5C2TA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c2tA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c2tA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c2tA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c2tA04
3UOXA 1E39A 2XVIA 3AEBA 4O5UA 5FMHA 2YVGA 1CJ4A 3DJGX 3AEEA 4J2WA 5KRQA 1E1LA 1ZMDA 1BGNA 2A8XA 3K30A 1COYA 3ISHA 1K0LA 5JCNA 1GETA 4A79A 1Y56B 4Z44A 3LZWA 3DK9A 2UZZA 3AB1A 3S5WA 5LV9A 3V76A 5U25A 2C3DA 1Q1RA 3GDPA 4XWRA 2ZZBA 4H4TA 3FMWA 2WETA 1PS9A 4IVOB 4Y4LA 4D04A 4EIQA 3SUCA 2PHHA 3B6DA 2BS3A 2XLUA 4BJZA 4YSHA 2NPXA 2C72A 1ZOVA 4K7ZA 3RP8A 4X4JA 3UOZA 2FJEA 3PVCA 1CC2A 3NHOX 2A89A 1PBDA 1FL2A 2C76A 4YKFA 1NG4A 1S3EA 3QVPA 4GRTA 3PO7A 5HHFA 4YTPA 2BK5A 3CNSA 2E5VA 2YG6A 3AD7B 3E1TA 3SM8A 5HYMA 1BGJA 4WCTA 4JY2A 3DK8A 4UP3A 1ELIA 3CNJA 3UTHA 3UP4A 1VRQB 2F5ZA 1ZY8A 2AR8A 2C70A 4FK1C 2IIDA 3ICSA 5EB5A 4H4ZA 3BI2A 1BKWA 1EL7A 2WPCA 5DBJA 3P1WA 5ER0A 1TDKA 5TR3A 1IJHA 1VG9A 2W0HA 2XVEA 4GDEA 1H86A 1N4VA 4H4XA 3CTYA 4DSHA 1CC6A 4C3XA 4JQ9A 2WHDA 2YLSA 4CY8A 3LB8A 2CULA 1PXAA 5IQ1A 1W4XA 2HQMA 3ALMA 3M13A 5FS7A 2YLWA 2XVJA 1S2QA 4YSZA 1GERA 4J33A 4P9SA 4B68A 2XFOA 4D03A 4YSXA 1N1PA 4FK1A 4OPUA 1F3PA 2XFPA 2AQJA 1D7LA 4GCMA 3G5RA 4U8LA 1ZKQA 4A6NB 1GTHA 4YXDA 1QLBA 1S2YA 2VQBA 2A87A 2WPFA 4AOSA 2X99A 1M6IA 4LU6A 5IPYA 5JCKA 2B7SA 1X31B 2YG4A 3G5QA 3FPZA 1TDFA 2GAGB 2V3BA 1ZK7A 1E7PA 4U8MA 4U8OA 3Q6JA 3UKQA 2V60A 3V3NA 5JCMA 4H4WA 4OPCA 4U8NA 4OCGA 2B9YA 3CIRA 3BI5A 4DGKA 1JEHA 4RSLA 4CCRA 5C3JA 4NTEA 1H7WA 3M12A 2BCPA 3GD4A 5HY5A 4TLZA 2APGA 5FS6A 1Y0PA 1JRXA 3NG7X 2JBVA 1KNPA 3DJDA 1Q1WA 3SQPA 4RG3A 1KF6A 4B65A 1F8WA 4JN9A 3AXBA 2IVDA 1D5TA 2RGHA 2YVJA 4GDPA 4OVIA 1H81A 4N9XA 2OALA 2R4EA 5EOWA 4YKGA 3UKFA 1HYUA 3IC9A 3B3RA 3DMEA 3NK2X 1H6VA 2YG7A 5KVHA 4B67A 1TDOA 1EL5A 4K8DA 3ATQA 1NHPA 2E4GA 1L9CA 1NPXA 1YQ4A 1L0VA 2DKHA 1IUVA 4JY3A 2DKIA 5FS9A 4USQA 1DODA 2BC1A 2BS4A 3CPJG 4CCQA 3AECA 2WP5A 1JRYA 4H2QA 1B5QA 1K0JA 2GQFA 1Y56A 2WOIA 3NH3X 4IA6A 3ICTA 3NKSA 5M0ZA 1GSNA 2R0CA 2ACZA 3QVRA 2GVCA 1ZX9A 3ICRA 4H2NA 5M10A 3DGHA 2H89A 1EBDA 1IUWA 3GMCA 3BHFA 4H4UA 1GRGA 1XDIA 2JK6A 5KWFA 3AYJA 2VVMA 4B66A 3NN6X 2C7GA 2BXRA 3KU9A 1DOCA 1KSSA 4ZCDA 1EL8A 4I58A 1GOSA 2R0GA 3UKKA 4J36A 4X9MA 4EMJA 3GQHA 2V3AA 1F6MA 1PJ6A 3DGZA 1IUUA 1D4EA 1Z6LA 4YTMA 4B63A 1O5WA 2GMHA 3AE2A 3NYCA 1L9DA 2VZ2A 4IA5A 1YKJA 5U1OA 2WDVA 3IF9A 1H83A 2Z5XA 2I0ZA 3CNDA 2ZBWA 3ADAB 2JB3A 3LOVA 3NYEA 2BCGG 4BV6A 2VQ7A 3BHKA 5BVAA 1H84A 3M0OA 1O95A 2VRMA 4J56A 4H4YA 4UDQA 3D1CA 1IUXA 3FBSA 4U8IA 4OPTA 4YT0A 1K4QA 3UOVA 1PXCA 4C74A 2XDOA 1DOBA 1DJQA 3GYIA 3AEGA 4BJYA 5BRTA 1O94A 2B76A 1D4DA 3F8RA 4Y4MA 5CQFA 2OLNA 5BULA 4TM1A 1B4VA 2YR4A 5KOWA 4PAAA 1F8SA 4A65A 1N4UA 2YG5A 5J60A 4C3YA 2V61A 1PBCA 1OJAA 4OPLA 3CNPA 1TDNA 3P9UA 4H4SA 1KSUA 1KNRA 1P2EA 4CRTA 3QFAA 3LJPA 4A6NA 3AE8A 4U8KA 1XHCA 1GALA 5GRTA 5KVIA 4E0VA 2GV8A 2X8HA 3AE9A 5C2TA 4AT2A 1ZDLA 3AE1A 1KDGA 2BK3A 2EQ8A 2RGOA 2YLXA 3AYIA 3UP5A 3H4KA 1FEAA 3ABVA 1OJDA 4IV9A 1LQTA 3K7MX 2QCUA 3H8IA 4OPIA 2Q7VA 4CNJA 3UKAA 3P4QA 3ALJA 1NEKA 5L46A 3UKPA 2GF3A 4K5RA 3GSIA 1ZMCA 2V5ZA 4Z2RA 1S3BA 5FS8A 2YG3A 3GYJA 3CGCA 4NZHA 5JCIA 3AE7A 3KKJA 3UKHA 2XVHA 1FOHA 4AP1A 1AOGA 1YQ3A 2XLSA 2FJDA 2GR1A 1V59A 3BNUA 3AD9B 3OC4A 2OLOA 4PABA 4DSGA 2WOVA 3NNEA 1PN0A 3NRNA 3S61A 3AEFA 4H7UA 2RABA 3GD3A 1PBEA 2BA9A 3NT6A 1JNZA 4I59A 1K0IA 3L8KA 3NLCA 3NTDA 1GRAA 1B37A 3NK1X 2WU2A 3EF6A 4EIPA 3H8LA 4A99A 1F8RA 2V6OA 3NIXA 2IVEA 2BYBA 2OA1A 2GRTA 3DK4A 4O5QA 3P4SA 1M64A 3KD9A 3RHAA 3KVEA 5KOXA 2R0PA 3QSSA 1PBFA 1GEUA 4IVMB 3F8DA 3CGDA 4EQRA 4U2SA 3AEAA 4U2TA 4NTDA 1YQZA 2X3NA 2PYXA 3T37A 4EM4A 4CY6A 4LA1A 3I3LA 2TMDA 4UDRA 1CL0A 4HA6A 2R46A 4J31A 2AAQA 2GH5A 1BZLA 1GNDA 1E1KA 4GUVA 4TM3A 1PBBA 3GYXA 4RG4A 3URHA 3RP7A 2C64A 4NTCA 5KXJA 4JNAA 1RYIA 2JKCA 4X9NA 4JNQA 4Z43A 4FX9A 1CHUA 3UOYA 2BXSA 3L1RA 3C4AA 4M52A 1IUTA 4CNKA 4EM3A 4Z2TA 4KX6A 3QJ4A 2O9ZA 2WOWA 1GXFA 3V3OA 4AP3A 3IWAA 3KPFA 3BNMA 2YM2A 4CBQA 3AEDA 4AOXA 5BUKA 3ZYXA 1VDCA 1D4CA 2QA2A 3CPHG 2XCGA 4Z24A 3LZXA 4Z2UA 3UTEA 2H88A 2GB0A 3VRBA 1PHHA 4USRA 5IQ4A 1FEBA 2WEUA 3COXA 3EANA 1ONFA 4H2PA 4OPDA 2XLPA 5CKUA 3UTFA 1LJ1A 4EMIA 4KPRA 1PXBA 2GR3A 1B8SA 1JRZA 1DOEA 4H4QA 3CPIG 4WX1A 2XFQA 1H82A 4NEVA 3DJJA 1GPEA 5JCLA 2BC0A 2Q0KA 3IHGA 2C65A 4EQWA 1NAAA 4FDCB 2BS2A 1JU2A 1XANA 1OJCA 2ZZCA 1PJ7A 2JB1A 3CNTA 4TM4A 2YAUA 4B1BA 4ICYA 2NVKX 3UKLA 1TRBA 4YTNA 2WQYA 1P2HA 2C67A 2QAEA 3Q9TA 4H4PA 4K5SA 4H4VA 3NN0X 4ZCCA 2X8GA 2YLZA 1GREA 1E6EA 2J3NA 3AD8B 3QFBA 1RP0A 5HXIA 3GDNA 1GRTA 2CFYA 1NHSA 2YR5A 3K7TA 4BURA 2C73A 4HB9A 4XWZA 4A9WA 1QJDA 2YQUA 3LXDA 2EQ6A 2Q0LA 2FJAA 4B69A 3VRAA 3AWIA 3NYFA 3RNMA 1LQUA 2B9WA 1GT8A 1D7YA 4AT0A 1FCDA 2Z5YA 3GWDA 3HZLA 2X50A 4TLXA 2XVFA 1VG0A 1E1MA 1L9EA 2C3CA 2EQ7A 1YY5A 2WP6A 1NHRA 3REDA 2YLRA 3UCLA 2BK4A 3CGBA 2WBAA 2TPRA 2WDRA 2Y6QA 3GRTA 4ECHA 2JB2A 1SEZA 4K2XA 5EB4A 1E1NA 1NENA 2WESA 2GR2A 2YM1A 3ATRA 3P4PA 4H4RA 2E1MA 2WP9A 3ZDNA 3F8PA 3I6DA 3II4A 2GQWA 4XXGA 4B64A 2XFNA 3FG2P 5U63A 3KLJA 1REOA 1NG3A 3VRDB 4J57A 4REKA 2B9XA 3SGLA 1OJ9A 2CVJA 1JOAA 3OZ2A 4U2LA 4UDPA 4EMWA 3C4NA 2XLRA 4U8JA 1NHQA 3EPTA 4DNAA 2YLTA 4A7AA 1CBOA 2BABA 3C96A 3VR8A 2BACA 3R9UA 1LVLA 3GWFA 4J34A 4A5LA 3AE4A 2GAHB 1PDHA 2C66A 3K7QX 2WPEA 5EBKA 4Z25A 1ZOYA 1GESA 1OJTA 1IUSA 3FIMB 4C5OA 3RP6A 3AYLA 3O0HA 2EQ9A 1LV0A 2YR6A 2R9ZA 3LADA 1LTXR 2XLTA 1PJ5A 1LPFA 2GEWA 4Y4NA 2R45A 3DA1A 1EL9A 2VRLA 3UTGA 4JDRA 3P4RA 2GR0A 2GMJA 4EQXA 3SFDA 1CJ2A 1MO9A 2B7RA 3D8XA 2X8CA 3QSEA 4TM0A 1MOKA 1BF3A 3NGCX 3PS9A 1CJ3A 1CJCA 4EQSA 3VQRA 4YSYA 2C75A 4LIIA 1CF3A 1MXTA 4ZN0A 3WE0A 2FJBA 3JSKA 4GR1A 4BK1A 3GMBA 1DNCA 1GRBA 2OAMA 2Q6UA 4OPGA 4C77A 4MJWA 2Y6RA 1XPQA 3NK0X 3ITJA 1GTEA 2ZZ0A 3AE6A 2WDQA 1N4WA 2CDUA 3DJEA 2YWLA 3NTAA 1KFYA 5GSNA 2XFUA 4GF7A 2QA1A 1BWCA 1FECA 1QO8A 1VQWA 5J7XA 3AE3A 2R4JA 2RGJA 1Q9IA 1ZP0A 2XYOA 1TYPA 4K22A 3G5SA 4ADWA 3SFEA 1DXLA 2ARDA 3KA7A 2VOUA 1CC4A 4APNA 3GRSA 1RSGA 2VVLG 4BK2A 2FBWA 3ALLA 3GQKA 1GRHA 3AE5A 2LFCA 4YWOA 1JNRA 1TYTA 2YVFA 2JAEA 3QSMA 4BK3A 3EAOA 3BI4A 2WS3A 1GV4A 2WU5A 3DH9A 3IHMA 4H50A 4NEWA 3CN8A 1H7XA 1GRFA 2VVLA 4Z26A 4U8PA 3VR9A 3CGEA 4H2RA 1DJNA 1UKVG 1NDAA 1TDEA
chains in the Genus database with same CATH superfamily
4U33A 3UOXA 3RIFA 2H3RA 2EX3A 1U5PA 5DQWA 5AQMB 3HKBE 3DJGX 1SA0E 4TNVA 4B3RT 1E1LA 4TV9E 4JI5T 2A8XA 5JCNA 1GETA 3S5WA 2UZZA 4L0RA 3SZWA 5U25A 1IZNB 2R6GF 2UUCT 3FMWA 1PS9A 4PJJA 3SUCA 2PHHA 2VKHA 2XLUA 2LJLA 4PW8A 4BJZA 3RP8A 2BRYA 2FJEA 3PUZF 1FJGT 3PVCA 3NHOX 3QVPA 2R074 1VBC4 2SPCA 4YTPA 5KOWA 2YG6A 5E0OA 4JY2A 2DNXA 5F3JA 1VRQB 2F5ZA 2C70A 2IIDA 2XAJB 2WPCA 5DBJA 5ER0A 1TDKA 5TR3A 1SE7A 5A1LA 3N9NA 4GDEA 1T7SA 4DSHA 2WHDA 2YLSA 1WR0A 3LB8A 5L3EB 4EXTA 1HX1B 3M13A 2VB6A 5LBQB 5H6RB 2XVJA 1S2QA 1D0YA 1GERA 2XQYA 2XFOA 1N1PA 4IE4A 4OPUA 1F3PA 5HCJA 2AQJA 4GCMA 3G5RA 4JUYA 5IYZE 4I50E 1GTHA 1S2YA 2WB5A 3TLTA 5AFUL 2A87A 2VQBA 5HCMA 5IHYA 2JIWA 4LU6A 2B7SA 5JCKA 3G5QA 3OTOT 2R044 2C5IT 1TDFA 3LBXA 3B13A 4U8MA 2IIUA 4U8OA 2V60A 5AQLB 4OPCA 4WZXA 4DGKA 4HGAA 4RSLA 2XPKA 5C3JA 4NTEA 4H63V 2EHOD 4LF9T 3L3PA 3NVOA 1M62A 1KNPA 3AVSA 2JQQA 4G63A 2IVDA 4GDPA 3FZHB 4FI5A 4LMKA 4MFRA 5LGUB 1HYUA 3NK2X 5AQOB 2YG7A 5KVHA 1AR94 4GK5E 1ZKEA 1NWMX 2WMNA 3B5MA 1NHPA 2E4GA 1YQ4A 1L0VA 1KNZA 2ES0A 2Q9QD 4JY3A 3FXDB 4AQYT 2KXPB 1ASJ4 3I9YA 3F57A 3UULA 5IUXA 3LFMA 4EIWA 3AECA 4UF0B 4ILBA 4AQGA 4H2QA 4JV5T 4X65T 3MJXA 2V7JA 4M1PA 1IUWA 4HFCA 3EUHA 2BVLA 3O9XA 3ZPOA 5KNLA 3RIUC 4YLHA 1Y01A 4TX5A 1DOCA 4I58A 1GOSA 2AXDS 3SWHA 4EMJA 4GYRA 4QXBB 2X9YA 2J1DG 1MIVA 3CVRA 2N1GA 3O1HA 2GMHA 2NW7A 3NYCA 4GK0E 3CQGB 5FL0A 3IF9A 4V1Av 2K5BB 4Z90A 3GN5B 4O4LE 4J56A 1XNQT 2YK0A 1UX5A 2CXDA 4G73A 3KV9A 3RIUA 4IT4A 4LMJA 3SRZA 2XDOA 3GYIA 3LK2B 2C0SA 2XSAA 5BRTA 3EAMA 1D4DA 2LKHA 4AQFC 4TM1A 5HXHA 1B4VA 4JI3T 4C90A 1OJAA 2HPLA 1TDNA 1KNRA 4CRTA 5LBMA 3QFAA 4JEHB 1W0BA 3FXEB 2E8IA 3KVAA 2JQHA 3AE8A 3UUNA 2GV8A 2V6XA 3HI2A 5C2TA 2VKJA 3UP5A 2EQ8A 2YLXA 3ZYLA 1OJDA 2ZM6T 4AQFA 5HXSA 2QCUA 3H8IA 4CN4A 3UU4A 2NTYA 2NW9A 3P4QA 5L46A 1NEKA 2GF3A 3K8PC 4K5RA 1ZMCA 2QA7A 5FS8A 2YG3A 2X66A 2WCAA 2XVHA 4AP1A 4L5GA 1YQ3A 3AD9B 3RYCE 2OLOA 4NXMT 4HE8A 4UVAB 5L4HA 4HTEA 4DV3T 2WY2A 3ZMVB 2BA9A 1JNZA 1V9DA 3NLCA 2JQ9A 3NTDA 2UXCT 1GRAA 4U3CA 2VVSA 4EIPA 2DCFA 2LHRA 2XQ3A 2GRTA 1W9RA 2OA1A 3KD9A 4IGUA 1HNWT 3F8DA 3CGDA 3HA4A 4NTDA 3T2ZA 4CY6A 5LHHB 2ZMAA 3I3LA 1CL0A 1PIV4 5LMUT 1MIWA 4AKHA 1E1KA 3R6NA 4OK0A 4F6RC 4JNAA 1RYIA 4PFOA 1VBA4 1HF8A 4FX9A 3UOYA 3EVYA 2BXSA 3RYFE 3HL6A 2UU9T 1IUTA 4CNKA 2MAWA 4Z2TA 4UIGA 4LFCT 4AP3A 3SZCA 4TWFA 2WBLA 4B3TT 3ONJA 2QA2A 2OA5A 2NWBA 1VRBA 4Z2UA 2GB0A 3EDVA 4H9RC 2CE7A 3EANA 4KMCA 4NNJA 3Q2MA 1LJ1A 1XI1A 3O1JA 4KPRA 2WWUA 1PXBA 3IHRA 4WX1A 1UX4A 3SYIA 3GWHA 3DJJA 1GPEA 3IHGA 4EZHA 4FDCB 2OLTA 1OJCA 2ZZCA 3CNTA 4X5TA 1NCQD 5FY0A 3PUGA 2C5KT 3PURA 1BR0A 3Q9TA 2WSSV 4ZCCA 3CMLA 5LB7B 1GREA 2YLZA 4QX8B 5HXIA 4BURA 1XDPA 5CA1E 1QJDA 3LXDA 4IDQA 5J2TE 5JDFA 3WI3A 2B9WA 4AT0A 1HNZT 1XHZA 3GWDA 2XVFA 3QB5A 1I94T 2C3CA 4OYKA 3SOLA 4NWZA 2BK4A 3CGBA 4K0KT 1E1NA 3P4PA 4H4RA 3OBVE 1EAH4 2PBIA 4DO0A 2X5ID 2IW5B 4ZI2D 4KBMB 3OVUA 3NRYA 2B9XA 4REKA 3N2KE 3OZ2A 2CVJA 4IE7A 4JI4T 4ZI3D 5L4EA 2XLRA 1NHQA 4CN1A 3C96A 2UXNB 1N36T 2W63A 4WBNE 3GWFA 4A5LA 3KDSE 3ANWB 1PDHA 2C66A 3RHWA 2LLYA 3ZT5A 4Z25A 3FIMB 4C5OA 2XQ4A 3RP6A 5BMVE 3AB3B 3AYLA 1IAPA 2LHNA 2R9ZA 4HFHA 1LTXR 1LPFA 3DA1A 3KBUA 5FYMA 4NPPA 3KBTA 4JDRA 2GMJA 4EQXA 1CJ2A 3ETUA 2X8CA 3NGCX 1CJ3A 3FI7A 1UK5A 2XQAA 2LSKA 4ZN0A 1UUSA 4BK1A 3VKHA 2VQFT 2Q6UA 2OAMA 4WYVA 3NK0X 3SZ0A 2BG9B 2CDUA 5JVDE 2YWLA 2JPFA 5GSNA 2XFUA 3AA1B 3HYWA 5J7XA 3AE3A 5CFBA 3KFWX 1Q9IA 2XYOA 4DR6T 5JDGA 2KINB 4GKKT 3GRSA 3FBZA 3QB5K 4BK2A 5FY1A 3AE5A 2LFCA 2YVFA 1T98A 4BK3A 4H50A 5HXRA 3DH9A 1R084 3CGEA 2LEHA 1UKVG 2MOZA 1TDEA 2E9XC 3AEBA 2N9DA 3ZN0B 1CJ4A 4J2WA 5KRQA 2CLYC 3K1SA 4XAXB 1K0LA 1Y56B 2AE9A 5AQFB 3AB1A 1POV0 3GDPA 2WZIA 4HKAA 4DR5T 4XWRA 2MTQA 2V7LA 4D04A 2I6HA 3ZMSB 3B6DA 4IE5A 1UCUA 2LM2A 3D0TA 2E5LT 4YSHA 3UOZA 4QH1A 3UU6A 2E9XA 4QH4A 3FB2A 1FMWA 3U3IA 1PBDA 2A89A 4IHJE 4HFEA 3PO7A 3QK6A 1BGJA 4WCTA 4EOZB 4UP3A 3CNJA 3UTHA 2XQ6A 5EB5A 4MLKA 3REDA 4FK1C 5J2UE 1EL7A 1NAFA 2YKSA 4Q4W4 2W0HA 1EZ3A 1HXS4 1I6ZA 2KT9A 2X9HA 1H86A 1W0AA 4IIJE 1HX8A 2BZBA 4JQ9A 1MMGA 5HWXA 1T72A 3AVRA 4CY8A 2XM1A 1OEDB 2CULA 3QNUA 1IBLT 5FS7A 4EV6A 4G74A 4FK1A 3L09A 3RC3A 4PDWD 2XFPA 1D7LA 4U8LA 1ZKQA 1QLBA 4AOSA 4DR1T 2EHOB 4X20E 3UKQA 3V3NA 4H4WA 3CMMA 1SUMB 3M12A 1AR84 5J1GA 2BCPA 5HY5A 2BG9E 1Q1WA 1VBB4 3ZCIA 4YJ2E 4RG3A 1KF6A 2DWKA 2YINA 1FIOA 2BKPA 4JN9A 3AXBA 4I0UA 2YDRA 1D5TA 4PAGA 4DV7T 1H81A 4N9XA 3MKDA 2Q9QB 3UKFA 4P1NA 2BKNA 3IC9A 2DL1A 1H6VA 3UTKA 2V5DA 1MNDA 1R8IA 1TDOA 3MACA 4GKJT 1EL5A 3ATQA 3RYHE 5IWAT 1NPXA 4LF6T 5AQUB 2DKHA 4ISSA 5FS9A 5AQGB 2CWOA 1O3XA 4E7ZA 3P50A 2NR4A 5AQSB 2JJ9A 3ICTA 4IL9A 3RRCA 5M0ZA 2UUAT 4DR3T 2F4VT 1HG2A 5L3DB 1GSNA 4EYUA 2GVCA 2R0CA 4EB6E 3QVRA 4H2NA 5M10A 3DGHA 4QX7B 5AQRB 3BHFA 4H4UA 1GRGA 1XDIA 1B7TA 5DQVA 1YXRA 3RLFF 2RA1A 3AYJA 2VVMA 4B66A 1YKHB 2C7GA 1RUG4 4UXNB 1MQTD 1KSSA 5LNKA 4X62T 2R0GA 4X9MA 5LG4A 4NIQA 5LHGB 3B57A 3H3MA 5HAXA 1O5WA 1L9DA 2VZ2A 4U2YA 5U1OA 2Z5XA 1RUE4 4ILAA 3N9QA 3ESLA 1O95A 3M0OA 4UDQA 3D1CA 1IUXA 4UV8B 2V7MA 2YDSA 4YT0A 3GA8A 3AEGA 1O94A 2YDQA 1AR74 5CQFA 2OLNA 5BULA 4PAAA 2GK9A 1N4UA 5J60A 4C3YA 2V61A 4OPLA 5ABFB 3KV4A 3M65A 2A9UA 4O2AE 1XHCA 5GRTA 4E0VA 2J4GA 3GMIA 4AT2A 4DV5T 2RGOA 3AYIA 1FEAA 3ABVA 4OFZA 4IV9A 1LQTA 3T2YA 5BR8T 4I55E 1IJ5A 5JDMA 3A7MA 1AR64 3ALJA 3UKPA 3PUAA 3GSIA 4PJMA 4KUMB 2PJQA 4Z2RA 1S3BA 3GYJA 4XZCA 1KK7A 3V5UA 5CGMA 5JCIA 1AOGA 4KHZF 3BNUA 2OV9A 4PABA 2IHR1 3FZMB 3Q5WA 2VL0A 3NNEA 1PN0A 2V1DB 3S61A 3AEFA 5LMNT 3L8KA 3E08A 1BR1A 3CX8B 1B37A 3NK1X 4HWIB 1HTJF 5JDLA 2IVEA 2D2SA 4UF0A 3DK4A 3LK3B 3RHAA 5KOXA 2XUEA 1PBFA 4CI2B 4EQRA 3AEAA 2PYXA 3NWIA 2L3LA 3ZN1B 3TLVA 2LSYA 4HA6A 3TLSA 2R46A 3CQCB 2AAQA 1BZLA 3URHA 2C64A 4NTCA 4AISA 1RHI4 3UFGA 4X9NA 4CXXA 4JNQA 2LSIA 4JI0T 1CHUA 3LSVA 4YFSA 5LJMA 5FVKA 5CA0E 2XTLA 4JI8T 4M52A 3OYZA 2BRAA 4IREA 4IDNA 2O9ZA 2WOWA 3V3OA 3IWAA 3KPFA 3BNMA 4CBQA 4DUZT 3AEDA 1D4CA 4H9QC 4LF4T 5JRCB 3GN5A 2XAQB 2XCGA 4Z24A 4IE6A 3BK9A 3VRBA 2C5JA 4USRA 4UELA 3CKDA 4H2PA 4OPDA 1ONFA 3UTFA 3RIAA 4QH5A 2GR3A 3OYXA 1JRZA 4H4QA 4U74A 1IBMT 2BC0A 1LVFA 2Q0KA 2C65A 1NAAA 1JU2A 2LOPA 2JB1A 4TM4A 5HWYA 1US7B 2DI4A 3UUXB 2JMHA 3RI5A 4ICYA 2NVKX 4YTNA 1P2HA 4H4PA 3AA7B 3NN0X 4H4VA 1Z0PA 2J3NA 3FHNA 2VK9A 3LDQB 1GRTA 2CFYA 2Y6XA 2YR5A 2CBJA 1XHXA 1VBD4 2FUPA 4FJOA 2W67A 4U2ZA 4XWZA 2N2NA 3PUYF 3VRAA 4YY3T 4TV8E 2PW9A 5AQQB 1D1CA 2X50A 5EK4A 2V6YB 3HKDE 2JQKA 1KEYA 3SZFA 3UCLA 5TAOA 2TPRA 2WDRA 3GRTA 4ECHA 2IMLA 4ZXLA 3KV5A 4K2XA 1J5WA 2YM1A 3ATRA 5H6QB 3ZDNA 4XXGA 2XFNA 3FG2P 1REOA 1NG3A 3BQLA 2VURA 3C4NA 2CXLA 4PFPA 2I59A 2YLTA 3M3ZB 1WLXA 2RM24 3PUSA 1LVLA 2KLQA 3AE4A 1E1HB 2WPEA 3EABA 2UUBT 4BAYB 3O0HA 4U72A 5LJNA 5JR9B 3JADA 2GEWA 1SHZC 4ADZA 5JTGA 2Y8DA 2GR0A 2B7RA 3X1DA 3QSEA 1MOKA 4EQSA 1CJCA 5M4YA 3OKQA 1MXTA 2HN1A 3WE0A 1DU2A 3RQUA 3AAAB 2IC6A 2Y6RA 3ITJA 2ZZ0A 3AE6A 5CB4E 4UVBB 3Q5DA 2QA1A 4GF7A 4DBRA 2R4JA 1OOPD 1ZP0A 1XMOT 4APNA 4WNKA 3GQKA 4II2A 2YOEA 3QSMA 2JAEA 3PV0F 2WS3A 2LOSA 2D0TA 3CN8A 3PDYA 1H7XA 4RHV4 4U8PA 3VR9A 5CJ5A 4H2RA 4O5UA 5FMHA 1MMAA 3AEEA 3P4WA 2WWVA 3A8YC 3AAEB 1J1JA 1BGNA 1MMNA 1COYA 3ISHA 4I43B 4ZEYA 3PUXF 1QSDA 4LF8T 3F31A 3V76A 4QXHB 2IC9A 2WETA 4IVOB 4UVCB 4EIQA 5L2LA 2BS3A 4O8SA 2ODUA 1D1BA 2C72A 1ZOVA 4ILCA 3E0ZA 3PTRB 4X64T 1FL2A 2C76A 2XSBA 4YKFA 3FZLB 1S3EA 5HHFA 5LYJE 4LFBT 2E5VA 3AD7B 3O1IA 4O2BE 5HYMA 4JYAT 3DK8A 4A97A 1ELIA 1RUD4 3UP4A 1ZY8A 3L8RA 3ICSA 4H4ZA 3BI2A 1BKWA 3RF1A 1VG9A 1XWMA 3LG7A 3VKGA 3ANWA 4H4XA 3CTYA 2XY8B 1R094 2BG9C 3F2EA 1HCIA 1PXAA 5FXWA 3JC6C 2XQ9A 2LKGA 3RGLA 1W4XA 3ALMA 2YLWA 2XQ7A 5KMRA 3QC9A 4P9SA 4B68A 4D03A 2H7VC 3RC8A 4PJNA 4A6NB 1G73A 4YXDA 2X99A 5IPYA 4F8HA 2ODVA 3FPZA 1PO24 2GAGB 5JCMA 2WMOA 4U8NA 4OCGA 3BI5A 4CXYA 3MXZA 2BG9A 1H7WA 2D5UA 3GD4A 5FS6A 1Y0PA 3S4UA 3DJDA 3SQPA 4B65A 4C91A 4PK5A 2RPAA 5ADXL 4LFAT 1N32T 2IUBA 2LSJA 4G2AA 2YVJA 2OALA 2R4EA 5EOWA 4YKGA 2XAGB 1H7CA 5AQTB 5FXXA 3CWZB 4B67A 3CK6A 4K8DA 3HYXA 1L9CA 1IUVA 2DKIA 1GQEA 4H9OC 3ZLIA 1DODA 2ACXA 4AXPA 2WP5A 3T1YT 3RX6A 4DMVA 1JRYA 1Y56A 1N34T 4IA6A 4H9PC 4BJNA 4GAVA 3C4WA 1ZX9A 3N2OA 1S94A 2JK6A 3N9OA 5FNVE 2BXRA 2X68A 2ZM2A 4ZCDA 3EDUA 5JDNA 4EEBA 3GQHA 4O4JE 1F6MA 1PJ6A 3DGZA 1IUUA 1D4EA 1Z6LA 4YTMA 2MPKA 1VOMA 3UQ7A 4ANJA 4IA5A 2WDVA 3K3OA 1H83A 4X1KE 1D0ZA 3ADAB 3LOVA 3NYEA 4BV6A 2VQ7A 3BHKA 1H84A 2VRMA 2QVAA 4G9KA 2EHOC 1D4M4 2LM9A 3K3QC 2YU2A 2QRXA 1K4QA 4MHCA 1HG5A 1PXCA 4C74A 3PJAA 4QXCB 3VHLA 1DOBA 1DJQA 3T0KA 4BJYA 2B1EA 1XNRT 4Y4MA 4IE0A 5JDHA 5F8PA 4DR4T 2YG5A 4ERRA 2R7FA 3CNPA 4H4SA 2V7KA 2HPJA 2EHOA 2KWIB 3SX6A 2XHEB 4DV0T 2Q9QC 1HNXT 5KVIA 1HRI4 2X8HA 3CX6B 2RR14 1ZDLA 5FVLA 2BK3A 4ZZCA 4BA9A 4HFDA 3K7MX 5EZYE 3N9LA 1HS7A 3UFEA 3UKAA 4ASKA 2V5ZA 4YJ3E 2Y48B 3AXJA 4LMLA 3FZKB 5LXTE 3CGCA 4NZHA 3T1HT 3UKHA 4NXNT 1FOHA 5ABEA 2XLSA 2Q9QA 2FJDA 2GR1A 1V59A 3OC4A 4DSGA 4JI1T 3GD3A 1PBEA 1U4QA 3JAEA 1K0IA 4COFA 1M7KA 2WU2A 3EF6A 2KZ7B 3I0OA 3H8LA 3ZKRA 1F8RA 3HYVA 5HEOA 3NIXA 2BYBA 4O5QA 3P4SA 2R0PA 3QSSA 1GEUA 4IVMB 5J0ZA 3SS1A 4U2SA 4JI2T 4U2TA 4EZ4A 4EM4A 5L3FB 3N5LA 4DIDB 2TMDA 4LA1A 4DR7T 3J9X1 2GH5A 4GUVA 1PBBA 3GYXA 4GYSA 3RP7A 2PFVA 3RKOA 5KXJA 2JKCA 3C4AA 5HEJA 2CWYA 3NBXX 2XQ8A 4CXWA 3VU7H 2YM2A 4AOXA 5BUKA 3JD74 3C98B 2CMRA 1YKEB 2W66A 3ZMUB 2PZSA 3CPHG 2RS14 3FBLA 5HEHA 2UXBT 2H88A 3H37A 4L9IA 5IQ4A 2H7OA 2WEUA 3COXA 5HYAA 1RUF4 3ZC1A 5ETWA 4Q4V4 1E2AA 1T8BA 2KMFA 1B8SA 4DV2T 2HHHT 4AI6A 3CPIG 2X0LB 2XFQA 4NEVA 3E22E 2UXXB 5JCLA 1BR2A 4EQWA 2HH7A 2BS2A 1XANA 5L3GB 4KP3C 4PK4A 2YAUA 5ABFA 1BR4A 5FP3A 3UKLA 2HWC4 2ZLYA 3A5XA 3RPUA 3PU8A 4N78D 3EI0A 1E6EA 3AD8B 3QFBA 1RP0A 2DWGA 1OEDE 4UR9A 2MYSA 4ZOLE 2RS34 4A9WA 3DJBA 3RRWA 2FJAA 3JAFA 3AWIA 4H63H 5LG3A 1HRV4 5LHIB 1D7YA 2L8KA 3N9PA 4A98A 4U31A 4TLXA 1E1MA 1L9EA 4AKRB 1LRZA 3U78A 1YY5A 2WP6A 5FY7A 2CHNA 1WR6A 4AKGA 4CN6A 2K3WA 2JB2A 2VL8A 2VQET 3T31A 2J62A 2GR2A 3RQWA 2WP9A 3PU3A 4B64A 3ZYMA 3VRDB 4J57A 4MALA 3SGLA 4AKIA 2V5CA 4ZS2A 2E9XD 4U2LA 2X0HA 4U8JA 3EPTA 4KI0F 1XDOA 4TZ4C 3VR8A 3HKCE 2BACA 1WFDA 3R9UA 3I0QA 3R84B 1WYBA 2GAHB 5EBKA 1ZOYA 1OJTA 4I4TE 5AQHB 1IUSA 2EQ9A 1LV0A 2A2FX 2YR6A 2DHRA 2XLTA 5L3BB 2R45A 4DV6T 2YEVC 3ONLC 5AQPB 3P4RA 3UUBA 2W61A 3SFDA 5KX5E 3D8XA 3L39A 4TM0A 4ILUA 1BF3A 3PS9A 1VBE4 4YSYA 4LIIA 1CF3A 4TUYE 2FJBA 3NZQA 3JSKA 4CQIA 3LBXB 4DV4T 1DNCA 4OPGA 5JRCA 1XPQA 3DJEA 1N4WA 4DNDA 4EAHA 4HWFA 4P0AA 1BWCA 1QO8A 1VQWA 1OWAA 3JBG4 1BEV4 2RGJA 1TYPA 3IA3A 3G5SA 5L47A 1DXLA 2VOUA 1RSGA 2E2AA 3UU5A 3ONXA 4WBOA 2VVLG 3ALLA 2UXDT 1PO14 5DABA 5KMSA 3BI4A 1GV4A 4Z26A 4DUYT 2NTXA 2X0YA 5FMNA 1DJNA 4ZI2C 5DJQC 1D0XA 4B3MT 4OYJA 1E39A 2XVIA 3PUVF 2YVGA 4ZI3C 2LRKA 1ZMDA 3K30A 3RYIE 2M6BA 4ZZBA 4A79A 4Q4Y4 4Z44A 3LZWA 3DK9A 5LV9A 4XBFB 4AKLA 2C3DA 1Q1RA 4LF7T 2VKDA 4G6HA 2ZZBA 4H4TA 2V6YA 3MK7C 2R064 3UUMA 4AIUA 4Y4LA 2VWAA 4IDZA 5LP6E 1RUC4 2BDEA 5L3CB 3KVBA 2NPXA 4K7ZA 4X4JA 1CC2A 3ETVA 4UEMA 1NG4A 5JR9C 4GRTA 4HN9A 2BK5A 3CNSA 1CUNA 3E1TA 3SM8A 3NZPA 3H3AA 1WYCA 2AR8A 2HN2A 3P1WA 2L9QA 1RMU4 1IJHA 4K0UA 2XVEA 3O4XE 2A72A 3KINB 1N4VA 1WCRA 5HEGA 1CC6A 4C3XA 1N33T 4QWNB 3HR0A 3HKEE 5KMQA 3RH3A 5IQ1A 2HQMA 5JR9A 2IAKA 2XAHB 3ZSTA 3Q9DA 4YSZA 4OX9T 4J33A 2VKOA 4QKNA 4ZS3A 4YSXA 1LKXA 3MA9A 2ZM8A 4MBQA 3G06A 2WPFA 1AJ3A 5KDMC 1M6IA 2PYLA 1X31B 2YG4A 3N2GE 4B6XA 2V3BA 1ZK7A 1E7PA 3Q6JA 4IDOA 3QUJA 2B9YA 3CIRA 3Q5EA 4LF5T 1JEHA 3T14A 2JRKA 4CCRA 1LVKA 4TLZA 2APGA 3OJAA 4TN7B 1JRXA 3NG7X 4G6GA 1FEWA 2JBVA 4IL4A 2BBJA 2NW8A 4DR2T 2CA5A 1F8WA 4Z8XA 3T8OA 5KMGP 2LRLA 2JMKA 3WAKA 2RGHA 3ZT7A 4OVIA 3P8CD 2C4CA 2RMU4 3B3RA 3DMEA 3PJAJ 1FMVA 3Q5XA 5LA6E 4CZZB 3C50A 3C4XA 5FXZA 2RP4A 3LK42 4A5XA 4USQA 4H9SE 2BC1A 3ZSSA 2PYJA 4DVDA 1MNEA 2BS4A 3CPJG 4CCQA 4JEUB 4ISTA 4TWDA 1B5QA 1K0JA 2CEAA 2GQFA 2WOIA 3NH3X 5JQGE 3C4ZA 3NKSA 3W15B 3J7Yq 2ACZA 3ICRA 5GONE 2CXFA 2H89A 1WRDA 2A3DA 1EBDA 2PTFA 3IF8B 3ZMZB 3GMCA 2WAUA 5KWFA 2NOXA 4JI6T 2W00A 3NN6X 3KU9A 4PK6A 1ZV4X 1EL8A 1Z8UA 5HXCA 5LOVE 3UKKA 4J36A 4Z91A 4KHPT 4HWHA 2V3AA 4B63A 4DV1T 3AE2A 2D0UA 5KMPA 1MMDA 3DP7A 1YKJA 2W0GA 1IJ6A 4QHOA 5EK2A 3CNDA 2I0ZA 2ZBWA 2JB3A 5LGNB 2BCGG 5AQIB 5BVAA 1YW0A 3ZEFB 2K24A 4H4YA 3FBSA 4U8IA 1EV14 2KWHA 4OPTA 3UOVA 3V5SA 1VRH4 2WM9A 3AA0B 2B76A 4EYYR 3TKLB 2X51A 1J5ET 3F8RA 4HFIA 4EEDA 2YR4A 1XZYA 1F8SA 4A65A 3RKGA 4E7SA 1PBCA 3N9MA 3P9UA 1Y64B 1KSUA 1P2EA 3PUWF 3JCFA 4JLEA 3LJPA 4A6NA 2XQ5A 4HWCA 2M6IA 4U8KA 4IDPA 4TNWA 1GALA 3KV6A 3AE9A 4O4HE 3AE1A 4X1IE 1S35A 1KDGA 3H4KA 3UT5E 4OPIA 4U7YA 4CI3B 3CX7B 2Q7VA 4CNJA 4HFVA 2PLV4 2YN6A 3SXIA 2CCQA 2LSGA 4U7IA 3CPZA 2WZHA 3AE7A 3KKJA 2QYWA 3SY4A 2WOVA 3NRNA 4H7UA 2RABA 3NT6A 4I59A 2K9AA 2X67A 3P7IA 3TLWA 3PE0A 4GOUA 1HR0T 4A99A 4P09A 2V6OA 3ZJ1A 1M64A 2ZM0A 3KVEA 5AQVB 3T37A 1YQZA 2X3NA 4WW0A 5HEUA 4UDRA 3QOFA 5JDQA 4J31A 1GNDA 4TM3A 2PY5A 2RS54 4RG4A 1QUUA 2CHOA 4Z43A 2QGSA 3T2KA 4DBQA 2XJ7A 4ZHQE 3L1RA 1XMQT 1PVC4 3PUQA 4EM3A 3I1AA 4KX6A 3QJ4A 1GXFA 3NKZA 1VCSA 5AQNB 1OXZA 2KSRA 3ZYXA 1VDCA 1W09A 1H8TD 3TLUA 3AAIA 1K5MD 3WAJA 3LZXA 1OEDC 1ZEEA 3UTEA 3UU8A 1PHHA 1ZHCA 1FEBA 5CKUA 2XLPA 1RUI4 1HFAA 5FL1A 4EMIA 2IDOB 2BVMA 1DOEA 3BQIA 1UGOA 3OPCA 1H82A 2V26A 2CBIA 2XZEA 3IEEA 4OHFA 2XAFB 2W62A 1PJ7A 3LJCA 4B3ST 5C8YE 4PNIA 5JREA 2XASB 5LGTB 4B1BA 3NRXA 1Z7S4 2BKOA 1TRBA 2WQYA 1OEDA 2C67A 2QAEA 3DTOA 4K5SA 1YD8G 2X8GA 2YU1A 4HWDA 3GDNA 4II3A 1NHSA 3K7TA 2C73A 4HB9A 2YQUA 2PG8A 2EQ6A 2Q0LA 4B69A 3NYFA 3RNMA 1LQUA 4CI1B 1GT8A 4ZI7E 1FCDA 2P9BA 2Z5YA 3HZLA 5AQKB 1VG0A 4Q4X4 1UURA 2EQ7A 4Q25A 1NHRA 3IBPA 4NUUA 3BQKA 2YLRA 5ABHA 5LCYA 2WBAA 3J8F4 2Y6QA 1RUJ4 1SEZA 2E9XB 5EB4A 4DMWA 1NENA 4PJLA 2WESA 2MBGA 5HXEA 2KNDA 2VVNA 2CLYB 2E1MA 3F8PA 3I6DA 3II4A 4EGWA 2CPTA 2V8SV 2LE8A 2GQWA 4HEAA 5U63A 3KLJA 1OJ9A 1JOAA 4UDPA 4EMWA 1MIYA 1AL24 3ZYKA 4X66T 1X79A 4DNAA 4A7AA 1CBOA 5EK3A 2BABA 3ZJ2A 2G0UA 3ZCJA 4J34A 5FXVA 1VCTA 2X9XA 1RUH4 2LT3A 4A56A 3K7QX 5ABGA 1GESA 2D9DA 1RVF4 2DLRA 3LADA 4Y4NA 1PJ5A 2X9WA 2Z6EA 1EL9A 3K3NA 2VRLA 3UTGA 3ZT6A 1MO9A 1IBKT 1COV4 4GB34 2W2UA 3AA6B 3C51A 5JH7E 3VQRA 2C75A 3KPKA 2M67A 2VASA 4HFBA 1NA1D 2XM2A 2BBHA 4GAPA 4GR1A 3I9WA 3AXJB 3GMBA 5F5WA 1GRBA 1X9BA 4MJWA 4C77A 3MZKB 2V7IA 1GTEA 3NTAA 2J47A 2WDQA 3C64A 4O4IE 2HWB4 1KFYA 4GIWA 3ZC0A 4NUVA 4TWHA 1FECA 4H9NC 4YHJA 2CRBA 1G8XA 4K22A 2K48A 4ADWA 3SFEA 2ARDA 3KA7A 4J2CA 1CC4A 3JC6D 3CQXC 3EHZA 4UV9B 5FKYA 2NP9A 2W4XA 2FBWA 2I0MA 1D1AA 4YHHT 1GRHA 4P0BA 4BJMA 4YWOA 4JI7T 1JNRA 1TYTA 3UQ4A 3EAOA 2CM0A 3IHMA 2WU5A 3FZFB 4NEWA 1GRFA 3ZMTB 2VVLA 5AQJB 3UU3A 4X1YE 1NDAA 4JBWF
chains in the Genus database with same CATH topology
3UOXA 1E39A 2XVIA 3AEBA 4O5UA 5FMHA 2YVGA 1CJ4A 3DJGX 3AEEA 4J2WA 5KRQA 1E1LA 1ZMDA 1BGNA 2A8XA 3K30A 1COYA 3ISHA 1K0LA 5JCNA 1GETA 4A79A 1Y56B 4Z44A 3LZWA 3DK9A 2UZZA 3AB1A 3S5WA 5LV9A 3SZWA 3V76A 5U25A 2C3DA 1Q1RA 3GDPA 4G6HA 4XWRA 2ZZBA 4H4TA 3FMWA 2WETA 1PS9A 4IVOB 4Y4LA 4D04A 4EIQA 3SUCA 2PHHA 3B6DA 2BS3A 2XLUA 4BJZA 4YSHA 2NPXA 2C72A 1ZOVA 4K7ZA 3RP8A 2BRYA 4X4JA 2FJEA 3UOZA 3PVCA 1CC2A 3NHOX 2A89A 1PBDA 1FL2A 2C76A 4YKFA 1NG4A 1S3EA 3QVPA 4GRTA 3PO7A 5HHFA 4YTPA 2BK5A 3CNSA 2E5VA 2YG6A 3AD7B 3E1TA 3SM8A 5HYMA 1BGJA 4WCTA 4JY2A 3DK8A 4UP3A 1ELIA 3CNJA 3UTHA 3UP4A 1VRQB 2F5ZA 1ZY8A 2AR8A 2C70A 4FK1C 2IIDA 3ICSA 5EB5A 4H4ZA 3BI2A 1BKWA 1EL7A 2WPCA 5DBJA 3P1WA 5ER0A 1TDKA 5TR3A 1IJHA 1VG9A 2W0HA 2XVEA 4GDEA 1H86A 1N4VA 4H4XA 3CTYA 4DSHA 1CC6A 4C3XA 4JQ9A 2WHDA 2YLSA 4CY8A 3LB8A 2CULA 1PXAA 5KMQA 5IQ1A 1W4XA 2HQMA 3ALMA 3M13A 5FS7A 2YLWA 2XVJA 5KMRA 1S2QA 4YSZA 1GERA 4G74A 4J33A 4P9SA 4B68A 2XFOA 4D03A 4YSXA 1N1PA 4FK1A 4OPUA 1F3PA 2XFPA 2AQJA 1D7LA 4GCMA 3G5RA 4U8LA 1ZKQA 4A6NB 1GTHA 4YXDA 1QLBA 1S2YA 2VQBA 2A87A 2WPFA 4AOSA 2X99A 1M6IA 4LU6A 5IPYA 5JCKA 2B7SA 1X31B 2YG4A 3G5QA 3FPZA 1TDFA 2GAGB 2V3BA 1ZK7A 1E7PA 4U8MA 4U8OA 3Q6JA 3UKQA 2V60A 3V3NA 5JCMA 4H4WA 4OPCA 4U8NA 3CMMA 2B9YA 3CIRA 3BI5A 4OCGA 4DGKA 1JEHA 4RSLA 3T14A 4CCRA 5C3JA 4NTEA 1H7WA 3M12A 2BCPA 3GD4A 5HY5A 4TLZA 2APGA 5FS6A 1Y0PA 1JRXA 3NG7X 4G6GA 2JBVA 1KNPA 3DJDA 1Q1WA 3SQPA 4RG3A 1KF6A 4B65A 1F8WA 4JN9A 3AXBA 2IVDA 1D5TA 2RGHA 2YVJA 4GDPA 4OVIA 1H81A 4N9XA 2OALA 2R4EA 5EOWA 4YKGA 2C4CA 3UKFA 1HYUA 3IC9A 3B3RA 3DMEA 3NK2X 1H6VA 2YG7A 5KVHA 4B67A 1TDOA 1EL5A 4K8DA 3ATQA 1NHPA 2E4GA 3HYXA 1L9CA 1NPXA 1YQ4A 1L0VA 2DKHA 1IUVA 4JY3A 2DKIA 5FS9A 4USQA 1DODA 2BC1A 2BS4A 3CPJG 4CCQA 3AECA 2WP5A 1JRYA 4H2QA 1B5QA 1K0JA 2GQFA 1Y56A 2WOIA 3NH3X 4IA6A 3ICTA 4GAVA 3NKSA 5M0ZA 1GSNA 2R0CA 2ACZA 3QVRA 2GVCA 1ZX9A 3ICRA 4H2NA 5M10A 3DGHA 2H89A 1EBDA 1IUWA 3GMCA 3BHFA 4H4UA 1GRGA 1XDIA 2JK6A 5KWFA 5KNLA 3AYJA 2VVMA 4B66A 3NN6X 2C7GA 2BXRA 3KU9A 1DOCA 1KSSA 4ZCDA 1EL8A 4I58A 1GOSA 2R0GA 3UKKA 4J36A 4X9MA 4EMJA 3GQHA 2V3AA 1F6MA 1PJ6A 3DGZA 1IUUA 1D4EA 1Z6LA 4YTMA 4B63A 1O5WA 2GMHA 3AE2A 3NYCA 1L9DA 5KMPA 2VZ2A 4IA5A 1YKJA 5U1OA 2WDVA 3IF9A 1H83A 2Z5XA 2I0ZA 3CNDA 2ZBWA 3ADAB 2JB3A 3LOVA 3NYEA 2BCGG 4BV6A 2VQ7A 3BHKA 5BVAA 1H84A 3M0OA 1O95A 2VRMA 4G9KA 4J56A 4H4YA 4UDQA 3D1CA 1IUXA 3FBSA 4U8IA 4OPTA 4YT0A 1K4QA 3UOVA 4G73A 1PXCA 4C74A 2XDOA 1DOBA 1DJQA 3GYIA 3AEGA 3T0KA 4BJYA 5BRTA 1O94A 2B76A 1D4DA 3F8RA 4Y4MA 5CQFA 2OLNA 5BULA 4TM1A 1B4VA 2YR4A 5KOWA 4PAAA 1F8SA 4A65A 1N4UA 2YG5A 5J60A 4C3YA 2V61A 1PBCA 1OJAA 4OPLA 3CNPA 1TDNA 3P9UA 4H4SA 1KSUA 1KNRA 1P2EA 4CRTA 3QFAA 3LJPA 4A6NA 3AE8A 3SX6A 4U8KA 1XHCA 1GALA 5GRTA 5KVIA 4E0VA 2GV8A 2X8HA 3AE9A 5C2TA 4AT2A 1ZDLA 3AE1A 1KDGA 2BK3A 2EQ8A 2RGOA 2YLXA 3AYIA 3UP5A 3H4KA 1FEAA 3ABVA 1OJDA 4IV9A 1LQTA 3K7MX 3T2YA 2QCUA 3H8IA 4OPIA 2Q7VA 4CNJA 3UKAA 3P4QA 3ALJA 1NEKA 5L46A 3UKPA 2GF3A 4K5RA 3SXIA 3GSIA 1ZMCA 2V5ZA 4Z2RA 1S3BA 5FS8A 2YG3A 3GYJA 3CGCA 4NZHA 5JCIA 3AE7A 3KKJA 3UKHA 2XVHA 1FOHA 4AP1A 1AOGA 1YQ3A 2XLSA 2FJDA 2GR1A 1V59A 3BNUA 3AD9B 3OC4A 2OLOA 4PABA 3SY4A 4DSGA 2WOVA 3NNEA 1PN0A 3NRNA 3S61A 3AEFA 4H7UA 2RABA 3GD3A 1PBEA 2BA9A 3NT6A 1JNZA 4I59A 1K0IA 3L8KA 3NLCA 3NTDA 1GRAA 1B37A 3NK1X 2WU2A 3EF6A 4EIPA 3SZ0A 3H8LA 4A99A 1F8RA 2V6OA 3HYVA 3NIXA 2IVEA 2BYBA 2OA1A 2GRTA 3DK4A 4O5QA 3P4SA 1M64A 3KD9A 3RHAA 3KVEA 5KOXA 2R0PA 3QSSA 1PBFA 1GEUA 4IVMB 3F8DA 3CGDA 4EQRA 4U2SA 3AEAA 4U2TA 4NTDA 1YQZA 2X3NA 2PYXA 3T37A 4EM4A 3T2ZA 4CY6A 4LA1A 3I3LA 2TMDA 4UDRA 1CL0A 4HA6A 2R46A 4J31A 2AAQA 2GH5A 1BZLA 1GNDA 1E1KA 4GUVA 4TM3A 1PBBA 3GYXA 4RG4A 3URHA 3RP7A 2C64A 4NTCA 5KXJA 4JNAA 1RYIA 2JKCA 4X9NA 4JNQA 4Z43A 3T2KA 4FX9A 1CHUA 3UOYA 2BXSA 3L1RA 3C4AA 4M52A 1IUTA 4CNKA 4EM3A 2BRAA 4Z2TA 4KX6A 3QJ4A 2O9ZA 2WOWA 1GXFA 3V3OA 4AP3A 3IWAA 3KPFA 3SZCA 3BNMA 2YM2A 4CBQA 3AEDA 4AOXA 5BUKA 3ZYXA 1VDCA 1D4CA 2QA2A 3CPHG 2XCGA 4Z24A 3LZXA 4Z2UA 3UTEA 2H88A 2GB0A 3VRBA 1PHHA 4USRA 5IQ4A 1FEBA 2WEUA 3COXA 3EANA 1ONFA 4H2PA 4OPDA 2XLPA 4NNJA 5CKUA 3UTFA 1LJ1A 4EMIA 4KPRA 1PXBA 2GR3A 1B8SA 1JRZA 1DOEA 4H4QA 3CPIG 4WX1A 2XFQA 3SYIA 1H82A 4NEVA 3DJJA 1GPEA 5JCLA 2BC0A 2Q0KA 3IHGA 2C65A 4EQWA 1NAAA 4FDCB 2BS2A 1JU2A 1XANA 1OJCA 2ZZCA 1PJ7A 2JB1A 3CNTA 4TM4A 2YAUA 4B1BA 4ICYA 2NVKX 3UKLA 1TRBA 4YTNA 2WQYA 1P2HA 2C67A 2QAEA 3Q9TA 4H4PA 4K5SA 4H4VA 3NN0X 4ZCCA 2X8GA 2YLZA 1GREA 1E6EA 2J3NA 3AD8B 3QFBA 1RP0A 5HXIA 3GDNA 1GRTA 2CFYA 1NHSA 4II3A 2YR5A 3K7TA 4BURA 2C73A 4HB9A 4XWZA 4A9WA 1QJDA 2YQUA 3LXDA 2EQ6A 2Q0LA 2FJAA 4B69A 3VRAA 3AWIA 3NYFA 3RNMA 1LQUA 2B9WA 1GT8A 1D7YA 4AT0A 1FCDA 2Z5YA 3GWDA 3HZLA 2X50A 4TLXA 2XVFA 1VG0A 1E1MA 1L9EA 2C3CA 2EQ7A 1YY5A 2WP6A 1NHRA 3SZFA 3REDA 4NWZA 2YLRA 3UCLA 2BK4A 3CGBA 2WBAA 2TPRA 2WDRA 2Y6QA 3GRTA 4ECHA 2JB2A 1SEZA 4K2XA 5EB4A 1E1NA 1NENA 3T31A 2WESA 2GR2A 2YM1A 3ATRA 3P4PA 4H4RA 2E1MA 2WP9A 3ZDNA 3F8PA 3I6DA 3II4A 2GQWA 4XXGA 4B64A 2XFNA 3FG2P 5U63A 3KLJA 1REOA 1NG3A 3VRDB 4J57A 4REKA 2B9XA 3SGLA 1OJ9A 2CVJA 1JOAA 3OZ2A 4U2LA 4UDPA 4EMWA 3C4NA 2XLRA 4U8JA 1NHQA 3EPTA 4DNAA 2YLTA 4A7AA 1CBOA 2BABA 3C96A 3VR8A 2BACA 3R9UA 1LVLA 3GWFA 4J34A 4A5LA 3AE4A 2GAHB 1PDHA 2C66A 3K7QX 2WPEA 5EBKA 4Z25A 1ZOYA 1GESA 1OJTA 1IUSA 3FIMB 4C5OA 3RP6A 3AYLA 3O0HA 2EQ9A 1LV0A 2YR6A 2R9ZA 3LADA 1LTXR 2XLTA 1PJ5A 1LPFA 2GEWA 4Y4NA 2R45A 3DA1A 1EL9A 2VRLA 3UTGA 4JDRA 3P4RA 2GR0A 2GMJA 4EQXA 3SFDA 1CJ2A 1MO9A 2B7RA 3D8XA 2X8CA 3QSEA 4TM0A 1MOKA 1BF3A 3NGCX 3PS9A 1CJ3A 1CJCA 4EQSA 3VQRA 4YSYA 2C75A 3KPKA 4LIIA 1CF3A 1MXTA 4ZN0A 3WE0A 2FJBA 3JSKA 4GAPA 4GR1A 4BK1A 3GMBA 1DNCA 1GRBA 2OAMA 2Q6UA 4OPGA 4C77A 4MJWA 2Y6RA 1XPQA 3NK0X 3ITJA 1GTEA 2ZZ0A 3AE6A 2WDQA 1N4WA 2CDUA 3DJEA 2YWLA 3NTAA 1KFYA 5GSNA 2XFUA 4GF7A 2QA1A 1BWCA 1FECA 1QO8A 1VQWA 3HYWA 5J7XA 3AE3A 2R4JA 2RGJA 1Q9IA 1ZP0A 2XYOA 1TYPA 4K22A 3G5SA 4ADWA 3SFEA 1DXLA 2ARDA 3KA7A 2VOUA 1CC4A 4APNA 3GRSA 1RSGA 2VVLG 4BK2A 2FBWA 3ALLA 3GQKA 4II2A 1GRHA 3AE5A 2LFCA 4YWOA 1JNRA 1TYTA 2YVFA 2JAEA 3QSMA 4BK3A 5KMSA 3EAOA 3BI4A 2WS3A 1GV4A 2WU5A 3DH9A 3IHMA 4H50A 4NEWA 3CN8A 1H7XA 1GRFA 2VVLA 4Z26A 4U8PA 3VR9A 3CGEA 4H2RA 1DJNA 1UKVG 1NDAA 1TDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOX A;  1E39 A;  2XVI A;  3AEB A;  4O5U A;  5FMH A;  2YVG A;  1CJ4 A;  3DJG X;  3AEE A;  4J2W A;  5KRQ A;  1E1L A;  1ZMD A;  1BGN A;  2A8X A;  3K30 A;  1COY A;  3ISH A;  1K0L A;  5JCN A;  1GET A;  4A79 A;  1Y56 B;  4Z44 A;  3LZW A;  3DK9 A;  2UZZ A;  3AB1 A;  3S5W A;  5LV9 A;  3V76 A;  5U25 A;  2C3D A;  1Q1R A;  3GDP A;  4XWR A;  2ZZB A;  4H4T A;  3FMW A;  2WET A;  1PS9 A;  4IVO B;  4Y4L A;  4D04 A;  4EIQ A;  3SUC A;  2PHH A;  3B6D A;  2BS3 A;  2XLU A;  4BJZ A;  4YSH A;  2NPX A;  2C72 A;  1ZOV A;  4K7Z A;  3RP8 A;  4X4J A;  3UOZ A;  2FJE A;  3PVC A;  1CC2 A;  3NHO X;  2A89 A;  1PBD A;  1FL2 A;  2C76 A;  4YKF A;  1NG4 A;  1S3E A;  3QVP A;  4GRT A;  3PO7 A;  5HHF A;  4YTP A;  2BK5 A;  3CNS A;  2E5V A;  2YG6 A;  3AD7 B;  3E1T A;  3SM8 A;  5HYM A;  1BGJ A;  4WCT A;  4JY2 A;  3DK8 A;  4UP3 A;  1ELI A;  3CNJ A;  3UTH A;  3UP4 A;  1VRQ B;  2F5Z A;  1ZY8 A;  2AR8 A;  2C70 A;  4FK1 C;  2IID A;  3ICS A;  5EB5 A;  4H4Z A;  3BI2 A;  1BKW A;  1EL7 A;  2WPC A;  5DBJ A;  3P1W A;  5ER0 A;  1TDK A;  5TR3 A;  1IJH A;  1VG9 A;  2W0H A;  2XVE A;  4GDE A;  1H86 A;  1N4V A;  4H4X A;  3CTY A;  4DSH A;  1CC6 A;  4C3X A;  4JQ9 A;  2WHD A;  2YLS A;  4CY8 A;  3LB8 A;  2CUL A;  1PXA A;  5IQ1 A;  1W4X A;  2HQM A;  3ALM A;  3M13 A;  5FS7 A;  2YLW A;  2XVJ A;  1S2Q A;  4YSZ A;  1GER A;  4J33 A;  4P9S A;  4B68 A;  2XFO A;  4D03 A;  4YSX A;  1N1P A;  4FK1 A;  4OPU A;  1F3P A;  2XFP A;  2AQJ A;  1D7L A;  4GCM A;  3G5R A;  4U8L A;  1ZKQ A;  4A6N B;  1GTH A;  4YXD A;  1QLB A;  1S2Y A;  2VQB A;  2A87 A;  2WPF A;  4AOS A;  2X99 A;  1M6I A;  4LU6 A;  5IPY A;  5JCK A;  2B7S A;  1X31 B;  2YG4 A;  3G5Q A;  3FPZ A;  1TDF A;  2GAG B;  2V3B A;  1ZK7 A;  1E7P A;  4U8M A;  4U8O A;  3Q6J A;  3UKQ A;  2V60 A;  3V3N A;  5JCM A;  4H4W A;  4OPC A;  4U8N A;  4OCG A;  2B9Y A;  3CIR A;  3BI5 A;  4DGK A;  1JEH A;  4RSL A;  4CCR A;  5C3J A;  4NTE A;  1H7W A;  3M12 A;  2BCP A;  3GD4 A;  5HY5 A;  4TLZ A;  2APG A;  5FS6 A;  1Y0P A;  1JRX A;  3NG7 X;  2JBV A;  1KNP A;  3DJD A;  1Q1W A;  3SQP A;  4RG3 A;  1KF6 A;  4B65 A;  1F8W A;  4JN9 A;  3AXB A;  2IVD A;  1D5T A;  2RGH A;  2YVJ A;  4GDP A;  4OVI A;  1H81 A;  4N9X A;  2OAL A;  2R4E A;  5EOW A;  4YKG A;  3UKF A;  1HYU A;  3IC9 A;  3B3R A;  3DME A;  3NK2 X;  1H6V A;  2YG7 A;  5KVH A;  4B67 A;  1TDO A;  1EL5 A;  4K8D A;  3ATQ A;  1NHP A;  2E4G A;  1L9C A;  1NPX A;  1YQ4 A;  1L0V A;  2DKH A;  1IUV A;  4JY3 A;  2DKI A;  5FS9 A;  4USQ A;  1DOD A;  2BC1 A;  2BS4 A;  3CPJ G;  4CCQ A;  3AEC A;  2WP5 A;  1JRY A;  4H2Q A;  1B5Q A;  1K0J A;  2GQF A;  1Y56 A;  2WOI A;  3NH3 X;  4IA6 A;  3ICT A;  3NKS A;  5M0Z A;  1GSN A;  2R0C A;  2ACZ A;  3QVR A;  2GVC A;  1ZX9 A;  3ICR A;  4H2N A;  5M10 A;  3DGH A;  2H89 A;  1EBD A;  1IUW A;  3GMC A;  3BHF A;  4H4U A;  1GRG A;  1XDI A;  2JK6 A;  5KWF A;  3AYJ A;  2VVM A;  4B66 A;  3NN6 X;  2C7G A;  2BXR A;  3KU9 A;  1DOC A;  1KSS A;  4ZCD A;  1EL8 A;  4I58 A;  1GOS A;  2R0G A;  3UKK A;  4J36 A;  4X9M A;  4EMJ A;  3GQH A;  2V3A A;  1F6M A;  1PJ6 A;  3DGZ A;  1IUU A;  1D4E A;  1Z6L A;  4YTM A;  4B63 A;  1O5W A;  2GMH A;  3AE2 A;  3NYC A;  1L9D A;  2VZ2 A;  4IA5 A;  1YKJ A;  5U1O A;  2WDV A;  3IF9 A;  1H83 A;  2Z5X A;  2I0Z A;  3CND A;  2ZBW A;  3ADA B;  2JB3 A;  3LOV A;  3NYE A;  2BCG G;  4BV6 A;  2VQ7 A;  3BHK A;  5BVA A;  1H84 A;  3M0O A;  1O95 A;  2VRM A;  4J56 A;  4H4Y A;  4UDQ A;  3D1C A;  1IUX A;  3FBS A;  4U8I A;  4OPT A;  4YT0 A;  1K4Q A;  3UOV A;  1PXC A;  4C74 A;  2XDO A;  1DOB A;  1DJQ A;  3GYI A;  3AEG A;  4BJY A;  5BRT A;  1O94 A;  2B76 A;  1D4D A;  3F8R A;  4Y4M A;  5CQF A;  2OLN A;  5BUL A;  4TM1 A;  1B4V A;  2YR4 A;  5KOW A;  4PAA A;  1F8S A;  4A65 A;  1N4U A;  2YG5 A;  5J60 A;  4C3Y A;  2V61 A;  1PBC A;  1OJA A;  4OPL A;  3CNP A;  1TDN A;  3P9U A;  4H4S A;  1KSU A;  1KNR A;  1P2E A;  4CRT A;  3QFA A;  3LJP A;  4A6N A;  3AE8 A;  4U8K A;  1XHC A;  1GAL A;  5GRT A;  5KVI A;  4E0V A;  2GV8 A;  2X8H A;  3AE9 A;  5C2T A;  4AT2 A;  1ZDL A;  3AE1 A;  1KDG A;  2BK3 A;  2EQ8 A;  2RGO A;  2YLX A;  3AYI A;  3UP5 A;  3H4K A;  1FEA A;  3ABV A;  1OJD A;  4IV9 A;  1LQT A;  3K7M X;  2QCU A;  3H8I A;  4OPI A;  2Q7V A;  4CNJ A;  3UKA A;  3P4Q A;  3ALJ A;  1NEK A;  5L46 A;  3UKP A;  2GF3 A;  4K5R A;  3GSI A;  1ZMC A;  2V5Z A;  4Z2R A;  1S3B A;  5FS8 A;  2YG3 A;  3GYJ A;  3CGC A;  4NZH A;  5JCI A;  3AE7 A;  3KKJ A;  3UKH A;  2XVH A;  1FOH A;  4AP1 A;  1AOG A;  1YQ3 A;  2XLS A;  2FJD A;  2GR1 A;  1V59 A;  3BNU A;  3AD9 B;  3OC4 A;  2OLO A;  4PAB A;  4DSG A;  2WOV A;  3NNE A;  1PN0 A;  3NRN A;  3S61 A;  3AEF A;  4H7U A;  2RAB A;  3GD3 A;  1PBE A;  2BA9 A;  3NT6 A;  1JNZ A;  4I59 A;  1K0I A;  3L8K A;  3NLC A;  3NTD A;  1GRA A;  1B37 A;  3NK1 X;  2WU2 A;  3EF6 A;  4EIP A;  3H8L A;  4A99 A;  1F8R A;  2V6O A;  3NIX A;  2IVE A;  2BYB A;  2OA1 A;  2GRT A;  3DK4 A;  4O5Q A;  3P4S A;  1M64 A;  3KD9 A;  3RHA A;  3KVE A;  5KOX A;  2R0P A;  3QSS A;  1PBF A;  1GEU A;  4IVM B;  3F8D A;  3CGD A;  4EQR A;  4U2S A;  3AEA A;  4U2T A;  4NTD A;  1YQZ A;  2X3N A;  2PYX A;  3T37 A;  4EM4 A;  4CY6 A;  4LA1 A;  3I3L A;  2TMD A;  4UDR A;  1CL0 A;  4HA6 A;  2R46 A;  4J31 A;  2AAQ A;  2GH5 A;  1BZL A;  1GND A;  1E1K A;  4GUV A;  4TM3 A;  1PBB A;  3GYX A;  4RG4 A;  3URH A;  3RP7 A;  2C64 A;  4NTC A;  5KXJ A;  4JNA A;  1RYI A;  2JKC A;  4X9N A;  4JNQ A;  4Z43 A;  4FX9 A;  1CHU A;  3UOY A;  2BXS A;  3L1R A;  3C4A A;  4M52 A;  1IUT A;  4CNK A;  4EM3 A;  4Z2T A;  4KX6 A;  3QJ4 A;  2O9Z A;  2WOW A;  1GXF A;  3V3O A;  4AP3 A;  3IWA A;  3KPF A;  3BNM A;  2YM2 A;  4CBQ A;  3AED A;  4AOX A;  5BUK A;  3ZYX A;  1VDC A;  1D4C A;  2QA2 A;  3CPH G;  2XCG A;  4Z24 A;  3LZX A;  4Z2U A;  3UTE A;  2H88 A;  2GB0 A;  3VRB A;  1PHH A;  4USR A;  5IQ4 A;  1FEB A;  2WEU A;  3COX A;  3EAN A;  1ONF A;  4H2P A;  4OPD A;  2XLP A;  5CKU A;  3UTF A;  1LJ1 A;  4EMI A;  4KPR A;  1PXB A;  2GR3 A;  1B8S A;  1JRZ A;  1DOE A;  4H4Q A;  3CPI G;  4WX1 A;  2XFQ A;  1H82 A;  4NEV A;  3DJJ A;  1GPE A;  5JCL A;  2BC0 A;  2Q0K A;  3IHG A;  2C65 A;  4EQW A;  1NAA A;  4FDC B;  2BS2 A;  1JU2 A;  1XAN A;  1OJC A;  2ZZC A;  1PJ7 A;  2JB1 A;  3CNT A;  4TM4 A;  2YAU A;  4B1B A;  4ICY A;  2NVK X;  3UKL A;  1TRB A;  4YTN A;  2WQY A;  1P2H A;  2C67 A;  2QAE A;  3Q9T A;  4H4P A;  4K5S A;  4H4V A;  3NN0 X;  4ZCC A;  2X8G A;  2YLZ A;  1GRE A;  1E6E A;  2J3N A;  3AD8 B;  3QFB A;  1RP0 A;  5HXI A;  3GDN A;  1GRT A;  2CFY A;  1NHS A;  2YR5 A;  3K7T A;  4BUR A;  2C73 A;  4HB9 A;  4XWZ A;  4A9W A;  1QJD A;  2YQU A;  3LXD A;  2EQ6 A;  2Q0L A;  2FJA A;  4B69 A;  3VRA A;  3AWI A;  3NYF A;  3RNM A;  1LQU A;  2B9W A;  1GT8 A;  1D7Y A;  4AT0 A;  1FCD A;  2Z5Y A;  3GWD A;  3HZL A;  2X50 A;  4TLX A;  2XVF A;  1VG0 A;  1E1M A;  1L9E A;  2C3C A;  2EQ7 A;  1YY5 A;  2WP6 A;  1NHR A;  3RED A;  2YLR A;  3UCL A;  2BK4 A;  3CGB A;  2WBA A;  2TPR A;  2WDR A;  2Y6Q A;  3GRT A;  4ECH A;  2JB2 A;  1SEZ A;  4K2X A;  5EB4 A;  1E1N A;  1NEN A;  2WES A;  2GR2 A;  2YM1 A;  3ATR A;  3P4P A;  4H4R A;  2E1M A;  2WP9 A;  3ZDN A;  3F8P A;  3I6D A;  3II4 A;  2GQW A;  4XXG A;  4B64 A;  2XFN A;  3FG2 P;  5U63 A;  3KLJ A;  1REO A;  1NG3 A;  3VRD B;  4J57 A;  4REK A;  2B9X A;  3SGL A;  1OJ9 A;  2CVJ A;  1JOA A;  3OZ2 A;  4U2L A;  4UDP A;  4EMW A;  3C4N A;  2XLR A;  4U8J A;  1NHQ A;  3EPT A;  4DNA A;  2YLT A;  4A7A A;  1CBO A;  2BAB A;  3C96 A;  3VR8 A;  2BAC A;  3R9U A;  1LVL A;  3GWF A;  4J34 A;  4A5L A;  3AE4 A;  2GAH B;  1PDH A;  2C66 A;  3K7Q X;  2WPE A;  5EBK A;  4Z25 A;  1ZOY A;  1GES A;  1OJT A;  1IUS A;  3FIM B;  4C5O A;  3RP6 A;  3AYL A;  3O0H A;  2EQ9 A;  1LV0 A;  2YR6 A;  2R9Z A;  3LAD A;  1LTX R;  2XLT A;  1PJ5 A;  1LPF A;  2GEW A;  4Y4N A;  2R45 A;  3DA1 A;  1EL9 A;  2VRL A;  3UTG A;  4JDR A;  3P4R A;  2GR0 A;  2GMJ A;  4EQX A;  3SFD A;  1CJ2 A;  1MO9 A;  2B7R A;  3D8X A;  2X8C A;  3QSE A;  4TM0 A;  1MOK A;  1BF3 A;  3NGC X;  3PS9 A;  1CJ3 A;  1CJC A;  4EQS A;  3VQR A;  4YSY A;  2C75 A;  4LII A;  1CF3 A;  1MXT A;  4ZN0 A;  3WE0 A;  2FJB A;  3JSK A;  4GR1 A;  4BK1 A;  3GMB A;  1DNC A;  1GRB A;  2OAM A;  2Q6U A;  4OPG A;  4C77 A;  4MJW A;  2Y6R A;  1XPQ A;  3NK0 X;  3ITJ A;  1GTE A;  2ZZ0 A;  3AE6 A;  2WDQ A;  1N4W A;  2CDU A;  3DJE A;  2YWL A;  3NTA A;  1KFY A;  5GSN A;  2XFU A;  4GF7 A;  2QA1 A;  1BWC A;  1FEC A;  1QO8 A;  1VQW A;  5J7X A;  3AE3 A;  2R4J A;  2RGJ A;  1Q9I A;  1ZP0 A;  2XYO A;  1TYP A;  4K22 A;  3G5S A;  4ADW A;  3SFE A;  1DXL A;  2ARD A;  3KA7 A;  2VOU A;  1CC4 A;  4APN A;  3GRS A;  1RSG A;  2VVL G;  4BK2 A;  2FBW A;  3ALL A;  3GQK A;  1GRH A;  3AE5 A;  2LFC A;  4YWO A;  1JNR A;  1TYT A;  2YVF A;  2JAE A;  3QSM A;  4BK3 A;  3EAO A;  3BI4 A;  2WS3 A;  1GV4 A;  2WU5 A;  3DH9 A;  3IHM A;  4H50 A;  4NEW A;  3CN8 A;  1H7X A;  1GRF A;  2VVL A;  4Z26 A;  4U8P A;  3VR9 A;  3CGE A;  4H2R A;  1DJN A;  1UKV G;  1NDA A;  1TDE A; 
#chains in the Genus database with same CATH topology
 4U33 A;  3UOX A;  3RIF A;  2H3R A;  2EX3 A;  1U5P A;  5DQW A;  5AQM B;  3HKB E;  3DJG X;  1SA0 E;  4TNV A;  4B3R T;  1E1L A;  4TV9 E;  4JI5 T;  2A8X A;  5JCN A;  1GET A;  3S5W A;  2UZZ A;  4L0R A;  3SZW A;  5U25 A;  1IZN B;  2R6G F;  2UUC T;  3FMW A;  1PS9 A;  4PJJ A;  3SUC A;  2PHH A;  2VKH A;  2XLU A;  2LJL A;  4PW8 A;  4BJZ A;  3RP8 A;  2BRY A;  2FJE A;  3PUZ F;  1FJG T;  3PVC A;  3NHO X;  3QVP A;  2R07 4;  1VBC 4;  2SPC A;  4YTP A;  5KOW A;  2YG6 A;  5E0O A;  4JY2 A;  2DNX A;  5F3J A;  1VRQ B;  2F5Z A;  2C70 A;  2IID A;  2XAJ B;  2WPC A;  5DBJ A;  5ER0 A;  1TDK A;  5TR3 A;  1SE7 A;  5A1L A;  3N9N A;  4GDE A;  1T7S A;  4DSH A;  2WHD A;  2YLS A;  1WR0 A;  3LB8 A;  5L3E B;  4EXT A;  1HX1 B;  3M13 A;  2VB6 A;  5LBQ B;  5H6R B;  2XVJ A;  1S2Q A;  1D0Y A;  1GER A;  2XQY A;  2XFO A;  1N1P A;  4IE4 A;  4OPU A;  1F3P A;  5HCJ A;  2AQJ A;  4GCM A;  3G5R A;  4JUY A;  5IYZ E;  4I50 E;  1GTH A;  1S2Y A;  2WB5 A;  3TLT A;  5AFU L;  2A87 A;  2VQB A;  5HCM A;  5IHY A;  2JIW A;  4LU6 A;  2B7S A;  5JCK A;  3G5Q A;  3OTO T;  2R04 4;  2C5I T;  1TDF A;  3LBX A;  3B13 A;  4U8M A;  2IIU A;  4U8O A;  2V60 A;  5AQL B;  4OPC A;  4WZX A;  4DGK A;  4HGA A;  4RSL A;  2XPK A;  5C3J A;  4NTE A;  4H63 V;  2EHO D;  4LF9 T;  3L3P A;  3NVO A;  1M62 A;  1KNP A;  3AVS A;  2JQQ A;  4G63 A;  2IVD A;  4GDP A;  3FZH B;  4FI5 A;  4LMK A;  4MFR A;  5LGU B;  1HYU A;  3NK2 X;  5AQO B;  2YG7 A;  5KVH A;  1AR9 4;  4GK5 E;  1ZKE A;  1NWM X;  2WMN A;  3B5M A;  1NHP A;  2E4G A;  1YQ4 A;  1L0V A;  1KNZ A;  2ES0 A;  2Q9Q D;  4JY3 A;  3FXD B;  4AQY T;  2KXP B;  1ASJ 4;  3I9Y A;  3F57 A;  3UUL A;  5IUX A;  3LFM A;  4EIW A;  3AEC A;  4UF0 B;  4ILB A;  4AQG A;  4H2Q A;  4JV5 T;  4X65 T;  3MJX A;  2V7J A;  4M1P A;  1IUW A;  4HFC A;  3EUH A;  2BVL A;  3O9X A;  3ZPO A;  5KNL A;  3RIU C;  4YLH A;  1Y01 A;  4TX5 A;  1DOC A;  4I58 A;  1GOS A;  2AXD S;  3SWH A;  4EMJ A;  4GYR A;  4QXB B;  2X9Y A;  2J1D G;  1MIV A;  3CVR A;  2N1G A;  3O1H A;  2GMH A;  2NW7 A;  3NYC A;  4GK0 E;  3CQG B;  5FL0 A;  3IF9 A;  4V1A v;  2K5B B;  4Z90 A;  3GN5 B;  4O4L E;  4J56 A;  1XNQ T;  2YK0 A;  1UX5 A;  2CXD A;  4G73 A;  3KV9 A;  3RIU A;  4IT4 A;  4LMJ A;  3SRZ A;  2XDO A;  3GYI A;  3LK2 B;  2C0S A;  2XSA A;  5BRT A;  3EAM A;  1D4D A;  2LKH A;  4AQF C;  4TM1 A;  5HXH A;  1B4V A;  4JI3 T;  4C90 A;  1OJA A;  2HPL A;  1TDN A;  1KNR A;  4CRT A;  5LBM A;  3QFA A;  4JEH B;  1W0B A;  3FXE B;  2E8I A;  3KVA A;  2JQH A;  3AE8 A;  3UUN A;  2GV8 A;  2V6X A;  3HI2 A;  5C2T A;  2VKJ A;  3UP5 A;  2EQ8 A;  2YLX A;  3ZYL A;  1OJD A;  2ZM6 T;  4AQF A;  5HXS A;  2QCU A;  3H8I A;  4CN4 A;  3UU4 A;  2NTY A;  2NW9 A;  3P4Q A;  5L46 A;  1NEK A;  2GF3 A;  3K8P C;  4K5R A;  1ZMC A;  2QA7 A;  5FS8 A;  2YG3 A;  2X66 A;  2WCA A;  2XVH A;  4AP1 A;  4L5G A;  1YQ3 A;  3AD9 B;  3RYC E;  2OLO A;  4NXM T;  4HE8 A;  4UVA B;  5L4H A;  4HTE A;  4DV3 T;  2WY2 A;  3ZMV B;  2BA9 A;  1JNZ A;  1V9D A;  3NLC A;  2JQ9 A;  3NTD A;  2UXC T;  1GRA A;  4U3C A;  2VVS A;  4EIP A;  2DCF A;  2LHR A;  2XQ3 A;  2GRT A;  1W9R A;  2OA1 A;  3KD9 A;  4IGU A;  1HNW T;  3F8D A;  3CGD A;  3HA4 A;  4NTD A;  3T2Z A;  4CY6 A;  5LHH B;  2ZMA A;  3I3L A;  1CL0 A;  1PIV 4;  5LMU T;  1MIW A;  4AKH A;  1E1K A;  3R6N A;  4OK0 A;  4F6R C;  4JNA A;  1RYI A;  4PFO A;  1VBA 4;  1HF8 A;  4FX9 A;  3UOY A;  3EVY A;  2BXS A;  3RYF E;  3HL6 A;  2UU9 T;  1IUT A;  4CNK A;  2MAW A;  4Z2T A;  4UIG A;  4LFC T;  4AP3 A;  3SZC A;  4TWF A;  2WBL A;  4B3T T;  3ONJ A;  2QA2 A;  2OA5 A;  2NWB A;  1VRB A;  4Z2U A;  2GB0 A;  3EDV A;  4H9R C;  2CE7 A;  3EAN A;  4KMC A;  4NNJ A;  3Q2M A;  1LJ1 A;  1XI1 A;  3O1J A;  4KPR A;  2WWU A;  1PXB A;  3IHR A;  4WX1 A;  1UX4 A;  3SYI A;  3GWH A;  3DJJ A;  1GPE A;  3IHG A;  4EZH A;  4FDC B;  2OLT A;  1OJC A;  2ZZC A;  3CNT A;  4X5T A;  1NCQ D;  5FY0 A;  3PUG A;  2C5K T;  3PUR A;  1BR0 A;  3Q9T A;  2WSS V;  4ZCC A;  3CML A;  5LB7 B;  1GRE A;  2YLZ A;  4QX8 B;  5HXI A;  4BUR A;  1XDP A;  5CA1 E;  1QJD A;  3LXD A;  4IDQ A;  5J2T E;  5JDF A;  3WI3 A;  2B9W A;  4AT0 A;  1HNZ T;  1XHZ A;  3GWD A;  2XVF A;  3QB5 A;  1I94 T;  2C3C A;  4OYK A;  3SOL A;  4NWZ A;  2BK4 A;  3CGB A;  4K0K T;  1E1N A;  3P4P A;  4H4R A;  3OBV E;  1EAH 4;  2PBI A;  4DO0 A;  2X5I D;  2IW5 B;  4ZI2 D;  4KBM B;  3OVU A;  3NRY A;  2B9X A;  4REK A;  3N2K E;  3OZ2 A;  2CVJ A;  4IE7 A;  4JI4 T;  4ZI3 D;  5L4E A;  2XLR A;  1NHQ A;  4CN1 A;  3C96 A;  2UXN B;  1N36 T;  2W63 A;  4WBN E;  3GWF A;  4A5L A;  3KDS E;  3ANW B;  1PDH A;  2C66 A;  3RHW A;  2LLY A;  3ZT5 A;  4Z25 A;  3FIM B;  4C5O A;  2XQ4 A;  3RP6 A;  5BMV E;  3AB3 B;  3AYL A;  1IAP A;  2LHN A;  2R9Z A;  4HFH A;  1LTX R;  1LPF A;  3DA1 A;  3KBU A;  5FYM A;  4NPP A;  3KBT A;  4JDR A;  2GMJ A;  4EQX A;  1CJ2 A;  3ETU A;  2X8C A;  3NGC X;  1CJ3 A;  3FI7 A;  1UK5 A;  2XQA A;  2LSK A;  4ZN0 A;  1UUS A;  4BK1 A;  3VKH A;  2VQF T;  2Q6U A;  2OAM A;  4WYV A;  3NK0 X;  3SZ0 A;  2BG9 B;  2CDU A;  5JVD E;  2YWL A;  2JPF A;  5GSN A;  2XFU A;  3AA1 B;  3HYW A;  5J7X A;  3AE3 A;  5CFB A;  3KFW X;  1Q9I A;  2XYO A;  4DR6 T;  5JDG A;  2KIN B;  4GKK T;  3GRS A;  3FBZ A;  3QB5 K;  4BK2 A;  5FY1 A;  3AE5 A;  2LFC A;  2YVF A;  1T98 A;  4BK3 A;  4H50 A;  5HXR A;  3DH9 A;  1R08 4;  3CGE A;  2LEH A;  1UKV G;  2MOZ A;  1TDE A;  2E9X C;  3AEB A;  2N9D A;  3ZN0 B;  1CJ4 A;  4J2W A;  5KRQ A;  2CLY C;  3K1S A;  4XAX B;  1K0L A;  1Y56 B;  2AE9 A;  5AQF B;  3AB1 A;  1POV 0;  3GDP A;  2WZI A;  4HKA A;  4DR5 T;  4XWR A;  2MTQ A;  2V7L A;  4D04 A;  2I6H A;  3ZMS B;  3B6D A;  4IE5 A;  1UCU A;  2LM2 A;  3D0T A;  2E5L T;  4YSH A;  3UOZ A;  4QH1 A;  3UU6 A;  2E9X A;  4QH4 A;  3FB2 A;  1FMW A;  3U3I A;  1PBD A;  2A89 A;  4IHJ E;  4HFE A;  3PO7 A;  3QK6 A;  1BGJ A;  4WCT A;  4EOZ B;  4UP3 A;  3CNJ A;  3UTH A;  2XQ6 A;  5EB5 A;  4MLK A;  3RED A;  4FK1 C;  5J2U E;  1EL7 A;  1NAF A;  2YKS A;  4Q4W 4;  2W0H A;  1EZ3 A;  1HXS 4;  1I6Z A;  2KT9 A;  2X9H A;  1H86 A;  1W0A A;  4IIJ E;  1HX8 A;  2BZB A;  4JQ9 A;  1MMG A;  5HWX A;  1T72 A;  3AVR A;  4CY8 A;  2XM1 A;  1OED B;  2CUL A;  3QNU A;  1IBL T;  5FS7 A;  4EV6 A;  4G74 A;  4FK1 A;  3L09 A;  3RC3 A;  4PDW D;  2XFP A;  1D7L A;  4U8L A;  1ZKQ A;  1QLB A;  4AOS A;  4DR1 T;  2EHO B;  4X20 E;  3UKQ A;  3V3N A;  4H4W A;  3CMM A;  1SUM B;  3M12 A;  1AR8 4;  5J1G A;  2BCP A;  5HY5 A;  2BG9 E;  1Q1W A;  1VBB 4;  3ZCI A;  4YJ2 E;  4RG3 A;  1KF6 A;  2DWK A;  2YIN A;  1FIO A;  2BKP A;  4JN9 A;  3AXB A;  4I0U A;  2YDR A;  1D5T A;  4PAG A;  4DV7 T;  1H81 A;  4N9X A;  3MKD A;  2Q9Q B;  3UKF A;  4P1N A;  2BKN A;  3IC9 A;  2DL1 A;  1H6V A;  3UTK A;  2V5D A;  1MND A;  1R8I A;  1TDO A;  3MAC A;  4GKJ T;  1EL5 A;  3ATQ A;  3RYH E;  5IWA T;  1NPX A;  4LF6 T;  5AQU B;  2DKH A;  4ISS A;  5FS9 A;  5AQG B;  2CWO A;  1O3X A;  4E7Z A;  3P50 A;  2NR4 A;  5AQS B;  2JJ9 A;  3ICT A;  4IL9 A;  3RRC A;  5M0Z A;  2UUA T;  4DR3 T;  2F4V T;  1HG2 A;  5L3D B;  1GSN A;  4EYU A;  2GVC A;  2R0C A;  4EB6 E;  3QVR A;  4H2N A;  5M10 A;  3DGH A;  4QX7 B;  5AQR B;  3BHF A;  4H4U A;  1GRG A;  1XDI A;  1B7T A;  5DQV A;  1YXR A;  3RLF F;  2RA1 A;  3AYJ A;  2VVM A;  4B66 A;  1YKH B;  2C7G A;  1RUG 4;  4UXN B;  1MQT D;  1KSS A;  5LNK A;  4X62 T;  2R0G A;  4X9M A;  5LG4 A;  4NIQ A;  5LHG B;  3B57 A;  3H3M A;  5HAX A;  1O5W A;  1L9D A;  2VZ2 A;  4U2Y A;  5U1O A;  2Z5X A;  1RUE 4;  4ILA A;  3N9Q A;  3ESL A;  1O95 A;  3M0O A;  4UDQ A;  3D1C A;  1IUX A;  4UV8 B;  2V7M A;  2YDS A;  4YT0 A;  3GA8 A;  3AEG A;  1O94 A;  2YDQ A;  1AR7 4;  5CQF A;  2OLN A;  5BUL A;  4PAA A;  2GK9 A;  1N4U A;  5J60 A;  4C3Y A;  2V61 A;  4OPL A;  5ABF B;  3KV4 A;  3M65 A;  2A9U A;  4O2A E;  1XHC A;  5GRT A;  4E0V A;  2J4G A;  3GMI A;  4AT2 A;  4DV5 T;  2RGO A;  3AYI A;  1FEA A;  3ABV A;  4OFZ A;  4IV9 A;  1LQT A;  3T2Y A;  5BR8 T;  4I55 E;  1IJ5 A;  5JDM A;  3A7M A;  1AR6 4;  3ALJ A;  3UKP A;  3PUA A;  3GSI A;  4PJM A;  4KUM B;  2PJQ A;  4Z2R A;  1S3B A;  3GYJ A;  4XZC A;  1KK7 A;  3V5U A;  5CGM A;  5JCI A;  1AOG A;  4KHZ F;  3BNU A;  2OV9 A;  4PAB A;  2IHR 1;  3FZM B;  3Q5W A;  2VL0 A;  3NNE A;  1PN0 A;  2V1D B;  3S61 A;  3AEF A;  5LMN T;  3L8K A;  3E08 A;  1BR1 A;  3CX8 B;  1B37 A;  3NK1 X;  4HWI B;  1HTJ F;  5JDL A;  2IVE A;  2D2S A;  4UF0 A;  3DK4 A;  3LK3 B;  3RHA A;  5KOX A;  2XUE A;  1PBF A;  4CI2 B;  4EQR A;  3AEA A;  2PYX A;  3NWI A;  2L3L A;  3ZN1 B;  3TLV A;  2LSY A;  4HA6 A;  3TLS A;  2R46 A;  3CQC B;  2AAQ A;  1BZL A;  3URH A;  2C64 A;  4NTC A;  4AIS A;  1RHI 4;  3UFG A;  4X9N A;  4CXX A;  4JNQ A;  2LSI A;  4JI0 T;  1CHU A;  3LSV A;  4YFS A;  5LJM A;  5FVK A;  5CA0 E;  2XTL A;  4JI8 T;  4M52 A;  3OYZ A;  2BRA A;  4IRE A;  4IDN A;  2O9Z A;  2WOW A;  3V3O A;  3IWA A;  3KPF A;  3BNM A;  4CBQ A;  4DUZ T;  3AED A;  1D4C A;  4H9Q C;  4LF4 T;  5JRC B;  3GN5 A;  2XAQ B;  2XCG A;  4Z24 A;  4IE6 A;  3BK9 A;  3VRB A;  2C5J A;  4USR A;  4UEL A;  3CKD A;  4H2P A;  4OPD A;  1ONF A;  3UTF A;  3RIA A;  4QH5 A;  2GR3 A;  3OYX A;  1JRZ A;  4H4Q A;  4U74 A;  1IBM T;  2BC0 A;  1LVF A;  2Q0K A;  2C65 A;  1NAA A;  1JU2 A;  2LOP A;  2JB1 A;  4TM4 A;  5HWY A;  1US7 B;  2DI4 A;  3UUX B;  2JMH A;  3RI5 A;  4ICY A;  2NVK X;  4YTN A;  1P2H A;  4H4P A;  3AA7 B;  3NN0 X;  4H4V A;  1Z0P A;  2J3N A;  3FHN A;  2VK9 A;  3LDQ B;  1GRT A;  2CFY A;  2Y6X A;  2YR5 A;  2CBJ A;  1XHX A;  1VBD 4;  2FUP A;  4FJO A;  2W67 A;  4U2Z A;  4XWZ A;  2N2N A;  3PUY F;  3VRA A;  4YY3 T;  4TV8 E;  2PW9 A;  5AQQ B;  1D1C A;  2X50 A;  5EK4 A;  2V6Y B;  3HKD E;  2JQK A;  1KEY A;  3SZF A;  3UCL A;  5TAO A;  2TPR A;  2WDR A;  3GRT A;  4ECH A;  2IML A;  4ZXL A;  3KV5 A;  4K2X A;  1J5W A;  2YM1 A;  3ATR A;  5H6Q B;  3ZDN A;  4XXG A;  2XFN A;  3FG2 P;  1REO A;  1NG3 A;  3BQL A;  2VUR A;  3C4N A;  2CXL A;  4PFP A;  2I59 A;  2YLT A;  3M3Z B;  1WLX A;  2RM2 4;  3PUS A;  1LVL A;  2KLQ A;  3AE4 A;  1E1H B;  2WPE A;  3EAB A;  2UUB T;  4BAY B;  3O0H A;  4U72 A;  5LJN A;  5JR9 B;  3JAD A;  2GEW A;  1SHZ C;  4ADZ A;  5JTG A;  2Y8D A;  2GR0 A;  2B7R A;  3X1D A;  3QSE A;  1MOK A;  4EQS A;  1CJC A;  5M4Y A;  3OKQ A;  1MXT A;  2HN1 A;  3WE0 A;  1DU2 A;  3RQU A;  3AAA B;  2IC6 A;  2Y6R A;  3ITJ A;  2ZZ0 A;  3AE6 A;  5CB4 E;  4UVB B;  3Q5D A;  2QA1 A;  4GF7 A;  4DBR A;  2R4J A;  1OOP D;  1ZP0 A;  1XMO T;  4APN A;  4WNK A;  3GQK A;  4II2 A;  2YOE A;  3QSM A;  2JAE A;  3PV0 F;  2WS3 A;  2LOS A;  2D0T A;  3CN8 A;  3PDY A;  1H7X A;  4RHV 4;  4U8P A;  3VR9 A;  5CJ5 A;  4H2R A;  4O5U A;  5FMH A;  1MMA A;  3AEE A;  3P4W A;  2WWV A;  3A8Y C;  3AAE B;  1J1J A;  1BGN A;  1MMN A;  1COY A;  3ISH A;  4I43 B;  4ZEY A;  3PUX F;  1QSD A;  4LF8 T;  3F31 A;  3V76 A;  4QXH B;  2IC9 A;  2WET A;  4IVO B;  4UVC B;  4EIQ A;  5L2L A;  2BS3 A;  4O8S A;  2ODU A;  1D1B A;  2C72 A;  1ZOV A;  4ILC A;  3E0Z A;  3PTR B;  4X64 T;  1FL2 A;  2C76 A;  2XSB A;  4YKF A;  3FZL B;  1S3E A;  5HHF A;  5LYJ E;  4LFB T;  2E5V A;  3AD7 B;  3O1I A;  4O2B E;  5HYM A;  4JYA T;  3DK8 A;  4A97 A;  1ELI A;  1RUD 4;  3UP4 A;  1ZY8 A;  3L8R A;  3ICS A;  4H4Z A;  3BI2 A;  1BKW A;  3RF1 A;  1VG9 A;  1XWM A;  3LG7 A;  3VKG A;  3ANW A;  4H4X A;  3CTY A;  2XY8 B;  1R09 4;  2BG9 C;  3F2E A;  1HCI A;  1PXA A;  5FXW A;  3JC6 C;  2XQ9 A;  2LKG A;  3RGL A;  1W4X A;  3ALM A;  2YLW A;  2XQ7 A;  5KMR A;  3QC9 A;  4P9S A;  4B68 A;  4D03 A;  2H7V C;  3RC8 A;  4PJN A;  4A6N B;  1G73 A;  4YXD A;  2X99 A;  5IPY A;  4F8H A;  2ODV A;  3FPZ A;  1PO2 4;  2GAG B;  5JCM A;  2WMO A;  4U8N A;  4OCG A;  3BI5 A;  4CXY A;  3MXZ A;  2BG9 A;  1H7W A;  2D5U A;  3GD4 A;  5FS6 A;  1Y0P A;  3S4U A;  3DJD A;  3SQP A;  4B65 A;  4C91 A;  4PK5 A;  2RPA A;  5ADX L;  4LFA T;  1N32 T;  2IUB A;  2LSJ A;  4G2A A;  2YVJ A;  2OAL A;  2R4E A;  5EOW A;  4YKG A;  2XAG B;  1H7C A;  5AQT B;  5FXX A;  3CWZ B;  4B67 A;  3CK6 A;  4K8D A;  3HYX A;  1L9C A;  1IUV A;  2DKI A;  1GQE A;  4H9O C;  3ZLI A;  1DOD A;  2ACX A;  4AXP A;  2WP5 A;  3T1Y T;  3RX6 A;  4DMV A;  1JRY A;  1Y56 A;  1N34 T;  4IA6 A;  4H9P C;  4BJN A;  4GAV A;  3C4W A;  1ZX9 A;  3N2O A;  1S94 A;  2JK6 A;  3N9O A;  5FNV E;  2BXR A;  2X68 A;  2ZM2 A;  4ZCD A;  3EDU A;  5JDN A;  4EEB A;  3GQH A;  4O4J E;  1F6M A;  1PJ6 A;  3DGZ A;  1IUU A;  1D4E A;  1Z6L A;  4YTM A;  2MPK A;  1VOM A;  3UQ7 A;  4ANJ A;  4IA5 A;  2WDV A;  3K3O A;  1H83 A;  4X1K E;  1D0Z A;  3ADA B;  3LOV A;  3NYE A;  4BV6 A;  2VQ7 A;  3BHK A;  1H84 A;  2VRM A;  2QVA A;  4G9K A;  2EHO C;  1D4M 4;  2LM9 A;  3K3Q C;  2YU2 A;  2QRX A;  1K4Q A;  4MHC A;  1HG5 A;  1PXC A;  4C74 A;  3PJA A;  4QXC B;  3VHL A;  1DOB A;  1DJQ A;  3T0K A;  4BJY A;  2B1E A;  1XNR T;  4Y4M A;  4IE0 A;  5JDH A;  5F8P A;  4DR4 T;  2YG5 A;  4ERR A;  2R7F A;  3CNP A;  4H4S A;  2V7K A;  2HPJ A;  2EHO A;  2KWI B;  3SX6 A;  2XHE B;  4DV0 T;  2Q9Q C;  1HNX T;  5KVI A;  1HRI 4;  2X8H A;  3CX6 B;  2RR1 4;  1ZDL A;  5FVL A;  2BK3 A;  4ZZC A;  4BA9 A;  4HFD A;  3K7M X;  5EZY E;  3N9L A;  1HS7 A;  3UFE A;  3UKA A;  4ASK A;  2V5Z A;  4YJ3 E;  2Y48 B;  3AXJ A;  4LML A;  3FZK B;  5LXT E;  3CGC A;  4NZH A;  3T1H T;  3UKH A;  4NXN T;  1FOH A;  5ABE A;  2XLS A;  2Q9Q A;  2FJD A;  2GR1 A;  1V59 A;  3OC4 A;  4DSG A;  4JI1 T;  3GD3 A;  1PBE A;  1U4Q A;  3JAE A;  1K0I A;  4COF A;  1M7K A;  2WU2 A;  3EF6 A;  2KZ7 B;  3I0O A;  3H8L A;  3ZKR A;  1F8R A;  3HYV A;  5HEO A;  3NIX A;  2BYB A;  4O5Q A;  3P4S A;  2R0P A;  3QSS A;  1GEU A;  4IVM B;  5J0Z A;  3SS1 A;  4U2S A;  4JI2 T;  4U2T A;  4EZ4 A;  4EM4 A;  5L3F B;  3N5L A;  4DID B;  2TMD A;  4LA1 A;  4DR7 T;  3J9X 1;  2GH5 A;  4GUV A;  1PBB A;  3GYX A;  4GYS A;  3RP7 A;  2PFV A;  3RKO A;  5KXJ A;  2JKC A;  3C4A A;  5HEJ A;  2CWY A;  3NBX X;  2XQ8 A;  4CXW A;  3VU7 H;  2YM2 A;  4AOX A;  5BUK A;  3JD7 4;  3C98 B;  2CMR A;  1YKE B;  2W66 A;  3ZMU B;  2PZS A;  3CPH G;  2RS1 4;  3FBL A;  5HEH A;  2UXB T;  2H88 A;  3H37 A;  4L9I A;  5IQ4 A;  2H7O A;  2WEU A;  3COX A;  5HYA A;  1RUF 4;  3ZC1 A;  5ETW A;  4Q4V 4;  1E2A A;  1T8B A;  2KMF A;  1B8S A;  4DV2 T;  2HHH T;  4AI6 A;  3CPI G;  2X0L B;  2XFQ A;  4NEV A;  3E22 E;  2UXX B;  5JCL A;  1BR2 A;  4EQW A;  2HH7 A;  2BS2 A;  1XAN A;  5L3G B;  4KP3 C;  4PK4 A;  2YAU A;  5ABF A;  1BR4 A;  5FP3 A;  3UKL A;  2HWC 4;  2ZLY A;  3A5X A;  3RPU A;  3PU8 A;  4N78 D;  3EI0 A;  1E6E A;  3AD8 B;  3QFB A;  1RP0 A;  2DWG A;  1OED E;  4UR9 A;  2MYS A;  4ZOL E;  2RS3 4;  4A9W A;  3DJB A;  3RRW A;  2FJA A;  3JAF A;  3AWI A;  4H63 H;  5LG3 A;  1HRV 4;  5LHI B;  1D7Y A;  2L8K A;  3N9P A;  4A98 A;  4U31 A;  4TLX A;  1E1M A;  1L9E A;  4AKR B;  1LRZ A;  3U78 A;  1YY5 A;  2WP6 A;  5FY7 A;  2CHN A;  1WR6 A;  4AKG A;  4CN6 A;  2K3W A;  2JB2 A;  2VL8 A;  2VQE T;  3T31 A;  2J62 A;  2GR2 A;  3RQW A;  2WP9 A;  3PU3 A;  4B64 A;  3ZYM A;  3VRD B;  4J57 A;  4MAL A;  3SGL A;  4AKI A;  2V5C A;  4ZS2 A;  2E9X D;  4U2L A;  2X0H A;  4U8J A;  3EPT A;  4KI0 F;  1XDO A;  4TZ4 C;  3VR8 A;  3HKC E;  2BAC A;  1WFD A;  3R9U A;  3I0Q A;  3R84 B;  1WYB A;  2GAH B;  5EBK A;  1ZOY A;  1OJT A;  4I4T E;  5AQH B;  1IUS A;  2EQ9 A;  1LV0 A;  2A2F X;  2YR6 A;  2DHR A;  2XLT A;  5L3B B;  2R45 A;  4DV6 T;  2YEV C;  3ONL C;  5AQP B;  3P4R A;  3UUB A;  2W61 A;  3SFD A;  5KX5 E;  3D8X A;  3L39 A;  4TM0 A;  4ILU A;  1BF3 A;  3PS9 A;  1VBE 4;  4YSY A;  4LII A;  1CF3 A;  4TUY E;  2FJB A;  3NZQ A;  3JSK A;  4CQI A;  3LBX B;  4DV4 T;  1DNC A;  4OPG A;  5JRC A;  1XPQ A;  3DJE A;  1N4W A;  4DND A;  4EAH A;  4HWF A;  4P0A A;  1BWC A;  1QO8 A;  1VQW A;  1OWA A;  3JBG 4;  1BEV 4;  2RGJ A;  1TYP A;  3IA3 A;  3G5S A;  5L47 A;  1DXL A;  2VOU A;  1RSG A;  2E2A A;  3UU5 A;  3ONX A;  4WBO A;  2VVL G;  3ALL A;  2UXD T;  1PO1 4;  5DAB A;  5KMS A;  3BI4 A;  1GV4 A;  4Z26 A;  4DUY T;  2NTX A;  2X0Y A;  5FMN A;  1DJN A;  4ZI2 C;  5DJQ C;  1D0X A;  4B3M T;  4OYJ A;  1E39 A;  2XVI A;  3PUV F;  2YVG A;  4ZI3 C;  2LRK A;  1ZMD A;  3K30 A;  3RYI E;  2M6B A;  4ZZB A;  4A79 A;  4Q4Y 4;  4Z44 A;  3LZW A;  3DK9 A;  5LV9 A;  4XBF B;  4AKL A;  2C3D A;  1Q1R A;  4LF7 T;  2VKD A;  4G6H A;  2ZZB A;  4H4T A;  2V6Y A;  3MK7 C;  2R06 4;  3UUM A;  4AIU A;  4Y4L A;  2VWA A;  4IDZ A;  5LP6 E;  1RUC 4;  2BDE A;  5L3C B;  3KVB A;  2NPX A;  4K7Z A;  4X4J A;  1CC2 A;  3ETV A;  4UEM A;  1NG4 A;  5JR9 C;  4GRT A;  4HN9 A;  2BK5 A;  3CNS A;  1CUN A;  3E1T A;  3SM8 A;  3NZP A;  3H3A A;  1WYC A;  2AR8 A;  2HN2 A;  3P1W A;  2L9Q A;  1RMU 4;  1IJH A;  4K0U A;  2XVE A;  3O4X E;  2A72 A;  3KIN B;  1N4V A;  1WCR A;  5HEG A;  1CC6 A;  4C3X A;  1N33 T;  4QWN B;  3HR0 A;  3HKE E;  5KMQ A;  3RH3 A;  5IQ1 A;  2HQM A;  5JR9 A;  2IAK A;  2XAH B;  3ZST A;  3Q9D A;  4YSZ A;  4OX9 T;  4J33 A;  2VKO A;  4QKN A;  4ZS3 A;  4YSX A;  1LKX A;  3MA9 A;  2ZM8 A;  4MBQ A;  3G06 A;  2WPF A;  1AJ3 A;  5KDM C;  1M6I A;  2PYL A;  1X31 B;  2YG4 A;  3N2G E;  4B6X A;  2V3B A;  1ZK7 A;  1E7P A;  3Q6J A;  4IDO A;  3QUJ A;  2B9Y A;  3CIR A;  3Q5E A;  4LF5 T;  1JEH A;  3T14 A;  2JRK A;  4CCR A;  1LVK A;  4TLZ A;  2APG A;  3OJA A;  4TN7 B;  1JRX A;  3NG7 X;  4G6G A;  1FEW A;  2JBV A;  4IL4 A;  2BBJ A;  2NW8 A;  4DR2 T;  2CA5 A;  1F8W A;  4Z8X A;  3T8O A;  5KMG P;  2LRL A;  2JMK A;  3WAK A;  2RGH A;  3ZT7 A;  4OVI A;  3P8C D;  2C4C A;  2RMU 4;  3B3R A;  3DME A;  3PJA J;  1FMV A;  3Q5X A;  5LA6 E;  4CZZ B;  3C50 A;  3C4X A;  5FXZ A;  2RP4 A;  3LK4 2;  4A5X A;  4USQ A;  4H9S E;  2BC1 A;  3ZSS A;  2PYJ A;  4DVD A;  1MNE A;  2BS4 A;  3CPJ G;  4CCQ A;  4JEU B;  4IST A;  4TWD A;  1B5Q A;  1K0J A;  2CEA A;  2GQF A;  2WOI A;  3NH3 X;  5JQG E;  3C4Z A;  3NKS A;  3W15 B;  3J7Y q;  2ACZ A;  3ICR A;  5GON E;  2CXF A;  2H89 A;  1WRD A;  2A3D A;  1EBD A;  2PTF A;  3IF8 B;  3ZMZ B;  3GMC A;  2WAU A;  5KWF A;  2NOX A;  4JI6 T;  2W00 A;  3NN6 X;  3KU9 A;  4PK6 A;  1ZV4 X;  1EL8 A;  1Z8U A;  5HXC A;  5LOV E;  3UKK A;  4J36 A;  4Z91 A;  4KHP T;  4HWH A;  2V3A A;  4B63 A;  4DV1 T;  3AE2 A;  2D0U A;  5KMP A;  1MMD A;  3DP7 A;  1YKJ A;  2W0G A;  1IJ6 A;  4QHO A;  5EK2 A;  3CND A;  2I0Z A;  2ZBW A;  2JB3 A;  5LGN B;  2BCG G;  5AQI B;  5BVA A;  1YW0 A;  3ZEF B;  2K24 A;  4H4Y A;  3FBS A;  4U8I A;  1EV1 4;  2KWH A;  4OPT A;  3UOV A;  3V5S A;  1VRH 4;  2WM9 A;  3AA0 B;  2B76 A;  4EYY R;  3TKL B;  2X51 A;  1J5E T;  3F8R A;  4HFI A;  4EED A;  2YR4 A;  1XZY A;  1F8S A;  4A65 A;  3RKG A;  4E7S A;  1PBC A;  3N9M A;  3P9U A;  1Y64 B;  1KSU A;  1P2E A;  3PUW F;  3JCF A;  4JLE A;  3LJP A;  4A6N A;  2XQ5 A;  4HWC A;  2M6I A;  4U8K A;  4IDP A;  4TNW A;  1GAL A;  3KV6 A;  3AE9 A;  4O4H E;  3AE1 A;  4X1I E;  1S35 A;  1KDG A;  3H4K A;  3UT5 E;  4OPI A;  4U7Y A;  4CI3 B;  3CX7 B;  2Q7V A;  4CNJ A;  4HFV A;  2PLV 4;  2YN6 A;  3SXI A;  2CCQ A;  2LSG A;  4U7I A;  3CPZ A;  2WZH A;  3AE7 A;  3KKJ A;  2QYW A;  3SY4 A;  2WOV A;  3NRN A;  4H7U A;  2RAB A;  3NT6 A;  4I59 A;  2K9A A;  2X67 A;  3P7I A;  3TLW A;  3PE0 A;  4GOU A;  1HR0 T;  4A99 A;  4P09 A;  2V6O A;  3ZJ1 A;  1M64 A;  2ZM0 A;  3KVE A;  5AQV B;  3T37 A;  1YQZ A;  2X3N A;  4WW0 A;  5HEU A;  4UDR A;  3QOF A;  5JDQ A;  4J31 A;  1GND A;  4TM3 A;  2PY5 A;  2RS5 4;  4RG4 A;  1QUU A;  2CHO A;  4Z43 A;  2QGS A;  3T2K A;  4DBQ A;  2XJ7 A;  4ZHQ E;  3L1R A;  1XMQ T;  1PVC 4;  3PUQ A;  4EM3 A;  3I1A A;  4KX6 A;  3QJ4 A;  1GXF A;  3NKZ A;  1VCS A;  5AQN B;  1OXZ A;  2KSR A;  3ZYX A;  1VDC A;  1W09 A;  1H8T D;  3TLU A;  3AAI A;  1K5M D;  3WAJ A;  3LZX A;  1OED C;  1ZEE A;  3UTE A;  3UU8 A;  1PHH A;  1ZHC A;  1FEB A;  5CKU A;  2XLP A;  1RUI 4;  1HFA A;  5FL1 A;  4EMI A;  2IDO B;  2BVM A;  1DOE A;  3BQI A;  1UGO A;  3OPC A;  1H82 A;  2V26 A;  2CBI A;  2XZE A;  3IEE A;  4OHF A;  2XAF B;  2W62 A;  1PJ7 A;  3LJC A;  4B3S T;  5C8Y E;  4PNI A;  5JRE A;  2XAS B;  5LGT B;  4B1B A;  3NRX A;  1Z7S 4;  2BKO A;  1TRB A;  2WQY A;  1OED A;  2C67 A;  2QAE A;  3DTO A;  4K5S A;  1YD8 G;  2X8G A;  2YU1 A;  4HWD A;  3GDN A;  4II3 A;  1NHS A;  3K7T A;  2C73 A;  4HB9 A;  2YQU A;  2PG8 A;  2EQ6 A;  2Q0L A;  4B69 A;  3NYF A;  3RNM A;  1LQU A;  4CI1 B;  1GT8 A;  4ZI7 E;  1FCD A;  2P9B A;  2Z5Y A;  3HZL A;  5AQK B;  1VG0 A;  4Q4X 4;  1UUR A;  2EQ7 A;  4Q25 A;  1NHR A;  3IBP A;  4NUU A;  3BQK A;  2YLR A;  5ABH A;  5LCY A;  2WBA A;  3J8F 4;  2Y6Q A;  1RUJ 4;  1SEZ A;  2E9X B;  5EB4 A;  4DMW A;  1NEN A;  4PJL A;  2WES A;  2MBG A;  5HXE A;  2KND A;  2VVN A;  2CLY B;  2E1M A;  3F8P A;  3I6D A;  3II4 A;  4EGW A;  2CPT A;  2V8S V;  2LE8 A;  2GQW A;  4HEA A;  5U63 A;  3KLJ A;  1OJ9 A;  1JOA A;  4UDP A;  4EMW A;  1MIY A;  1AL2 4;  3ZYK A;  4X66 T;  1X79 A;  4DNA A;  4A7A A;  1CBO A;  5EK3 A;  2BAB A;  3ZJ2 A;  2G0U A;  3ZCJ A;  4J34 A;  5FXV A;  1VCT A;  2X9X A;  1RUH 4;  2LT3 A;  4A56 A;  3K7Q X;  5ABG A;  1GES A;  2D9D A;  1RVF 4;  2DLR A;  3LAD A;  4Y4N A;  1PJ5 A;  2X9W A;  2Z6E A;  1EL9 A;  3K3N A;  2VRL A;  3UTG A;  3ZT6 A;  1MO9 A;  1IBK T;  1COV 4;  4GB3 4;  2W2U A;  3AA6 B;  3C51 A;  5JH7 E;  3VQR A;  2C75 A;  3KPK A;  2M67 A;  2VAS A;  4HFB A;  1NA1 D;  2XM2 A;  2BBH A;  4GAP A;  4GR1 A;  3I9W A;  3AXJ B;  3GMB A;  5F5W A;  1GRB A;  1X9B A;  4MJW A;  4C77 A;  3MZK B;  2V7I A;  1GTE A;  3NTA A;  2J47 A;  2WDQ A;  3C64 A;  4O4I E;  2HWB 4;  1KFY A;  4GIW A;  3ZC0 A;  4NUV A;  4TWH A;  1FEC A;  4H9N C;  4YHJ A;  2CRB A;  1G8X A;  4K22 A;  2K48 A;  4ADW A;  3SFE A;  2ARD A;  3KA7 A;  4J2C A;  1CC4 A;  3JC6 D;  3CQX C;  3EHZ A;  4UV9 B;  5FKY A;  2NP9 A;  2W4X A;  2FBW A;  2I0M A;  1D1A A;  4YHH T;  1GRH A;  4P0B A;  4BJM A;  4YWO A;  4JI7 T;  1JNR A;  1TYT A;  3UQ4 A;  3EAO A;  2CM0 A;  3IHM A;  2WU5 A;  3FZF B;  4NEW A;  1GRF A;  3ZMT B;  2VVL A;  5AQJ B;  3UU3 A;  4X1Y E;  1NDA A;  4JBW F; 
#chains in the Genus database with same CATH homology
 3UOX A;  1E39 A;  2XVI A;  3AEB A;  4O5U A;  5FMH A;  2YVG A;  1CJ4 A;  3DJG X;  3AEE A;  4J2W A;  5KRQ A;  1E1L A;  1ZMD A;  1BGN A;  2A8X A;  3K30 A;  1COY A;  3ISH A;  1K0L A;  5JCN A;  1GET A;  4A79 A;  1Y56 B;  4Z44 A;  3LZW A;  3DK9 A;  2UZZ A;  3AB1 A;  3S5W A;  5LV9 A;  3SZW A;  3V76 A;  5U25 A;  2C3D A;  1Q1R A;  3GDP A;  4G6H A;  4XWR A;  2ZZB A;  4H4T A;  3FMW A;  2WET A;  1PS9 A;  4IVO B;  4Y4L A;  4D04 A;  4EIQ A;  3SUC A;  2PHH A;  3B6D A;  2BS3 A;  2XLU A;  4BJZ A;  4YSH A;  2NPX A;  2C72 A;  1ZOV A;  4K7Z A;  3RP8 A;  2BRY A;  4X4J A;  2FJE A;  3UOZ A;  3PVC A;  1CC2 A;  3NHO X;  2A89 A;  1PBD A;  1FL2 A;  2C76 A;  4YKF A;  1NG4 A;  1S3E A;  3QVP A;  4GRT A;  3PO7 A;  5HHF A;  4YTP A;  2BK5 A;  3CNS A;  2E5V A;  2YG6 A;  3AD7 B;  3E1T A;  3SM8 A;  5HYM A;  1BGJ A;  4WCT A;  4JY2 A;  3DK8 A;  4UP3 A;  1ELI A;  3CNJ A;  3UTH A;  3UP4 A;  1VRQ B;  2F5Z A;  1ZY8 A;  2AR8 A;  2C70 A;  4FK1 C;  2IID A;  3ICS A;  5EB5 A;  4H4Z A;  3BI2 A;  1BKW A;  1EL7 A;  2WPC A;  5DBJ A;  3P1W A;  5ER0 A;  1TDK A;  5TR3 A;  1IJH A;  1VG9 A;  2W0H A;  2XVE A;  4GDE A;  1H86 A;  1N4V A;  4H4X A;  3CTY A;  4DSH A;  1CC6 A;  4C3X A;  4JQ9 A;  2WHD A;  2YLS A;  4CY8 A;  3LB8 A;  2CUL A;  1PXA A;  5KMQ A;  5IQ1 A;  1W4X A;  2HQM A;  3ALM A;  3M13 A;  5FS7 A;  2YLW A;  2XVJ A;  5KMR A;  1S2Q A;  4YSZ A;  1GER A;  4G74 A;  4J33 A;  4P9S A;  4B68 A;  2XFO A;  4D03 A;  4YSX A;  1N1P A;  4FK1 A;  4OPU A;  1F3P A;  2XFP A;  2AQJ A;  1D7L A;  4GCM A;  3G5R A;  4U8L A;  1ZKQ A;  4A6N B;  1GTH A;  4YXD A;  1QLB A;  1S2Y A;  2VQB A;  2A87 A;  2WPF A;  4AOS A;  2X99 A;  1M6I A;  4LU6 A;  5IPY A;  5JCK A;  2B7S A;  1X31 B;  2YG4 A;  3G5Q A;  3FPZ A;  1TDF A;  2GAG B;  2V3B A;  1ZK7 A;  1E7P A;  4U8M A;  4U8O A;  3Q6J A;  3UKQ A;  2V60 A;  3V3N A;  5JCM A;  4H4W A;  4OPC A;  4U8N A;  3CMM A;  2B9Y A;  3CIR A;  3BI5 A;  4OCG A;  4DGK A;  1JEH A;  4RSL A;  3T14 A;  4CCR A;  5C3J A;  4NTE A;  1H7W A;  3M12 A;  2BCP A;  3GD4 A;  5HY5 A;  4TLZ A;  2APG A;  5FS6 A;  1Y0P A;  1JRX A;  3NG7 X;  4G6G A;  2JBV A;  1KNP A;  3DJD A;  1Q1W A;  3SQP A;  4RG3 A;  1KF6 A;  4B65 A;  1F8W A;  4JN9 A;  3AXB A;  2IVD A;  1D5T A;  2RGH A;  2YVJ A;  4GDP A;  4OVI A;  1H81 A;  4N9X A;  2OAL A;  2R4E A;  5EOW A;  4YKG A;  2C4C A;  3UKF A;  1HYU A;  3IC9 A;  3B3R A;  3DME A;  3NK2 X;  1H6V A;  2YG7 A;  5KVH A;  4B67 A;  1TDO A;  1EL5 A;  4K8D A;  3ATQ A;  1NHP A;  2E4G A;  3HYX A;  1L9C A;  1NPX A;  1YQ4 A;  1L0V A;  2DKH A;  1IUV A;  4JY3 A;  2DKI A;  5FS9 A;  4USQ A;  1DOD A;  2BC1 A;  2BS4 A;  3CPJ G;  4CCQ A;  3AEC A;  2WP5 A;  1JRY A;  4H2Q A;  1B5Q A;  1K0J A;  2GQF A;  1Y56 A;  2WOI A;  3NH3 X;  4IA6 A;  3ICT A;  4GAV A;  3NKS A;  5M0Z A;  1GSN A;  2R0C A;  2ACZ A;  3QVR A;  2GVC A;  1ZX9 A;  3ICR A;  4H2N A;  5M10 A;  3DGH A;  2H89 A;  1EBD A;  1IUW A;  3GMC A;  3BHF A;  4H4U A;  1GRG A;  1XDI A;  2JK6 A;  5KWF A;  5KNL A;  3AYJ A;  2VVM A;  4B66 A;  3NN6 X;  2C7G A;  2BXR A;  3KU9 A;  1DOC A;  1KSS A;  4ZCD A;  1EL8 A;  4I58 A;  1GOS A;  2R0G A;  3UKK A;  4J36 A;  4X9M A;  4EMJ A;  3GQH A;  2V3A A;  1F6M A;  1PJ6 A;  3DGZ A;  1IUU A;  1D4E A;  1Z6L A;  4YTM A;  4B63 A;  1O5W A;  2GMH A;  3AE2 A;  3NYC A;  1L9D A;  5KMP A;  2VZ2 A;  4IA5 A;  1YKJ A;  5U1O A;  2WDV A;  3IF9 A;  1H83 A;  2Z5X A;  2I0Z A;  3CND A;  2ZBW A;  3ADA B;  2JB3 A;  3LOV A;  3NYE A;  2BCG G;  4BV6 A;  2VQ7 A;  3BHK A;  5BVA A;  1H84 A;  3M0O A;  1O95 A;  2VRM A;  4G9K A;  4J56 A;  4H4Y A;  4UDQ A;  3D1C A;  1IUX A;  3FBS A;  4U8I A;  4OPT A;  4YT0 A;  1K4Q A;  3UOV A;  4G73 A;  1PXC A;  4C74 A;  2XDO A;  1DOB A;  1DJQ A;  3GYI A;  3AEG A;  3T0K A;  4BJY A;  5BRT A;  1O94 A;  2B76 A;  1D4D A;  3F8R A;  4Y4M A;  5CQF A;  2OLN A;  5BUL A;  4TM1 A;  1B4V A;  2YR4 A;  5KOW A;  4PAA A;  1F8S A;  4A65 A;  1N4U A;  2YG5 A;  5J60 A;  4C3Y A;  2V61 A;  1PBC A;  1OJA A;  4OPL A;  3CNP A;  1TDN A;  3P9U A;  4H4S A;  1KSU A;  1KNR A;  1P2E A;  4CRT A;  3QFA A;  3LJP A;  4A6N A;  3AE8 A;  3SX6 A;  4U8K A;  1XHC A;  1GAL A;  5GRT A;  5KVI A;  4E0V A;  2GV8 A;  2X8H A;  3AE9 A;  5C2T A;  4AT2 A;  1ZDL A;  3AE1 A;  1KDG A;  2BK3 A;  2EQ8 A;  2RGO A;  2YLX A;  3AYI A;  3UP5 A;  3H4K A;  1FEA A;  3ABV A;  1OJD A;  4IV9 A;  1LQT A;  3K7M X;  3T2Y A;  2QCU A;  3H8I A;  4OPI A;  2Q7V A;  4CNJ A;  3UKA A;  3P4Q A;  3ALJ A;  1NEK A;  5L46 A;  3UKP A;  2GF3 A;  4K5R A;  3SXI A;  3GSI A;  1ZMC A;  2V5Z A;  4Z2R A;  1S3B A;  5FS8 A;  2YG3 A;  3GYJ A;  3CGC A;  4NZH A;  5JCI A;  3AE7 A;  3KKJ A;  3UKH A;  2XVH A;  1FOH A;  4AP1 A;  1AOG A;  1YQ3 A;  2XLS A;  2FJD A;  2GR1 A;  1V59 A;  3BNU A;  3AD9 B;  3OC4 A;  2OLO A;  4PAB A;  3SY4 A;  4DSG A;  2WOV A;  3NNE A;  1PN0 A;  3NRN A;  3S61 A;  3AEF A;  4H7U A;  2RAB A;  3GD3 A;  1PBE A;  2BA9 A;  3NT6 A;  1JNZ A;  4I59 A;  1K0I A;  3L8K A;  3NLC A;  3NTD A;  1GRA A;  1B37 A;  3NK1 X;  2WU2 A;  3EF6 A;  4EIP A;  3SZ0 A;  3H8L A;  4A99 A;  1F8R A;  2V6O A;  3HYV A;  3NIX A;  2IVE A;  2BYB A;  2OA1 A;  2GRT A;  3DK4 A;  4O5Q A;  3P4S A;  1M64 A;  3KD9 A;  3RHA A;  3KVE A;  5KOX A;  2R0P A;  3QSS A;  1PBF A;  1GEU A;  4IVM B;  3F8D A;  3CGD A;  4EQR A;  4U2S A;  3AEA A;  4U2T A;  4NTD A;  1YQZ A;  2X3N A;  2PYX A;  3T37 A;  4EM4 A;  3T2Z A;  4CY6 A;  4LA1 A;  3I3L A;  2TMD A;  4UDR A;  1CL0 A;  4HA6 A;  2R46 A;  4J31 A;  2AAQ A;  2GH5 A;  1BZL A;  1GND A;  1E1K A;  4GUV A;  4TM3 A;  1PBB A;  3GYX A;  4RG4 A;  3URH A;  3RP7 A;  2C64 A;  4NTC A;  5KXJ A;  4JNA A;  1RYI A;  2JKC A;  4X9N A;  4JNQ A;  4Z43 A;  3T2K A;  4FX9 A;  1CHU A;  3UOY A;  2BXS A;  3L1R A;  3C4A A;  4M52 A;  1IUT A;  4CNK A;  4EM3 A;  2BRA A;  4Z2T A;  4KX6 A;  3QJ4 A;  2O9Z A;  2WOW A;  1GXF A;  3V3O A;  4AP3 A;  3IWA A;  3KPF A;  3SZC A;  3BNM A;  2YM2 A;  4CBQ A;  3AED A;  4AOX A;  5BUK A;  3ZYX A;  1VDC A;  1D4C A;  2QA2 A;  3CPH G;  2XCG A;  4Z24 A;  3LZX A;  4Z2U A;  3UTE A;  2H88 A;  2GB0 A;  3VRB A;  1PHH A;  4USR A;  5IQ4 A;  1FEB A;  2WEU A;  3COX A;  3EAN A;  1ONF A;  4H2P A;  4OPD A;  2XLP A;  4NNJ A;  5CKU A;  3UTF A;  1LJ1 A;  4EMI A;  4KPR A;  1PXB A;  2GR3 A;  1B8S A;  1JRZ A;  1DOE A;  4H4Q A;  3CPI G;  4WX1 A;  2XFQ A;  3SYI A;  1H82 A;  4NEV A;  3DJJ A;  1GPE A;  5JCL A;  2BC0 A;  2Q0K A;  3IHG A;  2C65 A;  4EQW A;  1NAA A;  4FDC B;  2BS2 A;  1JU2 A;  1XAN A;  1OJC A;  2ZZC A;  1PJ7 A;  2JB1 A;  3CNT A;  4TM4 A;  2YAU A;  4B1B A;  4ICY A;  2NVK X;  3UKL A;  1TRB A;  4YTN A;  2WQY A;  1P2H A;  2C67 A;  2QAE A;  3Q9T A;  4H4P A;  4K5S A;  4H4V A;  3NN0 X;  4ZCC A;  2X8G A;  2YLZ A;  1GRE A;  1E6E A;  2J3N A;  3AD8 B;  3QFB A;  1RP0 A;  5HXI A;  3GDN A;  1GRT A;  2CFY A;  1NHS A;  4II3 A;  2YR5 A;  3K7T A;  4BUR A;  2C73 A;  4HB9 A;  4XWZ A;  4A9W A;  1QJD A;  2YQU A;  3LXD A;  2EQ6 A;  2Q0L A;  2FJA A;  4B69 A;  3VRA A;  3AWI A;  3NYF A;  3RNM A;  1LQU A;  2B9W A;  1GT8 A;  1D7Y A;  4AT0 A;  1FCD A;  2Z5Y A;  3GWD A;  3HZL A;  2X50 A;  4TLX A;  2XVF A;  1VG0 A;  1E1M A;  1L9E A;  2C3C A;  2EQ7 A;  1YY5 A;  2WP6 A;  1NHR A;  3SZF A;  3RED A;  4NWZ A;  2YLR A;  3UCL A;  2BK4 A;  3CGB A;  2WBA A;  2TPR A;  2WDR A;  2Y6Q A;  3GRT A;  4ECH A;  2JB2 A;  1SEZ A;  4K2X A;  5EB4 A;  1E1N A;  1NEN A;  3T31 A;  2WES A;  2GR2 A;  2YM1 A;  3ATR A;  3P4P A;  4H4R A;  2E1M A;  2WP9 A;  3ZDN A;  3F8P A;  3I6D A;  3II4 A;  2GQW A;  4XXG A;  4B64 A;  2XFN A;  3FG2 P;  5U63 A;  3KLJ A;  1REO A;  1NG3 A;  3VRD B;  4J57 A;  4REK A;  2B9X A;  3SGL A;  1OJ9 A;  2CVJ A;  1JOA A;  3OZ2 A;  4U2L A;  4UDP A;  4EMW A;  3C4N A;  2XLR A;  4U8J A;  1NHQ A;  3EPT A;  4DNA A;  2YLT A;  4A7A A;  1CBO A;  2BAB A;  3C96 A;  3VR8 A;  2BAC A;  3R9U A;  1LVL A;  3GWF A;  4J34 A;  4A5L A;  3AE4 A;  2GAH B;  1PDH A;  2C66 A;  3K7Q X;  2WPE A;  5EBK A;  4Z25 A;  1ZOY A;  1GES A;  1OJT A;  1IUS A;  3FIM B;  4C5O A;  3RP6 A;  3AYL A;  3O0H A;  2EQ9 A;  1LV0 A;  2YR6 A;  2R9Z A;  3LAD A;  1LTX R;  2XLT A;  1PJ5 A;  1LPF A;  2GEW A;  4Y4N A;  2R45 A;  3DA1 A;  1EL9 A;  2VRL A;  3UTG A;  4JDR A;  3P4R A;  2GR0 A;  2GMJ A;  4EQX A;  3SFD A;  1CJ2 A;  1MO9 A;  2B7R A;  3D8X A;  2X8C A;  3QSE A;  4TM0 A;  1MOK A;  1BF3 A;  3NGC X;  3PS9 A;  1CJ3 A;  1CJC A;  4EQS A;  3VQR A;  4YSY A;  2C75 A;  3KPK A;  4LII A;  1CF3 A;  1MXT A;  4ZN0 A;  3WE0 A;  2FJB A;  3JSK A;  4GAP A;  4GR1 A;  4BK1 A;  3GMB A;  1DNC A;  1GRB A;  2OAM A;  2Q6U A;  4OPG A;  4C77 A;  4MJW A;  2Y6R A;  1XPQ A;  3NK0 X;  3ITJ A;  1GTE A;  2ZZ0 A;  3AE6 A;  2WDQ A;  1N4W A;  2CDU A;  3DJE A;  2YWL A;  3NTA A;  1KFY A;  5GSN A;  2XFU A;  4GF7 A;  2QA1 A;  1BWC A;  1FEC A;  1QO8 A;  1VQW A;  3HYW A;  5J7X A;  3AE3 A;  2R4J A;  2RGJ A;  1Q9I A;  1ZP0 A;  2XYO A;  1TYP A;  4K22 A;  3G5S A;  4ADW A;  3SFE A;  1DXL A;  2ARD A;  3KA7 A;  2VOU A;  1CC4 A;  4APN A;  3GRS A;  1RSG A;  2VVL G;  4BK2 A;  2FBW A;  3ALL A;  3GQK A;  4II2 A;  1GRH A;  3AE5 A;  2LFC A;  4YWO A;  1JNR A;  1TYT A;  2YVF A;  2JAE A;  3QSM A;  4BK3 A;  5KMS A;  3EAO A;  3BI4 A;  2WS3 A;  1GV4 A;  2WU5 A;  3DH9 A;  3IHM A;  4H50 A;  4NEW A;  3CN8 A;  1H7X A;  1GRF A;  2VVL A;  4Z26 A;  4U8P A;  3VR9 A;  3CGE A;  4H2R A;  1DJN A;  1UKV G;  1NDA A;  1TDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...