A;  2YOE A;  4UR9 A;  2GR3 A;  4HFH A;  4U7Y A;  5KRQ A;  5LV9 A;  3FZL B;  4DR4 T;  2CWO A;  1RP0 A;  5E0O A;  1DU2 A;  4C3Y A;  2VB6 A;  5LGN B;  2VKJ A;  2O9Z A;  3ITJ A;  2D0T A;  1DXL A;  3CTY A;  5DQW A;  1VG9 A;  3AEF A;  4RG3 A;  4KI0 F;  4OPL A;  3LBX B;  1I6Z A;  3QK6 A;  4OPU A;  3MZK B;  3K3Q C;  1OJT A;  3II4 A;  2C73 A;  3MKD A;  3GYI A;  4H4Z A;  5JDG A;  2BG9 A;  3VRD B;  3O0H A;  4WBO A;  2EHO B;  2JAE A;  2UUB T;  1DNC A;  4G2A A;  4K22 A;  1FEC A;  2XVI A;  5FS9 A;  1IBL T;  2YG7 A;  3KBU A;  4GIW A;  1H7X A;  2EQ6 A;  2NVK X;  3KVB A;  2V3A A;  3GDP A;  2FJE A;  2K9A A;  1ZV4 X;  3F8D A;  3AYL A;  3AD9 B;  3ZLI A;  3WE0 A;  2JBV A;  4OYJ A;  4IL4 A;  4DUZ T;  5FNV E;  1GRF A;  1N4V A;  3CND A;  1R08 4;  4WW0 A;  2G0U A;  2QVA A;  4NPP A;  2UZZ A;  2R7F A;  1EL8 A;  2XQ8 A;  4PK5 A;  2BBJ A;  2XAG B;  2CVJ A;  4J34 A;  1BWC A;  1PXC A;  3CN8 A;  4JI6 T;  4ILA A;  1XHC A;  1VBB 4;  4H9O C;  4ZN0 A;  4H9Q C;  2RS3 4;  1WLX A;  5FP3 A;  1PBE A;  3P7I A;  5LGT B;  3LK3 B;  4AP1 A;  4YJ3 E;  1OED A;  4JY2 A;  1KF6 A;  5A1L A;  2L9Q A;  3O9X A;  3PU3 A;  3T1Y T;  2CCQ A;  3BQI A;  3KLJ A;  1KNZ A;  2BS3 A;  1L0V A;  3LXD A;  4DR1 T;  3ZC1 A;  2BAC A;  1UGO A;  5M10 A;  4EXT A;  2CHN A;  2YDR A;  3TKL B;  1PO2 4;  2Q7V A;  3KV6 A;  1CJC A;  1W9R A;  2F4V T;  2V5D A;  2EHO D;  2YQU A;  4U8L A;  1GPE A;  2OLO A;  3OPC A;  1NHS A;  1UX5 A;  3AE9 A;  2YKS A;  3CWZ B;  2R9Z A;  3H3M A;  1CBO A;  2LOP A;  4Z24 A;  5IQ4 A;  1FL2 A;  1SEZ A;  1PJ6 A;  3AE8 A;  1N4W A;  4O2A E;  2R0C A;  2A87 A;  2YVJ A;  1W0A A;  2IC9 A;  4DBQ A;  4H50 A;  4GOU A;  1GSN A;  4A6N B;  2WDQ A;  4HWF A;  5JRC B;  1OJC A;  2GF3 A;  2ZZC A;  4ECH A;  3PUA A;  4IT4 A;  1TDK A;  3LJC A;  5IYZ E;  4EQX A;  3GN5 A;  3NNE A;  2C5I T;  4YFS A;  2XHE B;  2EQ7 A;  2JKC A;  3AEG A;  2D0U A;  3WAJ A;  4WNK A;  2VRM A;  2R46 A;  3K7Q X;  3NK0 X;  3SM8 A;  1WR6 A;  2A8X A;  4YXD A;  4PK4 A;  4LMK A;  2XDO A;  4X66 T;  4JEH B;  4DV2 T;  2XQ4 A;  2GEW A;  2RPA A;  3HYX A;  5HXR A;  3CX8 B;  5JCI A;  1VRB A;  1VBC 4;  2WP6 A;  2WAU A;  1MMA A;  2XAJ B;  3PUZ F;  1XDP A;  2WBA A;  2YK0 A;  2GR0 A;  3DJG X;  2HN1 A;  3FZF B;  2BBH A;  4YTM A;  1FCD A;  5HYM A;  3Q6J A;  3P4W A;  5KXJ A;  2OAL A;  4UV8 B;  2V7I A;  4H2P A;  1LVL A;  2E8I A;  2C3C A;  2WDR A;  2ZBW A;  2BC0 A;  3C96 A;  1NA1 D;  2ZLY A;  4IE6 A;  2J1D G;  2V6O A;  1AR6 4;  5ABF B;  2CHO A;  4DV0 T;  2LJL A;  3N9O A;  1RUC 4;  2MPK A;  1K0I A;  2HPJ A;  3NTD A;  2WBL A;  3T2K A;  4OFZ A;  3SGL A;  3PV0 F;  1TDN A;  3ATR A;  4H4V A;  1JU2 A;  4HFI A;  3JC6 C;  4H4U A;  3CGB A;  2PYL A;  4RSL A;  4YTN A;  3HKB E;  5FXV A;  3ZC0 A;  1RSG A;  2VKD A;  4IE7 A;  2Q9Q B;  4B6X A;  2X8H A;  1GRB A;  5LOV E;  4COF A;  4G9K A;  4TUY E;  3S61 A;  2C64 A;  2B1E A;  3E0Z A;  3ZST A;  4P0B A;  5J7X A;  2ES0 A;  3AA1 B;  5J60 A;  5KMS A;  4BJZ A;  2R06 4;  2EQ9 A;  2JB1 A;  3NGC X;  4II3 A;  1ZOY A;  2CBJ A;  2H89 A;  5DQV A;  2HPL A;  4BK1 A;  2WHD A;  2XFQ A;  4NNJ A;  1HRV 4;  4Q4X 4;  3ZJ2 A;  3VR9 A;  3BNU A;  4LII A;  2WU2 A;  4Q25 A;  2YVF A;  2UXD T;  1GQE A;  1H8T D;  4B64 A;  2GMJ A;  1M7K A;  4TV9 E;  2VK9 A;  4CN1 A;  3IC9 A;  3WI3 A;  2DHR A;  4LFB T;  1M6I A;  4M52 A;  3JAD A;  3HL6 A;  3QVR A;  2W0G A;  2PG8 A;  2X9Y A;  2XQ6 A;  3AVR A;  3U3I A;  1S2Y A;  3ZYK A;  2E5V A;  3L8K A;  3RLF F;  5FMN A;  3LJP A;  1MXT A;  3ZCI A;  3Q5X A;  1FEW A;  5HCJ A;  3IHG A;  2TPR A;  1VCT A;  4EOZ B;  4CNJ A;  2OV9 A;  1FJG T;  2C72 A;  2YLT A;  3UKQ A;  3P4R A;  5JR9 B;  2LE8 A;  1HF8 A;  2ZZB A;  4JBW F;  4B3S T;  3PO7 A;  4AKI A;  2Y6Q A;  1W0B A;  1PBB A;  5KNL A;  2AQJ A;  2WET A;  3Q9T A;  5L4H A;  3PVC A;  4B66 A;  3CPZ A;  2X9X A;  5FMH A;  2OA5 A;  5LP6 E;  1E6E A;  3BQK A;  3B3R A;  2C7G A;  1Z7S 4;  3G06 A;  3F57 A;  3RQU A;  1RHI 4;  4C74 A;  2X68 A;  3UKL A;  2YG6 A;  1S35 A;  3QFB A;  2K5B B;  2C4C A;  2YLR A;  2MOZ A;  2H3R A;  2UU9 T;  4JY3 A;  5JR9 C;  4IDN A;  1CL0 A;  2WEU A;  1RUJ 4;  3FMW A;  3G5R A;  4KUM B;  1CF3 A;  2OLN A;  2WES A;  3GDN A;  3H8I A;  4ZXL A;  1BR0 A;  4OPG A;  3RP7 A;  2KXP B;  5AQG B;  2KWI B;  4OVI A;  1E1L A;  2XQ7 A;  2CEA A;  4EQS A;  3JAF A;  5HWY A;  5JDQ A;  3T31 A;  2XTL A;  4Z8X A;  3TLT A;  4WCT A;  3FZK B;  2E9X A;  4BA9 A;  1UKV G;  2V6X A;  4TZ4 C;  2QYW A;  1VOM A;  2BG9 E;  1B7T A;  5LJM A;  3QUJ A;  5HEH A;  4NTC A;  4TWF A;  3G5S A;  3ZT7 A;  3DJE A;  4U33 A;  2V26 A;  4Y4L A;  4NXM T;  4LF9 T;  5AQV B;  5HXI A;  2WM9 A;  3M12 A;  2PJQ A;  3PUQ A;  1VQW A;  3AEC A;  2NWB A;  1KFY A;  4DUY T;  3SZ0 A;  2J3N A;  5AQP B;  3ALJ A;  3RC3 A;  4PAG A;  2BKP A;  2V3B A;  3NH3 X;  1IBM T;  3AAA B;  4WBN E;  2QA7 A;  3VHL A;  1VRH 4;  3AVS A;  4Z91 A;  2Y48 B;  4GCM A;  4J33 A;  3SWH A;  1J5W A;  4I55 E;  1FOH A;  4IDO A;  4HFB A;  2WP5 A;  2YEV C;  4JI8 T;  2B7S A;  4X65 T;  4GK5 E;  3IHR A;  3ZMV B;  2YM1 A;  3C51 A;  3R9U A;  3M65 A;  1PHH A;  2BG9 C;  2JQK A;  3GYJ A;  5EZY E;  1OJD A;  2V7K A;  1CC4 A;  3CGD A;  4D03 A;  4X5T A;  1J5E T;  3B57 A;  5AQI B;  4B63 A;  4E7Z A;  5LBM A;  2XPK A;  1EAH 4;  3UFG A;  2D5U A;  4ZI2 C;  3V5S A;  2CMR A;  4ZZB A;  3NN6 X;  2OAM A;  5L46 A;  1Q1R A;  5FS7 A;  1AR9 4;  3ZYL A;  2LM9 A;  1NEK A;  3ICR A;  2IHR 1;  1N34 T;  4C90 A;  1HNZ T;  3EPT A;  2RM2 4;  3A5X A;  3AE5 A;  3UUB A;  3WAK A;  3VKH A;  2RP4 A;  2GAG B;  5L3G B;  1EBD A;  3DGH A;  4GKK T;  3RKG A;  2C67 A;  3ADA B;  4C3X A;  1MMG A;  4H4W A;  4K0U A;  4Z25 A;  3V76 A;  4AKL A;  2BDE A;  2XLP A;  1IAP A;  3RHW A;  5LBQ B;  5AQF B;  3I0O A;  4N78 D;  3ZDN A;  2BXS A;  4J36 A;  3L8R A;  1ZK7 A;  3UP4 A;  2VVL G;  5LXT E;  4JI5 T;  3R6N A;  4J2W A;  2EHO A;  1E39 A;  2XAS B;  3BQL A;  4A9W A;  2E9X C;  5HXH A;  2CE7 A;  5FL0 A;  4HN9 A;  4UEM A;  1S3B A;  3I1A A;  4Y4M A;  2WP9 A;  3CQG B;  2XVJ A;  4B3R T;  2ZZ0 A;  2KIN B;  1B37 A;  2GB0 A;  4REK A;  4EYY R;  2N1G A;  4IDZ A;  3UOZ A;  4C5O A;  3COX A;  2NW8 A;  3PUY F;  2IIU A;  3M13 A;  4YJ2 E;  1RUI 4;  2XFO A;  2VRL A;  5AQT B;  3UFE A;  2X9H A;  3NKZ A;  5FXZ A;  5KMG P;  3JBG 4;  4K7Z A;  1AL2 4;  2CLY B;  2YDQ A;  3CNP A;  4L0R A;  4PJN A;  5JH7 E;  3G5Q A;  3HKD E;  1SA0 E;  2RR1 4;  1JRY A;  4J56 A;  1JNZ A;  2NW9 A;  2DCF A;  5FVK A;  1DJQ A;  5J2U E;  4J31 A;  3D1C A;  2JMH A;  4YSH A;  2X51 A;  5KMQ A;  3BI5 A;  4PJJ A;  2WS3 A;  4X1K E;  3H3A A;  4AKH A;  3CX6 B;  3ZMU B;  2R4E A;  4QXC B;  2IUB A;  1PBC A;  4A97 A;  1T7S A;  1HG5 A;  3AYJ A;  5M0Z A;  3SUC A;  1YW0 A;  3L39 A;  5EBK A;  4Y4N A;  4X62 T;  4I0U A;  3I9W A;  2QAE A;  4BUR A;  3NYF A;  3NK1 X;  4FDC B;  3K7T A;  3CPH G;  3O1J A;  4EM4 A;  3CGE A;  3C98 B;  4NUU A;  5BMV E;  1XMQ T;  3M0O A;  2C3D A;  1YKE B;  3UU3 A;  2DKI A;  1T72 A;  2Z5Y A;  1XI1 A;  1W09 A;  4DSG A;  4DR6 T;  4CI2 B;  5JRE A;  1D5T A;  3K30 A;  1WYB A;  5F8P A;  3KBT A;  1S2Q A;  1TYP A;  3RP8 A;  3P4Q A;  4H4Y A;  1IUS A;  2X9W A;  2ZM0 A;  3UP5 A;  3QJ4 A;  2MAW A;  2MTQ A;  4H9N C;  4O5Q A;  3NN0 X;  2LT3 A;  2GMH A;  1L9C A;  5EB5 A;  3Q5W A;  4QX8 B;  4NXN T;  4C91 A;  5FS6 A;  4X64 T;  4IGU A;  2D9D A;  2E4G A;  3SFE A;  3ZCJ A;  2CDU A;  4ZEY A;  4DV5 T;  3AEB A;  4YT0 A;  3E08 A;  2NPX A;  2UUA T;  1DOC A;  2W62 A;  5GON E;  3KKJ A;  3S4U A;  4L9I A;  3QC9 A;  3ISH A;  3RP6 A;  5JDN A;  3UQ4 A;  3ESL A;  3K1S A;  3ZJ1 A;  2DLR A;  3V3N A;  3SS1 A;  4PFO A;  5HEG A;  2V7L A;  1YQ4 A;  1N4U A;  1TRB A;  3KPF A;  2C0S A;  3FG2 P;  4K2X A;  4HA6 A;  4MBQ A;  3GWD A;  2W63 A;  3ALL A;  3ETU A;  3OYX A;  1HX1 B; 
#chains in the Genus database with same CATH homology
 3SY4 A;  1IJH A;  1ZDL A;  4GRT A;  5JCI A;  3AB1 A;  3GSI A;  1D7Y A;  1K0L A;  2YLZ A;  2BK4 A;  2WP6 A;  3H4K A;  4IA6 A;  2R0G A;  4NZH A;  2WPE A;  1P2H A;  3IF9 A;  1YQZ A;  4GF7 A;  2WBA A;  4U8M A;  5KOW A;  2FBW A;  2GR0 A;  1O5W A;  2B9W A;  5CKU A;  1Y56 A;  2Q6U A;  3CNS A;  3DJG X;  5HHF A;  3RNM A;  1NDA A;  1K4Q A;  5JCM A;  5KWF A;  1EL9 A;  4YTM A;  1FCD A;  4FX9 A;  4GDE A;  3Q6J A;  5HYM A;  4BV6 A;  1CC6 A;  1D4D A;  1MO9 A;  5JCL A;  1NPX A;  3URH A;  5KXJ A;  3T2Y A;  4H4T A;  2OAL A;  3F8R A;  4TM1 A;  1JOA A;  2BA9 A;  2WOV A;  1KDG A;  2GVC A;  1OJA A;  4H2P A;  1LVL A;  4CRT A;  4H2Q A;  2C3C A;  4U2S A;  2WDR A;  4CNK A;  1TDO A;  2ZBW A;  2Q0L A;  1XDI A;  2BC0 A;  4Z44 A;  1PBD A;  3SFD A;  2XVE A;  3C96 A;  3UP4 A;  3NG7 X;  3NTA A;  4IA5 A;  4NEV A;  1S3E A;  2PYX A;  1YKJ A;  4NWZ A;  2V6O A;  1ZKQ A;  4EQR A;  1COY A;  2QA1 A;  3GD4 A;  4XWR A;  4PAB A;  2IID A;  5BUK A;  4DGK A;  1H86 A;  3BI2 A;  1Q9I A;  1F8R A;  3NHO X;  1K0I A;  1N1P A;  4USQ A;  2B9Y A;  3NTD A;  3T2K A;  5GSN A;  3KA7 A;  4PAA A;  3ATR A;  1TDN A;  4H4V A;  3SGL A;  1JU2 A;  2WU5 A;  4H4U A;  2FJB A;  3CGB A;  2LFC A;  4RSL A;  4YTN A;  2GQF A;  1E1M A;  1RSG A;  3P4S A;  3FBS A;  3QSM A;  1GTH A;  4U2L A;  2V5Z A;  3E1T A;  4OCG A;  3SX6 A;  3AEE A;  2X8H A;  4AOS A;  1GRB A;  4G9K A;  4G73 A;  1RYI A;  1NHQ A;  5JCN A;  3UKP A;  1REO A;  3S61 A;  2C64 A;  1B5Q A;  4NTE A;  1Y56 B;  5J7X A;  4GR1 A;  5J60 A;  2WQY A;  3AD7 B;  4YSZ A;  3DGZ A;  4BJZ A;  2EQ9 A;  3V3O A;  5ER0 A;  4EM3 A;  2JB1 A;  3HYW A;  3NGC X;  1ZOY A;  2H89 A;  3GMC A;  4II3 A;  4E0V A;  2XLU A;  1LPF A;  4BK1 A;  2WHD A;  5KMR A;  2XFQ A;  3GYX A;  4NNJ A;  2IVD A;  4AT0 A;  3QVP A;  2C76 A;  3VR9 A;  3BNU A;  4LII A;  2WU2 A;  2YR5 A;  2YG4 A;  1GER A;  3BNM A;  1GOS A;  1LJ1 A;  1MOK A;  2C66 A;  2YVF A;  2BK3 A;  1KNR A;  3DK8 A;  4B64 A;  2GQW A;  2GMJ A;  3NT6 A;  3IC9 A;  1L9E A;  4DSH A;  5EOW A;  2BRY A;  3L1R A;  1M6I A;  3K7M X;  3AWI A;  1E7P A;  2VZ2 A;  4M52 A;  5C2T A;  4JQ9 A;  3QVR A;  2WOI A;  1XAN A;  1ONF A;  4EQW A;  1S2Y A;  4EMW A;  4KPR A;  3QSE A;  1LTX R;  2E5V A;  3L8K A;  5JCK A;  4A99 A;  3LJP A;  4FK1 A;  1MXT A;  1X31 B;  4U8O A;  4LU6 A;  4OPI A;  4X4J A;  1GAL A;  2XFN A;  4AOX A;  4GUV A;  4YKG A;  3IHG A;  1GV4 A;  3I3L A;  2TPR A;  3IHM A;  3UOX A;  4CNJ A;  1D4E A;  2C72 A;  2VVL A;  2GAH B;  2YLT A;  3P4R A;  4ZCC A;  3AE2 A;  2WDV A;  1B4V A;  2XVH A;  1KSS A;  3ATQ A;  3UKK A;  1GRT A;  2ZZB A;  4ZCD A;  1KNP A;  3PO7 A;  2V61 A;  5BVA A;  2Y6Q A;  2XLT A;  1PBB A;  4J57 A;  1CJ3 A;  2W0H A;  1GT8 A;  3QSS A;  2AQJ A;  2WET A;  3Q9T A;  1BGN A;  1TDF A;  5KNL A;  3PVC A;  1F3P A;  4B66 A;  2DKH A;  5FMH A;  1E6E A;  1PXB A;  1PXA A;  3B3R A;  1QLB A;  2C7G A;  4K8D A;  4IV9 A;  2YLS A;  1V59 A;  2TMD A;  4YWO A;  4C74 A;  3UKL A;  2YG6 A;  3ABV A;  4GDP A;  3QFB A;  4K5S A;  2C4C A;  3DK9 A;  2YLR A;  4JY3 A;  5HY5 A;  1CL0 A;  2X3N A;  1LV0 A;  2RGH A;  3EF6 A;  3SQP A;  2WEU A;  3UKA A;  3FMW A;  3G5R A;  4N9X A;  4UP3 A;  1CF3 A;  2WES A;  1GEU A;  2OLN A;  4HB9 A;  1GES A;  3GDN A;  3H8I A;  3ICS A;  4OPG A;  4U8K A;  4U8I A;  3RP7 A;  3SZW A;  4I58 A;  1NG4 A;  4XWZ A;  5KMS A;  2GV8 A;  1H82 A;  1Y0P A;  4CCR A;  4AP3 A;  5KVI A;  4OVI A;  1E1L A;  4XXG A;  3GQH A;  4AT2 A;  1H84 A;  2PHH A;  2C75 A;  1OJ9 A;  3CNT A;  4USR A;  4ICY A;  1PBF A;  1YY5 A;  4EQS A;  1PS9 A;  3T31 A;  1HYU A;  3GWF A;  4BJY A;  2YM2 A;  3SYI A;  4WCT A;  3UKQ A;  4EIP A;  2R45 A;  2BRA A;  4U8J A;  1UKV G;  5U63 A;  4OPC A;  3KD9 A;  3RED A;  1BF3 A;  3GD3 A;  2YLW A;  2VVM A;  2YVG A;  3CPJ G;  3SZC A;  1ELI A;  1BKW A;  2ACZ A;  5EB4 A;  1F8S A;  4NTC A;  3IWA A;  1VRQ B;  1QJD A;  3NK2 X;  1TDE A;  3AXB A;  1F6M A;  3G5S A;  3LZW A;  3DJE A;  1NHR A;  1FEB A;  4B68 A;  2VOU A;  2YWL A;  1GRA A;  2YR6 A;  1NHP A;  4Y4L A;  3VRA A;  4YKF A;  4H4P A;  1IUW A;  3S5W A;  1CHU A;  5HXI A;  3GRS A;  1DJN A;  3M12 A;  1E1N A;  2WPC A;  1EL5 A;  5KOX A;  4YSY A;  1VQW A;  2BS4 A;  3AEC A;  1KFY A;  1LQU A;  2GR1 A;  2WOW A;  2XLR A;  3NYC A;  4TLZ A;  4UDP A;  3SZ0 A;  3T14 A;  1NAA A;  2J3N A;  1NEN A;  3ALM A;  3ALJ A;  1ZMD A;  1GRE A;  2V3B A;  3AD8 B;  3NH3 X;  3SXI A;  4B69 A;  2QA2 A;  3ZYX A;  3CNJ A;  3AEA A;  3BHK A;  4NTD A;  4P9S A;  3KVE A;  2V60 A;  1QO8 A;  2YLX A;  2XVF A;  1JRZ A;  1D7L A;  3UKH A;  4B67 A;  2OA1 A;  4GCM A;  1H7W A;  4A79 A;  1GET A;  1PN0 A;  4J33 A;  5GRT A;  1E1K A;  3QFA A;  4IVM B;  4JDR A;  1FOH A;  4I59 A;  2WP5 A;  1XPQ A;  4JNQ A;  4D04 A;  1BZL A;  2YG5 A;  2Y6R A;  2B7S A;  1NG3 A;  2YG3 A;  5CQF A;  3CMM A;  3UOY A;  2BAB A;  2A89 A;  1DOD A;  3GRT A;  2AR8 A;  3NLC A;  4OPT A;  2YR4 A;  1ZY8 A;  2YM1 A;  1LQT A;  3R9U A;  1PJ5 A;  1PHH A;  3GYJ A;  1OJD A;  1CC4 A;  3CGD A;  4D03 A;  1H6V A;  5BUL A;  2X8G A;  1KSU A;  4B63 A;  2RGO A;  4NEW A;  2YAU A;  3NN6 X;  4YTP A;  1GND A;  2JB2 A;  2OAM A;  5L46 A;  2RAB A;  4KX6 A;  3FPZ A;  1Q1R A;  2E1M A;  5FS7 A;  1NEK A;  3ICR A;  3NYE A;  4UDR A;  3AE6 A;  4ADW A;  1H83 A;  4H2R A;  2B9X A;  4Z2T A;  3EPT A;  5FS8 A;  1YQ3 A;  4O5U A;  3AE5 A;  3OZ2 A;  2GAG B;  3D8X A;  2GR3 A;  5LV9 A;  3DGH A;  1EBD A;  5KRQ A;  4C3X A;  2C67 A;  4EMI A;  3ADA B;  4H2N A;  3JSK A;  4OPD A;  1RP0 A;  3UCL A;  2B76 A;  3DK4 A;  3EAO A;  4FK1 C;  4C3Y A;  1IUU A;  3ICT A;  2ARD A;  4H4W A;  4Z25 A;  3V76 A;  2O9Z A;  2I0Z A;  2X8C A;  3ITJ A;  3VR8 A;  1DXL A;  1JRX A;  2XLP A;  3CTY A;  4Z2U A;  1VG9 A;  4H7U A;  3AEF A;  4RG3 A;  4Z43 A;  4OPL A;  4Z26 A;  4RG4 A;  2R4J A;  4OPU A;  2BYB A;  5C3J A;  2XYO A;  5U25 A;  3ZDN A;  3LOV A;  5U1O A;  2H88 A;  5BRT A;  1OJT A;  2BXS A;  3II4 A;  4GAV A;  1ZK7 A;  2C73 A;  3AYI A;  3CIR A;  3GYI A;  1F8W A;  2VVL G;  4H4Z A;  4WX1 A;  3UTE A;  1M64 A;  3DME A;  3O0H A;  1E39 A;  4J2W A;  3VRD B;  2XFU A;  1Q1W A;  3DJJ A;  4A9W A;  1VDC A;  1ZP0 A;  2JAE A;  3BI4 A;  1S3B A;  4G74 A;  5IQ1 A;  3AED A;  3UTF A;  4Y4M A;  2WP9 A;  1CJ2 A;  2C70 A;  2XVJ A;  2FJA A;  2BCP A;  1DNC A;  3C4A A;  2ZZ0 A;  4K22 A;  1B37 A;  1FEC A;  2GB0 A;  2XVI A;  1EL7 A;  4H4S A;  4REK A;  3T37 A;  3UOZ A;  3CPI G;  5FS9 A;  4A5L A;  4C5O A;  5KVH A;  3COX A;  2YG7 A;  1H7X A;  1CC2 A;  1B8S A;  2EQ6 A;  2NVK X;  3UTH A;  1DOB A;  2V3A A;  2FJE A;  3GDP A;  3M13 A;  4APN A;  3DA1 A;  3F8D A;  2XFO A;  1IUT A;  2VRL A;  2XFP A;  2APG A;  2CUL A;  3AYL A;  3AD9 B;  4CY6 A;  2JK6 A;  3WE0 A;  2JBV A;  3AE3 A;  2BS2 A;  4TM0 A;  4K7Z A;  2BC1 A;  4TM3 A;  1GRF A;  3T0K A;  1N4V A;  2IVE A;  3CNP A;  3CND A;  3F8P A;  1ZMC A;  5IPY A;  3UKF A;  2GRT A;  2UZZ A;  1EL8 A;  3G5Q A;  2CVJ A;  4J34 A;  2Q0K A;  1JRY A;  2BK5 A;  4J56 A;  1JNZ A;  1BWC A;  2WPF A;  1PXC A;  2CFY A;  3CN8 A;  1DJQ A;  5KMP A;  1PDH A;  1XHC A;  4J31 A;  3D1C A;  3NKS A;  4MJW A;  4YSH A;  2BXR A;  4G6H A;  1ZX9 A;  5KMQ A;  4ZN0 A;  3BI5 A;  4A7A A;  1K0J A;  2WS3 A;  3HZL A;  4X9M A;  2R4E A;  3SZF A;  3VRB A;  1PBC A;  2QCU A;  2XCG A;  1PBE A;  3LAD A;  3AYJ A;  5M0Z A;  3SUC A;  4H4R A;  1H81 A;  1L9D A;  1TYT A;  3FIM B;  4Y4N A;  5EBK A;  1GRH A;  3P4P A;  4AP1 A;  3H8L A;  4X9N A;  2GR2 A;  1AOG A;  4JY2 A;  2QAE A;  1KF6 A;  3LZX A;  3HYV A;  1CJ4 A;  4BUR A;  3NYF A;  3NK1 X;  4FDC B;  3K7T A;  3NRN A;  4UDQ A;  2F5Z A;  3CPH G;  1JNR A;  3UTG A;  4BK2 A;  4LA1 A;  4EM4 A;  3CGE A;  4CCQ A;  4IVO B;  3AE1 A;  3KLJ A;  4J36 A;  4CBQ A;  3T2Z A;  4II2 A;  3LB8 A;  2C3D A;  3M0O A;  2BS3 A;  1L0V A;  1P2E A;  3LXD A;  2DKI A;  2X99 A;  2BAC A;  3KPK A;  2Z5Y A;  5TR3 A;  5M10 A;  3PS9 A;  4CY8 A;  2B7R A;  2XLS A;  3RHA A;  1FEA A;  1BGJ A;  3NIX A;  1GRG A;  2EQ8 A;  4B1B A;  3AE7 A;  2FJD A;  4DSG A;  4JNA A;  2GH5 A;  2Q7V A;  3VQR A;  3P9U A;  4B65 A;  1GXF A;  1CJC A;  4EIQ A;  1DOE A;  3EAN A;  2YQU A;  1D5T A;  1W4X A;  3K30 A;  1GPE A;  4U8L A;  1S2Q A;  1TYP A;  2OLO A;  4K5R A;  1NHS A;  1GTE A;  3RP8 A;  3P4Q A;  4H4Y A;  1IUS A;  3AE9 A;  2R0P A;  4G6G A;  3QJ4 A;  3UP5 A;  4A65 A;  3OC4 A;  2R9Z A;  4O5Q A;  4H4X A;  3NN0 X;  2C65 A;  2GMH A;  1L9C A;  1CBO A;  4TLX A;  5EB5 A;  4Z24 A;  4U8P A;  2AAQ A;  3CGC A;  5IQ4 A;  1FL2 A;  1SEZ A;  1PJ6 A;  5FS6 A;  3AE8 A;  1N4W A;  3P1W A;  2E4G A;  3SFE A;  2A87 A;  2R0C A;  2CDU A;  2X50 A;  2YVJ A;  1ZOV A;  3DH9 A;  3AEB A;  4JN9 A;  2VQ7 A;  4YT0 A;  4H50 A;  1PJ7 A;  2NPX A;  1GSN A;  1Z6L A;  2WDQ A;  4A6N B;  1OJC A;  1DOC A;  4Z2R A;  2GF3 A;  2ZZC A;  4TM4 A;  4ECH A;  3KKJ A;  4GAP A;  3ISH A;  3RP6 A;  1TDK A;  5DBJ A;  3GMB A;  1O94 A;  4BK3 A;  3B6D A;  4EQX A;  3V3N A;  4H4Q A;  2JB3 A;  3I6D A;  3NNE A;  1JEH A;  1D4C A;  2EQ7 A;  3KU9 A;  1YQ4 A;  2JKC A;  1N4U A;  1TRB A;  3C4N A;  3AEG A;  2VQB A;  3KPF A;  4YSX A;  1VG0 A;  4DNA A;  2VRM A;  4EMJ A;  2R46 A;  2Z5X A;  3K7Q X;  4U2T A;  3FG2 P;  3NK0 X;  4A6N A;  2RGJ A;  2A8X A;  3SM8 A;  3AE4 A;  4YXD A;  1IUV A;  2XDO A;  1IUX A;  4K2X A;  4HA6 A;  4U8N A;  2BCG G;  3UOV A;  4C77 A;  3GWD A;  2GEW A;  3ALL A;  3DJD A;  1O95 A;  3HYX A;  3BHF A;  2HQM A;  3GQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...