5C2TA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
b'SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c2tA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c2tA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c2tA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c2tA04
4B1BA 1NG4A 4I58A 4IA6A 2WU5A 2YM1A 4IV9A 4YSYA 1JRZA 2C75A 1DJQA 1K4QA 4H4ZA 2YVFA 1JNZA 1EL5A 1UKVG 4OPGA 1H7XA 3GD4A 3NIXA 2B9XA 2XFPA 4IA5A 3AE9A 2DKHA 1MO9A 2B9YA 3B6DA 4Z43A 2VQBA 3ABVA 1ZMCA 4H50A 2JBVA 5KXJA 1PBEA 2Y6QA 4K5SA 2I0ZA 3NYFA 5KVHA 4YTMA 3CGBA 3DJDA 4USQA 1VG0A 2RGJA 4XWRA 3ICRA 2Q0KA 2XFQA 4EQWA 5FS7A 1JU2A 3ITJA 1HYUA 5HYMA 1PJ5A 4USRA 3NKSA 4MJWA 3DJEA 1NHQA 1GXFA 2R0PA 4GF7A 1LQUA 3DMEA 2X99A 1S3EA 4RG3A 3CNSA 1D7YA 3UKFA 4CCRA 3FG2P 2TPRA 2WETA 1L9EA 3C96A 1NDAA 4C3YA 1CJ4A 3NTAA 1KNPA 5JCIA 3UKHA 2FBWA 2X3NA 2YLTA 3K30A 5JCMA 2ZZCA 4B63A 5FS9A 4CY8A 3GD3A 3F8RA 4N9XA 2CVJA 3G5QA 3KVEA 2XCGA 2YG6A 1E39A 4H4XA 3AEBA 1Y56A 5J7XA 3NTDA 2VVLA 2Z5YA 3IF9A 2GQWA 3AE6A 4GRTA 3CPHG 4K22A 1CHUA 3IHGA 3UKPA 2C67A 2E4GA 2GAGB 2BS3A 1NENA 4AOSA 2XVJA 3AE7A 1L9DA 2YR5A 4K5RA 3SQPA 2YM2A 2BC0A 2GB0A 3LADA 4M52A 4H2RA 3P4SA 3K7TA 3SGLA 2C3CA 3ALJA 1Q1WA 1D4CA 5ER0A 5FMHA 1SEZA 3NN0X 4A6NB 2X50A 4CBQA 4D04A 2UZZA 1TRBA 2WESA 2YLWA 4TM0A 4B68A 3LZXA 5EB5A 1F8SA 2JKCA 4X9NA 3L8KA 1DJNA 4GCMA 5LV9A 2GEWA 2A87A 2ARDA 4J56A 4J36A 2J3NA 4JN9A 3KLJA 1GRAA 2BS4A 3QFAA 1RSGA 3S5WA 1BKWA 2GVCA 4FK1C 1K0IA 3QSEA 4C77A 1NG3A 1KDGA 4TM3A 1E1LA 2B7SA 2WS3A 3AXBA 3LXDA 4TLZA 4BK1A 3NNEA 1M6IA 1PXCA 3LJPA 4GDEA 4REKA 1EBDA 2JB3A 2A8XA 1IUSA 3EANA 2XVFA 1CC6A 4BJYA 4O5UA 4JNAA 3GMBA 2C72A 3IC9A 4OPLA 1LPFA 2GR1A 3GYJA 2R4EA 2XVHA 2C64A 3GRTA 3AB1A 4EM3A 5HY5A 4RG4A 1IUTA 4DNAA 2V60A 1OJCA 3IHMA 3AD8B 3V3NA 1GTHA 2WHDA 2WPFA 2ZZ0A 2WOVA 4FDCB 4EIQA 3NK0X 4A79A 2YG5A 1AOGA 4APNA 2JK6A 4U2TA 3REDA 4H2NA 4EMIA 3V3OA 3BI5A 1VQWA 1ZK7A 1F8RA 1DXLA 3LOVA 2WQYA 3GDPA 1XPQA 2VZ2A 4GDPA 1S3BA 2XLSA 2Q0LA 2BC1A 1FL2A 2BCGG 3UOYA 1BF3A 4WX1A 3QVRA 5C3JA 3RP8A 3ISHA 4IVMB 2GV8A 1PXBA 4YTPA 1Z6LA 2YLRA 4XWZA 1P2EA 3B3RA 2C66A 3BNMA 5GSNA 2EQ7A 2NPXA 3UOXA 3GYXA 3GQHA 1YY5A 4Y4LA 2WP6A 1EL7A 5FS8A 3FBSA 4YKFA 2V5ZA 2XLPA 4JDRA 4B65A 2IVDA 2WU2A 4U2LA 3F8DA 3UTEA 3EPTA 1GPEA 3UKKA 1OJ9A 2XFOA 5HHFA 3VRBA 2BK4A 2C65A 4BJZA 1TYPA 1YQZA 2PHHA 3AE1A 2WPCA 3PO7A 1PXAA 2XVEA 2QAEA 2YAUA 1F6MA 2GR2A 4H4UA 1E7PA 2GMHA 3CGCA 4PABA 5KOXA 3AE5A 1GV4A 2GR0A 2Q6UA 3H8IA 4H2PA 3QJ4A 4Y4NA 1XHCA 2YG4A 3DGZA 4U2SA 2BK5A 1H83A 3NYEA 4ZCCA 2BS2A 1BGNA 2V6OA 1B5QA 1DNCA 2GR3A 2WOWA 3UCLA 4P9SA 2WP5A 3D1CA 1GRGA 3R9UA 2EQ6A 4H4TA 4EIPA 4AT0A 3BI2A 3VQRA 1LVLA 4J57A 2R0GA 4NZHA 4U8OA 1CJ3A 3O0HA 3RHAA 4BK3A 4YSZA 2XDOA 4EQSA 3CGEA 4X9MA 3AEAA 3E1TA 3M0OA 2PYXA 2BCPA 2FJDA 4HB9A 4U8LA 1KSSA 3AE2A 4OPDA 4Z25A 2OLOA 3ATQA 3OZ2A 2BABA 1KSUA 3ADAB 3GMCA 2OALA 3C4NA 4TM4A 4OCGA 2QA2A 5BRTA 1E1MA 2A89A 2GMJA 3GRSA 3NG7X 1YKJA 3RP6A 1FCDA 5M0ZA 3GYIA 4OPTA 3WE0A 4J31A 3BNUA 3RNMA 5IQ1A 1BZLA 2RABA 1GERA 1E1NA 4TLXA 4J33A 5EBKA 2RGHA 5CKUA 3UP5A 4Z2TA 1V59A 2IVEA 2C3DA 3CNDA 4KPRA 5FS6A 3D8XA 3NYCA 4H2QA 4WCTA 3UTFA 3BHKA 4U8NA 1CC4A 3DJJA 4GR1A 1O5WA 1GTEA 3AD9B 1GRBA 3P4PA 3CTYA 4XXGA 3P1WA 4JNQA 3H4KA 1IUVA 2QCUA 1PJ7A 2R0CA 2XLUA 3GQKA 3IWAA 1H82A 2B76A 3DH9A 4UDQA 2JB1A 1NHPA 2BXSA 3NK2X 1ZKQA 4U8MA 1O95A 3VR8A 2VRMA 5JCKA 2GAHB 1XDIA 1FOHA 4UDPA 3KKJA 4A65A 2OAMA 1CJCA 3F8PA 4NTCA 4CNKA 3COXA 3CGDA 4EQRA 1YQ4A 1CBOA 2C73A 2O9ZA 1E1KA 1GRHA 3KPFA 5DBJA 2AR8A 3NLCA 2YR6A 4YXDA 1LV0A 1D4EA 3SFDA 1H84A 3AD7B 3AEDA 1K0JA 1GRFA 2BYBA 1ZP0A 1Y0PA 1CF3A 1QJDA 5U63A 3HZLA 1TDOA 1PHHA 2ZBWA 2W0HA 1VG9A 4U8PA 5KRQA 5CQFA 4AP3A 2YG7A 4K8DA 4Z44A 2C7GA 4DSGA 4A6NA 3GWDA 4C5OA 2X8GA 3BI4A 4BURA 4EMJA 1D5TA 1TDNA 2WDQA 3CPIG 3NHOX 4UP3A 5HXIA 1PN0A 4CCQA 3I3LA 1BGJA 3CN8A 4OPUA 3DK4A 3II4A 1TYTA 3URHA 3ICTA 2GRTA 3LZWA 3M13A 1LJ1A 2VVMA 1ZMDA 4DGKA 3GDNA 4EMWA 1LTXR 4YT0A 1B8SA 2IIDA 3BHFA 1L0VA 3QSSA 2ZZBA 4ADWA 4U8KA 2Q7VA 1EL8A 2XFUA 5BVAA 3DJGX 1D4DA 1Q1RA 2YR4A 3VRDB 2OA1A 2R45A 1S2YA 1FEBA 2YLZA 1ZY8A 4Z2UA 2V61A 1PDHA 2YG3A 1XANA 3M12A 4A7AA 2BXRA 1N4UA 1VDCA 3AWIA 1ZOYA 4NEVA 4IVOB 4NTEA 1ELIA 3KA7A 4A9WA 2C70A 3Q9TA 1MOKA 1PJ6A 4KX6A 1H6VA 5EOWA 3EAOA 4ZN0A 3KD9A 2BACA 5GRTA 1X31B 1GOSA 3T37A 1W4XA 1KF6A 3G5RA 2X8HA 2WOIA 3FIMB 3ALMA 1TDFA 3CPJG 3UTGA 4Z26A 4EQXA 4AOXA 1IUXA 4J2WA 3AYJA 2VQ7A 4Y4MA 4BV6A 5KWFA 1Q9IA 3UOZA 3DA1A 1NEKA 3P9UA 4NTDA 1GREA 1F3PA 1PBBA 1QO8A 3P4RA 2BK3A 1Y56B 4JY3A 2YQUA 2VVLG 1LQTA 3AE8A 1OJTA 2EQ9A 3PVCA 2FJBA 1QLBA 3FMWA 3AEFA 4FK1A 4JQ9A 4O5QA 4CRTA 4H4YA 1KNRA 2Z5XA 2AAQA 1IUWA 2V3BA 1DOEA 3I6DA 4U8JA 3SM8A 2XLRA 2LFCA 2CFYA 2VOUA 1GALA 3C4AA 1BWCA 4H4VA 1KFYA 5JCNA 1H7WA 3AE3A 3LB8A 2YVGA 4YKGA 5IQ4A 5J60A 3AEGA 3NT6A 3OC4A 1CJ2A 1YQ3A 3QVPA 1P2HA 4BK2A 4RSLA 1VRQB 1GNDA 2TMDA 3FPZA 3K7QX 1GESA 3UP4A 3CIRA 1H86A 3L1RA 3ICSA 4K2XA 2NVKX 1FEAA 2YLXA 4YWOA 1DOCA 5JCLA 1DOBA 1RP0A 3CNTA 4PAAA 4YTNA 4JY2A 5EB4A 1O94A 3KU9A 3GSIA 4LA1A 3ATRA 3ZYXA 1NAAA 3Q6JA 2BA9A 1DODA 1N1PA 2GF3A 2XFNA 1JOAA 1PBDA 2WDVA 1PBCA 2RGOA 3DK9A 1EL9A 3AECA 1OJAA 2C76A 2CDUA 1NHSA 2WBAA 4TM1A 3AYLA 2VRLA 1PBFA 2E5VA 1M64A 2XYOA 5BUKA 1FECA 5KOWA 4E0VA 4J34A 2B9WA 1NPXA 3AYIA 4K7ZA 4AT2A 4H7UA 2FJEA 3G5SA 2X8CA 4DSHA 2Y6RA 4A99A 3ZDNA 1K0LA 2JB2A 3PS9A 2HQMA 1ZDLA 1GSNA 2YLSA 3ALLA 1OJDA 1REOA 1IJHA 3AE4A 4ICYA 1N4VA 5KVIA 4OVIA 4B67A 1ZOVA 3AEEA 2FJAA 4FX9A 5L46A 4H4PA 1E6EA 1JRYA 4B69A 3DK8A 2XVIA 3UKAA 5C2TA 3UTHA 4YSHA 3NK1X 1GETA 4CY6A 5U1OA 1TDEA 3NH3X 4B66A 1JEHA 2JAEA 3K7MX 2ACZA 2WP9A 2APGA 2OLNA 3NGCX 4EM4A 4A5LA 3V76A 2GQFA 2GH5A 4H4SA 2R46A 4ECHA 3UOVA 1TDKA 4H4WA 1ZX9A 1L9CA 2E1MA 3S61A 1GEUA 4LIIA 3UKQA 4HA6A 2B7RA 3SFEA 3VR9A 4OPIA 1COYA 4C3XA 4C74A 3JSKA 4B64A 1GT8A 5BULA 3H8LA 2AQJA 2EQ8A 4H4QA 4ZCDA 2F5ZA 2V3AA 3DGHA 1NHRA 2H89A 1GRTA 4X4JA 3CNJA 3EF6A 4U8IA 4Z2RA 1ONFA 2YVJA 4GUVA 3P4QA 5TR3A 1PS9A 2WPEA 2YWLA 3NN6X 4NEWA 3QFBA 1CC2A 1JRXA 2R4JA 3QSMA 2WEUA 5M10A 4D03A 4H4RA 1IUUA 1S2QA 1F8WA 4OPCA 2QA1A 4Z24A 2R9ZA 5IPYA 2H88A 2XLTA 4UDRA 3SUCA 2WDRA 3UKLA 1RYIA 1H81A 4LU6A 1CL0A 4YSXA 1B4VA 4I59A 3VRAA 1N4WA 1D7LA 5U25A 3GWFA 3NRNA 1B37A 4CNJA 1JNRA 2CULA 3CNPA 3RP7A 2DKIA 1MXTA 4AP1A
chains in the Genus database with same CATH superfamily
2LRLA 4IA6A 4YSYA 1JRZA 4E7ZA 2F4VT 3HKDE 3ZCJA 1JNZA 1UKVG 4OPGA 2A9UA 2I0MA 5L4HA 5CGMA 2VL0A 3PUQA 2Q9QA 3P7IA 4EZ4A 4TWDA 4B3ST 5AQJB 3PUXF 2IUBA 3ABVA 3RI5A 3J7Yq 2JMHA 5L47A 2V5DA 5LG3A 3EABA 2BRAA 5HWXA 2I0ZA 4UXNB 4USQA 1VG0A 2RGJA 4KI0F 1HYUA 2XTLA 4OHFA 2W62A 3DJEA 3P50A 2R0PA 2QA7A 4COFA 4H9NC 1LVKA 4RG3A 3CNSA 1D7YA 3IF8B 4X66T 3ONXA 5HCMA 5HEUA 2CXDA 4QH5A 4C3YA 4GK0E 1PIV4 1CJ4A 4QX8B 5JCIA 4IE7A 3EDUA 2X3NA 2IC6A 5BR8T 2MPKA 4N9XA 3G5QA 1IJ5A 2YG6A 3SZFA 2J1DG 4H4XA 2ZM2A 4OX9T 4B3MT 2GQWA 2PTFA 5LHIB 5AQVB 4K22A 3CPHG 3IHGA 4K0KT 1RVF4 2BS3A 3PJAJ 2YR5A 4K5RA 3HR0A 2BC0A 2C3CA 4GB34 1D4CA 5FMHA 1OEDA 4O4HE 5JTGA 2BBJA 2X50A 4D04A 2HWC4 1TRBA 2WESA 4B68A 4X9NA 5JQGE 4P0AA 3L8KA 3R6NA 5LV9A 1IJ6A 2ARDA 4QXHB 4JN9A 2BS4A 3QFAA 1RSGA 4WZXA 1NG3A 4CN6A 3WI3A 3PUAA 1E1LA 2WS3A 3AXBA 4II3A 3TLWA 3NNEA 1M6IA 2A8XA 5C8YE 3EANA 2XVFA 4BJYA 2BG9C 3AA6B 4PK6A 1XHXA 2GR1A 3GYJA 3KDSE 3I0OA 4HFVA 3SOLA 1OJCA 3B13A 1GTHA 4A5XA 3RIUC 4EIQA 2KLQA 1AL24 3LK3B 2VVNA 4LMLA 3H3MA 4U2TA 1XDOA 3BI5A 2CMRA 1AR64 1F8RA 2CLYC 1S3BA 2XLSA 5M4YA 1FL2A 3UOYA 4JEUB 1BF3A 4YTPA 1P2EA 4NPPA 2LSJA 4JUYA 1J1JA 3GN5A 5E0OA 1EL7A 5FS8A 3NVOA 2WU2A 3F8DA 3UTEA 2BG9B 2XQ7A 4UF0A 4X1IE 4I43B 3OPCA 2BK4A 5AQOB 1PXAA 2QAEA 4LF7T 5LGUB 4H4UA 3CGCA 4ILCA 5ABFA 3ZSTA 2XQ4A 4H9RC 3ETVA 4G9KA 3UQ4A 4JLEA 4H2PA 4Y4NA 1XHCA 3DGZA 4U2SA 2BK5A 3LFMA 1BGNA 4OYJA 2V6OA 1IBMT 2WP5A 4I0UA 3D1CA 1XZYA 1IAPA 3BI2A 1LVLA 4BK3A 1VBB4 2YDRA 3OYXA 4X5TA 3E1TA 4E7SA 2PYXA 4U8LA 1MMGA 4PK5A 1V9DA 4H63H 5AQNB 4UR9A 3AVRA 2BABA 3EI0A 2X9WA 2OALA 4DR5T 2QA2A 4GYSA 2X9YA 1E1MA 2GMJA 3GRSA 2IDOB 4RHV4 2YDSA 5M0ZA 2XAQB 5L3EB 2KINB 1UCUA 2RABA 2XQ3A 3AVSA 5CKUA 1V59A 4DV2T 2NP9A 2V7IA 3U78A 3D8XA 3NYCA 4HWIB 3FBZA 2XSBA 4DV0T 3ONJA 1US7B 3AD9B 1OEDE 1GRBA 3CTYA 4XXGA 4JNQA 1IUVA 2QCUA 1FMVA 4HEAA 3DH9A 4ZHQE 2JB1A 3N2KE 1NHPA 2E9XA 1ZKQA 3LBXB 3NK2X 5GONE 1O95A 2XQ5A 3VR8A 5HEOA 2DNXA 5JCKA 2GAHB 2YOEA 3K3QC 3MK7C 3KKJA 4UIGA 4TWFA 2L8KA 3CKDA 4WNKA 1N34T 2O9ZA 4YLHA 2V8SV 1YKHB 2CM0A 3CVRA 3RIFA 5LGNB 3E0ZA 3SFDA 3AD7B 1Y0PA 5U63A 1RUG4 2UXNB 2UU9T 1VG9A 2V7LA 5KRQA 1YD8G 4Z44A 4DSGA 2CE7A 1D5TA 2WDQA 3LJCA 5JVDE 5CJ5A 3II4A 1TYTA 4EIWA 4GKJT 3TLTA 1S94A 1LTXR 2LEHA 4YT0A 4AKIA 4GIWA 2IHR1 2Q7VA 4BJMA 4CQIA 2XFUA 5HEJA 4TUYE 2YR4A 4I4TE 1RHI4 4A7AA 2LKGA 3AWIA 1ZOYA 4IVOB 3AXJB 1MMAA 2C70A 3Q9TA 4DV1T 1H6VA 3AAIA 5AQHB 5GRTA 1X31B 3N9LA 1KF6A 2CEAA 2XHEB 2WOIA 3FIMB 3ZKRA 2WCAA 3UTGA 4Z26A 4JBWF 2PBIA 4J2WA 4DIDB 1QUUA 3AYJA 1FJGT 4ZI2D 1GREA 2V6YB 4DNDA 3B57A 3RKOA 4Z8XA 4TN7B 2EQ9A 2K48A 1MNEA 4YJ3E 2WY2A 2VKOA 2AE9A 2VQET 3SM8A 3I6DA 4QXBB 2CFYA 4H4VA 5L3GB 5JCNA 2IIUA 3AE3A 3T1YT 5L3CB 3CK6A 5DABA 3ZYKA 4PK4A 4BK2A 1HX1B 2ODUA 2BG9E 1GNDA 1UURA 5AQGB 4Q4W4 2ZM6T 4YWOA 1MQTD 4YTNA 3N9NA 4F8HA 4IE0A 3ZT7A 2ZM0A 5HXSA 3ZYXA 4TZ4C 2MOZA 1DODA 2GF3A 4GAVA 2WDVA 2JJ9A 2Y8DA 4TM1A 4ASKA 1PBFA 3PU8A 2E5VA 5LHHB 5BUKA 3AYIA 3KFWX 3G5SA 4JI5T 3PS9A 3W15B 2HQMA 4ICYA 2RS14 2N2NA 3KINB 5JR9C 3OYZA 1XHZA 2VL8A 1N36T 4QHOA 2XVIA 4CY6A 5U1OA 4B66A 2VKDA 2XAGB 2ACZA 2QVAA 4PFPA 4A5LA 3V76A 4YY3T 4ZZCA 5AQSB 4L5GA 4H4SA 4U74A 4L9IA 3UOVA 4H4WA 3JD74 2E1MA 3S61A 3RYHE 4LIIA 2CA5A 3UUNA 3SFEA 3VR9A 4C3XA 3JSKA 1GT8A 2AQJA 1HF8A 2VWAA 5FL1A 2YN6A 3DGHA 3T8OA 1NHRA 4MHCA 4X4JA 4Z2RA 2VK9A 4U31A 2WPEA 3NN6X 2X68A 3QFBA 5HXEA 2WB5A 5M10A 2JQKA 4D03A 2QA1A 1X9BA 2XLTA 1H81A 4C90A 2CHOA 1POV0 4YSXA 1WLXA 1B4VA 1N4WA 5JDGA 1D7LA 5U25A 3GWFA 3PTRB 5KMSA 2CULA 3RP7A 2DKIA 2W0GA 4B1BA 1NG4A 4K0UA 4DV7T 2PYLA 2XQAA 1T7SA 2YM1A 4IV9A 2C75A 1WYBA 3ETUA 2XM1A 3A8YC 1EL5A 1H7XA 3GD4A 2XY8B 2NOXA 2XFPA 2RPAA 3QOFA 4JI8T 1UUSA 1MO9A 2B9YA 2VQBA 4H50A 5EK2A 2PJQA 2Y6QA 2CPTA 2LM2A 4YTMA 3CGBA 4XWRA 3B5MA 4U33A 2Q0KA 1SHZC 2UUAT 2G0UA 4PJLA 1PO24 4KP3C 5JREA 1PJ5A 4G2AA 3NKSA 2LSIA 3UU4A 4USRA 2ACXA 3MACA 1XMQT 4GF7A 1LQUA 3DMEA 1S3EA 4CCRA 3UKFA 1OOPD 2QGSA 4UVAB 3UU6A 3NTAA 2LHNA 3PUGA 3UKHA 3NZPA 3K30A 2V26A 4DR6T 5JCMA 2DL1A 2W4XA 2MBGA 2WBLA 1OXZA 3P8CD 2CCQA 4NUUA 3AAAB 5EK4A 2JMKA 4AQYT 3NTDA 2VVLA 2Z5YA 3KV4A 4DMWA 1CHUA 2J4GA 2XQ8A 2D9DA 2GAGB 1NENA 4LF8T 5IYZE 4AOSA 3AE7A 1L9DA 3ZMZB 2RA1A 2YM2A 4C91A 4M52A 3P4SA 4MFRA 3N9QA 4CI2B 4L0RA 5FVLA 4UV9B 4EXTA 2JPFA 4A6NB 1VBA4 4DBQA 3KV9A 1FMWA 4HWFA 4JYAT 4U7YA 4TM0A 2YLWA 4ZEYA 3LZXA 1F8SA 4QH4A 2IW5B 4ZI2C 2GEWA 2J3NA 1GRAA 1WR6A 3S5WA 3EUHA 5ABEA 2GVCA 4FK1C 3GMIA 4TM3A 3HKCE 2CWOA 4HFCA 3OBVE 4PNIA 4REKA 4GDEA 3ZMVB 2JB3A 1IUSA 4X65T 4JNAA 4OPLA 4ZS2A 2R7FA 3GRTA 3AB1A 4EM3A 5HY5A 1M7KA 2W67A 2X9HA 4DNAA 2V60A 2P9BA 3U3IA 3CMMA 3AD8B 2WHDA 2WOVA 2NW8A 3NK0X 4A79A 1AOGA 2Q9QB 4AKLA 1VQWA 4CXXA 1DXLA 2BZBA 2X0YA 4CXYA 2Q0LA 5JRCA 2V7KA 2BC1A 4LFAT 4HGAA 2D0TA 4WX1A 1J5WA 2VKJA 4IVMB 1Z6LA 1RMU4 3B3RA 4FI5A 1MNDA 2C66A 5GSNA 2EQ7A 3UOXA 2YINA 4H9SE 1YY5A 4M1PA 1HNZT 1W9RA 4YKFA 4JDRA 3T2YA 3ZPOA 5F3JA 3ANWB 3FZLB 3PDYA 4P0BA 3VRBA 2WM9A 1TYPA 2PHHA 3AE1A 2XVEA 5JH7E 2GMHA 1HG2A 2OV9A 4PAGA 2VQFT 2Q6UA 3H8IA 2EHOC 4EB6E 2YG4A 5EZYE 1H83A 3K1SA 4ZCCA 2BS2A 1B5QA 3TLSA 3UQ7A 3MKDA 1DNCA 2WOWA 3UCLA 5LYJE 1XDPA 3R9UA 3QNUA 2YEVC 3IBPA 3VQRA 2CRBA 1CJ3A 3O0HA 3RHAA 4EQSA 5CFBA 1T8BA 3M0OA 4TX5A 4P09A 2BCPA 2FJDA 1FEWA 2W66A 2OLOA 3RYCE 2YU1A 1KSUA 3GMCA 1AR84 3C4NA 4OCGA 4IREA 1AR74 3NG7X 2A89A 3GA8A 2KWHA 4WW0A 2VKHA 4J31A 3LK42 3BNUA 3QB5A 3RNMA 2VURA 4IL9A 4H63V 3UFEA 3UP5A 5LHGB 1T98A 4IE6A 2IVEA 3CNDA 2WWVA 5FS6A 1R8IA 3OKQA 2EHOB 4HE8A 3UTFA 3BHKA 4U8NA 1O5WA 3O1HA 5LCYA 1GTEA 3PJAA 2C4CA 3H4KA 3GQKA 2XLUA 2OLTA 4KHPT 1H82A 2B76A 3IWAA 5AQTB 5EK3A 4AQFC 2MTQA 2JQ9A 2YKSA 4NTCA 2UXXB 4EQRA 3AA0B 1CBOA 1E1KA 3KPFA 5L3FB 3NLCA 4YXDA 1LV0A 1D4EA 1K0JA 1GRFA 1CF3A 1QJDA 5CA1E 2LKHA 1TDOA 3K8PC 4J2CA 2YG7A 3F57A 4BURA 5HXIA 1TDNA 3CPIG 5AQLB 1PN0A 4CCQA 4X62T 4GAPA 4GOUA 3C4XA 3HYWA 3ZYLA 4O4IE 2PZSA 5FYMA 3M13A 4UF0B 2W63A 4O2AE 2VVMA 4DGKA 4EMWA 4ADWA 1B8SA 2ZZBA 4U8KA 1EL8A 5BVAA 1D4DA 1PVC4 5ABGA 3VRDB 1NA1D 2H7OA 1S2YA 1D0YA 1ZY8A 4OFZA 2YG3A 5FNVE 3UFGA 1N4UA 1VDCA 3KA7A 3QUJA 4ZXLA 3HA4A 3RPUA 4ZN0A 3RH3A 3KD9A 3T37A 3T2KA 1W4XA 1N32T 5H6RB 3CPJG 3RC3A 2C0SA 2LHRA 4EQXA 2PYJA 2JQQA 2VQ7A 2N9DA 4HTEA 1Q9IA 5HEGA 4DR4T 3DA1A 1NEKA 4DUYT 2LSGA 1I94T 2JRKA 1IBKT 4JY3A 3NZQA 1Y56B 3KVBA 2YQUA 1HR0T 1PO14 2BKNA 1LQTA 5DQWA 1OJTA 3PVCA 1QLBA 5FP3A 4JQ9A 4CRTA 4YJ2E 1IUWA 2V3BA 1DOEA 2XLRA 4IDPA 3UT5E 2VOUA 1GALA 3C4AA 4U7IA 2BG9A 4U2YA 3AEGA 4H9OC 3PUYF 1CJ2A 5IHYA 2RS54 2ES0A 4II2A 4RSLA 3CIRA 1H86A 3L1RA 4K2XA 2PW9A 5JCLA 1DOBA 2KNDA 1RP0A 1D4M4 5EB4A 3RIUA 3GSIA 1VRBA 2WWUA 1NAAA 5HWYA 3Q6JA 1W0BA 5HAXA 1PBDA 2CDUA 1SA0E 2R074 2XYOA 5KOWA 4E0VA 5HXCA 5KMRA 1HRV4 2B9WA 4H7UA 2Y6RA 5AFUL 3ZDNA 1HRI4 1ZDLA 1GSNA 4DR1T 1OJDA 1REOA 1IJHA 1N4VA 2CXFA 1KEYA 5J2TE 4B69A 1XNQT 3DK8A 3UTHA 5C2TA 4OYKA 4YSHA 4PW8A 3PUSA 1TDEA 1JEHA 3K7MX 5KMQA 2APGA 2OA5A 4EM4A 4UVCB 2C5JA 3OJAA 2GH5A 2R044 1HNXT 4ECHA 3BQIA 2NW7A 3N9MA 4ILBA 3RX6A 3SXIA 2QYWA 2B7RA 4OPIA 3UULA 4C74A 4X1YE 3H8LA 3RGLA 4A56A 2FUPA 2HWB4 5J0ZA 3RIAA 2YU2A 1RUE4 2YWLA 2HPLA 3KPKA 4MALA 3LBXA 1IBLT 5JDQA 1IUUA 4HFDA 2I59A 2R9ZA 3MZKB 1EAH4 3T1HT 5LMUT 4HFIA 3VRAA 4I59A 4Z90A 2UXBT 3NRNA 1JNRA 4AP1A 4ANJA 1MIYA 2WU5A 2NWBA 1LVFA 1VCSA 2Q9QD 2YVFA 4LMJA 2NR4A 4G73A 3KV6A 2XQYA 2L3LA 4BJNA 2LE8A 3NBXX 2DKHA 3B6DA 4ISTA 1ZMCA 4O4LE 1PBEA 2XJ7A 5F8PA 5BMVE 5FVKA 3IHRA 3JAFA 4K5SA 2X5ID 1Z0PA 5KVHA 3TKLB 3DJDA 4JEHB 4TV9E 2XFQA 2W00A 5HYMA 2NW9A 4MJWA 1NHQA 5FY1A 4QWNB 3AXJA 1EZ3A 2ZLYA 5TAOA 3FG2P 2TPRA 2WETA 3RRCA 2C5IT 3DJBA 1L9EA 1Y64B 5L3DB 3C96A 4FJOA 2B1EA 2FBWA 2LJLA 3GD3A 2CHNA 3SZ0A 4MLKA 4JI1T 3V5UA 2V6YA 2LSYA 4AXPA 5ETWA 3AE6A 3MXZA 4AI6A 2E4GA 2ODVA 1GQEA 1SUMB 2XVJA 3JAEA 2W61A 2XAHB 4JI3T 3VHLA 4DMVA 2GB0A 3JC6C 3LADA 4H2RA 2KXPB 4UV8B 3K7TA 1RUI4 1YXRA 3HL6A 1Q1WA 1SEZA 3NN0X 3NRYA 4IGUA 5FMNA 4CBQA 3RYFE 4CXWA 1S35A 1G8XA 4O4JE 2PG8A 2UZZA 5EB5A 2JKCA 1DJNA 4GCMA 3UTKA 2DHRA 2A87A 4J56A 1BKWA 4JI4T 2J62A 3L39A 2EHOD 4ZI3C 1KDGA 2B7SA 2E2AA 4BK1A 2VB6A 3R84B 2XQ9A 3AAEB 5AQMB 3SYIA 5HXHA 3GMBA 2C72A 4Q4X4 3IC9A 2J47A 2PFVA 1LPFA 3O9XA 2R4EA 1H7CA 2BVLA 1ASJ4 2X51A 5H6QB 4QX7B 1IUTA 5AQRB 2K24A 2D2SA 2HH7A 3IHMA 3V3NA 1WRDA 3K3NA 3BQKA 1LKXA 2R6GF 2ZZ0A 2YG5A 1D1CA 2Z6EA 4CZZB 2JK6A 4IDZA 3RQWA 4EMIA 2X67A 3ZC1A 4H2NA 3JBG4 2M67A 3LOVA 2WQYA 1XPQA 2VZ2A 4HFBA 3ZJ2A 4U72A 1COV4 4UVBB 3ZMUB 3ZSSA 2KSRA 3QVRA 2E8IA 2VVSA 5C3JA 3ISHA 2GV8A 4CN1A 1PXBA 2YLRA 4Q4V4 4DO0A 2NPXA 4ZS3A 4LF6T 2YDQA 3ONLC 2JQHA 4B65A 2C5KT 2IVDA 4U2LA 2UUCT 1GPEA 4F6RC 2XFOA 1HX8A 2NTXA 1D0ZA 3ZJ1A 2C65A 3PUWF 5LGTB 1YQZA 2WPCA 1WYCA 1DU2A 5JR9A 2YAUA 1F6MA 2GR2A 4AISA 4PABA 3AA7B 1E1HB 1ZHCA 1IZNB 5CB4E 2GR0A 4HFEA 3QJ4A 5LJMA 5AQQB 4G63A 5J2UE 1XMOT 3CMLA 3NYEA 2GR3A 4QKNA 3LSVA 4P9SA 4PJNA 1GRGA 1FIOA 4NZHA 3FZMB 1YW0A 4YSZA 5FXVA 3CGEA 4X9MA 2BKPA 3AEAA 3SY4A 5KMGP 4AKGA 1QSDA 4OPDA 3ATQA 1ZKEA 3OZ2A 3ADAB 4A98A 1YKJA 3RP6A 5CA0E 4JV5T 1FCDA 4YHHT 2N1GA 4EV6A 4OPTA 2QRXA 2W2UA 5AQIB 5IQ1A 3LG7A 2BRYA 4TLXA 4CI3B 4J33A 5EBKA 3PE0A 1ZV4X 4HWDA 2C3DA 2Q9QC 3H37A 5ADXL 2H7VC 1YKEB 4G74A 1CC4A 3MA9A 4HN9A 1XI1A 2A2FX 3P1WA 4NIQA 4IDOA 2BXSA 1LRZA 2KT9A 2VRMA 5JDLA 4DV4T 1XDIA 1NAFA 2OAMA 4CNKA 3COXA 4EYUA 3GWHA 1YQ4A 3E22E 3RC8A 2C73A 5DBJA 2M6IA 4XBFB 1VBE4 3N9PA 2DI4A 4HWHA 3CX8B 3KV5A 3WAKA 1H84A 2BYBA 1ZP0A 1AJ3A 3EHZA 3HZLA 5JRCB 4U8PA 2XZEA 4YFSA 4AP3A 4TWHA 4A6NA 3ZC0A 3GWDA 4C5OA 3BI4A 4UP3A 1U4QA 1BGJA 3CN8A 4OPUA 2Y6XA 3DK4A 4ERRA 3URHA 3ICTA 4ILAA 3LZWA 2V1DB 3UUBA 2V7JA 1LJ1A 3CX6B 1D0XA 3GDNA 3BHFA 1L0VA 2ZMAA 3DJGX 1Q1RA 4TNVA 1RUJ4 2RS34 2OA1A 3G06A 3V5SA 3K3OA 1FEBA 2YLZA 4G6GA 2V61A 1PDHA 1XANA 4UELA 5IUXA 1VOMA 3ZLIA 2BXRA 1T72A 1HNWT 5LJNA 1MOKA 5EOWA 4MBQA 2E5LT 3UUXB 1GOSA 5FY7A 3C4WA 4CI1B 4IIJE 4ZOLE 3T0KA 3IA3A 2MYSA 3I0QA 3SZWA 4AOXA 4B3TT 4HFHA 2HPJA 4AKRB 4BV6A 5KWFA 3UOZA 5A1LA 3P9UA 2D5UA 5JDHA 1PBBA 3P4RA 5KX5E 4LFCT 3AE8A 3N2GE 2FJBA 4FK1A 3CWZB 4LF5T 4H4YA 3J8F4 2AAQA 3Q2MA 2XAJB 4LFBT 2D0UA 1K5MD 1BWCA 1KFYA 1H7WA 3LB8A 5IQ4A 4KUMB 4NXNT 3NT6A 3ANWA 3OC4A 4EEBA 2X0LB 1RUC4 1YQ3A 2I6HA 1VRQB 4V1Av 2TMDA 4IE4A 3K7QX 4GKKT 1OEDB 3UP4A 3ICSA 2YLXA 4TNWA 1DOCA 3P4WA 4PAAA 3DTOA 4JY2A 3Q5XA 3KU9A 4HWCA 3ATRA 1HG5A 3EAMA 2BA9A 1N1PA 2XFNA 1JOAA 1EL9A 3AECA 5HEHA 1NHSA 2WBAA 1VCTA 2VRLA 4JI2T 1M64A 1FECA 5JDNA 3FZHB 4K7ZA 2X8CA 3ZYMA 4A99A 1N33T 1K0LA 3PU3A 1MMNA 3SRZA 4OVIA 4B67A 1ZOVA 3AEEA 4FX9A 4EAHA 3FBLA 1JRYA 4HKAA 2RM24 2XAFB 2JAEA 1KK7A 1UK5A 4ISSA 3NGCX 5HXRA 3ZMTB 3FXEB 3L3PA 2GQFA 4G6HA 4JI7T 1ZX9A 1L9CA 1OWAA 3UKQA 1HXS4 4NWZA 2CBIA 2A3DA 4B64A 2EHOA 5BULA 4PFOA 3WAJA 4H4QA 2V3AA 3GN5B 2PY5A 2H89A 3T31A 3CNJA 3EF6A 4U8IA 4KHZF 3ZT6A 1ONFA 2YVJA 4GUVA 3P4QA 3QK6A 5TR3A 3Q5DA 1VBD4 1JRXA 3J9X1 2R4JA 2YK0A 2WEUA 4H4RA 1S2QA 1ZEEA 1HFAA 3FI7A 4N78D 3UUMA 2X66A 3SUCA 2WDRA 3UKLA 4LU6A 1CL0A 3O1JA 4GK5E 3X1DA 3BK9A 5ABFB 2DWKA 1B37A 3AA1B 4CNJA 3CNPA 1MIWA 5IWAT 4WBNE 2V7MA 3CX7B 3EDVA 3FXDB 3F2EA 2XSAA 2KZ7B 2RP4A 4I58A 4PDWD 3CPZA 3JC6D 3C98B 1DJQA 1K4QA 4X20E 4H4ZA 1R084 3TLUA 3O4XE 4XAXB 3KBUA 3NIXA 2B9XA 2WZIA 4IA5A 2E9XC 5ABHA 1AR94 3AE9A 3OTOT 4IT4A 4Z43A 4DVDA 2JBVA 5KXJA 3ZMSB 2DLRA 4IDQA 3NYFA 3N2OA 4JI0T 4ZI3D 5KMPA 5AQUB 4CN4A 1HTJF 4AQFA 3ICRA 3RF1A 4EQWA 1W0AA 5FS7A 2H3RA 1JU2A 3ITJA 2IMLA 3FHNA 1GXFA 1R094 3L09A 3HKBE 1G73A 2X99A 5KNLA 1J5ET 2M6BA 2CLYB 1NDAA 3FZKB 1KNPA 4TV8E 3EVYA 3C64A 4KMCA 5L2LA 1XWMA 3UU5A 3BQLA 2YLTA 2ZZCA 4B63A 5FS9A 4CY8A 3F8RA 2CVJA 1RUD4 3KVEA 4XZCA 2XCGA 1E39A 2E9XB 2KMFA 3AEBA 1BR1A 3Q5EA 4I50E 1Y56A 5J7XA 1KNZA 3IF9A 4IE5A 4DBRA 4GRTA 5LB7B 4ILUA 5LOVE 2C67A 3UKPA 4EZHA 3SS1A 1RUH4 4O2BE 5KDMC 3SQPA 4Q4Y4 4IL4A 4U2ZA 2A72A 3SGLA 3FZFB 3T14A 3ALJA 3RKGA 5ER0A 1BEV4 1XNRT 1O3XA 5LP6E 4LF4T 2X0HA 3ZN0B 2LOPA 2XASB 4LF9T 4J36A 3KLJA 4A97A 3I9YA 4C77A 1K0IA 3QSEA 3LXDA 2BBHA 4TLZA 3LJPA 2Y48B 1PXCA 3HYVA 1BR4A 1EBDA 1CC6A 1CUNA 4O5UA 2XVHA 2C64A 2XM2A 4DR3T 2RMU4 4RG4A 2WSSV 5DQVA 3VKHA 3ZEFB 1BR0A 5F5WA 1SE7A 3D0TA 4X1KE 3A5XA 3UU3A 2CWYA 2WPFA 4FDCB 2IAKA 3SWHA 4APNA 3QB5K 3REDA 3V3OA 4AQGA 4DUZT 1ZK7A 2KWIB 3PUVF 4NNJA 3GDPA 4GDPA 1Z7S4 5HCJA 5LMNT 4P1NA 4WBOA 5FKYA 2BCGG 1HCIA 4EYYR 5LBQB 3NRXA 3RP8A 4XWZA 4ZZBA 2WZHA 3JCFA 3BNMA 3GQHA 2LRKA 3GYXA 4Y4LA 2WP6A 3FBSA 2V5ZA 2XLPA 4QH1A 3NKZA 5LA6E 5LNKA 3EPTA 1UGOA 5FXZA 3UKKA 1OJ9A 3AB3B 5HHFA 4BJZA 3PO7A 3RLFF 3CQXC 1E7PA 5KOXA 3AE5A 4ZI7E 4DV3T 1GV4A 2UXCT 3RQUA 4Q25A 2SPCA 4EGWA 5L3BB 1Y01A 2LLYA 1EV14 4IHJE 3L8RA 2VASA 4EIPA 2EQ6A 4H4TA 3ZCIA 2UUBT 4AT0A 5J1GA 4PJMA 4J57A 2R0GA 4U8OA 2XDOA 3PURA 4YHJA 4HB9A 1KSSA 3AE2A 2V5CA 1B7TA 4Z25A 1NWMX 1UX4A 2CXLA 4X64T 4QXCB 5LBMA 4TM4A 2WMOA 5BRTA 2K5BB 2LSKA 3GYIA 3C4ZA 3SX6A 3WE0A 3QC9A 2BVMA 1BZLA 1GERA 3C50A 1E1NA 2RGHA 3MJXA 4Z2TA 3M65A 2BKOA 4DR2T 4KPRA 1U5PA 5HYAA 4H2QA 4WCTA 1M62A 2V6XA 1HS7A 4B3RT 3DJJA 4GR1A 2DWGA 3P4PA 4DV6T 1PJ7A 2R0CA 5JDMA 3T2ZA 4UDQA 3NWIA 4U8MA 5FXWA 2PLV4 3RRWA 1FOHA 3VU7H 2UXDT 4UDPA 4BA9A 4A65A 3F8PA 1CJCA 3CGDA 3O1IA 1GRHA 1WR0A 3Q5WA 2AR8A 2YR6A 2EX3A 2NTYA 4EEDA 3ESLA 3AEDA 3ZN1B 3CQGB 1PHHA 2ZBWA 2W0HA 4DR7T 5CQFA 4Z91A 4K8DA 2C7GA 2X8GA 4EMJA 3NHOX 3HKEE 3SZCA 3M3ZB 3A7MA 3PV0F 2XUEA 3RHWA 5JDFA 3I3LA 2DCFA 2AXDS 4JI6T 1I6ZA 2LT3A 2GRTA 3S4UA 2HN1A 4H9PC 1ZMDA 2IIDA 1W09A 3QSSA 2LM9A 3KBTA 3E08A 5JR9B 4GYRA 4NXMT 4O8SA 2R45A 4Z2UA 3HI2A 4B6XA 3M12A 5FY0A 4NEVA 4NTEA 1NCQD 1ELIA 4A9WA 1PJ6A 4KX6A 3EAOA 2BACA 3G5RA 2X8HA 3ALMA 3TLVA 3ZT5A 1TDFA 3C51A 3I9WA 1IUXA 4Y4MA 2X9XA 4NTDA 1F3PA 2BK3A 1QO8A 4DV5T 3PUZF 2VVLG 4KBMB 3IEEA 3FMWA 3AEFA 4O5QA 1KNRA 2CBJA 2WMNA 2Z5XA 4U8JA 2WAUA 2K3WA 2LFCA 2XPKA 3CQCB 2YVGA 4YKGA 5J60A 5LXTE 3QVPA 1P2HA 3FB2A 3RYIE 3FPZA 3N5LA 1GESA 1D1AA 2XQ6A 1FEAA 2NVKX 3CNTA 2MAWA 1X79A 3VKGA 3N9OA 1O94A 5FL0A 4LA1A 4AKHA 5L4EA 4I55E 1PBCA 2RGOA 3DK9A 3OVUA 1OJAA 5FXXA 2C76A 3AYLA 1VBC4 3HYXA 3Q9DA 2RR14 2R064 4J34A 3JADA 4IDNA 1NPXA 4AT2A 2FJEA 1WCRA 4DSHA 2E9XD 4PJJA 2JB2A 2YLSA 3ALLA 1MMDA 5DJQC 1D1BA 3AE4A 5KVIA 1WFDA 5AQFB 2FJAA 3I1AA 5L46A 4H4PA 1E6EA 4OK0A 2IC9A 3UKAA 3KVAA 3NK1X 1GETA 2ZM8A 3NH3X 1E2AA 2WP9A 2OLNA 1UX5A 3H3AA 3LK2B 1BR2A 2R46A 1RUF4 1TDKA 2L9QA 4WYVA 2HN2A 2GK9A 1GEUA 3F31A 1H8TD 4HA6A 5AQKB 1COYA 4UEMA 2EQ8A 4EOZB 4ZCDA 2F5ZA 4AIUA 1MIVA 1GRTA 2JIWA 1PS9A 2HHHT 4NEWA 2BDEA 4U3CA 1CC2A 4BAYB 3QSMA 4LMKA 1F8WA 4OPCA 2LOSA 4Z24A 5LG4A 3UU8A 4NUVA 5IPYA 2H88A 3LDQB 4UDRA 2K9AA 4ADZA 1VRH4 1RYIA 4H9QC 3DP7A 1Z8UA 1MXTA 5AQPB 1OEDC
chains in the Genus database with same CATH topology
4B1BA 1NG4A 4I58A 4IA6A 2WU5A 2YM1A 4IV9A 4YSYA 1JRZA 2C75A 1DJQA 1K4QA 4H4ZA 2YVFA 1JNZA 1EL5A 1UKVG 4OPGA 1H7XA 3GD4A 4G73A 3NIXA 2B9XA 2XFPA 4IA5A 3AE9A 2DKHA 1MO9A 2B9YA 3B6DA 4Z43A 2VQBA 3ABVA 1ZMCA 4H50A 2JBVA 5KXJA 1PBEA 2Y6QA 2BRAA 4K5SA 2I0ZA 3NYFA 5KVHA 5KMPA 4YTMA 3CGBA 3DJDA 4USQA 1VG0A 2RGJA 4XWRA 3ICRA 2Q0KA 2XFQA 4EQWA 5FS7A 1JU2A 3ITJA 1HYUA 5HYMA 1PJ5A 4USRA 3NKSA 4MJWA 3DJEA 1NHQA 1GXFA 2R0PA 4GF7A 1LQUA 3DMEA 2X99A 5KNLA 1S3EA 4RG3A 3CNSA 1D7YA 3UKFA 4CCRA 3FG2P 2TPRA 2WETA 1L9EA 3C96A 1NDAA 4C3YA 1CJ4A 3NTAA 1KNPA 5JCIA 3UKHA 2FBWA 2X3NA 2YLTA 3K30A 5JCMA 2ZZCA 4B63A 5FS9A 4CY8A 3GD3A 3F8RA 4N9XA 2CVJA 3G5QA 3KVEA 3SZ0A 2XCGA 2YG6A 1E39A 3SZFA 4H4XA 3AEBA 1Y56A 5J7XA 3NTDA 2VVLA 2Z5YA 3IF9A 2GQWA 3AE6A 4GRTA 3CPHG 4K22A 1CHUA 3IHGA 3UKPA 2C67A 2E4GA 2GAGB 2BS3A 1NENA 4AOSA 2XVJA 3AE7A 1L9DA 2YR5A 4K5RA 3SQPA 2YM2A 2BC0A 2GB0A 3LADA 4M52A 4H2RA 3P4SA 3K7TA 3SGLA 2C3CA 3T14A 3ALJA 1Q1WA 1D4CA 5ER0A 5FMHA 1SEZA 3NN0X 4A6NB 2X50A 4CBQA 4D04A 2UZZA 1TRBA 2WESA 2YLWA 4TM0A 4B68A 3LZXA 5EB5A 1F8SA 2JKCA 4X9NA 3L8KA 1DJNA 4GCMA 5LV9A 2GEWA 2A87A 2ARDA 4J56A 4J36A 2J3NA 4JN9A 3KLJA 1GRAA 2BS4A 3QFAA 1RSGA 3S5WA 1BKWA 2GVCA 4FK1C 1K0IA 3QSEA 4C77A 1NG3A 1KDGA 4TM3A 1E1LA 2B7SA 2WS3A 3AXBA 3LXDA 4TLZA 4II3A 4BK1A 3NNEA 1M6IA 1PXCA 3HYVA 3LJPA 4GDEA 4REKA 1EBDA 2JB3A 2A8XA 1IUSA 3EANA 2XVFA 1CC6A 4BJYA 3SYIA 4O5UA 4JNAA 3GMBA 2C72A 3IC9A 4OPLA 1LPFA 2GR1A 3GYJA 2R4EA 2XVHA 2C64A 3GRTA 3AB1A 4EM3A 5HY5A 4RG4A 1IUTA 4DNAA 2V60A 1OJCA 3IHMA 3CMMA 3AD8B 3V3NA 1GTHA 2WHDA 2WPFA 2ZZ0A 2WOVA 4FDCB 4EIQA 3NK0X 4A79A 2YG5A 1AOGA 4APNA 2JK6A 4U2TA 3REDA 4H2NA 4EMIA 3V3OA 3BI5A 1VQWA 1ZK7A 1F8RA 1DXLA 4NNJA 3LOVA 2WQYA 3GDPA 1XPQA 2VZ2A 4GDPA 1S3BA 2XLSA 2Q0LA 2BC1A 1FL2A 2BCGG 3UOYA 1BF3A 4WX1A 3QVRA 5C3JA 3RP8A 3ISHA 4IVMB 2GV8A 1PXBA 4YTPA 1Z6LA 2YLRA 4XWZA 1P2EA 3B3RA 2C66A 3BNMA 5GSNA 2EQ7A 2NPXA 3UOXA 3GYXA 3GQHA 1YY5A 4Y4LA 2WP6A 1EL7A 5FS8A 3FBSA 4YKFA 2V5ZA 2XLPA 4JDRA 4B65A 2IVDA 2WU2A 3T2YA 4U2LA 3F8DA 3UTEA 3EPTA 1GPEA 3UKKA 1OJ9A 2XFOA 5HHFA 3VRBA 2BK4A 2C65A 4BJZA 1TYPA 1YQZA 2PHHA 3AE1A 2WPCA 3PO7A 1PXAA 2XVEA 2QAEA 2YAUA 1F6MA 2GR2A 4H4UA 1E7PA 2GMHA 3CGCA 4PABA 5KOXA 3AE5A 1GV4A 4G9KA 2GR0A 2Q6UA 3H8IA 4H2PA 3QJ4A 4Y4NA 1XHCA 2YG4A 3DGZA 4U2SA 2BK5A 1H83A 3NYEA 4ZCCA 2BS2A 1BGNA 2V6OA 1B5QA 1DNCA 2GR3A 2WOWA 3UCLA 4P9SA 2WP5A 3D1CA 1GRGA 3R9UA 2EQ6A 4H4TA 4EIPA 4AT0A 3BI2A 3VQRA 1LVLA 4J57A 2R0GA 4NZHA 4U8OA 1CJ3A 3O0HA 3RHAA 4BK3A 4YSZA 2XDOA 4EQSA 3CGEA 4X9MA 3AEAA 3E1TA 3SY4A 3M0OA 2PYXA 2BCPA 2FJDA 4HB9A 4U8LA 1KSSA 3AE2A 4OPDA 4Z25A 2OLOA 3ATQA 3OZ2A 2BABA 1KSUA 3ADAB 3GMCA 2OALA 3C4NA 4TM4A 4OCGA 2QA2A 5BRTA 1E1MA 2A89A 2GMJA 3GRSA 3NG7X 1YKJA 3RP6A 1FCDA 5M0ZA 3GYIA 3SX6A 4OPTA 3WE0A 4J31A 3BNUA 3RNMA 5IQ1A 1BZLA 2RABA 1GERA 2BRYA 1E1NA 4TLXA 4J33A 5EBKA 2RGHA 5CKUA 3UP5A 4Z2TA 1V59A 2IVEA 2C3DA 3CNDA 4KPRA 5FS6A 3D8XA 3NYCA 4H2QA 4WCTA 4G74A 3UTFA 3BHKA 4U8NA 1CC4A 3DJJA 4GR1A 1O5WA 1GTEA 3AD9B 1GRBA 3P4PA 3CTYA 4XXGA 3P1WA 4JNQA 2C4CA 3H4KA 1IUVA 2QCUA 1PJ7A 2R0CA 2XLUA 3T2ZA 3GQKA 3IWAA 1H82A 2B76A 3DH9A 4UDQA 2JB1A 1NHPA 2BXSA 3NK2X 1ZKQA 4U8MA 1O95A 3VR8A 2VRMA 5JCKA 2GAHB 1XDIA 1FOHA 4UDPA 3KKJA 4A65A 2OAMA 1CJCA 3F8PA 4NTCA 4CNKA 3COXA 3CGDA 4EQRA 1YQ4A 1CBOA 2C73A 2O9ZA 1E1KA 1GRHA 3KPFA 5DBJA 2AR8A 3NLCA 2YR6A 4YXDA 1LV0A 1D4EA 3SFDA 1H84A 3AD7B 3AEDA 1K0JA 1GRFA 2BYBA 1ZP0A 1Y0PA 1CF3A 1QJDA 5U63A 3HZLA 1TDOA 1PHHA 2ZBWA 2W0HA 1VG9A 4U8PA 5KRQA 5CQFA 4AP3A 2YG7A 4K8DA 4Z44A 2C7GA 4DSGA 4A6NA 3GWDA 4C5OA 2X8GA 3BI4A 4BURA 4EMJA 1D5TA 1TDNA 2WDQA 3CPIG 3NHOX 4UP3A 5HXIA 1PN0A 3SZCA 4CCQA 4GAPA 3I3LA 1BGJA 3CN8A 4OPUA 3DK4A 3HYWA 3II4A 1TYTA 3URHA 3ICTA 2GRTA 3LZWA 3M13A 1LJ1A 2VVMA 1ZMDA 4DGKA 3GDNA 4EMWA 1LTXR 4YT0A 1B8SA 2IIDA 3BHFA 1L0VA 3QSSA 2ZZBA 4ADWA 4U8KA 2Q7VA 1EL8A 2XFUA 5BVAA 3DJGX 1D4DA 1Q1RA 2YR4A 3VRDB 2OA1A 2R45A 1S2YA 1FEBA 2YLZA 1ZY8A 4G6GA 2V61A 4Z2UA 1PDHA 2YG3A 1XANA 3M12A 4A7AA 2BXRA 1N4UA 1VDCA 3AWIA 1ZOYA 4NEVA 4IVOB 4NTEA 1ELIA 3KA7A 4A9WA 2C70A 3Q9TA 1MOKA 1PJ6A 4KX6A 1H6VA 5EOWA 3EAOA 4ZN0A 3KD9A 2BACA 5GRTA 1X31B 1GOSA 3T37A 3T2KA 1W4XA 1KF6A 3G5RA 2X8HA 2WOIA 3FIMB 3ALMA 1TDFA 3CPJG 3T0KA 3UTGA 4Z26A 4EQXA 3SZWA 4AOXA 1IUXA 4J2WA 3AYJA 2VQ7A 4Y4MA 4BV6A 5KWFA 1Q9IA 3UOZA 3DA1A 1NEKA 3P9UA 4NTDA 1GREA 1F3PA 1PBBA 1QO8A 3P4RA 2BK3A 1Y56B 4JY3A 2YQUA 2VVLG 1LQTA 3AE8A 1OJTA 2EQ9A 3PVCA 2FJBA 1QLBA 3FMWA 3AEFA 4FK1A 4JQ9A 4O5QA 4CRTA 4H4YA 1KNRA 2Z5XA 2AAQA 1IUWA 2V3BA 1DOEA 3I6DA 4U8JA 3SM8A 2XLRA 2LFCA 2CFYA 2VOUA 1GALA 3C4AA 1BWCA 4H4VA 1KFYA 5JCNA 1H7WA 3AE3A 3LB8A 2YVGA 4YKGA 5IQ4A 5J60A 3AEGA 3NT6A 3OC4A 1CJ2A 1YQ3A 3QVPA 1P2HA 4II2A 4BK2A 4RSLA 1VRQB 1GNDA 2TMDA 3FPZA 3K7QX 1GESA 3UP4A 3CIRA 1H86A 3L1RA 3ICSA 4K2XA 2NVKX 1FEAA 2YLXA 4YWOA 1DOCA 5JCLA 1DOBA 1RP0A 3CNTA 4PAAA 4YTNA 4JY2A 5EB4A 1O94A 3KU9A 3GSIA 4LA1A 3ATRA 3ZYXA 1NAAA 3Q6JA 2BA9A 1DODA 1N1PA 2GF3A 2XFNA 1JOAA 4GAVA 1PBDA 2WDVA 1PBCA 2RGOA 3DK9A 1EL9A 3AECA 1OJAA 2C76A 2CDUA 1NHSA 2WBAA 4TM1A 3AYLA 2VRLA 3HYXA 1PBFA 2E5VA 1M64A 2XYOA 5BUKA 1FECA 5KOWA 4E0VA 4J34A 5KMRA 2B9WA 1NPXA 3AYIA 4K7ZA 4AT2A 4H7UA 2FJEA 3G5SA 2X8CA 4DSHA 2Y6RA 4A99A 3ZDNA 1K0LA 2JB2A 3PS9A 2HQMA 1ZDLA 1GSNA 2YLSA 3ALLA 1OJDA 1REOA 1IJHA 3AE4A 4ICYA 1N4VA 5KVIA 4OVIA 4B67A 1ZOVA 3AEEA 2FJAA 4FX9A 5L46A 4H4PA 1E6EA 1JRYA 4B69A 3DK8A 2XVIA 3UKAA 5C2TA 3UTHA 4YSHA 3NK1X 1GETA 4CY6A 5U1OA 1TDEA 3NH3X 4B66A 1JEHA 2JAEA 3K7MX 2ACZA 2WP9A 5KMQA 2APGA 2OLNA 3NGCX 4EM4A 4A5LA 3V76A 2GQFA 2GH5A 4G6HA 4H4SA 2R46A 4ECHA 3UOVA 1TDKA 4H4WA 1ZX9A 1L9CA 2E1MA 3S61A 1GEUA 4LIIA 3UKQA 3SXIA 4NWZA 4HA6A 2B7RA 3SFEA 3VR9A 4OPIA 1COYA 4C3XA 4C74A 3JSKA 4B64A 1GT8A 5BULA 3H8LA 2AQJA 2EQ8A 4H4QA 4ZCDA 2F5ZA 2V3AA 3DGHA 1NHRA 2H89A 1GRTA 4X4JA 3T31A 3CNJA 3EF6A 4U8IA 4Z2RA 1ONFA 2YVJA 4GUVA 3P4QA 5TR3A 1PS9A 2WPEA 2YWLA 3NN6X 4NEWA 3QFBA 1CC2A 1JRXA 3KPKA 2R4JA 3QSMA 2WEUA 5M10A 4D03A 4H4RA 1IUUA 1S2QA 1F8WA 4OPCA 2QA1A 4Z24A 2R9ZA 5IPYA 2H88A 2XLTA 4UDRA 3SUCA 2WDRA 3UKLA 1RYIA 1H81A 4LU6A 1CL0A 4YSXA 1B4VA 4I59A 3VRAA 1N4WA 1D7LA 5U25A 3GWFA 3NRNA 1B37A 4CNJA 5KMSA 1JNRA 2CULA 3CNPA 3RP7A 2DKIA 1MXTA 4AP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1B A;  1NG4 A;  4I58 A;  4IA6 A;  2WU5 A;  2YM1 A;  4IV9 A;  4YSY A;  1JRZ A;  2C75 A;  1DJQ A;  1K4Q A;  4H4Z A;  2YVF A;  1JNZ A;  1EL5 A;  1UKV G;  4OPG A;  1H7X A;  3GD4 A;  3NIX A;  2B9X A;  2XFP A;  4IA5 A;  3AE9 A;  2DKH A;  1MO9 A;  2B9Y A;  3B6D A;  4Z43 A;  2VQB A;  3ABV A;  1ZMC A;  4H50 A;  2JBV A;  5KXJ A;  1PBE A;  2Y6Q A;  4K5S A;  2I0Z A;  3NYF A;  5KVH A;  4YTM A;  3CGB A;  3DJD A;  4USQ A;  1VG0 A;  2RGJ A;  4XWR A;  3ICR A;  2Q0K A;  2XFQ A;  4EQW A;  5FS7 A;  1JU2 A;  3ITJ A;  1HYU A;  5HYM A;  1PJ5 A;  4USR A;  3NKS A;  4MJW A;  3DJE A;  1NHQ A;  1GXF A;  2R0P A;  4GF7 A;  1LQU A;  3DME A;  2X99 A;  1S3E A;  4RG3 A;  3CNS A;  1D7Y A;  3UKF A;  4CCR A;  3FG2 P;  2TPR A;  2WET A;  1L9E A;  3C96 A;  1NDA A;  4C3Y A;  1CJ4 A;  3NTA A;  1KNP A;  5JCI A;  3UKH A;  2FBW A;  2X3N A;  2YLT A;  3K30 A;  5JCM A;  2ZZC A;  4B63 A;  5FS9 A;  4CY8 A;  3GD3 A;  3F8R A;  4N9X A;  2CVJ A;  3G5Q A;  3KVE A;  2XCG A;  2YG6 A;  1E39 A;  4H4X A;  3AEB A;  1Y56 A;  5J7X A;  3NTD A;  2VVL A;  2Z5Y A;  3IF9 A;  2GQW A;  3AE6 A;  4GRT A;  3CPH G;  4K22 A;  1CHU A;  3IHG A;  3UKP A;  2C67 A;  2E4G A;  2GAG B;  2BS3 A;  1NEN A;  4AOS A;  2XVJ A;  3AE7 A;  1L9D A;  2YR5 A;  4K5R A;  3SQP A;  2YM2 A;  2BC0 A;  2GB0 A;  3LAD A;  4M52 A;  4H2R A;  3P4S A;  3K7T A;  3SGL A;  2C3C A;  3ALJ A;  1Q1W A;  1D4C A;  5ER0 A;  5FMH A;  1SEZ A;  3NN0 X;  4A6N B;  2X50 A;  4CBQ A;  4D04 A;  2UZZ A;  1TRB A;  2WES A;  2YLW A;  4TM0 A;  4B68 A;  3LZX A;  5EB5 A;  1F8S A;  2JKC A;  4X9N A;  3L8K A;  1DJN A;  4GCM A;  5LV9 A;  2GEW A;  2A87 A;  2ARD A;  4J56 A;  4J36 A;  2J3N A;  4JN9 A;  3KLJ A;  1GRA A;  2BS4 A;  3QFA A;  1RSG A;  3S5W A;  1BKW A;  2GVC A;  4FK1 C;  1K0I A;  3QSE A;  4C77 A;  1NG3 A;  1KDG A;  4TM3 A;  1E1L A;  2B7S A;  2WS3 A;  3AXB A;  3LXD A;  4TLZ A;  4BK1 A;  3NNE A;  1M6I A;  1PXC A;  3LJP A;  4GDE A;  4REK A;  1EBD A;  2JB3 A;  2A8X A;  1IUS A;  3EAN A;  2XVF A;  1CC6 A;  4BJY A;  4O5U A;  4JNA A;  3GMB A;  2C72 A;  3IC9 A;  4OPL A;  1LPF A;  2GR1 A;  3GYJ A;  2R4E A;  2XVH A;  2C64 A;  3GRT A;  3AB1 A;  4EM3 A;  5HY5 A;  4RG4 A;  1IUT A;  4DNA A;  2V60 A;  1OJC A;  3IHM A;  3AD8 B;  3V3N A;  1GTH A;  2WHD A;  2WPF A;  2ZZ0 A;  2WOV A;  4FDC B;  4EIQ A;  3NK0 X;  4A79 A;  2YG5 A;  1AOG A;  4APN A;  2JK6 A;  4U2T A;  3RED A;  4H2N A;  4EMI A;  3V3O A;  3BI5 A;  1VQW A;  1ZK7 A;  1F8R A;  1DXL A;  3LOV A;  2WQY A;  3GDP A;  1XPQ A;  2VZ2 A;  4GDP A;  1S3B A;  2XLS A;  2Q0L A;  2BC1 A;  1FL2 A;  2BCG G;  3UOY A;  1BF3 A;  4WX1 A;  3QVR A;  5C3J A;  3RP8 A;  3ISH A;  4IVM B;  2GV8 A;  1PXB A;  4YTP A;  1Z6L A;  2YLR A;  4XWZ A;  1P2E A;  3B3R A;  2C66 A;  3BNM A;  5GSN A;  2EQ7 A;  2NPX A;  3UOX A;  3GYX A;  3GQH A;  1YY5 A;  4Y4L A;  2WP6 A;  1EL7 A;  5FS8 A;  3FBS A;  4YKF A;  2V5Z A;  2XLP A;  4JDR A;  4B65 A;  2IVD A;  2WU2 A;  4U2L A;  3F8D A;  3UTE A;  3EPT A;  1GPE A;  3UKK A;  1OJ9 A;  2XFO A;  5HHF A;  3VRB A;  2BK4 A;  2C65 A;  4BJZ A;  1TYP A;  1YQZ A;  2PHH A;  3AE1 A;  2WPC A;  3PO7 A;  1PXA A;  2XVE A;  2QAE A;  2YAU A;  1F6M A;  2GR2 A;  4H4U A;  1E7P A;  2GMH A;  3CGC A;  4PAB A;  5KOX A;  3AE5 A;  1GV4 A;  2GR0 A;  2Q6U A;  3H8I A;  4H2P A;  3QJ4 A;  4Y4N A;  1XHC A;  2YG4 A;  3DGZ A;  4U2S A;  2BK5 A;  1H83 A;  3NYE A;  4ZCC A;  2BS2 A;  1BGN A;  2V6O A;  1B5Q A;  1DNC A;  2GR3 A;  2WOW A;  3UCL A;  4P9S A;  2WP5 A;  3D1C A;  1GRG A;  3R9U A;  2EQ6 A;  4H4T A;  4EIP A;  4AT0 A;  3BI2 A;  3VQR A;  1LVL A;  4J57 A;  2R0G A;  4NZH A;  4U8O A;  1CJ3 A;  3O0H A;  3RHA A;  4BK3 A;  4YSZ A;  2XDO A;  4EQS A;  3CGE A;  4X9M A;  3AEA A;  3E1T A;  3M0O A;  2PYX A;  2BCP A;  2FJD A;  4HB9 A;  4U8L A;  1KSS A;  3AE2 A;  4OPD A;  4Z25 A;  2OLO A;  3ATQ A;  3OZ2 A;  2BAB A;  1KSU A;  3ADA B;  3GMC A;  2OAL A;  3C4N A;  4TM4 A;  4OCG A;  2QA2 A;  5BRT A;  1E1M A;  2A89 A;  2GMJ A;  3GRS A;  3NG7 X;  1YKJ A;  3RP6 A;  1FCD A;  5M0Z A;  3GYI A;  4OPT A;  3WE0 A;  4J31 A;  3BNU A;  3RNM A;  5IQ1 A;  1BZL A;  2RAB A;  1GER A;  1E1N A;  4TLX A;  4J33 A;  5EBK A;  2RGH A;  5CKU A;  3UP5 A;  4Z2T A;  1V59 A;  2IVE A;  2C3D A;  3CND A;  4KPR A;  5FS6 A;  3D8X A;  3NYC A;  4H2Q A;  4WCT A;  3UTF A;  3BHK A;  4U8N A;  1CC4 A;  3DJJ A;  4GR1 A;  1O5W A;  1GTE A;  3AD9 B;  1GRB A;  3P4P A;  3CTY A;  4XXG A;  3P1W A;  4JNQ A;  3H4K A;  1IUV A;  2QCU A;  1PJ7 A;  2R0C A;  2XLU A;  3GQK A;  3IWA A;  1H82 A;  2B76 A;  3DH9 A;  4UDQ A;  2JB1 A;  1NHP A;  2BXS A;  3NK2 X;  1ZKQ A;  4U8M A;  1O95 A;  3VR8 A;  2VRM A;  5JCK A;  2GAH B;  1XDI A;  1FOH A;  4UDP A;  3KKJ A;  4A65 A;  2OAM A;  1CJC A;  3F8P A;  4NTC A;  4CNK A;  3COX A;  3CGD A;  4EQR A;  1YQ4 A;  1CBO A;  2C73 A;  2O9Z A;  1E1K A;  1GRH A;  3KPF A;  5DBJ A;  2AR8 A;  3NLC A;  2YR6 A;  4YXD A;  1LV0 A;  1D4E A;  3SFD A;  1H84 A;  3AD7 B;  3AED A;  1K0J A;  1GRF A;  2BYB A;  1ZP0 A;  1Y0P A;  1CF3 A;  1QJD A;  5U63 A;  3HZL A;  1TDO A;  1PHH A;  2ZBW A;  2W0H A;  1VG9 A;  4U8P A;  5KRQ A;  5CQF A;  4AP3 A;  2YG7 A;  4K8D A;  4Z44 A;  2C7G A;  4DSG A;  4A6N A;  3GWD A;  4C5O A;  2X8G A;  3BI4 A;  4BUR A;  4EMJ A;  1D5T A;  1TDN A;  2WDQ A;  3CPI G;  3NHO X;  4UP3 A;  5HXI A;  1PN0 A;  4CCQ A;  3I3L A;  1BGJ A;  3CN8 A;  4OPU A;  3DK4 A;  3II4 A;  1TYT A;  3URH A;  3ICT A;  2GRT A;  3LZW A;  3M13 A;  1LJ1 A;  2VVM A;  1ZMD A;  4DGK A;  3GDN A;  4EMW A;  1LTX R;  4YT0 A;  1B8S A;  2IID A;  3BHF A;  1L0V A;  3QSS A;  2ZZB A;  4ADW A;  4U8K A;  2Q7V A;  1EL8 A;  2XFU A;  5BVA A;  3DJG X;  1D4D A;  1Q1R A;  2YR4 A;  3VRD B;  2OA1 A;  2R45 A;  1S2Y A;  1FEB A;  2YLZ A;  1ZY8 A;  4Z2U A;  2V61 A;  1PDH A;  2YG3 A;  1XAN A;  3M12 A;  4A7A A;  2BXR A;  1N4U A;  1VDC A;  3AWI A;  1ZOY A;  4NEV A;  4IVO B;  4NTE A;  1ELI A;  3KA7 A;  4A9W A;  2C70 A;  3Q9T A;  1MOK A;  1PJ6 A;  4KX6 A;  1H6V A;  5EOW A;  3EAO A;  4ZN0 A;  3KD9 A;  2BAC A;  5GRT A;  1X31 B;  1GOS A;  3T37 A;  1W4X A;  1KF6 A;  3G5R A;  2X8H A;  2WOI A;  3FIM B;  3ALM A;  1TDF A;  3CPJ G;  3UTG A;  4Z26 A;  4EQX A;  4AOX A;  1IUX A;  4J2W A;  3AYJ A;  2VQ7 A;  4Y4M A;  4BV6 A;  5KWF A;  1Q9I A;  3UOZ A;  3DA1 A;  1NEK A;  3P9U A;  4NTD A;  1GRE A;  1F3P A;  1PBB A;  1QO8 A;  3P4R A;  2BK3 A;  1Y56 B;  4JY3 A;  2YQU A;  2VVL G;  1LQT A;  3AE8 A;  1OJT A;  2EQ9 A;  3PVC A;  2FJB A;  1QLB A;  3FMW A;  3AEF A;  4FK1 A;  4JQ9 A;  4O5Q A;  4CRT A;  4H4Y A;  1KNR A;  2Z5X A;  2AAQ A;  1IUW A;  2V3B A;  1DOE A;  3I6D A;  4U8J A;  3SM8 A;  2XLR A;  2LFC A;  2CFY A;  2VOU A;  1GAL A;  3C4A A;  1BWC A;  4H4V A;  1KFY A;  5JCN A;  1H7W A;  3AE3 A;  3LB8 A;  2YVG A;  4YKG A;  5IQ4 A;  5J60 A;  3AEG A;  3NT6 A;  3OC4 A;  1CJ2 A;  1YQ3 A;  3QVP A;  1P2H A;  4BK2 A;  4RSL A;  1VRQ B;  1GND A;  2TMD A;  3FPZ A;  3K7Q X;  1GES A;  3UP4 A;  3CIR A;  1H86 A;  3L1R A;  3ICS A;  4K2X A;  2NVK X;  1FEA A;  2YLX A;  4YWO A;  1DOC A;  5JCL A;  1DOB A;  1RP0 A;  3CNT A;  4PAA A;  4YTN A;  4JY2 A;  5EB4 A;  1O94 A;  3KU9 A;  3GSI A;  4LA1 A;  3ATR A;  3ZYX A;  1NAA A;  3Q6J A;  2BA9 A;  1DOD A;  1N1P A;  2GF3 A;  2XFN A;  1JOA A;  1PBD A;  2WDV A;  1PBC A;  2RGO A;  3DK9 A;  1EL9 A;  3AEC A;  1OJA A;  2C76 A;  2CDU A;  1NHS A;  2WBA A;  4TM1 A;  3AYL A;  2VRL A;  1PBF A;  2E5V A;  1M64 A;  2XYO A;  5BUK A;  1FEC A;  5KOW A;  4E0V A;  4J34 A;  2B9W A;  1NPX A;  3AYI A;  4K7Z A;  4AT2 A;  4H7U A;  2FJE A;  3G5S A;  2X8C A;  4DSH A;  2Y6R A;  4A99 A;  3ZDN A;  1K0L A;  2JB2 A;  3PS9 A;  2HQM A;  1ZDL A;  1GSN A;  2YLS A;  3ALL A;  1OJD A;  1REO A;  1IJH A;  3AE4 A;  4ICY A;  1N4V A;  5KVI A;  4OVI A;  4B67 A;  1ZOV A;  3AEE A;  2FJA A;  4FX9 A;  5L46 A;  4H4P A;  1E6E A;  1JRY A;  4B69 A;  3DK8 A;  2XVI A;  3UKA A;  5C2T A;  3UTH A;  4YSH A;  3NK1 X;  1GET A;  4CY6 A;  5U1O A;  1TDE A;  3NH3 X;  4B66 A;  1JEH A;  2JAE A;  3K7M X;  2ACZ A;  2WP9 A;  2APG A;  2OLN A;  3NGC X;  4EM4 A;  4A5L A;  3V76 A;  2GQF A;  2GH5 A;  4H4S A;  2R46 A;  4ECH A;  3UOV A;  1TDK A;  4H4W A;  1ZX9 A;  1L9C A;  2E1M A;  3S61 A;  1GEU A;  4LII A;  3UKQ A;  4HA6 A;  2B7R A;  3SFE A;  3VR9 A;  4OPI A;  1COY A;  4C3X A;  4C74 A;  3JSK A;  4B64 A;  1GT8 A;  5BUL A;  3H8L A;  2AQJ A;  2EQ8 A;  4H4Q A;  4ZCD A;  2F5Z A;  2V3A A;  3DGH A;  1NHR A;  2H89 A;  1GRT A;  4X4J A;  3CNJ A;  3EF6 A;  4U8I A;  4Z2R A;  1ONF A;  2YVJ A;  4GUV A;  3P4Q A;  5TR3 A;  1PS9 A;  2WPE A;  2YWL A;  3NN6 X;  4NEW A;  3QFB A;  1CC2 A;  1JRX A;  2R4J A;  3QSM A;  2WEU A;  5M10 A;  4D03 A;  4H4R A;  1IUU A;  1S2Q A;  1F8W A;  4OPC A;  2QA1 A;  4Z24 A;  2R9Z A;  5IPY A;  2H88 A;  2XLT A;  4UDR A;  3SUC A;  2WDR A;  3UKL A;  1RYI A;  1H81 A;  4LU6 A;  1CL0 A;  4YSX A;  1B4V A;  4I59 A;  3VRA A;  1N4W A;  1D7L A;  5U25 A;  3GWF A;  3NRN A;  1B37 A;  4CNJ A;  1JNR A;  2CUL A;  3CNP A;  3RP7 A;  2DKI A;  1MXT A;  4AP1 A; 
#chains in the Genus database with same CATH topology
 2LRL A;  4IA6 A;  4YSY A;  1JRZ A;  4E7Z A;  2F4V T;  3HKD E;  3ZCJ A;  1JNZ A;  1UKV G;  4OPG A;  2A9U A;  2I0M A;  5L4H A;  5CGM A;  2VL0 A;  3PUQ A;  2Q9Q A;  3P7I A;  4EZ4 A;  4TWD A;  4B3S T;  5AQJ B;  3PUX F;  2IUB A;  3ABV A;  3RI5 A;  3J7Y q;  2JMH A;  5L47 A;  2V5D A;  5LG3 A;  3EAB A;  2BRA A;  5HWX A;  2I0Z A;  4UXN B;  4USQ A;  1VG0 A;  2RGJ A;  4KI0 F;  1HYU A;  2XTL A;  4OHF A;  2W62 A;  3DJE A;  3P50 A;  2R0P A;  2QA7 A;  4COF A;  4H9N C;  1LVK A;  4RG3 A;  3CNS A;  1D7Y A;  3IF8 B;  4X66 T;  3ONX A;  5HCM A;  5HEU A;  2CXD A;  4QH5 A;  4C3Y A;  4GK0 E;  1PIV 4;  1CJ4 A;  4QX8 B;  5JCI A;  4IE7 A;  3EDU A;  2X3N A;  2IC6 A;  5BR8 T;  2MPK A;  4N9X A;  3G5Q A;  1IJ5 A;  2YG6 A;  3SZF A;  2J1D G;  4H4X A;  2ZM2 A;  4OX9 T;  4B3M T;  2GQW A;  2PTF A;  5LHI B;  5AQV B;  4K22 A;  3CPH G;  3IHG A;  4K0K T;  1RVF 4;  2BS3 A;  3PJA J;  2YR5 A;  4K5R A;  3HR0 A;  2BC0 A;  2C3C A;  4GB3 4;  1D4C A;  5FMH A;  1OED A;  4O4H E;  5JTG A;  2BBJ A;  2X50 A;  4D04 A;  2HWC 4;  1TRB A;  2WES A;  4B68 A;  4X9N A;  5JQG E;  4P0A A;  3L8K A;  3R6N A;  5LV9 A;  1IJ6 A;  2ARD A;  4QXH B;  4JN9 A;  2BS4 A;  3QFA A;  1RSG A;  4WZX A;  1NG3 A;  4CN6 A;  3WI3 A;  3PUA A;  1E1L A;  2WS3 A;  3AXB A;  4II3 A;  3TLW A;  3NNE A;  1M6I A;  2A8X A;  5C8Y E;  3EAN A;  2XVF A;  4BJY A;  2BG9 C;  3AA6 B;  4PK6 A;  1XHX A;  2GR1 A;  3GYJ A;  3KDS E;  3I0O A;  4HFV A;  3SOL A;  1OJC A;  3B13 A;  1GTH A;  4A5X A;  3RIU C;  4EIQ A;  2KLQ A;  1AL2 4;  3LK3 B;  2VVN A;  4LML A;  3H3M A;  4U2T A;  1XDO A;  3BI5 A;  2CMR A;  1AR6 4;  1F8R A;  2CLY C;  1S3B A;  2XLS A;  5M4Y A;  1FL2 A;  3UOY A;  4JEU B;  1BF3 A;  4YTP A;  1P2E A;  4NPP A;  2LSJ A;  4JUY A;  1J1J A;  3GN5 A;  5E0O A;  1EL7 A;  5FS8 A;  3NVO A;  2WU2 A;  3F8D A;  3UTE A;  2BG9 B;  2XQ7 A;  4UF0 A;  4X1I E;  4I43 B;  3OPC A;  2BK4 A;  5AQO B;  1PXA A;  2QAE A;  4LF7 T;  5LGU B;  4H4U A;  3CGC A;  4ILC A;  5ABF A;  3ZST A;  2XQ4 A;  4H9R C;  3ETV A;  4G9K A;  3UQ4 A;  4JLE A;  4H2P A;  4Y4N A;  1XHC A;  3DGZ A;  4U2S A;  2BK5 A;  3LFM A;  1BGN A;  4OYJ A;  2V6O A;  1IBM T;  2WP5 A;  4I0U A;  3D1C A;  1XZY A;  1IAP A;  3BI2 A;  1LVL A;  4BK3 A;  1VBB 4;  2YDR A;  3OYX A;  4X5T A;  3E1T A;  4E7S A;  2PYX A;  4U8L A;  1MMG A;  4PK5 A;  1V9D A;  4H63 H;  5AQN B;  4UR9 A;  3AVR A;  2BAB A;  3EI0 A;  2X9W A;  2OAL A;  4DR5 T;  2QA2 A;  4GYS A;  2X9Y A;  1E1M A;  2GMJ A;  3GRS A;  2IDO B;  4RHV 4;  2YDS A;  5M0Z A;  2XAQ B;  5L3E B;  2KIN B;  1UCU A;  2RAB A;  2XQ3 A;  3AVS A;  5CKU A;  1V59 A;  4DV2 T;  2NP9 A;  2V7I A;  3U78 A;  3D8X A;  3NYC A;  4HWI B;  3FBZ A;  2XSB A;  4DV0 T;  3ONJ A;  1US7 B;  3AD9 B;  1OED E;  1GRB A;  3CTY A;  4XXG A;  4JNQ A;  1IUV A;  2QCU A;  1FMV A;  4HEA A;  3DH9 A;  4ZHQ E;  2JB1 A;  3N2K E;  1NHP A;  2E9X A;  1ZKQ A;  3LBX B;  3NK2 X;  5GON E;  1O95 A;  2XQ5 A;  3VR8 A;  5HEO A;  2DNX A;  5JCK A;  2GAH B;  2YOE A;  3K3Q C;  3MK7 C;  3KKJ A;  4UIG A;  4TWF A;  2L8K A;  3CKD A;  4WNK A;  1N34 T;  2O9Z A;  4YLH A;  2V8S V;  1YKH B;  2CM0 A;  3CVR A;  3RIF A;  5LGN B;  3E0Z A;  3SFD A;  3AD7 B;  1Y0P A;  5U63 A;  1RUG 4;  2UXN B;  2UU9 T;  1VG9 A;  2V7L A;  5KRQ A;  1YD8 G;  4Z44 A;  4DSG A;  2CE7 A;  1D5T A;  2WDQ A;  3LJC A;  5JVD E;  5CJ5 A;  3II4 A;  1TYT A;  4EIW A;  4GKJ T;  3TLT A;  1S94 A;  1LTX R;  2LEH A;  4YT0 A;  4AKI A;  4GIW A;  2IHR 1;  2Q7V A;  4BJM A;  4CQI A;  2XFU A;  5HEJ A;  4TUY E;  2YR4 A;  4I4T E;  1RHI 4;  4A7A A;  2LKG A;  3AWI A;  1ZOY A;  4IVO B;  3AXJ B;  1MMA A;  2C70 A;  3Q9T A;  4DV1 T;  1H6V A;  3AAI A;  5AQH B;  5GRT A;  1X31 B;  3N9L A;  1KF6 A;  2CEA A;  2XHE B;  2WOI A;  3FIM B;  3ZKR A;  2WCA A;  3UTG A;  4Z26 A;  4JBW F;  2PBI A;  4J2W A;  4DID B;  1QUU A;  3AYJ A;  1FJG T;  4ZI2 D;  1GRE A;  2V6Y B;  4DND A;  3B57 A;  3RKO A;  4Z8X A;  4TN7 B;  2EQ9 A;  2K48 A;  1MNE A;  4YJ3 E;  2WY2 A;  2VKO A;  2AE9 A;  2VQE T;  3SM8 A;  3I6D A;  4QXB B;  2CFY A;  4H4V A;  5L3G B;  5JCN A;  2IIU A;  3AE3 A;  3T1Y T;  5L3C B;  3CK6 A;  5DAB A;  3ZYK A;  4PK4 A;  4BK2 A;  1HX1 B;  2ODU A;  2BG9 E;  1GND A;  1UUR A;  5AQG B;  4Q4W 4;  2ZM6 T;  4YWO A;  1MQT D;  4YTN A;  3N9N A;  4F8H A;  4IE0 A;  3ZT7 A;  2ZM0 A;  5HXS A;  3ZYX A;  4TZ4 C;  2MOZ A;  1DOD A;  2GF3 A;  4GAV A;  2WDV A;  2JJ9 A;  2Y8D A;  4TM1 A;  4ASK A;  1PBF A;  3PU8 A;  2E5V A;  5LHH B;  5BUK A;  3AYI A;  3KFW X;  3G5S A;  4JI5 T;  3PS9 A;  3W15 B;  2HQM A;  4ICY A;  2RS1 4;  2N2N A;  3KIN B;  5JR9 C;  3OYZ A;  1XHZ A;  2VL8 A;  1N36 T;  4QHO A;  2XVI A;  4CY6 A;  5U1O A;  4B66 A;  2VKD A;  2XAG B;  2ACZ A;  2QVA A;  4PFP A;  4A5L A;  3V76 A;  4YY3 T;  4ZZC A;  5AQS B;  4L5G A;  4H4S A;  4U74 A;  4L9I A;  3UOV A;  4H4W A;  3JD7 4;  2E1M A;  3S61 A;  3RYH E;  4LII A;  2CA5 A;  3UUN A;  3SFE A;  3VR9 A;  4C3X A;  3JSK A;  1GT8 A;  2AQJ A;  1HF8 A;  2VWA A;  5FL1 A;  2YN6 A;  3DGH A;  3T8O A;  1NHR A;  4MHC A;  4X4J A;  4Z2R A;  2VK9 A;  4U31 A;  2WPE A;  3NN6 X;  2X68 A;  3QFB A;  5HXE A;  2WB5 A;  5M10 A;  2JQK A;  4D03 A;  2QA1 A;  1X9B A;  2XLT A;  1H81 A;  4C90 A;  2CHO A;  1POV 0;  4YSX A;  1WLX A;  1B4V A;  1N4W A;  5JDG A;  1D7L A;  5U25 A;  3GWF A;  3PTR B;  5KMS A;  2CUL A;  3RP7 A;  2DKI A;  2W0G A;  4B1B A;  1NG4 A;  4K0U A;  4DV7 T;  2PYL A;  2XQA A;  1T7S A;  2YM1 A;  4IV9 A;  2C75 A;  1WYB A;  3ETU A;  2XM1 A;  3A8Y C;  1EL5 A;  1H7X A;  3GD4 A;  2XY8 B;  2NOX A;  2XFP A;  2RPA A;  3QOF A;  4JI8 T;  1UUS A;  1MO9 A;  2B9Y A;  2VQB A;  4H50 A;  5EK2 A;  2PJQ A;  2Y6Q A;  2CPT A;  2LM2 A;  4YTM A;  3CGB A;  4XWR A;  3B5M A;  4U33 A;  2Q0K A;  1SHZ C;  2UUA T;  2G0U A;  4PJL A;  1PO2 4;  4KP3 C;  5JRE A;  1PJ5 A;  4G2A A;  3NKS A;  2LSI A;  3UU4 A;  4USR A;  2ACX A;  3MAC A;  1XMQ T;  4GF7 A;  1LQU A;  3DME A;  1S3E A;  4CCR A;  3UKF A;  1OOP D;  2QGS A;  4UVA B;  3UU6 A;  3NTA A;  2LHN A;  3PUG A;  3UKH A;  3NZP A;  3K30 A;  2V26 A;  4DR6 T;  5JCM A;  2DL1 A;  2W4X A;  2MBG A;  2WBL A;  1OXZ A;  3P8C D;  2CCQ A;  4NUU A;  3AAA B;  5EK4 A;  2JMK A;  4AQY T;  3NTD A;  2VVL A;  2Z5Y A;  3KV4 A;  4DMW A;  1CHU A;  2J4G A;  2XQ8 A;  2D9D A;  2GAG B;  1NEN A;  4LF8 T;  5IYZ E;  4AOS A;  3AE7 A;  1L9D A;  3ZMZ B;  2RA1 A;  2YM2 A;  4C91 A;  4M52 A;  3P4S A;  4MFR A;  3N9Q A;  4CI2 B;  4L0R A;  5FVL A;  4UV9 B;  4EXT A;  2JPF A;  4A6N B;  1VBA 4;  4DBQ A;  3KV9 A;  1FMW A;  4HWF A;  4JYA T;  4U7Y A;  4TM0 A;  2YLW A;  4ZEY A;  3LZX A;  1F8S A;  4QH4 A;  2IW5 B;  4ZI2 C;  2GEW A;  2J3N A;  1GRA A;  1WR6 A;  3S5W A;  3EUH A;  5ABE A;  2GVC A;  4FK1 C;  3GMI A;  4TM3 A;  3HKC E;  2CWO A;  4HFC A;  3OBV E;  4PNI A;  4REK A;  4GDE A;  3ZMV B;  2JB3 A;  1IUS A;  4X65 T;  4JNA A;  4OPL A;  4ZS2 A;  2R7F A;  3GRT A;  3AB1 A;  4EM3 A;  5HY5 A;  1M7K A;  2W67 A;  2X9H A;  4DNA A;  2V60 A;  2P9B A;  3U3I A;  3CMM A;  3AD8 B;  2WHD A;  2WOV A;  2NW8 A;  3NK0 X;  4A79 A;  1AOG A;  2Q9Q B;  4AKL A;  1VQW A;  4CXX A;  1DXL A;  2BZB A;  2X0Y A;  4CXY A;  2Q0L A;  5JRC A;  2V7K A;  2BC1 A;  4LFA T;  4HGA A;  2D0T A;  4WX1 A;  1J5W A;  2VKJ A;  4IVM B;  1Z6L A;  1RMU 4;  3B3R A;  4FI5 A;  1MND A;  2C66 A;  5GSN A;  2EQ7 A;  3UOX A;  2YIN A;  4H9S E;  1YY5 A;  4M1P A;  1HNZ T;  1W9R A;  4YKF A;  4JDR A;  3T2Y A;  3ZPO A;  5F3J A;  3ANW B;  3FZL B;  3PDY A;  4P0B A;  3VRB A;  2WM9 A;  1TYP A;  2PHH A;  3AE1 A;  2XVE A;  5JH7 E;  2GMH A;  1HG2 A;  2OV9 A;  4PAG A;  2VQF T;  2Q6U A;  3H8I A;  2EHO C;  4EB6 E;  2YG4 A;  5EZY E;  1H83 A;  3K1S A;  4ZCC A;  2BS2 A;  1B5Q A;  3TLS A;  3UQ7 A;  3MKD A;  1DNC A;  2WOW A;  3UCL A;  5LYJ E;  1XDP A;  3R9U A;  3QNU A;  2YEV C;  3IBP A;  3VQR A;  2CRB A;  1CJ3 A;  3O0H A;  3RHA A;  4EQS A;  5CFB A;  1T8B A;  3M0O A;  4TX5 A;  4P09 A;  2BCP A;  2FJD A;  1FEW A;  2W66 A;  2OLO A;  3RYC E;  2YU1 A;  1KSU A;  3GMC A;  1AR8 4;  3C4N A;  4OCG A;  4IRE A;  1AR7 4;  3NG7 X;  2A89 A;  3GA8 A;  2KWH A;  4WW0 A;  2VKH A;  4J31 A;  3LK4 2;  3BNU A;  3QB5 A;  3RNM A;  2VUR A;  4IL9 A;  4H63 V;  3UFE A;  3UP5 A;  5LHG B;  1T98 A;  4IE6 A;  2IVE A;  3CND A;  2WWV A;  5FS6 A;  1R8I A;  3OKQ A;  2EHO B;  4HE8 A;  3UTF A;  3BHK A;  4U8N A;  1O5W A;  3O1H A;  5LCY A;  1GTE A;  3PJA A;  2C4C A;  3H4K A;  3GQK A;  2XLU A;  2OLT A;  4KHP T;  1H82 A;  2B76 A;  3IWA A;  5AQT B;  5EK3 A;  4AQF C;  2MTQ A;  2JQ9 A;  2YKS A;  4NTC A;  2UXX B;  4EQR A;  3AA0 B;  1CBO A;  1E1K A;  3KPF A;  5L3F B;  3NLC A;  4YXD A;  1LV0 A;  1D4E A;  1K0J A;  1GRF A;  1CF3 A;  1QJD A;  5CA1 E;  2LKH A;  1TDO A;  3K8P C;  4J2C A;  2YG7 A;  3F57 A;  4BUR A;  5HXI A;  1TDN A;  3CPI G;  5AQL B;  1PN0 A;  4CCQ A;  4X62 T;  4GAP A;  4GOU A;  3C4X A;  3HYW A;  3ZYL A;  4O4I E;  2PZS A;  5FYM A;  3M13 A;  4UF0 B;  2W63 A;  4O2A E;  2VVM A;  4DGK A;  4EMW A;  4ADW A;  1B8S A;  2ZZB A;  4U8K A;  1EL8 A;  5BVA A;  1D4D A;  1PVC 4;  5ABG A;  3VRD B;  1NA1 D;  2H7O A;  1S2Y A;  1D0Y A;  1ZY8 A;  4OFZ A;  2YG3 A;  5FNV E;  3UFG A;  1N4U A;  1VDC A;  3KA7 A;  3QUJ A;  4ZXL A;  3HA4 A;  3RPU A;  4ZN0 A;  3RH3 A;  3KD9 A;  3T37 A;  3T2K A;  1W4X A;  1N32 T;  5H6R B;  3CPJ G;  3RC3 A;  2C0S A;  2LHR A;  4EQX A;  2PYJ A;  2JQQ A;  2VQ7 A;  2N9D A;  4HTE A;  1Q9I A;  5HEG A;  4DR4 T;  3DA1 A;  1NEK A;  4DUY T;  2LSG A;  1I94 T;  2JRK A;  1IBK T;  4JY3 A;  3NZQ A;  1Y56 B;  3KVB A;  2YQU A;  1HR0 T;  1PO1 4;  2BKN A;  1LQT A;  5DQW A;  1OJT A;  3PVC A;  1QLB A;  5FP3 A;  4JQ9 A;  4CRT A;  4YJ2 E;  1IUW A;  2V3B A;  1DOE A;  2XLR A;  4IDP A;  3UT5 E;  2VOU A;  1GAL A;  3C4A A;  4U7I A;  2BG9 A;  4U2Y A;  3AEG A;  4H9O C;  3PUY F;  1CJ2 A;  5IHY A;  2RS5 4;  2ES0 A;  4II2 A;  4RSL A;  3CIR A;  1H86 A;  3L1R A;  4K2X A;  2PW9 A;  5JCL A;  1DOB A;  2KND A;  1RP0 A;  1D4M 4;  5EB4 A;  3RIU A;  3GSI A;  1VRB A;  2WWU A;  1NAA A;  5HWY A;  3Q6J A;  1W0B A;  5HAX A;  1PBD A;  2CDU A;  1SA0 E;  2R07 4;  2XYO A;  5KOW A;  4E0V A;  5HXC A;  5KMR A;  1HRV 4;  2B9W A;  4H7U A;  2Y6R A;  5AFU L;  3ZDN A;  1HRI 4;  1ZDL A;  1GSN A;  4DR1 T;  1OJD A;  1REO A;  1IJH A;  1N4V A;  2CXF A;  1KEY A;  5J2T E;  4B69 A;  1XNQ T;  3DK8 A;  3UTH A;  5C2T A;  4OYK A;  4YSH A;  4PW8 A;  3PUS A;  1TDE A;  1JEH A;  3K7M X;  5KMQ A;  2APG A;  2OA5 A;  4EM4 A;  4UVC B;  2C5J A;  3OJA A;  2GH5 A;  2R04 4;  1HNX T;  4ECH A;  3BQI A;  2NW7 A;  3N9M A;  4ILB A;  3RX6 A;  3SXI A;  2QYW A;  2B7R A;  4OPI A;  3UUL A;  4C74 A;  4X1Y E;  3H8L A;  3RGL A;  4A56 A;  2FUP A;  2HWB 4;  5J0Z A;  3RIA A;  2YU2 A;  1RUE 4;  2YWL A;  2HPL A;  3KPK A;  4MAL A;  3LBX A;  1IBL T;  5JDQ A;  1IUU A;  4HFD A;  2I59 A;  2R9Z A;  3MZK B;  1EAH 4;  3T1H T;  5LMU T;  4HFI A;  3VRA A;  4I59 A;  4Z90 A;  2UXB T;  3NRN A;  1JNR A;  4AP1 A;  4ANJ A;  1MIY A;  2WU5 A;  2NWB A;  1LVF A;  1VCS A;  2Q9Q D;  2YVF A;  4LMJ A;  2NR4 A;  4G73 A;  3KV6 A;  2XQY A;  2L3L A;  4BJN A;  2LE8 A;  3NBX X;  2DKH A;  3B6D A;  4IST A;  1ZMC A;  4O4L E;  1PBE A;  2XJ7 A;  5F8P A;  5BMV E;  5FVK A;  3IHR A;  3JAF A;  4K5S A;  2X5I D;  1Z0P A;  5KVH A;  3TKL B;  3DJD A;  4JEH B;  4TV9 E;  2XFQ A;  2W00 A;  5HYM A;  2NW9 A;  4MJW A;  1NHQ A;  5FY1 A;  4QWN B;  3AXJ A;  1EZ3 A;  2ZLY A;  5TAO A;  3FG2 P;  2TPR A;  2WET A;  3RRC A;  2C5I T;  3DJB A;  1L9E A;  1Y64 B;  5L3D B;  3C96 A;  4FJO A;  2B1E A;  2FBW A;  2LJL A;  3GD3 A;  2CHN A;  3SZ0 A;  4MLK A;  4JI1 T;  3V5U A;  2V6Y A;  2LSY A;  4AXP A;  5ETW A;  3AE6 A;  3MXZ A;  4AI6 A;  2E4G A;  2ODV A;  1GQE A;  1SUM B;  2XVJ A;  3JAE A;  2W61 A;  2XAH B;  4JI3 T;  3VHL A;  4DMV A;  2GB0 A;  3JC6 C;  3LAD A;  4H2R A;  2KXP B;  4UV8 B;  3K7T A;  1RUI 4;  1YXR A;  3HL6 A;  1Q1W A;  1SEZ A;  3NN0 X;  3NRY A;  4IGU A;  5FMN A;  4CBQ A;  3RYF E;  4CXW A;  1S35 A;  1G8X A;  4O4J E;  2PG8 A;  2UZZ A;  5EB5 A;  2JKC A;  1DJN A;  4GCM A;  3UTK A;  2DHR A;  2A87 A;  4J56 A;  1BKW A;  4JI4 T;  2J62 A;  3L39 A;  2EHO D;  4ZI3 C;  1KDG A;  2B7S A;  2E2A A;  4BK1 A;  2VB6 A;  3R84 B;  2XQ9 A;  3AAE B;  5AQM B;  3SYI A;  5HXH A;  3GMB A;  2C72 A;  4Q4X 4;  3IC9 A;  2J47 A;  2PFV A;  1LPF A;  3O9X A;  2R4E A;  1H7C A;  2BVL A;  1ASJ 4;  2X51 A;  5H6Q B;  4QX7 B;  1IUT A;  5AQR B;  2K24 A;  2D2S A;  2HH7 A;  3IHM A;  3V3N A;  1WRD A;  3K3N A;  3BQK A;  1LKX A;  2R6G F;  2ZZ0 A;  2YG5 A;  1D1C A;  2Z6E A;  4CZZ B;  2JK6 A;  4IDZ A;  3RQW A;  4EMI A;  2X67 A;  3ZC1 A;  4H2N A;  3JBG 4;  2M67 A;  3LOV A;  2WQY A;  1XPQ A;  2VZ2 A;  4HFB A;  3ZJ2 A;  4U72 A;  1COV 4;  4UVB B;  3ZMU B;  3ZSS A;  2KSR A;  3QVR A;  2E8I A;  2VVS A;  5C3J A;  3ISH A;  2GV8 A;  4CN1 A;  1PXB A;  2YLR A;  4Q4V 4;  4DO0 A;  2NPX A;  4ZS3 A;  4LF6 T;  2YDQ A;  3ONL C;  2JQH A;  4B65 A;  2C5K T;  2IVD A;  4U2L A;  2UUC T;  1GPE A;  4F6R C;  2XFO A;  1HX8 A;  2NTX A;  1D0Z A;  3ZJ1 A;  2C65 A;  3PUW F;  5LGT B;  1YQZ A;  2WPC A;  1WYC A;  1DU2 A;  5JR9 A;  2YAU A;  1F6M A;  2GR2 A;  4AIS A;  4PAB A;  3AA7 B;  1E1H B;  1ZHC A;  1IZN B;  5CB4 E;  2GR0 A;  4HFE A;  3QJ4 A;  5LJM A;  5AQQ B;  4G63 A;  5J2U E;  1XMO T;  3CML A;  3NYE A;  2GR3 A;  4QKN A;  3LSV A;  4P9S A;  4PJN A;  1GRG A;  1FIO A;  4NZH A;  3FZM B;  1YW0 A;  4YSZ A;  5FXV A;  3CGE A;  4X9M A;  2BKP A;  3AEA A;  3SY4 A;  5KMG P;  4AKG A;  1QSD A;  4OPD A;  3ATQ A;  1ZKE A;  3OZ2 A;  3ADA B;  4A98 A;  1YKJ A;  3RP6 A;  5CA0 E;  4JV5 T;  1FCD A;  4YHH T;  2N1G A;  4EV6 A;  4OPT A;  2QRX A;  2W2U A;  5AQI B;  5IQ1 A;  3LG7 A;  2BRY A;  4TLX A;  4CI3 B;  4J33 A;  5EBK A;  3PE0 A;  1ZV4 X;  4HWD A;  2C3D A;  2Q9Q C;  3H37 A;  5ADX L;  2H7V C;  1YKE B;  4G74 A;  1CC4 A;  3MA9 A;  4HN9 A;  1XI1 A;  2A2F X;  3P1W A;  4NIQ A;  4IDO A;  2BXS A;  1LRZ A;  2KT9 A;  2VRM A;  5JDL A;  4DV4 T;  1XDI A;  1NAF A;  2OAM A;  4CNK A;  3COX A;  4EYU A;  3GWH A;  1YQ4 A;  3E22 E;  3RC8 A;  2C73 A;  5DBJ A;  2M6I A;  4XBF B;  1VBE 4;  3N9P A;  2DI4 A;  4HWH A;  3CX8 B;  3KV5 A;  3WAK A;  1H84 A;  2BYB A;  1ZP0 A;  1AJ3 A;  3EHZ A;  3HZL A;  5JRC B;  4U8P A;  2XZE A;  4YFS A;  4AP3 A;  4TWH A;  4A6N A;  3ZC0 A;  3GWD A;  4C5O A;  3BI4 A;  4UP3 A;  1U4Q A;  1BGJ A;  3CN8 A;  4OPU A;  2Y6X A;  3DK4 A;  4ERR A;  3URH A;  3ICT A;  4ILA A;  3LZW A;  2V1D B;  3UUB A;  2V7J A;  1LJ1 A;  3CX6 B;  1D0X A;  3GDN A;  3BHF A;  1L0V A;  2ZMA A;  3DJG X;  1Q1R A;  4TNV A;  1RUJ 4;  2RS3 4;  2OA1 A;  3G06 A;  3V5S A;  3K3O A;  1FEB A;  2YLZ A;  4G6G A;  2V61 A;  1PDH A;  1XAN A;  4UEL A;  5IUX A;  1VOM A;  3ZLI A;  2BXR A;  1T72 A;  1HNW T;  5LJN A;  1MOK A;  5EOW A;  4MBQ A;  2E5L T;  3UUX B;  1GOS A;  5FY7 A;  3C4W A;  4CI1 B;  4IIJ E;  4ZOL E;  3T0K A;  3IA3 A;  2MYS A;  3I0Q A;  3SZW A;  4AOX A;  4B3T T;  4HFH A;  2HPJ A;  4AKR B;  4BV6 A;  5KWF A;  3UOZ A;  5A1L A;  3P9U A;  2D5U A;  5JDH A;  1PBB A;  3P4R A;  5KX5 E;  4LFC T;  3AE8 A;  3N2G E;  2FJB A;  4FK1 A;  3CWZ B;  4LF5 T;  4H4Y A;  3J8F 4;  2AAQ A;  3Q2M A;  2XAJ B;  4LFB T;  2D0U A;  1K5M D;  1BWC A;  1KFY A;  1H7W A;  3LB8 A;  5IQ4 A;  4KUM B;  4NXN T;  3NT6 A;  3ANW A;  3OC4 A;  4EEB A;  2X0L B;  1RUC 4;  1YQ3 A;  2I6H A;  1VRQ B;  4V1A v;  2TMD A;  4IE4 A;  3K7Q X;  4GKK T;  1OED B;  3UP4 A;  3ICS A;  2YLX A;  4TNW A;  1DOC A;  3P4W A;  4PAA A;  3DTO A;  4JY2 A;  3Q5X A;  3KU9 A;  4HWC A;  3ATR A;  1HG5 A;  3EAM A;  2BA9 A;  1N1P A;  2XFN A;  1JOA A;  1EL9 A;  3AEC A;  5HEH A;  1NHS A;  2WBA A;  1VCT A;  2VRL A;  4JI2 T;  1M64 A;  1FEC A;  5JDN A;  3FZH B;  4K7Z A;  2X8C A;  3ZYM A;  4A99 A;  1N33 T;  1K0L A;  3PU3 A;  1MMN A;  3SRZ A;  4OVI A;  4B67 A;  1ZOV A;  3AEE A;  4FX9 A;  4EAH A;  3FBL A;  1JRY A;  4HKA A;  2RM2 4;  2XAF B;  2JAE A;  1KK7 A;  1UK5 A;  4ISS A;  3NGC X;  5HXR A;  3ZMT B;  3FXE B;  3L3P A;  2GQF A;  4G6H A;  4JI7 T;  1ZX9 A;  1L9C A;  1OWA A;  3UKQ A;  1HXS 4;  4NWZ A;  2CBI A;  2A3D A;  4B64 A;  2EHO A;  5BUL A;  4PFO A;  3WAJ A;  4H4Q A;  2V3A A;  3GN5 B;  2PY5 A;  2H89 A;  3T31 A;  3CNJ A;  3EF6 A;  4U8I A;  4KHZ F;  3ZT6 A;  1ONF A;  2YVJ A;  4GUV A;  3P4Q A;  3QK6 A;  5TR3 A;  3Q5D A;  1VBD 4;  1JRX A;  3J9X 1;  2R4J A;  2YK0 A;  2WEU A;  4H4R A;  1S2Q A;  1ZEE A;  1HFA A;  3FI7 A;  4N78 D;  3UUM A;  2X66 A;  3SUC A;  2WDR A;  3UKL A;  4LU6 A;  1CL0 A;  3O1J A;  4GK5 E;  3X1D A;  3BK9 A;  5ABF B;  2DWK A;  1B37 A;  3AA1 B;  4CNJ A;  3CNP A;  1MIW A;  5IWA T;  4WBN E;  2V7M A;  3CX7 B;  3EDV A;  3FXD B;  3F2E A;  2XSA A;  2KZ7 B;  2RP4 A;  4I58 A;  4PDW D;  3CPZ A;  3JC6 D;  3C98 B;  1DJQ A;  1K4Q A;  4X20 E;  4H4Z A;  1R08 4;  3TLU A;  3O4X E;  4XAX B;  3KBU A;  3NIX A;  2B9X A;  2WZI A;  4IA5 A;  2E9X C;  5ABH A;  1AR9 4;  3AE9 A;  3OTO T;  4IT4 A;  4Z43 A;  4DVD A;  2JBV A;  5KXJ A;  3ZMS B;  2DLR A;  4IDQ A;  3NYF A;  3N2O A;  4JI0 T;  4ZI3 D;  5KMP A;  5AQU B;  4CN4 A;  1HTJ F;  4AQF A;  3ICR A;  3RF1 A;  4EQW A;  1W0A A;  5FS7 A;  2H3R A;  1JU2 A;  3ITJ A;  2IML A;  3FHN A;  1GXF A;  1R09 4;  3L09 A;  3HKB E;  1G73 A;  2X99 A;  5KNL A;  1J5E T;  2M6B A;  2CLY B;  1NDA A;  3FZK B;  1KNP A;  4TV8 E;  3EVY A;  3C64 A;  4KMC A;  5L2L A;  1XWM A;  3UU5 A;  3BQL A;  2YLT A;  2ZZC A;  4B63 A;  5FS9 A;  4CY8 A;  3F8R A;  2CVJ A;  1RUD 4;  3KVE A;  4XZC A;  2XCG A;  1E39 A;  2E9X B;  2KMF A;  3AEB A;  1BR1 A;  3Q5E A;  4I50 E;  1Y56 A;  5J7X A;  1KNZ A;  3IF9 A;  4IE5 A;  4DBR A;  4GRT A;  5LB7 B;  4ILU A;  5LOV E;  2C67 A;  3UKP A;  4EZH A;  3SS1 A;  1RUH 4;  4O2B E;  5KDM C;  3SQP A;  4Q4Y 4;  4IL4 A;  4U2Z A;  2A72 A;  3SGL A;  3FZF B;  3T14 A;  3ALJ A;  3RKG A;  5ER0 A;  1BEV 4;  1XNR T;  1O3X A;  5LP6 E;  4LF4 T;  2X0H A;  3ZN0 B;  2LOP A;  2XAS B;  4LF9 T;  4J36 A;  3KLJ A;  4A97 A;  3I9Y A;  4C77 A;  1K0I A;  3QSE A;  3LXD A;  2BBH A;  4TLZ A;  3LJP A;  2Y48 B;  1PXC A;  3HYV A;  1BR4 A;  1EBD A;  1CC6 A;  1CUN A;  4O5U A;  2XVH A;  2C64 A;  2XM2 A;  4DR3 T;  2RMU 4;  4RG4 A;  2WSS V;  5DQV A;  3VKH A;  3ZEF B;  1BR0 A;  5F5W A;  1SE7 A;  3D0T A;  4X1K E;  3A5X A;  3UU3 A;  2CWY A;  2WPF A;  4FDC B;  2IAK A;  3SWH A;  4APN A;  3QB5 K;  3RED A;  3V3O A;  4AQG A;  4DUZ T;  1ZK7 A;  2KWI B;  3PUV F;  4NNJ A;  3GDP A;  4GDP A;  1Z7S 4;  5HCJ A;  5LMN T;  4P1N A;  4WBO A;  5FKY A;  2BCG G;  1HCI A;  4EYY R;  5LBQ B;  3NRX A;  3RP8 A;  4XWZ A;  4ZZB A;  2WZH A;  3JCF A;  3BNM A;  3GQH A;  2LRK A;  3GYX A;  4Y4L A;  2WP6 A;  3FBS A;  2V5Z A;  2XLP A;  4QH1 A;  3NKZ A;  5LA6 E;  5LNK A;  3EPT A;  1UGO A;  5FXZ A;  3UKK A;  1OJ9 A;  3AB3 B;  5HHF A;  4BJZ A;  3PO7 A;  3RLF F;  3CQX C;  1E7P A;  5KOX A;  3AE5 A;  4ZI7 E;  4DV3 T;  1GV4 A;  2UXC T;  3RQU A;  4Q25 A;  2SPC A;  4EGW A;  5L3B B;  1Y01 A;  2LLY A;  1EV1 4;  4IHJ E;  3L8R A;  2VAS A;  4EIP A;  2EQ6 A;  4H4T A;  3ZCI A;  2UUB T;  4AT0 A;  5J1G A;  4PJM A;  4J57 A;  2R0G A;  4U8O A;  2XDO A;  3PUR A;  4YHJ A;  4HB9 A;  1KSS A;  3AE2 A;  2V5C A;  1B7T A;  4Z25 A;  1NWM X;  1UX4 A;  2CXL A;  4X64 T;  4QXC B;  5LBM A;  4TM4 A;  2WMO A;  5BRT A;  2K5B B;  2LSK A;  3GYI A;  3C4Z A;  3SX6 A;  3WE0 A;  3QC9 A;  2BVM A;  1BZL A;  1GER A;  3C50 A;  1E1N A;  2RGH A;  3MJX A;  4Z2T A;  3M65 A;  2BKO A;  4DR2 T;  4KPR A;  1U5P A;  5HYA A;  4H2Q A;  4WCT A;  1M62 A;  2V6X A;  1HS7 A;  4B3R T;  3DJJ A;  4GR1 A;  2DWG A;  3P4P A;  4DV6 T;  1PJ7 A;  2R0C A;  5JDM A;  3T2Z A;  4UDQ A;  3NWI A;  4U8M A;  5FXW A;  2PLV 4;  3RRW A;  1FOH A;  3VU7 H;  2UXD T;  4UDP A;  4BA9 A;  4A65 A;  3F8P A;  1CJC A;  3CGD A;  3O1I A;  1GRH A;  1WR0 A;  3Q5W A;  2AR8 A;  2YR6 A;  2EX3 A;  2NTY A;  4EED A;  3ESL A;  3AED A;  3ZN1 B;  3CQG B;  1PHH A;  2ZBW A;  2W0H A;  4DR7 T;  5CQF A;  4Z91 A;  4K8D A;  2C7G A;  2X8G A;  4EMJ A;  3NHO X;  3HKE E;  3SZC A;  3M3Z B;  3A7M A;  3PV0 F;  2XUE A;  3RHW A;  5JDF A;  3I3L A;  2DCF A;  2AXD S;  4JI6 T;  1I6Z A;  2LT3 A;  2GRT A;  3S4U A;  2HN1 A;  4H9P C;  1ZMD A;  2IID A;  1W09 A;  3QSS A;  2LM9 A;  3KBT A;  3E08 A;  5JR9 B;  4GYR A;  4NXM T;  4O8S A;  2R45 A;  4Z2U A;  3HI2 A;  4B6X A;  3M12 A;  5FY0 A;  4NEV A;  4NTE A;  1NCQ D;  1ELI A;  4A9W A;  1PJ6 A;  4KX6 A;  3EAO A;  2BAC A;  3G5R A;  2X8H A;  3ALM A;  3TLV A;  3ZT5 A;  1TDF A;  3C51 A;  3I9W A;  1IUX A;  4Y4M A;  2X9X A;  4NTD A;  1F3P A;  2BK3 A;  1QO8 A;  4DV5 T;  3PUZ F;  2VVL G;  4KBM B;  3IEE A;  3FMW A;  3AEF A;  4O5Q A;  1KNR A;  2CBJ A;  2WMN A;  2Z5X A;  4U8J A;  2WAU A;  2K3W A;  2LFC A;  2XPK A;  3CQC B;  2YVG A;  4YKG A;  5J60 A;  5LXT E;  3QVP A;  1P2H A;  3FB2 A;  3RYI E;  3FPZ A;  3N5L A;  1GES A;  1D1A A;  2XQ6 A;  1FEA A;  2NVK X;  3CNT A;  2MAW A;  1X79 A;  3VKG A;  3N9O A;  1O94 A;  5FL0 A;  4LA1 A;  4AKH A;  5L4E A;  4I55 E;  1PBC A;  2RGO A;  3DK9 A;  3OVU A;  1OJA A;  5FXX A;  2C76 A;  3AYL A;  1VBC 4;  3HYX A;  3Q9D A;  2RR1 4;  2R06 4;  4J34 A;  3JAD A;  4IDN A;  1NPX A;  4AT2 A;  2FJE A;  1WCR A;  4DSH A;  2E9X D;  4PJJ A;  2JB2 A;  2YLS A;  3ALL A;  1MMD A;  5DJQ C;  1D1B A;  3AE4 A;  5KVI A;  1WFD A;  5AQF B;  2FJA A;  3I1A A;  5L46 A;  4H4P A;  1E6E A;  4OK0 A;  2IC9 A;  3UKA A;  3KVA A;  3NK1 X;  1GET A;  2ZM8 A;  3NH3 X;  1E2A A;  2WP9 A;  2OLN A;  1UX5 A;  3H3A A;  3LK2 B;  1BR2 A;  2R46 A;  1RUF 4;  1TDK A;  2L9Q A;  4WYV A;  2HN2 A;  2GK9 A;  1GEU A;  3F31 A;  1H8T D;  4HA6 A;  5AQK B;  1COY A;  4UEM A;  2EQ8 A;  4EOZ B;  4ZCD A;  2F5Z A;  4AIU A;  1MIV A;  1GRT A;  2JIW A;  1PS9 A;  2HHH T;  4NEW A;  2BDE A;  4U3C A;  1CC2 A;  4BAY B;  3QSM A;  4LMK A;  1F8W A;  4OPC A;  2LOS A;  4Z24 A;  5LG4 A;  3UU8 A;  4NUV A;  5IPY A;  2H88 A;  3LDQ B;  4UDR A;  2K9A A;  4ADZ A;  1VRH 4;  1RYI A;  4H9Q C;  3DP7 A;  1Z8U A;  1MXT A;  5AQP B;  1OED C; 
#chains in the Genus database with same CATH homology
 4B1B A;  1NG4 A;  4I58 A;  4IA6 A;  2WU5 A;  2YM1 A;  4IV9 A;  4YSY A;  1JRZ A;  2C75 A;  1DJQ A;  1K4Q A;  4H4Z A;  2YVF A;  1JNZ A;  1EL5 A;  1UKV G;  4OPG A;  1H7X A;  3GD4 A;  4G73 A;  3NIX A;  2B9X A;  2XFP A;  4IA5 A;  3AE9 A;  2DKH A;  1MO9 A;  2B9Y A;  3B6D A;  4Z43 A;  2VQB A;  3ABV A;  1ZMC A;  4H50 A;  2JBV A;  5KXJ A;  1PBE A;  2Y6Q A;  2BRA A;  4K5S A;  2I0Z A;  3NYF A;  5KVH A;  5KMP A;  4YTM A;  3CGB A;  3DJD A;  4USQ A;  1VG0 A;  2RGJ A;  4XWR A;  3ICR A;  2Q0K A;  2XFQ A;  4EQW A;  5FS7 A;  1JU2 A;  3ITJ A;  1HYU A;  5HYM A;  1PJ5 A;  4USR A;  3NKS A;  4MJW A;  3DJE A;  1NHQ A;  1GXF A;  2R0P A;  4GF7 A;  1LQU A;  3DME A;  2X99 A;  5KNL A;  1S3E A;  4RG3 A;  3CNS A;  1D7Y A;  3UKF A;  4CCR A;  3FG2 P;  2TPR A;  2WET A;  1L9E A;  3C96 A;  1NDA A;  4C3Y A;  1CJ4 A;  3NTA A;  1KNP A;  5JCI A;  3UKH A;  2FBW A;  2X3N A;  2YLT A;  3K30 A;  5JCM A;  2ZZC A;  4B63 A;  5FS9 A;  4CY8 A;  3GD3 A;  3F8R A;  4N9X A;  2CVJ A;  3G5Q A;  3KVE A;  3SZ0 A;  2XCG A;  2YG6 A;  1E39 A;  3SZF A;  4H4X A;  3AEB A;  1Y56 A;  5J7X A;  3NTD A;  2VVL A;  2Z5Y A;  3IF9 A;  2GQW A;  3AE6 A;  4GRT A;  3CPH G;  4K22 A;  1CHU A;  3IHG A;  3UKP A;  2C67 A;  2E4G A;  2GAG B;  2BS3 A;  1NEN A;  4AOS A;  2XVJ A;  3AE7 A;  1L9D A;  2YR5 A;  4K5R A;  3SQP A;  2YM2 A;  2BC0 A;  2GB0 A;  3LAD A;  4M52 A;  4H2R A;  3P4S A;  3K7T A;  3SGL A;  2C3C A;  3T14 A;  3ALJ A;  1Q1W A;  1D4C A;  5ER0 A;  5FMH A;  1SEZ A;  3NN0 X;  4A6N B;  2X50 A;  4CBQ A;  4D04 A;  2UZZ A;  1TRB A;  2WES A;  2YLW A;  4TM0 A;  4B68 A;  3LZX A;  5EB5 A;  1F8S A;  2JKC A;  4X9N A;  3L8K A;  1DJN A;  4GCM A;  5LV9 A;  2GEW A;  2A87 A;  2ARD A;  4J56 A;  4J36 A;  2J3N A;  4JN9 A;  3KLJ A;  1GRA A;  2BS4 A;  3QFA A;  1RSG A;  3S5W A;  1BKW A;  2GVC A;  4FK1 C;  1K0I A;  3QSE A;  4C77 A;  1NG3 A;  1KDG A;  4TM3 A;  1E1L A;  2B7S A;  2WS3 A;  3AXB A;  3LXD A;  4TLZ A;  4II3 A;  4BK1 A;  3NNE A;  1M6I A;  1PXC A;  3HYV A;  3LJP A;  4GDE A;  4REK A;  1EBD A;  2JB3 A;  2A8X A;  1IUS A;  3EAN A;  2XVF A;  1CC6 A;  4BJY A;  3SYI A;  4O5U A;  4JNA A;  3GMB A;  2C72 A;  3IC9 A;  4OPL A;  1LPF A;  2GR1 A;  3GYJ A;  2R4E A;  2XVH A;  2C64 A;  3GRT A;  3AB1 A;  4EM3 A;  5HY5 A;  4RG4 A;  1IUT A;  4DNA A;  2V60 A;  1OJC A;  3IHM A;  3CMM A;  3AD8 B;  3V3N A;  1GTH A;  2WHD A;  2WPF A;  2ZZ0 A;  2WOV A;  4FDC B;  4EIQ A;  3NK0 X;  4A79 A;  2YG5 A;  1AOG A;  4APN A;  2JK6 A;  4U2T A;  3RED A;  4H2N A;  4EMI A;  3V3O A;  3BI5 A;  1VQW A;  1ZK7 A;  1F8R A;  1DXL A;  4NNJ A;  3LOV A;  2WQY A;  3GDP A;  1XPQ A;  2VZ2 A;  4GDP A;  1S3B A;  2XLS A;  2Q0L A;  2BC1 A;  1FL2 A;  2BCG G;  3UOY A;  1BF3 A;  4WX1 A;  3QVR A;  5C3J A;  3RP8 A;  3ISH A;  4IVM B;  2GV8 A;  1PXB A;  4YTP A;  1Z6L A;  2YLR A;  4XWZ A;  1P2E A;  3B3R A;  2C66 A;  3BNM A;  5GSN A;  2EQ7 A;  2NPX A;  3UOX A;  3GYX A;  3GQH A;  1YY5 A;  4Y4L A;  2WP6 A;  1EL7 A;  5FS8 A;  3FBS A;  4YKF A;  2V5Z A;  2XLP A;  4JDR A;  4B65 A;  2IVD A;  2WU2 A;  3T2Y A;  4U2L A;  3F8D A;  3UTE A;  3EPT A;  1GPE A;  3UKK A;  1OJ9 A;  2XFO A;  5HHF A;  3VRB A;  2BK4 A;  2C65 A;  4BJZ A;  1TYP A;  1YQZ A;  2PHH A;  3AE1 A;  2WPC A;  3PO7 A;  1PXA A;  2XVE A;  2QAE A;  2YAU A;  1F6M A;  2GR2 A;  4H4U A;  1E7P A;  2GMH A;  3CGC A;  4PAB A;  5KOX A;  3AE5 A;  1GV4 A;  4G9K A;  2GR0 A;  2Q6U A;  3H8I A;  4H2P A;  3QJ4 A;  4Y4N A;  1XHC A;  2YG4 A;  3DGZ A;  4U2S A;  2BK5 A;  1H83 A;  3NYE A;  4ZCC A;  2BS2 A;  1BGN A;  2V6O A;  1B5Q A;  1DNC A;  2GR3 A;  2WOW A;  3UCL A;  4P9S A;  2WP5 A;  3D1C A;  1GRG A;  3R9U A;  2EQ6 A;  4H4T A;  4EIP A;  4AT0 A;  3BI2 A;  3VQR A;  1LVL A;  4J57 A;  2R0G A;  4NZH A;  4U8O A;  1CJ3 A;  3O0H A;  3RHA A;  4BK3 A;  4YSZ A;  2XDO A;  4EQS A;  3CGE A;  4X9M A;  3AEA A;  3E1T A;  3SY4 A;  3M0O A;  2PYX A;  2BCP A;  2FJD A;  4HB9 A;  4U8L A;  1KSS A;  3AE2 A;  4OPD A;  4Z25 A;  2OLO A;  3ATQ A;  3OZ2 A;  2BAB A;  1KSU A;  3ADA B;  3GMC A;  2OAL A;  3C4N A;  4TM4 A;  4OCG A;  2QA2 A;  5BRT A;  1E1M A;  2A89 A;  2GMJ A;  3GRS A;  3NG7 X;  1YKJ A;  3RP6 A;  1FCD A;  5M0Z A;  3GYI A;  3SX6 A;  4OPT A;  3WE0 A;  4J31 A;  3BNU A;  3RNM A;  5IQ1 A;  1BZL A;  2RAB A;  1GER A;  2BRY A;  1E1N A;  4TLX A;  4J33 A;  5EBK A;  2RGH A;  5CKU A;  3UP5 A;  4Z2T A;  1V59 A;  2IVE A;  2C3D A;  3CND A;  4KPR A;  5FS6 A;  3D8X A;  3NYC A;  4H2Q A;  4WCT A;  4G74 A;  3UTF A;  3BHK A;  4U8N A;  1CC4 A;  3DJJ A;  4GR1 A;  1O5W A;  1GTE A;  3AD9 B;  1GRB A;  3P4P A;  3CTY A;  4XXG A;  3P1W A;  4JNQ A;  2C4C A;  3H4K A;  1IUV A;  2QCU A;  1PJ7 A;  2R0C A;  2XLU A;  3T2Z A;  3GQK A;  3IWA A;  1H82 A;  2B76 A;  3DH9 A;  4UDQ A;  2JB1 A;  1NHP A;  2BXS A;  3NK2 X;  1ZKQ A;  4U8M A;  1O95 A;  3VR8 A;  2VRM A;  5JCK A;  2GAH B;  1XDI A;  1FOH A;  4UDP A;  3KKJ A;  4A65 A;  2OAM A;  1CJC A;  3F8P A;  4NTC A;  4CNK A;  3COX A;  3CGD A;  4EQR A;  1YQ4 A;  1CBO A;  2C73 A;  2O9Z A;  1E1K A;  1GRH A;  3KPF A;  5DBJ A;  2AR8 A;  3NLC A;  2YR6 A;  4YXD A;  1LV0 A;  1D4E A;  3SFD A;  1H84 A;  3AD7 B;  3AED A;  1K0J A;  1GRF A;  2BYB A;  1ZP0 A;  1Y0P A;  1CF3 A;  1QJD A;  5U63 A;  3HZL A;  1TDO A;  1PHH A;  2ZBW A;  2W0H A;  1VG9 A;  4U8P A;  5KRQ A;  5CQF A;  4AP3 A;  2YG7 A;  4K8D A;  4Z44 A;  2C7G A;  4DSG A;  4A6N A;  3GWD A;  4C5O A;  2X8G A;  3BI4 A;  4BUR A;  4EMJ A;  1D5T A;  1TDN A;  2WDQ A;  3CPI G;  3NHO X;  4UP3 A;  5HXI A;  1PN0 A;  3SZC A;  4CCQ A;  4GAP A;  3I3L A;  1BGJ A;  3CN8 A;  4OPU A;  3DK4 A;  3HYW A;  3II4 A;  1TYT A;  3URH A;  3ICT A;  2GRT A;  3LZW A;  3M13 A;  1LJ1 A;  2VVM A;  1ZMD A;  4DGK A;  3GDN A;  4EMW A;  1LTX R;  4YT0 A;  1B8S A;  2IID A;  3BHF A;  1L0V A;  3QSS A;  2ZZB A;  4ADW A;  4U8K A;  2Q7V A;  1EL8 A;  2XFU A;  5BVA A;  3DJG X;  1D4D A;  1Q1R A;  2YR4 A;  3VRD B;  2OA1 A;  2R45 A;  1S2Y A;  1FEB A;  2YLZ A;  1ZY8 A;  4G6G A;  2V61 A;  4Z2U A;  1PDH A;  2YG3 A;  1XAN A;  3M12 A;  4A7A A;  2BXR A;  1N4U A;  1VDC A;  3AWI A;  1ZOY A;  4NEV A;  4IVO B;  4NTE A;  1ELI A;  3KA7 A;  4A9W A;  2C70 A;  3Q9T A;  1MOK A;  1PJ6 A;  4KX6 A;  1H6V A;  5EOW A;  3EAO A;  4ZN0 A;  3KD9 A;  2BAC A;  5GRT A;  1X31 B;  1GOS A;  3T37 A;  3T2K A;  1W4X A;  1KF6 A;  3G5R A;  2X8H A;  2WOI A;  3FIM B;  3ALM A;  1TDF A;  3CPJ G;  3T0K A;  3UTG A;  4Z26 A;  4EQX A;  3SZW A;  4AOX A;  1IUX A;  4J2W A;  3AYJ A;  2VQ7 A;  4Y4M A;  4BV6 A;  5KWF A;  1Q9I A;  3UOZ A;  3DA1 A;  1NEK A;  3P9U A;  4NTD A;  1GRE A;  1F3P A;  1PBB A;  1QO8 A;  3P4R A;  2BK3 A;  1Y56 B;  4JY3 A;  2YQU A;  2VVL G;  1LQT A;  3AE8 A;  1OJT A;  2EQ9 A;  3PVC A;  2FJB A;  1QLB A;  3FMW A;  3AEF A;  4FK1 A;  4JQ9 A;  4O5Q A;  4CRT A;  4H4Y A;  1KNR A;  2Z5X A;  2AAQ A;  1IUW A;  2V3B A;  1DOE A;  3I6D A;  4U8J A;  3SM8 A;  2XLR A;  2LFC A;  2CFY A;  2VOU A;  1GAL A;  3C4A A;  1BWC A;  4H4V A;  1KFY A;  5JCN A;  1H7W A;  3AE3 A;  3LB8 A;  2YVG A;  4YKG A;  5IQ4 A;  5J60 A;  3AEG A;  3NT6 A;  3OC4 A;  1CJ2 A;  1YQ3 A;  3QVP A;  1P2H A;  4II2 A;  4BK2 A;  4RSL A;  1VRQ B;  1GND A;  2TMD A;  3FPZ A;  3K7Q X;  1GES A;  3UP4 A;  3CIR A;  1H86 A;  3L1R A;  3ICS A;  4K2X A;  2NVK X;  1FEA A;  2YLX A;  4YWO A;  1DOC A;  5JCL A;  1DOB A;  1RP0 A;  3CNT A;  4PAA A;  4YTN A;  4JY2 A;  5EB4 A;  1O94 A;  3KU9 A;  3GSI A;  4LA1 A;  3ATR A;  3ZYX A;  1NAA A;  3Q6J A;  2BA9 A;  1DOD A;  1N1P A;  2GF3 A;  2XFN A;  1JOA A;  4GAV A;  1PBD A;  2WDV A;  1PBC A;  2RGO A;  3DK9 A;  1EL9 A;  3AEC A;  1OJA A;  2C76 A;  2CDU A;  1NHS A;  2WBA A;  4TM1 A;  3AYL A;  2VRL A;  3HYX A;  1PBF A;  2E5V A;  1M64 A;  2XYO A;  5BUK A;  1FEC A;  5KOW A;  4E0V A;  4J34 A;  5KMR A;  2B9W A;  1NPX A;  3AYI A;  4K7Z A;  4AT2 A;  4H7U A;  2FJE A;  3G5S A;  2X8C A;  4DSH A;  2Y6R A;  4A99 A;  3ZDN A;  1K0L A;  2JB2 A;  3PS9 A;  2HQM A;  1ZDL A;  1GSN A;  2YLS A;  3ALL A;  1OJD A;  1REO A;  1IJH A;  3AE4 A;  4ICY A;  1N4V A;  5KVI A;  4OVI A;  4B67 A;  1ZOV A;  3AEE A;  2FJA A;  4FX9 A;  5L46 A;  4H4P A;  1E6E A;  1JRY A;  4B69 A;  3DK8 A;  2XVI A;  3UKA A;  5C2T A;  3UTH A;  4YSH A;  3NK1 X;  1GET A;  4CY6 A;  5U1O A;  1TDE A;  3NH3 X;  4B66 A;  1JEH A;  2JAE A;  3K7M X;  2ACZ A;  2WP9 A;  5KMQ A;  2APG A;  2OLN A;  3NGC X;  4EM4 A;  4A5L A;  3V76 A;  2GQF A;  2GH5 A;  4G6H A;  4H4S A;  2R46 A;  4ECH A;  3UOV A;  1TDK A;  4H4W A;  1ZX9 A;  1L9C A;  2E1M A;  3S61 A;  1GEU A;  4LII A;  3UKQ A;  3SXI A;  4NWZ A;  4HA6 A;  2B7R A;  3SFE A;  3VR9 A;  4OPI A;  1COY A;  4C3X A;  4C74 A;  3JSK A;  4B64 A;  1GT8 A;  5BUL A;  3H8L A;  2AQJ A;  2EQ8 A;  4H4Q A;  4ZCD A;  2F5Z A;  2V3A A;  3DGH A;  1NHR A;  2H89 A;  1GRT A;  4X4J A;  3T31 A;  3CNJ A;  3EF6 A;  4U8I A;  4Z2R A;  1ONF A;  2YVJ A;  4GUV A;  3P4Q A;  5TR3 A;  1PS9 A;  2WPE A;  2YWL A;  3NN6 X;  4NEW A;  3QFB A;  1CC2 A;  1JRX A;  3KPK A;  2R4J A;  3QSM A;  2WEU A;  5M10 A;  4D03 A;  4H4R A;  1IUU A;  1S2Q A;  1F8W A;  4OPC A;  2QA1 A;  4Z24 A;  2R9Z A;  5IPY A;  2H88 A;  2XLT A;  4UDR A;  3SUC A;  2WDR A;  3UKL A;  1RYI A;  1H81 A;  4LU6 A;  1CL0 A;  4YSX A;  1B4V A;  4I59 A;  3VRA A;  1N4W A;  1D7L A;  5U25 A;  3GWF A;  3NRN A;  1B37 A;  4CNJ A;  5KMS A;  1JNR A;  2CUL A;  3CNP A;  3RP7 A;  2DKI A;  1MXT A;  4AP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...