5C2TA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c2tA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c2tA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c2tA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c2tA04
3AYLA 5C3JA 4TM3A 3S5WA 1H84A 2Q0LA 2QA1A 2R45A 1LVLA 3AD9B 4GDPA 1Y56B 2WU2A 1E39A 3VRBA 3UTGA 4B63A 4CRTA 4J34A 2C72A 1ZOYA 1EL7A 2V61A 3PVCA 2VVLA 2X8HA 3UP4A 3AE2A 4BURA 1KDGA 1TDEA 4YTMA 3FPZA 2BK4A 2AR8A 3K7MX 3K30A 2O9ZA 4JNAA 3EF6A 2YLZA 2NVKX 5JCIA 2JB1A 1REOA 2WHDA 4GDEA 4N9XA 3K7TA 3UOYA 1F3PA 3IWAA 3NYEA 4B1BA 2BA9A 4WX1A 2Q0KA 1PXBA 3UTHA 3Q9TA 2VRLA 2GEWA 4TM0A 3AWIA 2YLTA 4CCQA 5IQ4A 2GR3A 2E5VA 4YKGA 5FS9A 1TYPA 1SEZA 2GAGB 2GMJA 1NAAA 1EBDA 2YWLA 1GTHA 1TDKA 2C3DA 4NTCA 3NH3X 1GNDA 4K5SA 2YLRA 4YSYA 2XVEA 2Z5YA 3CPIG 5J60A 2CDUA 2B9XA 2OALA 3OZ2A 3UCLA 4GCMA 1F8WA 4M52A 4A7AA 2XFPA 2XDOA 3QFAA 1XANA 4DNAA 4BK3A 3IHMA 3KVEA 4RG3A 2CULA 1L0VA 4NTDA 5M0ZA 3DK4A 3F8DA 3AE1A 3SFDA 1D4EA 1KSUA 4HB9A 1JRXA 3C4NA 4APNA 4ZCDA 4EIQA 4YTPA 1H83A 4J36A 4RSLA 3UP5A 4Z25A 2WP6A 1PBBA 1GRTA 4J57A 2GMHA 2BC0A 3AEEA 4WCTA 2UZZA 4C5OA 4A5LA 2H89A 3I6DA 2YG5A 3GYIA 2GQFA 2BC1A 2VQ7A 4H4YA 4Z2RA 4X4JA 3SM8A 3H4KA 1K0IA 1GERA 4YSXA 5KOWA 3CPJG 1YQ3A 1TRBA 2V6OA 1NHRA 4AOXA 2C64A 4U8KA 4A79A 1D7LA 3BHKA 4UDRA 3GQKA 3BI2A 1DNCA 2WETA 3NIXA 4OCGA 1KF6A 2YG4A 4C3XA 3P4RA 3PS9A 1CF3A 5JCMA 4OPCA 1CC6A 5GSNA 1N4VA 1COYA 4DSGA 1XPQA 2V5ZA 3VRAA 4O5UA 1JRZA 3G5QA 4IVOB 4OPGA 4YWOA 5L46A 4C3YA 2BS2A 1O5WA 4D03A 1VDCA 4DGKA 3NN6X 1L9EA 1E1NA 4U8LA 1V59A 1NHPA 1TYTA 2XVFA 1Z6LA 3ALMA 3RP7A 2APGA 4JY3A 4A65A 5BVAA 1JNRA 1IUSA 1H81A 3ALLA 3GQHA 2XFUA 2BYBA 3M13A 4XWZA 2RABA 3NGCX 2DKHA 4EMJA 2BACA 1CJCA 4YT0A 2B76A 3ALJA 4CCRA 3KU9A 4EQWA 1P2HA 1IUWA 1PS9A 3AEGA 1B4VA 1YQZA 4B64A 2B9YA 4YSZA 4P9SA 1D4DA 3V3NA 4NTEA 4AP1A 3AECA 3ATQA 1CJ4A 3EPTA 3KD9A 1K4QA 1EL9A 1O94A 4IA6A 3HZLA 3P4SA 4CNKA 2JB2A 3AE3A 3NG7X 4A6NB 2R0PA 1LJ1A 3GYJA 2PHHA 2Z5XA 1S3EA 4K2XA 2RGOA 3PO7A 2FJEA 3QVPA 3LB8A 4U8JA 4U8MA 5LV9A 2XLSA 2IVDA 1VG9A 3CGDA 3KKJA 4OPIA 4RG4A 3RHAA 3L8KA 3UOVA 1DJQA 4YSHA 5JCKA 3R9UA 1N1PA 2H88A 1TDFA 3FG2P 1LPFA 2WEUA 3CPHG 3ATRA 4KPRA 1NDAA 1DODA 2C76A 1CHUA 3B3RA 3AEAA 2EQ6A 3ITJA 4JDRA 1Q9IA 2WP5A 3F8PA 4J56A 4TM4A 5JCLA 1GPEA 3AE9A 1NHQA 2IIDA 2JK6A 1RSGA 4C77A 2V60A 1NHSA 1F6MA 2CFYA 2GR0A 2YQUA 3AE6A 1Q1WA 2YLWA 3GRTA 2GH5A 2ZBWA 4HA6A 2R4JA 1MO9A 4YKFA 2GVCA 3UKKA 4XXGA 3NT6A 5DBJA 2B7RA 2OAMA 1CL0A 1JOAA 2R0CA 1KSSA 3QFBA 4Y4NA 3T37A 3LZXA 3UKHA 3KLJA 3LADA 3BI5A 2BS4A 1VRQB 1HYUA 4Y4MA 4ECHA 1PJ7A 2WDVA 3KA7A 2GR2A 1X31B 4JNQA 4MJWA 3URHA 5U1OA 4NZHA 5FS7A 2FJDA 3VR8A 3M12A 1EL8A 2WPFA 1K0JA 3ICTA 3QSMA 2YG6A 2C65A 4ADWA 4D04A 4EM4A 3SFEA 1L9CA 1TDNA 1VG0A 3KPFA 4CY8A 4JY2A 2EQ9A 3FMWA 1FL2A 3VR9A 2WBAA 2X3NA 3NLCA 3DJEA 1D5TA 2GRTA 1OJTA 2E1MA 2BXRA 1O95A 2XLTA 3G5SA 2YM1A 3M0OA 1ZKQA 2WP9A 2ARDA 2GV8A 4Z44A 3CNJA 1S3BA 2X50A 1LQUA 4EQXA 2J3NA 5EB4A 3S61A 4ZN0A 3CNPA 1LV0A 1OJ9A 2A8XA 1YQ4A 1P2EA 2BABA 4H4WA 3P4PA 3P4QA 1F8RA 1NPXA 4LU6A 1NG3A 4H4RA 1LQTA 1FCDA 1B5QA 3P1WA 2YR4A 3LOVA 2XFNA 1W4XA 3GD4A 4H7UA 4Z24A 2EQ7A 3D8XA 3QJ4A 3EANA 2WOWA 2C7GA 2B9WA 1Q1RA 5KXJA 3BHFA 4IVMB 2VOUA 4EQSA 1IUUA 5EOWA 1ZP0A 1GV4A 2GQWA 2OLOA 2R0GA 1MXTA 1H86A 4BK2A 1E7PA 1RP0A 1GRGA 3IF9A 1CJ2A 2VVLG 3CNDA 4CY6A 3GSIA 3GWDA 3NHOX 3BNUA 1PBFA 1NG4A 4H2QA 4AP3A 2JKCA 2F5ZA 1KFYA 3BI4A 1FECA 2GB0A 3CNTA 1M64A 3OC4A 4I58A 3RP6A 1FEBA 3FBSA 2BS3A 2YM2A 1H7WA 1PDHA 5ER0A 2XVHA 3UKLA 4ZCCA 4H4SA 3I3LA 5BUKA 1L9DA 4UP3A 4IA5A 2PYXA 2YG3A 1PXCA 4AT2A 2WQYA 3AYIA 4H2RA 2EQ8A 2YR5A 2X99A 3ICRA 1OJDA 4EQRA 5KOXA 1F8SA 1DOEA 5KWFA 4U8NA 3ZYXA 2RGJA 3C96A 2Y6RA 4Y4LA 1E1LA 3AXBA 4UDPA 3NK1X 4FK1A 2CVJA 2X8GA 3D1CA 4FK1C 1GOSA 4A99A 4BJZA 2Q6UA 2R4EA 3FIMB 2XVJA 2R46A 4GRTA 2VQBA 5JCNA 2JAEA 3EAOA 3GDNA 4H4ZA 4EMWA 3NK0X 2OLNA 3DGZA 3SGLA 1GSNA 2QCUA 4H4VA 4J2WA 1KNPA 4H2PA 5FS8A 2C75A 2V3BA 3QVRA 4B67A 5BRTA 1BF3A 3COXA 4U8IA 4B68A 4A9WA 1IUVA 1OJCA 2WDQA 4H4TA 1PN0A 3AD7B 2XLUA 3G5RA 2YR6A 4NEVA 2LFCA 1S2YA 3CNSA 2IVEA 3GYXA 1BKWA 1DOBA 4NEWA 4K7ZA 2XLRA 1Y0PA 1AOGA 5FMHA 1OJAA 2WU5A 3ZDNA 5KRQA 1DOCA 4LA1A 4TM1A 2VVMA 3QSSA 2WPCA 3NYCA 3UKQA 1Y56A 1IJHA 4U2TA 5M10A 2V3AA 1XHCA 1CC2A 3JSKA 1CJ3A 2C3CA 4BK1A 1DJNA 5U63A 3AE4A 3LXDA 2XCGA 4H4XA 4UDQA 4OPTA 4YTNA 2FBWA 5CKUA 3NYFA 4O5QA 1B8SA 4I59A 2A89A 5IPYA 4CNJA 1LTXR 3ISHA 3NKSA 4XWRA 3GD3A 4E0VA 1DXLA 1NENA 3ADAB 5GRTA 3RNMA 4PAAA 2DKIA 1FEAA 3DH9A 2ACZA 2E4GA 1EL5A 1M6IA 2TPRA 3DJJA 1PBDA 4H4QA 3UKAA 3IC9A 2QA2A 3ICSA 3QSEA 4CBQA 5EBKA 3LZWA 4DSHA 2GR1A 3UTEA 1GTEA 3VRDB 2XFOA 4OPUA 3B6DA 1GESA 3F8RA 3DK8A 5C2TA 3AEDA 1FOHA 3AEBA 2C66A 1GALA 1ZMCA 2YLSA 4K5RA 1GEUA 1PHHA 2GF3A 1TDOA 2WOIA 4H4PA 3NNEA 2BCPA 3II4A 1H82A 4EM3A 2FJBA 2B7SA 5J7XA 4OPLA 3VQRA 4FX9A 4USQA 3AYJA 2OA1A 2ZZCA 4J33A 3CGBA 1E6EA 4U8PA 1B37A 1ZDLA 4TLZA 5KVHA 2YVFA 4H50A 2WESA 3SQPA 1CC4A 2YVGA 3O0HA 3CN8A 3UKPA 4J31A 1QJDA 1S2QA 1ZY8A 1GRAA 2XFQA 3CTYA 4IV9A 1PBCA 3NTDA 4FDCB 4EIPA 1GT8A 2X8CA 1VQWA 1XDIA 2WDRA 3L1RA 4H2NA 4USRA 3DJGX 2Y6QA 4GF7A 1H7XA 1QLBA 2JBVA 1N4UA 3NTAA 3K7QX 2YVJA 3Q6JA 3SUCA 4LIIA 4Z43A 2XVIA 3CIRA 3V3OA 5FS6A 4AOSA 2BCGG 2YLXA 1BGJA 2VZ2A 1BZLA 4H4UA 1JRYA 1GRFA 4U2LA 3REDA 3DK9A 1IUTA 5BULA 3ABVA 1BWCA 4K22A 3AEFA 3AE7A 1MOKA 3LJPA 4YXDA 2ZZ0A 5HXIA 4B66A 4REKA 4GUVA 2C70A 3V76A 4TLXA 3GMBA 1PJ5A 4ICYA 5TR3A 1JEHA 3CGCA 3GDPA 1GRBA 2Q7VA 2WS3A 2JB3A 4BJYA 1UKVG 1D4CA 2C67A 3DA1A 4JQ9A 1QO8A 3DMEA 1H6VA 4OVIA 1GXFA 1JU2A 1GETA 4KX6A 1RYIA 2AAQA 1K0LA 3P9UA 1E1KA 3DGHA 3H8LA 2VRMA 4Z2TA 3AB1A 3UTFA 3H8IA 1IUXA 2BK5A 1KNRA 2ZZBA 2NPXA 4JN9A 2XYOA 5HYMA 2RGHA 4X9MA 4Z26A 2W0HA 1ZK7A 2BXSA 1N4WA 1YKJA 2I0ZA 2GAHB 1ZMDA 4A6NA 4U2SA 1YY5A 3UKFA 3AE8A 4B65A 3GRSA 2WOVA 2AQJA 3DJDA 2A87A 1BGNA 1JNZA 5CQFA 4AT0A 5IQ1A 1ZOVA 3BNMA 1PBEA 3NK2X 5HY5A 3E1TA 4BV6A 5KVIA 3CGEA 4B69A 4GR1A 5EB5A 2YG7A 2R9ZA 2FJAA 3NN0X 3GMCA 4X9NA 2QAEA 3UOXA 3UOZA 4PABA 1GREA 2BK3A 3IHGA 1CBOA 2YAUA 2XLPA 1D7YA 4U8OA 1NEKA 4Z2UA 1ZX9A 1PJ6A 1ONFA 2TMDA 3AD8B 3AE5A 1E1MA 4OPDA 4K8DA 2WPEA 2C73A 2HQMA 3WE0A 4C74A 3C4AA 3GWFA 5U25A 4EMIA 1GRHA 3RP8A 1PXAA 1ELIA 5HHFA 3NRNA
chains in the Genus database with same CATH superfamily
3S5WA 1H84A 5JDNA 2XQYA 3ZSSA 5LNKA 1Y56B 3VRBA 4J34A 2V61A 3PVCA 3TLWA 1SA0E 2CE7A 2KINB 4V1Av 5JCIA 4N9XA 2BKPA 1PXBA 5HEHA 2VRLA 4TM0A 4AQFA 4PK5A 3OYZA 5IQ4A 2GR3A 1OXZA 2YWLA 2C3DA 2R074 4K5SA 2YLRA 4YSYA 3CPIG 2BVLA 4IDQA 3LSVA 2OALA 2ZMAA 3OZ2A 3UCLA 1PIV4 4A7AA 4HWCA 4MALA 4BK3A 1MMNA 4NNJA 3IHMA 2VASA 4U74A 1R094 3F8DA 4DR6T 4EAHA 4U7IA 5ABGA 2EHOD 4B3TT 2C5IT 2IHR1 5FVLA 2MOZA 5AQSB 2GMHA 2ES0A 2BC0A 3FXEB 2UZZA 3GYIA 3SRZA 2BC1A 3A5XA 2A72A 1K0IA 4CN4A 2XQ8A 2V7KA 3FXDB 4KBMB 2DLRA 2XJ7A 2KNDA 3MZKB 5CJ5A 3CMMA 3RRWA 3QNUA 1DNCA 3EHZA 1KF6A 4C3XA 1IBKT 5A1LA 4H9QC 1Z8UA 3HA4A 4DSGA 5FVKA 5AQVB 4JI0T 1W0AA 2BS2A 4TNVA 1HXS4 4NIQA 4DGKA 4OYJA 5FY0A 4MHCA 1VRBA 3ZN0B 1NHPA 1XMOT 2CXLA 1H81A 3K8PC 4DV2T 3H3MA 2XFUA 3GQHA 2Q9QC 3UU4A 2RABA 5JDQA 3NGCX 2BACA 2WY2A 3ALJA 4FJOA 3KU9A 2JMHA 1I6ZA 2H7OA 1IUWA 2YOEA 1T8BA 1B4VA 4B64A 3R6NA 3MXZA 4YSZA 3V3NA 3UUNA 3SYIA 4JI2T 3KD9A 2WWVA 1EL9A 1O94A 1XMQT 3HZLA 4CNKA 4PJLA 3AE3A 5FP3A 5ABFA 4A6NB 2R0PA 1OEDC 2PHHA 3C51A 2RGOA 2ODVA 3SZ0A 5LV9A 4L9IA 4OPIA 3RHAA 3KFWX 2Y6XA 3UOVA 5LG4A 1DJQA 2ZLYA 3EI0A 1N1PA 5JREA 3CQXC 3I0QA 2IIUA 4YHHT 2HPLA 2JJ9A 1DODA 2C76A 4H9OC 4TNWA 2B1EA 1Q9IA 4J56A 3U3IA 3AE9A 2WBLA 1RSGA 5HXCA 3FBZA 3O9XA 2VURA 2GR0A 3IBPA 1XDPA 3N2KE 2R4JA 2GVCA 1YKEB 3Q9DA 3GN5A 4JI4T 1CL0A 1JOAA 3I1AA 3I9YA 3ONLC 4JI6T 1OOPD 3UKHA 4X64T 5DQVA 5AQMB 3UFEA 4MJWA 1VBC4 4YHJA 2FJDA 2ZM0A 3UU3A 5JQGE 2WPFA 1K0JA 3ICTA 2YG6A 4ADWA 3ZC0A 5AQNB 3PUGA 4J2CA 3FMWA 2YU2A 3VR9A 1MMDA 3K3QC 3NLCA 1WRDA 2E1MA 3G5SA 1O95A 2XLTA 4U8JA 4WBNE 3LK3B 4UEMA 2X50A 4PFOA 5IHYA 4EQXA 4O4LE 2CBIA 4EYYR 4Z90A 2YDSA 2HH7A 1YQ4A 4H4WA 3P4PA 2VQET 4GKJT 2IMLA 4H4RA 2KZ7B 5L3FB 4H9PC 1B5QA 3P1WA 5BMVE 2E9XD 4H7UA 2CBJA 4DO0A 4XZCA 2UXXB 2WOWA 2C7GA 3V5SA 1Q1RA 2J47A 5CB4E 2CPTA 2PG8A 5AFUL 2OLOA 2CM0A 5AQGB 4ASKA 1E7PA 5KMGP 5HXEA 3RYHE 3AAAB 1POV0 3JC6D 4TV9E 2KT9A 1PBFA 3RP6A 4COFA 3ZPOA 5FXXA 2BS3A 3G06A 4GK0E 2YM2A 1PDHA 4AISA 1I94T 3UQ7A 1RUE4 5BUKA 1IAPA 2PYXA 1AR84 4DVDA 2WQYA 3AYIA 4H2RA 2BDEA 2X99A 4ZI2C 1PO14 1F8SA 1RVF4 4ZZCA 1Z7S4 4U8NA 4Y4LA 2BZBA 2Y6RA 5JR9A 2CVJA 1LVKA 2X8GA 3D1CA 3ZEFB 4FK1C 2H3RA 2Q6UA 3RI5A 1VOMA 2XM2A 4PJNA 3FIMB 1E1HB 5DABA 2QRXA 2JAEA 2NR4A 3CX6B 2OLNA 1GSNA 1HS7A 3HYXA 5L4EA 4Z8XA 2V3BA 1VBA4 3O1IA 1W9RA 3Q5XA 4B68A 5HAXA 2XTLA 2Q9QB 4IE6A 5LOVE 3ZLIA 1IUVA 2WDQA 1AL24 1BR0A 1PN0A 4NEVA 5EK2A 1BKWA 5FMHA 1DOCA 2LT3A 3RC3A 4TM1A 4IDZA 1Y56A 4U2TA 5M10A 2V3AA 1XHCA 1OEDB 4KHZF 4BK1A 4PW8A 1DJNA 4H4XA 4YTNA 2X68A 5J2TE 4I59A 2BRYA 4CNJA 3N9LA 1LTXR 2LJLA 1UCUA 2WZHA 1NENA 1WR0A 2HN1A 2KWHA 1PO24 2HN2A 1FEAA 4PJMA 3IA3A 1M6IA 1PBDA 2DHRA 2JQ9A 5F5WA 5L4HA 5HEJA 3S4UA 4OPUA 3RKOA 3OJAA 2N1GA 4XAXB 5LB7B 3ZMUB 3F8RA 1RUF4 3DK8A 1VBD4 3NVOA 2HWC4 2C66A 1GALA 3VKHA 1PHHA 5EK3A 1TDOA 2X0YA 2BRAA 4EM3A 2CMRA 5J7XA 2OA1A 4LMKA 1Z0PA 3UT5E 1ZDLA 5FMNA 1BEV4 5LHGB 3O0HA 3GWHA 4DUZT 3CN8A 3UKPA 3T0KA 1ZY8A 3QC9A 4YJ3E 3J7Yq 3CTYA 1FEWA 1KK7A 3L1RA 4H2NA 4GF7A 1H7XA 2JBVA 5LHHB 2LE8A 2V7JA 3AA7B 3SUCA 4CI3B 3PUWF 1VRH4 2VZ2A 3DJBA 4H4UA 1ZKEA 3ZJ2A 2XQ4A 2Z6EA 3Q5WA 1GRFA 3REDA 3ABVA 1BWCA 2ZM8A 4K22A 5FYMA 2PTFA 3AE7A 4YXDA 2IDOB 4HKAA 4GIWA 5L2LA 4B66A 4EXTA 2C70A 4GUVA 4TUYE 3V76A 1PJ5A 4ICYA 2WSSV 1JEHA 3GDPA 2RS34 2W2UA 5AQHB 4BJYA 4O4HE 3RIUA 2C67A 3DMEA 4OVIA 3EUHA 3P9UA 4DR5T 3RYIE 1KNRA 2ZZBA 2NPXA 3TLVA 5HYMA 4U3CA 4X9MA 3RYFE 2W0HA 1WYCA 4A6NA 1ZMDA 2PYLA 4U2SA 1YY5A 3ZMSB 3UFGA 2WOVA 2A87A 4CXWA 1ZOVA 3AA1B 4BV6A 4WBOA 2CRBA 3CWZB 4JLEA 4GR1A 3RIFA 2FJAA 3GMCA 1D1BA 2H7VC 3TLTA 2Y8DA 4K0KT 1E2AA 3BQLA 4I43B 4ANJA 1D7YA 1NEKA 4U8OA 2LOPA 2CA5A 1UUSA 3AE5A 2VKDA 2WPEA 2C73A 2HQMA 3WE0A 4C74A 3C4AA 5U25A 4WZXA 2CCQA 2L8KA 5HHFA 4CRTA 2W4XA 3AYLA 1H8TD 4X66T 2QA1A 5JDMA 2R45A 4M1PA 4HN9A 4B63A 2C72A 1UK5A 4IDPA 1XHXA 3UP4A 3AE2A 3K7MX 2AR8A 3D0TA 3J9X1 1HX1B 2LRKA 3EF6A 2JB1A 3UOYA 2C5JA 5H6RB 3K7TA 2W67A 1LRZA 2J62A 3PV0F 4OFZA 3NYEA 2Q0KA 3UTHA 2IW5B 3P4WA 3QB5K 3N9MA 4YKGA 3PUVF 5FS9A 3EDVA 3KPKA 1FIOA 2BBJA 4PK4A 1M62A 1GNDA 1D0YA 4LMJA 4A56A 4EEDA 2Z5YA 4RHV4 4GCMA 1F8WA 2UXNB 2XFPA 2XDOA 3QFAA 4HFDA 4XBFB 2CULA 3DK4A 5AQJB 1D4EA 5IYZE 5KMQA 4HB9A 3B5MA 5AQLB 5FXVA 4YTPA 4J36A 4RSLA 1GRTA 2A2FX 3ZN1B 2XASB 5JVDE 4X4JA 3SM8A 1FJGT 4NXNT 3JCFA 3M3ZB 2LHNA 4K0UA 4YSXA 4CXXA 1YQ3A 4EEBA 1J1JA 2X9XA 4DIDB 4UDRA 3GQKA 3BI2A 4CN1A 1YXRA 2YG4A 3P4RA 5TAOA 4P09A 1CF3A 2YN6A 4OPCA 4HWIB 5GSNA 1V9DA 5DQWA 4IVOB 2LSKA 3PU8A 4H9RC 3SZWA 3UULA 2BG9E 1HNZT 1V59A 2UXBT 1TYTA 3ALMA 2APGA 2Q9QA 5FY1A 2WM9A 4JY3A 4HFHA 3ALLA 4A65A 3M13A 2BYBA 4EMJA 5FKYA 2B76A 4YT0A 1CJCA 4EQWA 3CKDA 1PS9A 3AEGA 1YQZA 2B9YA 1D4DA 4TWDA 3OVUA 4EGWA 3EPTA 4QX7B 1K4QA 2MTQA 4IA6A 1CUNA 1OEDA 4ZHQE 4OYKA 3NG7X 2X9HA 3GYJA 1S3EA 3PO7A 5KDMC 2FJEA 3LB8A 2X9YA 3KKJA 3CGDA 4RG4A 3LDQB 2H88A 3FG2P 2WEUA 3HKDE 3CPHG 3ATRA 2RMU4 2V6XA 2M6BA 4YJ2E 4A97A 3B3RA 3AEAA 3PUAA 2EQ6A 4JDRA 4HFVA 2K24A 5JCLA 3H37A 4LMLA 1NHSA 3SXIA 2YQUA 1ZV4X 3AE6A 1Q1WA 3GRTA 4HA6A 2GH5A 2ZBWA 4WNKA 5KMRA 3NT6A 2YINA 2OAMA 3K1SA 1KSSA 2BKOA 2IAKA 2G0UA 3NBXX 4Y4NA 3T37A 3LZXA 3KLJA 1XNRT 4Y4MA 3E08A 2GR2A 1MIVA 5U1OA 1NA1D 4NZHA 2C0SA 1RUI4 5AQTB 4LF9T 1MMGA 4EM4A 3SFEA 1L9CA 1TDNA 3EDUA 2EQ9A 4OK0A 4DR3T 2XQAA 2X5ID 4ILAA 3LK2B 2GV8A 2R7FA 4TWHA 4NUVA 1S3BA 2J3NA 4GOUA 4ZN0A 3CNPA 2A8XA 2BABA 3K3OA 2V1DB 2X0HA 4FI5A 4LU6A 1YKHB 4UELA 2JQHA 4QXBB 4UV9B 4Z24A 4X1YE 2UUAT 2NP9A 4NUUA 5EOWA 5H6QB 2R0GA 5KMPA 4BK2A 4CY6A 4KUMB 3GWDA 4LF7T 3NHOX 4AP3A 2F5ZA 4I58A 3ONJA 4HFEA 5LMNT 1FEBA 1RUC4 1WFDA 3UKLA 3JAFA 1L9DA 3CQCB 5AQQB 4LFBT 1PXCA 2JIWA 2M67A 3ZMTB 2XQ9A 1OJDA 1DOEA 3NKZA 4PNIA 4H9NC 3N9OA 4UDPA 2VKJA 4FK1A 4ILBA 2KXPB 1COV4 2PLV4 4UIGA 4BJZA 2I6HA 2P9BA 2XVJA 4JYAT 1N34T 4Q4Y4 3C98B 4GRTA 2VQBA 3N9QA 3NK0X 3DGZA 3M65A 4H4VA 4AXPA 4J2WA 5BRTA 3EVYA 4B67A 4AQGA 1BF3A 4U8IA 1QSDA 2BG9C 1FMVA 4O4JE 2PJQA 4E7SA 4H4TA 3AD7B 3G5RA 4JI7T 1S2YA 2IVEA 3CNSA 3PDYA 1DOBA 4K7ZA 1LKXA 1Y0PA 2BBHA 3AAIA 2LSJA 2WU5A 3ZDNA 4QXHB 5KRQA 1HRI4 4F8HA 1U5PA 3ESLA 3HKCE 1CC2A 3UUMA 3WAKA 4OPTA 2FBWA 1YD8G 3ZYKA 5CKUA 5AQIB 2LLYA 2A89A 1BR4A 2I59A 3L09A 4LFAT 1HCIA 3EABA 3NKSA 4XWRA 4E0VA 1DXLA 1XI1A 4I0UA 4PAAA 3ZT7A 2ACZA 1EL5A 4H4QA 3IC9A 3LK42 4DR7T 3ICSA 2X67A 5J2UE 3LZWA 5JRCB 4X5TA 4DSHA 4EZ4A 3HYVA 3B6DA 1GESA 3BK9A 2NWBA 2YK0A 3ETUA 5C2TA 1FOHA 3AA6B 1MIWA 3AB3B 1ZMCA 1KNZA 4G6HA 3NNEA 2BCPA 2DL1A 2B7SA 3KVBA 3VQRA 4FX9A 3AYJA 2ZZCA 3I9WA 4CI2B 4TLZA 3O1JA 4I50E 2YVGA 2OV9A 3ZJ1A 4J31A 5JTGA 1S2QA 1IJ5A 4IE7A 1D0XA 1GRAA 4IV9A 4HWDA 4FDCB 2SPCA 1XDIA 2Y6QA 1R8IA 5HXSA 3TLSA 1XWMA 3PU3A 3T14A 5FS6A 4AOSA 4U2YA 2YLXA 3F57A 3OKQA 2XAGB 4HWHA 3ZMVB 4DV0T 1JRYA 3DK9A 1T98A 1RUH4 5ABHA 3KBTA 1M7KA 2PZSA 3VHLA 1PVC4 4TLXA 3GMBA 3CGCA 3RQUA 2V7LA 1AR64 4O2BE 3BQIA 1UKVG 4ZI3D 4JQ9A 1QO8A 1H6VA 1GXFA 1JU2A 4KX6A 2AAQA 3O1HA 3DGHA 2A3DA 2QA7A 3H8IA 1IUXA 1NAFA 2WWUA 3MA9A 4JN9A 2XM1A 1UURA 3KVAA 1IZNB 4CI1B 2V26A 2I0ZA 1HR0T 4AKRB 2M6IA 3RF1A 1BGNA 2UUBT 2VL8A 4AT0A 3SZCA 5IQ1A 3ONXA 3BNMA 1PBEA 3MK7C 4X62T 2JMKA 2R9ZA 3UOXA 3NZQA 2HHHT 4ISTA 2BG9B 1CBOA 1HTJF 5KX5E 4YFSA 1ONFA 3WI3A 4OPDA 1GQEA 2LEHA 3C64A 4G63A 1S94A 1ELIA 5F8PA 4TM3A 3T31A 3TKLB 2Q0LA 3AD9B 4GDPA 2WU2A 3UTGA 2EHOC 1EL7A 2VVLA 4JI3T 2X8HA 4BURA 1KDGA 3K30A 4JNAA 2BK4A 4WW0A 2O9ZA 2NVKX 2RM24 4II2A 3IWAA 4L0RA 4QH5A 4B1BA 2BA9A 3LJCA 1MNDA 2FUPA 3AWIA 4DV6T 1KEYA 2E5VA 2L9QA 2LOSA 4U2ZA 3FZLB 1SEZA 2GAGB 1NAAA 1GTHA 2KMFA 5CGMA 1HX8A 2GK9A 2XVEA 2IC9A 3C50A 2CDUA 2CXFA 4GYRA 3L3PA 3K3NA 4M52A 4B3MT 1XANA 4DNAA 2VK9A 5HEOA 4RG3A 2C4CA 4NTDA 5FXZA 3TLUA 3AE1A 2IUBA 1JRXA 3E22E 2YDQA 4APNA 4EIQA 4G73A 1J5WA 1W09A 2Y48B 4QH1A 2WAUA 4WYVA 1H83A 4Z25A 3UP5A 4QWNB 1PBBA 4J57A 4CQIA 4U33A 1HFAA 4C5OA 2H89A 3I6DA 2YG5A 3JBG4 4MBQA 3T1HT 3ZT5A 1GERA 4F6RC 4JI1T 5KOWA 3RQWA 3CPJG 5ETWA 1TRBA 4AOXA 2C64A 3CX8B 1D7LA 2CHNA 4U7YA 2WETA 3NIXA 5E0OA 4JV5T 2W00A 5JCMA 3HR0A 2K48A 2PW9A 3KINB 4X1KE 1COYA 4O5UA 3VRAA 4JBWF 4YWOA 1W0BA 2HPJA 4OPGA 5L46A 4HWFA 1D4M4 4C3YA 1O5WA 4D03A 1VDCA 2XHEB 3NN6X 3PJAJ 3AVSA 1L9EA 4U8LA 2VVNA 2XVFA 3RP7A 4TX5A 5BVAA 4UXNB 5EZYE 3BQKA 2DKHA 4CCRA 1P2HA 1RHI4 3IEEA 3CVRA 4NTEA 3C4WA 3UU6A 1CJ4A 4I55E 4PAGA 3RC8A 1HG2A 1H7CA 2IC6A 4U8MA 4ZZBA 2KWIB 2XLSA 2QGSA 2WCAA 3JD74 1VG9A 5L3EB 2XQ6A 2WB5A 3R9UA 3HL6A 4DV1T 4KPRA 4U72A 1NDAA 1CHUA 2WP5A 2XSBA 3RLFF 3F8PA 1NHQA 2JK6A 2KSRA 2Q9QD 3UQ4A 2C5KT 3A7MA 5JRCA 2CFYA 2YLWA 3ZKRA 4YKFA 2E9XC 4XXGA 3T8OA 2EHOB 5LGUB 2LSYA 1US7B 2UUCT 2ZM2A 5LXTE 3LADA 4ECHA 2BS4A 1PJ7A 2WDVA 3KA7A 3JADA 3JC6C 3P8CD 2ZM6T 1YW0A 5FS7A 3VR8A 3M12A 4ZS3A 2C65A 4QX8B 4D04A 4CY8A 3KPFA 5IUXA 1VG0A 2PFVA 1FL2A 2J1DG 3ZT6A 3GN5B 2X3NA 1RUJ4 3DJEA 1D5TA 2GRTA 2BXRA 2VKOA 2WP9A 1XDOA 4UVAB 2ARDA 2RP4A 2QYWA 3PUZF 2D2SA 3L39A 5IWAT 4DUYT 2LHRA 1LV0A 1OJ9A 1VBE4 3P4QA 1F8RA 5FL0A 4GAVA 5HWYA 1LQTA 1FCDA 4NXMT 3SWHA 3NWIA 3HKEE 3N2OA 3C4ZA 5KXJA 3AA0B 2KLQA 4IDNA 5LJNA 5ABEA 1IUUA 3C4XA 3R84B 1ZP0A 3OBVE 4PJJA 1RP0A 1GRGA 4DV7T 1HRV4 1CJ2A 2VVLG 4UR9A 1MMAA 3BI4A 3CNTA 3OC4A 3FBSA 1H7WA 5ER0A 1RUG4 2XVHA 4H4SA 1VCTA 2VVSA 3I3LA 4UP3A 4IA5A 2DWGA 2YG3A 4AT2A 2YU1A 3AXJB 1UGOA 2EQ8A 3ICRA 4EQRA 5EK4A 3B57A 2VL0A 5KWFA 2JQQA 3ZYXA 4HFIA 2RGJA 1E1LA 3KV9A 1DU2A 3FBLA 5LCYA 3CX7B 3ZMZB 1GOSA 4P0BA 4C91A 4IGUA 2JRKA 2LKGA 2R044 3GDNA 3OPCA 3F2EA 4BJNA 2QCUA 4NWZA 5KMSA 1KNPA 3I0OA 4OX9T 4H2PA 5FS8A 2MBGA 2C75A 2BG9A 3QVRA 3COXA 4A9WA 1OJCA 3FZFB 2HWB4 4CXYA 4ILUA 2BVMA 3N5LA 5HXRA 2YR6A 2LFCA 2XAFB 3GYXA 4QHOA 5LGNB 1AOGA 2RS14 1XHZA 2R6GF 5M4YA 4ADZA 5LYJE 4G74A 1OJAA 4EV6A 4LA1A 2VVMA 1FMWA 3UKQA 4IREA 3W15B 1AJ3A 5LJMA 4ZI2D 4EOZB 3QB5A 4ZEYA 1S35A 3ANWB 2NW7A 5AQPB 3NYFA 1B8SA 1IJ6A 1D1CA 1AR94 3AAEB 3GD3A 3RNMA 2DKIA 3DH9A 3RPUA 2E4GA 3MKDA 2WMNA 2NTXA 5EBKA 2ODUA 5LBMA 4AI6A 4LF6T 2E9XB 3UTEA 4II3A 1GTEA 2NW8A 3MACA 2QVAA 4I4TE 5LMUT 4AKLA 5CA1E 4O4IE 2GF3A 4H4PA 1R084 5LA6E 3II4A 5JDHA 5LG3A 1AR74 1EV14 5ADXL 4USQA 4J33A 1HG5A 3U78A 1E6EA 4U8PA 2V5DA 4QKNA 3ZCIA 2RS54 5KVHA 2YVFA 4H50A 1CC4A 4LF4T 4TV8E 3N2GE 1IBLT 1SHZC 1QJDA 3T2ZA 3UU8A 2WZIA 4CZZB 2XFQA 1PBCA 3NTDA 4EIPA 4DNDA 2X8CA 4USRA 2NOXA 3DJGX 4O2AE 3NTAA 4EYUA 3FB2A 1N4UA 3K7QX 2YVJA 2W66A 4LIIA 2XAQB 2XVIA 3CIRA 3V3OA 4Z43A 5AQFB 5LBQB 5FY7A 2BCGG 1MIYA 2NTYA 3J8F4 4L5GA 4LF5T 1BGJA 1BZLA 4U2LA 2MAWA 4MFRA 3GMIA 5BULA 2DWKA 1MOKA 3LJPA 5DJQC 4P0AA 1X79A 2K9AA 3IHRA 3P50A 3RRCA 2LM9A 1GRBA 2WS3A 5AQUB 4G6GA 1NWMX 5CA0E 1D4CA 2V7MA 4IDOA 1GETA 1RYIA 3RGLA 1K0LA 3H8LA 2VRMA 3KBUA 3AB1A 1EZ3A 3UUXB 3PTRB 4HFCA 2V6YB 3AVRA 4N78D 2UXCT 4Z26A 5L47A 1ZK7A 2BXSA 5AQRB 2PYJA 4UVCB 4B65A 3GRSA 4IE5A 2AQJA 3DJDA 2X9WA 5CQFA 5HY5A 3SX6A 5HYAA 1WR6A 5KVIA 4B69A 2X0LB 2X51A 4Q25A 4PABA 3GA8A 2BK3A 3H3AA 2YEVC 2XPKA 5LP6E 4Z2UA 1ZX9A 4KI0F 1XZYA 1E1MA 4K8DA 2N9DA 4JEUB 4EMIA 5FNVE 2YG7A 2CLYC 5C3JA 2X66A 1LVLA 2EHOA 2CXDA 1HNXT 3RHWA 1E39A 3KV4A 1ZOYA 2RPAA 2V5CA 4YLHA 4Z91A 1TDEA 4YTMA 3FPZA 3RIAA 2YLZA 2UU9T 1REOA 2WHDA 4GDEA 3LG7A 3Q5EA 1F3PA 4GK5E 4WX1A 2XAJB 3CQGB 3Q9TA 2GEWA 2D0TA 2R064 2YLTA 4CCQA 1QUUA 4AQFC 1TYPA 4Q4W4 2GMJA 1EBDA 1TDKA 2J4GA 4NTCA 2CEAA 3N9PA 3NH3X 4UF0B 5AQKB 4JI8T 5J0ZA 5J60A 3VKGA 2B9XA 3CK6A 4EIWA 3DTOA 3KVEA 3UUBA 1L0VA 5M0ZA 3SFDA 2A9UA 5JDGA 1KSUA 3C4NA 2DCFA 4ZCDA 3JAEA 4ERRA 4DBQA 2WP6A 2CWYA 1MQTD 4IT4A 4P1NA 3AEEA 4WCTA 4A5LA 4HFBA 4JI5T 4DR2T 2GQFA 2VQ7A 4H4YA 4Z2RA 3H4KA 1J5ET 3AXJA 1VBB4 1VCSA 2V6OA 1NHRA 2W63A 4U8KA 4A79A 1T72A 3BHKA 2LSGA 2N2NA 2LM2A 3RH3A 2XY8B 3O4XE 4OCGA 2D9DA 3ZC1A 3PS9A 3CPZA 1CC6A 5LGTB 3T2YA 2JPFA 1N4VA 1XPQA 2V5ZA 3Q2MA 4KMCA 1JRZA 5HEUA 3G5QA 3OTOT 3L8RA 4QXCB 4BA9A 3PJAA 4ZS2A 5L3CB 1E1NA 4YY3T 3T2KA 4KP3C 3RYCE 1Z6LA 1D0ZA 1JNRA 1IUSA 4XWZA 3SS1A 2AE9A 4GYSA 5GONE 2OLTA 3LBXB 5F3JA 3KV5A 2VQFT 1BR1A 5HWXA 4X65T 4DV3T 4P9SA 1ZHCA 2CHOA 2E2AA 3PURA 3AECA 3ATQA 4AP1A 2RR14 4GKKT 1UX4A 5AQOB 3P4SA 2JB2A 4IIJE 4MLKA 4TWFA 1LJ1A 1XNQT 2Z5XA 1SUMB 4K2XA 3QVPA 3ANWA 2BKNA 3QUJA 2IVDA 1T7SA 3L8KA 4YSHA 2K5BB 5JCKA 2XSAA 2D0UA 2XZEA 2V8SV 1TDFA 4EB6E 1LPFA 4AKHA 1D1AA 4X20E 3X1DA 5L3GB 4H63H 2XQ3A 2E5LT 4G2AA 3ITJA 4TM4A 4PK6A 1GPEA 4DR1T 2IIDA 1RUD4 4C77A 2V60A 4G9KA 1N36T 1F6MA 4AQYT 2E9XA 2XQ7A 2CLYB 3KV6A 3ZCJA 1MO9A 1Y64B 1SE7A 3UKKA 1O3XA 3UU5A 5DBJA 3V5UA 2B7RA 5HEGA 2JQKA 4ILCA 2R0CA 3F31A 2YDRA 3QFBA 3NRYA 2UXDT 3BI5A 3QOFA 1VRQB 1HYUA 3HI2A 4JNQA 1X31B 3URHA 2CWOA 4A5XA 1EL8A 5C8YE 3QSMA 3FHNA 3OYXA 4JY2A 1UX5A 4H9SE 2WBAA 2VB6A 1OJTA 3M0OA 4Z44A 2YM1A 1ZKQA 3B13A 4EZHA 3CNJA 1LQUA 4QH4A 5EB4A 3S61A 1ASJ4 2NW9A 5JDLA 2PBIA 1P2EA 4DMVA 1NPXA 2V7IA 4A98A 1NG3A 2RA1A 2WMOA 4JEHB 4ZXLA 5JDFA 2YR4A 3LOVA 2XFNA 1W4XA 3GD4A 2EQ7A 3D8XA 3QJ4A 3EANA 3PUQA 2B9WA 2PY5A 4BAYB 3BHFA 4IVMB 1BR2A 2VOUA 4EQSA 1GV4A 2GQWA 1MXTA 1H86A 3NRXA 3IF9A 3CNDA 5HCMA 3GSIA 3BNUA 1NG4A 4H2QA 2JKCA 1KFYA 1FECA 2GB0A 1M64A 3DP7A 4ZCCA 1NCQD 4DBRA 2VKHA 5HCJA 2V6YA 4HEAA 2YR5A 1RMU4 5KOXA 3LFMA 5JH7E 3VU7H 4E7ZA 1B7TA 3C96A 1OWAA 3AXBA 3NK1X 5JR9C 3FZKB 3EAMA 4A99A 2R4EA 3RKGA 2W61A 2R46A 5JCNA 3EAOA 4H4ZA 4NPPA 4EMWA 3SGLA 3N9NA 4IE4A 4DR4T 4IE0A 4IL4A 3KDSE 3IF8B 3SOLA 4JUYA 4DV5T 5CFBA 2XLUA 1K5MD 2W62A 4NEWA 2XLRA 3ZYMA 3P7IA 3QSSA 1WYBA 2WPCA 3NYCA 4U31A 1IJHA 2D5UA 3FZHB 3JSKA 1CJ3A 2C3CA 5ABFB 4KHPT 3AE4A 3PE0A 5U63A 3LXDA 2XCGA 2DNXA 4UDQA 4UV8B 5LHIB 2I0MA 3PUXF 4Q4V4 4O5QA 2K3WA 1LVFA 5IPYA 2LSIA 2EX3A 3ISHA 3ADAB 3PUSA 5GRTA 2YKSA 2ACXA 3FZMB 2TPRA 3DJJA 3SZFA 3FI7A 3UKAA 4UF0A 2QA2A 3QSEA 3A8YC 4CBQA 3RX6A 2MPKA 2GR1A 4ZI7E 4ZOLE 4UVBB 3VRDB 2XFOA 3AEDA 5BR8T 2DI4A 3PUYF 1Y01A 3AEBA 2YLSA 3T1YT 4K5RA 1GEUA 1ZEEA 2L3LA 2WOIA 1MNEA 2F4VT 1H82A 2FJBA 4OPLA 4C90A 4X1IE 4ZI3C 3CGBA 4TZ4C 3E0ZA 4AKGA 1N32T 1B37A 4HGAA 2WESA 3SQPA 2LKHA 3HKBE 3ZSTA 1WCRA 4B3RT 4AKIA 4AIUA 3ZYLA 1GT8A 1VQWA 2WDRA 2E8IA 1WLXA 1QLBA 2XUEA 3Q6JA 4LF8T 2AXDS 4GB34 1U4QA 1HNWT 4B6XA 1IUTA 4OHFA 2W0GA 3AEFA 1EAH4 5J1GA 2ZZ0A 5HXIA 4REKA 4PFPA 5KNLA 1G73A 5TR3A 2OA5A 5FXWA 2Q7VA 2MYSA 3Q5DA 3SY4A 3QK6A 2JB3A 4DMWA 1IBMT 3LBXA 3DA1A 3RIUC 4LFCT 2LRLA 4IL9A 3CMLA 1E1KA 5HXHA 4Z2TA 1X9BA 4HE8A 3UTFA 5FL1A 4Q4X4 2BK5A 4TN7B 4GAPA 3HYWA 2XQ5A 2XYOA 2RGHA 1HF8A 1OEDE 3WAJA 4PDWD 1N33T 5L3DB 1N4WA 1YKJA 2GAHB 5JR9B 3UKFA 3AE8A 1G8XA 4HTEA 4IHJE 4H63V 4O8SA 1JNZA 4CN6A 3NK2X 3E1TA 3UTKA 3CGEA 4DV4T 3NZPA 5EB5A 3NN0X 4ISSA 5L3BB 2QAEA 4X9NA 3UOZA 1GREA 2VWAA 3IHGA 3ETVA 2YAUA 2XLPA 2XAHB 1PJ6A 3AD8B 2TMDA 4BJMA 3GWFA 4B3ST 3MJXA 1GRHA 1PXAA 3RP8A 3NRNA
chains in the Genus database with same CATH topology
3AYLA 5C3JA 4TM3A 3S5WA 1H84A 3T31A 2Q0LA 2QA1A 2R45A 1LVLA 3AD9B 4GDPA 1Y56B 2WU2A 1E39A 3VRBA 3UTGA 4B63A 4CRTA 4J34A 2C72A 1ZOYA 1EL7A 2V61A 3PVCA 2VVLA 2X8HA 3UP4A 3AE2A 4BURA 1KDGA 1TDEA 4YTMA 3FPZA 2BK4A 2AR8A 3K7MX 3K30A 2O9ZA 4JNAA 3EF6A 2YLZA 2NVKX 5JCIA 2JB1A 1REOA 2WHDA 4GDEA 4N9XA 3K7TA 3UOYA 1F3PA 4II2A 3IWAA 3NYEA 4B1BA 2BA9A 4WX1A 2Q0KA 1PXBA 3UTHA 3Q9TA 2VRLA 2GEWA 4TM0A 3AWIA 2YLTA 4CCQA 5IQ4A 2GR3A 2E5VA 4YKGA 5FS9A 1TYPA 1SEZA 2GAGB 2GMJA 1NAAA 1EBDA 2YWLA 3KPKA 1GTHA 1TDKA 2C3DA 4NTCA 3NH3X 1GNDA 4K5SA 2YLRA 4YSYA 2XVEA 2Z5YA 3CPIG 5J60A 2CDUA 2B9XA 2OALA 3OZ2A 3UCLA 4GCMA 1F8WA 4M52A 4A7AA 2XFPA 2XDOA 3QFAA 1XANA 4DNAA 4BK3A 4NNJA 3IHMA 3KVEA 4RG3A 2C4CA 1L0VA 2CULA 4NTDA 5M0ZA 3DK4A 3F8DA 3AE1A 3SFDA 1D4EA 1KSUA 5KMQA 4HB9A 1JRXA 3C4NA 4APNA 4ZCDA 4EIQA 4G73A 4YTPA 1H83A 4J36A 4RSLA 3UP5A 4Z25A 2WP6A 1PBBA 1GRTA 4J57A 2GMHA 2BC0A 3AEEA 4WCTA 2UZZA 4C5OA 4A5LA 2H89A 3I6DA 2YG5A 3GYIA 2GQFA 2BC1A 2VQ7A 4H4YA 4Z2RA 4X4JA 3SM8A 3H4KA 1K0IA 1GERA 4YSXA 5KOWA 3CPJG 1YQ3A 1TRBA 2V6OA 1NHRA 4AOXA 2C64A 3CMMA 4U8KA 4A79A 1D7LA 3BHKA 4UDRA 3GQKA 3BI2A 1DNCA 2WETA 3NIXA 4OCGA 1KF6A 2YG4A 4C3XA 3P4RA 3PS9A 1CF3A 5JCMA 4OPCA 1CC6A 5GSNA 3T2YA 1N4VA 1COYA 4DSGA 1XPQA 2V5ZA 3VRAA 4O5UA 1JRZA 3G5QA 4IVOB 4OPGA 4YWOA 5L46A 4C3YA 2BS2A 1O5WA 4D03A 1VDCA 3SZWA 4DGKA 3NN6X 1L9EA 1E1NA 4U8LA 1V59A 1NHPA 1TYTA 2XVFA 1Z6LA 3ALMA 3RP7A 2APGA 3T2KA 4JY3A 4A65A 5BVAA 1JNRA 1IUSA 1H81A 3ALLA 3GQHA 2XFUA 2BYBA 3M13A 4XWZA 2RABA 3NGCX 2DKHA 4EMJA 2BACA 1CJCA 4YT0A 2B76A 3ALJA 4CCRA 3KU9A 4EQWA 1P2HA 1IUWA 1PS9A 3AEGA 1B4VA 1YQZA 4B64A 2B9YA 4YSZA 4P9SA 1D4DA 3V3NA 4NTEA 3SYIA 4AP1A 3AECA 3ATQA 1CJ4A 3EPTA 3KD9A 1K4QA 1EL9A 1O94A 4IA6A 3HZLA 3P4SA 4CNKA 2JB2A 3AE3A 3NG7X 4A6NB 2R0PA 1LJ1A 3GYJA 2PHHA 2Z5XA 1S3EA 4K2XA 2RGOA 3PO7A 2FJEA 3QVPA 3LB8A 4U8JA 4U8MA 3SZ0A 5LV9A 2XLSA 2IVDA 1VG9A 3CGDA 3KKJA 4OPIA 4RG4A 3RHAA 3L8KA 3UOVA 1DJQA 4YSHA 5JCKA 3R9UA 1N1PA 2H88A 1TDFA 3FG2P 1LPFA 2WEUA 3CPHG 3ATRA 4KPRA 1NDAA 1DODA 2C76A 1CHUA 3B3RA 3AEAA 2EQ6A 3ITJA 4JDRA 1Q9IA 2WP5A 3F8PA 4J56A 4TM4A 5JCLA 1GPEA 3AE9A 1NHQA 2IIDA 2JK6A 1RSGA 4C77A 2V60A 4G9KA 1NHSA 3SXIA 1F6MA 2CFYA 2GR0A 2YQUA 3AE6A 1Q1WA 2YLWA 3GRTA 2GH5A 2ZBWA 4HA6A 2R4JA 1MO9A 4YKFA 2GVCA 3UKKA 4XXGA 5KMRA 3NT6A 5DBJA 2B7RA 2OAMA 1CL0A 1JOAA 2R0CA 1KSSA 3QFBA 4Y4NA 3T37A 3LZXA 3UKHA 3KLJA 3LADA 3BI5A 2BS4A 1VRQB 1HYUA 4Y4MA 4ECHA 1PJ7A 2WDVA 3KA7A 2GR2A 1X31B 4JNQA 4MJWA 3URHA 5U1OA 4NZHA 5FS7A 2FJDA 3VR8A 3M12A 1EL8A 2WPFA 1K0JA 3ICTA 3QSMA 2YG6A 2C65A 4ADWA 4D04A 4EM4A 3SFEA 1L9CA 1TDNA 1VG0A 3KPFA 4CY8A 4JY2A 2EQ9A 3FMWA 1FL2A 3VR9A 2WBAA 2X3NA 3NLCA 3DJEA 1D5TA 2GRTA 1OJTA 2E1MA 2BXRA 1O95A 2XLTA 3G5SA 2YM1A 3M0OA 1ZKQA 2WP9A 2ARDA 2GV8A 4Z44A 3CNJA 1S3BA 2X50A 1LQUA 4EQXA 2J3NA 5EB4A 3S61A 4ZN0A 3CNPA 1LV0A 1OJ9A 2A8XA 1YQ4A 1P2EA 2BABA 4H4WA 3P4PA 3P4QA 1F8RA 1NPXA 4GAVA 4LU6A 1NG3A 4H4RA 1LQTA 1FCDA 1B5QA 3P1WA 2YR4A 3LOVA 2XFNA 1W4XA 3GD4A 4H7UA 4Z24A 2EQ7A 3D8XA 3QJ4A 3EANA 2WOWA 2C7GA 2B9WA 1Q1RA 5KXJA 3BHFA 4IVMB 2VOUA 4EQSA 1IUUA 5EOWA 1ZP0A 1GV4A 2GQWA 2OLOA 2R0GA 1MXTA 1H86A 5KMPA 4BK2A 1E7PA 1RP0A 1GRGA 3IF9A 1CJ2A 2VVLG 3CNDA 4CY6A 3GSIA 3GWDA 3NHOX 3BNUA 1PBFA 1NG4A 4H2QA 4AP3A 2JKCA 2F5ZA 1KFYA 3BI4A 1FECA 2GB0A 3CNTA 1M64A 3OC4A 4I58A 3RP6A 1FEBA 3FBSA 2BS3A 2YM2A 1H7WA 1PDHA 5ER0A 2XVHA 3UKLA 4ZCCA 4H4SA 3I3LA 5BUKA 1L9DA 4UP3A 4IA5A 2PYXA 2YG3A 1PXCA 4AT2A 2WQYA 3AYIA 4H2RA 2EQ8A 2YR5A 2X99A 3ICRA 1OJDA 4EQRA 5KOXA 1F8SA 1DOEA 5KWFA 4U8NA 3ZYXA 2RGJA 3C96A 2Y6RA 4Y4LA 1E1LA 3AXBA 4UDPA 3NK1X 4FK1A 2CVJA 2X8GA 3D1CA 4FK1C 1GOSA 4A99A 4BJZA 2Q6UA 2R4EA 3FIMB 2XVJA 2R46A 4GRTA 2VQBA 5JCNA 2JAEA 3EAOA 3GDNA 4H4ZA 4EMWA 3NK0X 2OLNA 3DGZA 3SGLA 1GSNA 2QCUA 4H4VA 3HYXA 4NWZA 4J2WA 1KNPA 5KMSA 4H2PA 5FS8A 2C75A 2V3BA 3QVRA 4B67A 5BRTA 1BF3A 3COXA 4U8IA 4B68A 4A9WA 1IUVA 1OJCA 2WDQA 4H4TA 1PN0A 3AD7B 2XLUA 3G5RA 2YR6A 4NEVA 2LFCA 1S2YA 3CNSA 2IVEA 3GYXA 1BKWA 1DOBA 4NEWA 4K7ZA 2XLRA 1Y0PA 1AOGA 5FMHA 4G74A 1OJAA 2WU5A 3ZDNA 5KRQA 1DOCA 4LA1A 4TM1A 2VVMA 3QSSA 2WPCA 3NYCA 3UKQA 1Y56A 1IJHA 4U2TA 5M10A 2V3AA 1XHCA 1CC2A 3JSKA 1CJ3A 2C3CA 4BK1A 1DJNA 5U63A 3AE4A 3LXDA 2XCGA 4H4XA 4UDQA 4OPTA 4YTNA 2FBWA 5CKUA 3NYFA 4O5QA 1B8SA 4I59A 2A89A 5IPYA 2BRYA 4CNJA 1LTXR 3ISHA 3NKSA 4XWRA 3GD3A 4E0VA 1DXLA 1NENA 3ADAB 5GRTA 3RNMA 4PAAA 2DKIA 1FEAA 3DH9A 2ACZA 2E4GA 1EL5A 1M6IA 2TPRA 3DJJA 1PBDA 4H4QA 3SZFA 3UKAA 3IC9A 2QA2A 3ICSA 3QSEA 4CBQA 5EBKA 3LZWA 4DSHA 2GR1A 3UTEA 4II3A 3HYVA 1GTEA 3VRDB 2XFOA 4OPUA 3B6DA 1GESA 3F8RA 3DK8A 5C2TA 3AEDA 1FOHA 3AEBA 2C66A 1GALA 1ZMCA 2YLSA 4G6HA 1GEUA 4K5RA 1PHHA 2GF3A 1TDOA 2WOIA 4H4PA 3NNEA 2BCPA 2BRAA 3II4A 1H82A 4EM3A 2FJBA 2B7SA 5J7XA 4OPLA 3VQRA 4FX9A 4USQA 3AYJA 2OA1A 2ZZCA 4J33A 3CGBA 1E6EA 4U8PA 1B37A 1ZDLA 4TLZA 5KVHA 2YVFA 4H50A 2WESA 3SQPA 1CC4A 2YVGA 3O0HA 3CN8A 3UKPA 4J31A 1QJDA 1S2QA 1ZY8A 3T0KA 3T2ZA 1GRAA 2XFQA 3CTYA 4IV9A 1PBCA 3NTDA 4FDCB 4EIPA 1GT8A 2X8CA 1VQWA 1XDIA 2WDRA 3L1RA 4H2NA 4USRA 3DJGX 2Y6QA 4GF7A 1H7XA 1QLBA 2JBVA 1N4UA 3NTAA 3K7QX 2YVJA 3Q6JA 3SUCA 4LIIA 4Z43A 2XVIA 3CIRA 3V3OA 3T14A 5FS6A 4AOSA 2BCGG 2YLXA 1BGJA 2VZ2A 1BZLA 4H4UA 1JRYA 1GRFA 4U2LA 3REDA 3DK9A 1IUTA 5BULA 3ABVA 1BWCA 4K22A 3AEFA 3AE7A 1MOKA 3LJPA 4YXDA 2ZZ0A 5HXIA 4B66A 4REKA 4GUVA 2C70A 3V76A 4TLXA 5KNLA 3GMBA 1PJ5A 4ICYA 5TR3A 1JEHA 3CGCA 3GDPA 1GRBA 2Q7VA 2WS3A 4G6GA 3SY4A 2JB3A 4BJYA 1UKVG 1D4CA 2C67A 3DA1A 4JQ9A 1QO8A 3DMEA 1H6VA 4OVIA 1GXFA 1JU2A 1GETA 4KX6A 1RYIA 2AAQA 1K0LA 3P9UA 1E1KA 3DGHA 3H8LA 2VRMA 4Z2TA 3AB1A 3UTFA 3H8IA 1IUXA 2BK5A 1KNRA 2ZZBA 2NPXA 4GAPA 3HYWA 4JN9A 2XYOA 5HYMA 2RGHA 4X9MA 4Z26A 2W0HA 1ZK7A 2BXSA 1N4WA 1YKJA 2I0ZA 2GAHB 1ZMDA 4A6NA 4U2SA 1YY5A 3UKFA 3AE8A 4B65A 3GRSA 2WOVA 2AQJA 3DJDA 2A87A 1BGNA 1JNZA 5CQFA 4AT0A 3SZCA 5IQ1A 1ZOVA 3BNMA 1PBEA 3NK2X 3SX6A 3E1TA 4BV6A 5HY5A 5KVIA 3CGEA 4B69A 4GR1A 5EB5A 2YG7A 2R9ZA 2FJAA 3NN0X 3GMCA 4X9NA 2QAEA 3UOXA 3UOZA 4PABA 1GREA 2BK3A 3IHGA 1CBOA 2YAUA 2XLPA 1D7YA 4U8OA 1NEKA 4Z2UA 1ZX9A 1PJ6A 1ONFA 2TMDA 3AD8B 3AE5A 1E1MA 4OPDA 4K8DA 2WPEA 2C73A 2HQMA 3WE0A 4C74A 3C4AA 3GWFA 5U25A 4EMIA 1GRHA 3RP8A 1PXAA 1ELIA 5HHFA 3NRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYL A;  5C3J A;  4TM3 A;  3S5W A;  1H84 A;  2Q0L A;  2QA1 A;  2R45 A;  1LVL A;  3AD9 B;  4GDP A;  1Y56 B;  2WU2 A;  1E39 A;  3VRB A;  3UTG A;  4B63 A;  4CRT A;  4J34 A;  2C72 A;  1ZOY A;  1EL7 A;  2V61 A;  3PVC A;  2VVL A;  2X8H A;  3UP4 A;  3AE2 A;  4BUR A;  1KDG A;  1TDE A;  4YTM A;  3FPZ A;  2BK4 A;  2AR8 A;  3K7M X;  3K30 A;  2O9Z A;  4JNA A;  3EF6 A;  2YLZ A;  2NVK X;  5JCI A;  2JB1 A;  1REO A;  2WHD A;  4GDE A;  4N9X A;  3K7T A;  3UOY A;  1F3P A;  3IWA A;  3NYE A;  4B1B A;  2BA9 A;  4WX1 A;  2Q0K A;  1PXB A;  3UTH A;  3Q9T A;  2VRL A;  2GEW A;  4TM0 A;  3AWI A;  2YLT A;  4CCQ A;  5IQ4 A;  2GR3 A;  2E5V A;  4YKG A;  5FS9 A;  1TYP A;  1SEZ A;  2GAG B;  2GMJ A;  1NAA A;  1EBD A;  2YWL A;  1GTH A;  1TDK A;  2C3D A;  4NTC A;  3NH3 X;  1GND A;  4K5S A;  2YLR A;  4YSY A;  2XVE A;  2Z5Y A;  3CPI G;  5J60 A;  2CDU A;  2B9X A;  2OAL A;  3OZ2 A;  3UCL A;  4GCM A;  1F8W A;  4M52 A;  4A7A A;  2XFP A;  2XDO A;  3QFA A;  1XAN A;  4DNA A;  4BK3 A;  3IHM A;  3KVE A;  4RG3 A;  2CUL A;  1L0V A;  4NTD A;  5M0Z A;  3DK4 A;  3F8D A;  3AE1 A;  3SFD A;  1D4E A;  1KSU A;  4HB9 A;  1JRX A;  3C4N A;  4APN A;  4ZCD A;  4EIQ A;  4YTP A;  1H83 A;  4J36 A;  4RSL A;  3UP5 A;  4Z25 A;  2WP6 A;  1PBB A;  1GRT A;  4J57 A;  2GMH A;  2BC0 A;  3AEE A;  4WCT A;  2UZZ A;  4C5O A;  4A5L A;  2H89 A;  3I6D A;  2YG5 A;  3GYI A;  2GQF A;  2BC1 A;  2VQ7 A;  4H4Y A;  4Z2R A;  4X4J A;  3SM8 A;  3H4K A;  1K0I A;  1GER A;  4YSX A;  5KOW A;  3CPJ G;  1YQ3 A;  1TRB A;  2V6O A;  1NHR A;  4AOX A;  2C64 A;  4U8K A;  4A79 A;  1D7L A;  3BHK A;  4UDR A;  3GQK A;  3BI2 A;  1DNC A;  2WET A;  3NIX A;  4OCG A;  1KF6 A;  2YG4 A;  4C3X A;  3P4R A;  3PS9 A;  1CF3 A;  5JCM A;  4OPC A;  1CC6 A;  5GSN A;  1N4V A;  1COY A;  4DSG A;  1XPQ A;  2V5Z A;  3VRA A;  4O5U A;  1JRZ A;  3G5Q A;  4IVO B;  4OPG A;  4YWO A;  5L46 A;  4C3Y A;  2BS2 A;  1O5W A;  4D03 A;  1VDC A;  4DGK A;  3NN6 X;  1L9E A;  1E1N A;  4U8L A;  1V59 A;  1NHP A;  1TYT A;  2XVF A;  1Z6L A;  3ALM A;  3RP7 A;  2APG A;  4JY3 A;  4A65 A;  5BVA A;  1JNR A;  1IUS A;  1H81 A;  3ALL A;  3GQH A;  2XFU A;  2BYB A;  3M13 A;  4XWZ A;  2RAB A;  3NGC X;  2DKH A;  4EMJ A;  2BAC A;  1CJC A;  4YT0 A;  2B76 A;  3ALJ A;  4CCR A;  3KU9 A;  4EQW A;  1P2H A;  1IUW A;  1PS9 A;  3AEG A;  1B4V A;  1YQZ A;  4B64 A;  2B9Y A;  4YSZ A;  4P9S A;  1D4D A;  3V3N A;  4NTE A;  4AP1 A;  3AEC A;  3ATQ A;  1CJ4 A;  3EPT A;  3KD9 A;  1K4Q A;  1EL9 A;  1O94 A;  4IA6 A;  3HZL A;  3P4S A;  4CNK A;  2JB2 A;  3AE3 A;  3NG7 X;  4A6N B;  2R0P A;  1LJ1 A;  3GYJ A;  2PHH A;  2Z5X A;  1S3E A;  4K2X A;  2RGO A;  3PO7 A;  2FJE A;  3QVP A;  3LB8 A;  4U8J A;  4U8M A;  5LV9 A;  2XLS A;  2IVD A;  1VG9 A;  3CGD A;  3KKJ A;  4OPI A;  4RG4 A;  3RHA A;  3L8K A;  3UOV A;  1DJQ A;  4YSH A;  5JCK A;  3R9U A;  1N1P A;  2H88 A;  1TDF A;  3FG2 P;  1LPF A;  2WEU A;  3CPH G;  3ATR A;  4KPR A;  1NDA A;  1DOD A;  2C76 A;  1CHU A;  3B3R A;  3AEA A;  2EQ6 A;  3ITJ A;  4JDR A;  1Q9I A;  2WP5 A;  3F8P A;  4J56 A;  4TM4 A;  5JCL A;  1GPE A;  3AE9 A;  1NHQ A;  2IID A;  2JK6 A;  1RSG A;  4C77 A;  2V60 A;  1NHS A;  1F6M A;  2CFY A;  2GR0 A;  2YQU A;  3AE6 A;  1Q1W A;  2YLW A;  3GRT A;  2GH5 A;  2ZBW A;  4HA6 A;  2R4J A;  1MO9 A;  4YKF A;  2GVC A;  3UKK A;  4XXG A;  3NT6 A;  5DBJ A;  2B7R A;  2OAM A;  1CL0 A;  1JOA A;  2R0C A;  1KSS A;  3QFB A;  4Y4N A;  3T37 A;  3LZX A;  3UKH A;  3KLJ A;  3LAD A;  3BI5 A;  2BS4 A;  1VRQ B;  1HYU A;  4Y4M A;  4ECH A;  1PJ7 A;  2WDV A;  3KA7 A;  2GR2 A;  1X31 B;  4JNQ A;  4MJW A;  3URH A;  5U1O A;  4NZH A;  5FS7 A;  2FJD A;  3VR8 A;  3M12 A;  1EL8 A;  2WPF A;  1K0J A;  3ICT A;  3QSM A;  2YG6 A;  2C65 A;  4ADW A;  4D04 A;  4EM4 A;  3SFE A;  1L9C A;  1TDN A;  1VG0 A;  3KPF A;  4CY8 A;  4JY2 A;  2EQ9 A;  3FMW A;  1FL2 A;  3VR9 A;  2WBA A;  2X3N A;  3NLC A;  3DJE A;  1D5T A;  2GRT A;  1OJT A;  2E1M A;  2BXR A;  1O95 A;  2XLT A;  3G5S A;  2YM1 A;  3M0O A;  1ZKQ A;  2WP9 A;  2ARD A;  2GV8 A;  4Z44 A;  3CNJ A;  1S3B A;  2X50 A;  1LQU A;  4EQX A;  2J3N A;  5EB4 A;  3S61 A;  4ZN0 A;  3CNP A;  1LV0 A;  1OJ9 A;  2A8X A;  1YQ4 A;  1P2E A;  2BAB A;  4H4W A;  3P4P A;  3P4Q A;  1F8R A;  1NPX A;  4LU6 A;  1NG3 A;  4H4R A;  1LQT A;  1FCD A;  1B5Q A;  3P1W A;  2YR4 A;  3LOV A;  2XFN A;  1W4X A;  3GD4 A;  4H7U A;  4Z24 A;  2EQ7 A;  3D8X A;  3QJ4 A;  3EAN A;  2WOW A;  2C7G A;  2B9W A;  1Q1R A;  5KXJ A;  3BHF A;  4IVM B;  2VOU A;  4EQS A;  1IUU A;  5EOW A;  1ZP0 A;  1GV4 A;  2GQW A;  2OLO A;  2R0G A;  1MXT A;  1H86 A;  4BK2 A;  1E7P A;  1RP0 A;  1GRG A;  3IF9 A;  1CJ2 A;  2VVL G;  3CND A;  4CY6 A;  3GSI A;  3GWD A;  3NHO X;  3BNU A;  1PBF A;  1NG4 A;  4H2Q A;  4AP3 A;  2JKC A;  2F5Z A;  1KFY A;  3BI4 A;  1FEC A;  2GB0 A;  3CNT A;  1M64 A;  3OC4 A;  4I58 A;  3RP6 A;  1FEB A;  3FBS A;  2BS3 A;  2YM2 A;  1H7W A;  1PDH A;  5ER0 A;  2XVH A;  3UKL A;  4ZCC A;  4H4S A;  3I3L A;  5BUK A;  1L9D A;  4UP3 A;  4IA5 A;  2PYX A;  2YG3 A;  1PXC A;  4AT2 A;  2WQY A;  3AYI A;  4H2R A;  2EQ8 A;  2YR5 A;  2X99 A;  3ICR A;  1OJD A;  4EQR A;  5KOX A;  1F8S A;  1DOE A;  5KWF A;  4U8N A;  3ZYX A;  2RGJ A;  3C96 A;  2Y6R A;  4Y4L A;  1E1L A;  3AXB A;  4UDP A;  3NK1 X;  4FK1 A;  2CVJ A;  2X8G A;  3D1C A;  4FK1 C;  1GOS A;  4A99 A;  4BJZ A;  2Q6U A;  2R4E A;  3FIM B;  2XVJ A;  2R46 A;  4GRT A;  2VQB A;  5JCN A;  2JAE A;  3EAO A;  3GDN A;  4H4Z A;  4EMW A;  3NK0 X;  2OLN A;  3DGZ A;  3SGL A;  1GSN A;  2QCU A;  4H4V A;  4J2W A;  1KNP A;  4H2P A;  5FS8 A;  2C75 A;  2V3B A;  3QVR A;  4B67 A;  5BRT A;  1BF3 A;  3COX A;  4U8I A;  4B68 A;  4A9W A;  1IUV A;  1OJC A;  2WDQ A;  4H4T A;  1PN0 A;  3AD7 B;  2XLU A;  3G5R A;  2YR6 A;  4NEV A;  2LFC A;  1S2Y A;  3CNS A;  2IVE A;  3GYX A;  1BKW A;  1DOB A;  4NEW A;  4K7Z A;  2XLR A;  1Y0P A;  1AOG A;  5FMH A;  1OJA A;  2WU5 A;  3ZDN A;  5KRQ A;  1DOC A;  4LA1 A;  4TM1 A;  2VVM A;  3QSS A;  2WPC A;  3NYC A;  3UKQ A;  1Y56 A;  1IJH A;  4U2T A;  5M10 A;  2V3A A;  1XHC A;  1CC2 A;  3JSK A;  1CJ3 A;  2C3C A;  4BK1 A;  1DJN A;  5U63 A;  3AE4 A;  3LXD A;  2XCG A;  4H4X A;  4UDQ A;  4OPT A;  4YTN A;  2FBW A;  5CKU A;  3NYF A;  4O5Q A;  1B8S A;  4I59 A;  2A89 A;  5IPY A;  4CNJ A;  1LTX R;  3ISH A;  3NKS A;  4XWR A;  3GD3 A;  4E0V A;  1DXL A;  1NEN A;  3ADA B;  5GRT A;  3RNM A;  4PAA A;  2DKI A;  1FEA A;  3DH9 A;  2ACZ A;  2E4G A;  1EL5 A;  1M6I A;  2TPR A;  3DJJ A;  1PBD A;  4H4Q A;  3UKA A;  3IC9 A;  2QA2 A;  3ICS A;  3QSE A;  4CBQ A;  5EBK A;  3LZW A;  4DSH A;  2GR1 A;  3UTE A;  1GTE A;  3VRD B;  2XFO A;  4OPU A;  3B6D A;  1GES A;  3F8R A;  3DK8 A;  5C2T A;  3AED A;  1FOH A;  3AEB A;  2C66 A;  1GAL A;  1ZMC A;  2YLS A;  4K5R A;  1GEU A;  1PHH A;  2GF3 A;  1TDO A;  2WOI A;  4H4P A;  3NNE A;  2BCP A;  3II4 A;  1H82 A;  4EM3 A;  2FJB A;  2B7S A;  5J7X A;  4OPL A;  3VQR A;  4FX9 A;  4USQ A;  3AYJ A;  2OA1 A;  2ZZC A;  4J33 A;  3CGB A;  1E6E A;  4U8P A;  1B37 A;  1ZDL A;  4TLZ A;  5KVH A;  2YVF A;  4H50 A;  2WES A;  3SQP A;  1CC4 A;  2YVG A;  3O0H A;  3CN8 A;  3UKP A;  4J31 A;  1QJD A;  1S2Q A;  1ZY8 A;  1GRA A;  2XFQ A;  3CTY A;  4IV9 A;  1PBC A;  3NTD A;  4FDC B;  4EIP A;  1GT8 A;  2X8C A;  1VQW A;  1XDI A;  2WDR A;  3L1R A;  4H2N A;  4USR A;  3DJG X;  2Y6Q A;  4GF7 A;  1H7X A;  1QLB A;  2JBV A;  1N4U A;  3NTA A;  3K7Q X;  2YVJ A;  3Q6J A;  3SUC A;  4LII A;  4Z43 A;  2XVI A;  3CIR A;  3V3O A;  5FS6 A;  4AOS A;  2BCG G;  2YLX A;  1BGJ A;  2VZ2 A;  1BZL A;  4H4U A;  1JRY A;  1GRF A;  4U2L A;  3RED A;  3DK9 A;  1IUT A;  5BUL A;  3ABV A;  1BWC A;  4K22 A;  3AEF A;  3AE7 A;  1MOK A;  3LJP A;  4YXD A;  2ZZ0 A;  5HXI A;  4B66 A;  4REK A;  4GUV A;  2C70 A;  3V76 A;  4TLX A;  3GMB A;  1PJ5 A;  4ICY A;  5TR3 A;  1JEH A;  3CGC A;  3GDP A;  1GRB A;  2Q7V A;  2WS3 A;  2JB3 A;  4BJY A;  1UKV G;  1D4C A;  2C67 A;  3DA1 A;  4JQ9 A;  1QO8 A;  3DME A;  1H6V A;  4OVI A;  1GXF A;  1JU2 A;  1GET A;  4KX6 A;  1RYI A;  2AAQ A;  1K0L A;  3P9U A;  1E1K A;  3DGH A;  3H8L A;  2VRM A;  4Z2T A;  3AB1 A;  3UTF A;  3H8I A;  1IUX A;  2BK5 A;  1KNR A;  2ZZB A;  2NPX A;  4JN9 A;  2XYO A;  5HYM A;  2RGH A;  4X9M A;  4Z26 A;  2W0H A;  1ZK7 A;  2BXS A;  1N4W A;  1YKJ A;  2I0Z A;  2GAH B;  1ZMD A;  4A6N A;  4U2S A;  1YY5 A;  3UKF A;  3AE8 A;  4B65 A;  3GRS A;  2WOV A;  2AQJ A;  3DJD A;  2A87 A;  1BGN A;  1JNZ A;  5CQF A;  4AT0 A;  5IQ1 A;  1ZOV A;  3BNM A;  1PBE A;  3NK2 X;  5HY5 A;  3E1T A;  4BV6 A;  5KVI A;  3CGE A;  4B69 A;  4GR1 A;  5EB5 A;  2YG7 A;  2R9Z A;  2FJA A;  3NN0 X;  3GMC A;  4X9N A;  2QAE A;  3UOX A;  3UOZ A;  4PAB A;  1GRE A;  2BK3 A;  3IHG A;  1CBO A;  2YAU A;  2XLP A;  1D7Y A;  4U8O A;  1NEK A;  4Z2U A;  1ZX9 A;  1PJ6 A;  1ONF A;  2TMD A;  3AD8 B;  3AE5 A;  1E1M A;  4OPD A;  4K8D A;  2WPE A;  2C73 A;  2HQM A;  3WE0 A;  4C74 A;  3C4A A;  3GWF A;  5U25 A;  4EMI A;  1GRH A;  3RP8 A;  1PXA A;  1ELI A;  5HHF A;  3NRN A; 
#chains in the Genus database with same CATH topology
 3S5W A;  1H84 A;  5JDN A;  2XQY A;  3ZSS A;  5LNK A;  1Y56 B;  3VRB A;  4J34 A;  2V61 A;  3PVC A;  3TLW A;  1SA0 E;  2CE7 A;  2KIN B;  4V1A v;  5JCI A;  4N9X A;  2BKP A;  1PXB A;  5HEH A;  2VRL A;  4TM0 A;  4AQF A;  4PK5 A;  3OYZ A;  5IQ4 A;  2GR3 A;  1OXZ A;  2YWL A;  2C3D A;  2R07 4;  4K5S A;  2YLR A;  4YSY A;  3CPI G;  2BVL A;  4IDQ A;  3LSV A;  2OAL A;  2ZMA A;  3OZ2 A;  3UCL A;  1PIV 4;  4A7A A;  4HWC A;  4MAL A;  4BK3 A;  1MMN A;  4NNJ A;  3IHM A;  2VAS A;  4U74 A;  1R09 4;  3F8D A;  4DR6 T;  4EAH A;  4U7I A;  5ABG A;  2EHO D;  4B3T T;  2C5I T;  2IHR 1;  5FVL A;  2MOZ A;  5AQS B;  2GMH A;  2ES0 A;  2BC0 A;  3FXE B;  2UZZ A;  3GYI A;  3SRZ A;  2BC1 A;  3A5X A;  2A72 A;  1K0I A;  4CN4 A;  2XQ8 A;  2V7K A;  3FXD B;  4KBM B;  2DLR A;  2XJ7 A;  2KND A;  3MZK B;  5CJ5 A;  3CMM A;  3RRW A;  3QNU A;  1DNC A;  3EHZ A;  1KF6 A;  4C3X A;  1IBK T;  5A1L A;  4H9Q C;  1Z8U A;  3HA4 A;  4DSG A;  5FVK A;  5AQV B;  4JI0 T;  1W0A A;  2BS2 A;  4TNV A;  1HXS 4;  4NIQ A;  4DGK A;  4OYJ A;  5FY0 A;  4MHC A;  1VRB A;  3ZN0 B;  1NHP A;  1XMO T;  2CXL A;  1H81 A;  3K8P C;  4DV2 T;  3H3M A;  2XFU A;  3GQH A;  2Q9Q C;  3UU4 A;  2RAB A;  5JDQ A;  3NGC X;  2BAC A;  2WY2 A;  3ALJ A;  4FJO A;  3KU9 A;  2JMH A;  1I6Z A;  2H7O A;  1IUW A;  2YOE A;  1T8B A;  1B4V A;  4B64 A;  3R6N A;  3MXZ A;  4YSZ A;  3V3N A;  3UUN A;  3SYI A;  4JI2 T;  3KD9 A;  2WWV A;  1EL9 A;  1O94 A;  1XMQ T;  3HZL A;  4CNK A;  4PJL A;  3AE3 A;  5FP3 A;  5ABF A;  4A6N B;  2R0P A;  1OED C;  2PHH A;  3C51 A;  2RGO A;  2ODV A;  3SZ0 A;  5LV9 A;  4L9I A;  4OPI A;  3RHA A;  3KFW X;  2Y6X A;  3UOV A;  5LG4 A;  1DJQ A;  2ZLY A;  3EI0 A;  1N1P A;  5JRE A;  3CQX C;  3I0Q A;  2IIU A;  4YHH T;  2HPL A;  2JJ9 A;  1DOD A;  2C76 A;  4H9O C;  4TNW A;  2B1E A;  1Q9I A;  4J56 A;  3U3I A;  3AE9 A;  2WBL A;  1RSG A;  5HXC A;  3FBZ A;  3O9X A;  2VUR A;  2GR0 A;  3IBP A;  1XDP A;  3N2K E;  2R4J A;  2GVC A;  1YKE B;  3Q9D A;  3GN5 A;  4JI4 T;  1CL0 A;  1JOA A;  3I1A A;  3I9Y A;  3ONL C;  4JI6 T;  1OOP D;  3UKH A;  4X64 T;  5DQV A;  5AQM B;  3UFE A;  4MJW A;  1VBC 4;  4YHJ A;  2FJD A;  2ZM0 A;  3UU3 A;  5JQG E;  2WPF A;  1K0J A;  3ICT A;  2YG6 A;  4ADW A;  3ZC0 A;  5AQN B;  3PUG A;  4J2C A;  3FMW A;  2YU2 A;  3VR9 A;  1MMD A;  3K3Q C;  3NLC A;  1WRD A;  2E1M A;  3G5S A;  1O95 A;  2XLT A;  4U8J A;  4WBN E;  3LK3 B;  4UEM A;  2X50 A;  4PFO A;  5IHY A;  4EQX A;  4O4L E;  2CBI A;  4EYY R;  4Z90 A;  2YDS A;  2HH7 A;  1YQ4 A;  4H4W A;  3P4P A;  2VQE T;  4GKJ T;  2IML A;  4H4R A;  2KZ7 B;  5L3F B;  4H9P C;  1B5Q A;  3P1W A;  5BMV E;  2E9X D;  4H7U A;  2CBJ A;  4DO0 A;  4XZC A;  2UXX B;  2WOW A;  2C7G A;  3V5S A;  1Q1R A;  2J47 A;  5CB4 E;  2CPT A;  2PG8 A;  5AFU L;  2OLO A;  2CM0 A;  5AQG B;  4ASK A;  1E7P A;  5KMG P;  5HXE A;  3RYH E;  3AAA B;  1POV 0;  3JC6 D;  4TV9 E;  2KT9 A;  1PBF A;  3RP6 A;  4COF A;  3ZPO A;  5FXX A;  2BS3 A;  3G06 A;  4GK0 E;  2YM2 A;  1PDH A;  4AIS A;  1I94 T;  3UQ7 A;  1RUE 4;  5BUK A;  1IAP A;  2PYX A;  1AR8 4;  4DVD A;  2WQY A;  3AYI A;  4H2R A;  2BDE A;  2X99 A;  4ZI2 C;  1PO1 4;  1F8S A;  1RVF 4;  4ZZC A;  1Z7S 4;  4U8N A;  4Y4L A;  2BZB A;  2Y6R A;  5JR9 A;  2CVJ A;  1LVK A;  2X8G A;  3D1C A;  3ZEF B;  4FK1 C;  2H3R A;  2Q6U A;  3RI5 A;  1VOM A;  2XM2 A;  4PJN A;  3FIM B;  1E1H B;  5DAB A;  2QRX A;  2JAE A;  2NR4 A;  3CX6 B;  2OLN A;  1GSN A;  1HS7 A;  3HYX A;  5L4E A;  4Z8X A;  2V3B A;  1VBA 4;  3O1I A;  1W9R A;  3Q5X A;  4B68 A;  5HAX A;  2XTL A;  2Q9Q B;  4IE6 A;  5LOV E;  3ZLI A;  1IUV A;  2WDQ A;  1AL2 4;  1BR0 A;  1PN0 A;  4NEV A;  5EK2 A;  1BKW A;  5FMH A;  1DOC A;  2LT3 A;  3RC3 A;  4TM1 A;  4IDZ A;  1Y56 A;  4U2T A;  5M10 A;  2V3A A;  1XHC A;  1OED B;  4KHZ F;  4BK1 A;  4PW8 A;  1DJN A;  4H4X A;  4YTN A;  2X68 A;  5J2T E;  4I59 A;  2BRY A;  4CNJ A;  3N9L A;  1LTX R;  2LJL A;  1UCU A;  2WZH A;  1NEN A;  1WR0 A;  2HN1 A;  2KWH A;  1PO2 4;  2HN2 A;  1FEA A;  4PJM A;  3IA3 A;  1M6I A;  1PBD A;  2DHR A;  2JQ9 A;  5F5W A;  5L4H A;  5HEJ A;  3S4U A;  4OPU A;  3RKO A;  3OJA A;  2N1G A;  4XAX B;  5LB7 B;  3ZMU B;  3F8R A;  1RUF 4;  3DK8 A;  1VBD 4;  3NVO A;  2HWC 4;  2C66 A;  1GAL A;  3VKH A;  1PHH A;  5EK3 A;  1TDO A;  2X0Y A;  2BRA A;  4EM3 A;  2CMR A;  5J7X A;  2OA1 A;  4LMK A;  1Z0P A;  3UT5 E;  1ZDL A;  5FMN A;  1BEV 4;  5LHG B;  3O0H A;  3GWH A;  4DUZ T;  3CN8 A;  3UKP A;  3T0K A;  1ZY8 A;  3QC9 A;  4YJ3 E;  3J7Y q;  3CTY A;  1FEW A;  1KK7 A;  3L1R A;  4H2N A;  4GF7 A;  1H7X A;  2JBV A;  5LHH B;  2LE8 A;  2V7J A;  3AA7 B;  3SUC A;  4CI3 B;  3PUW F;  1VRH 4;  2VZ2 A;  3DJB A;  4H4U A;  1ZKE A;  3ZJ2 A;  2XQ4 A;  2Z6E A;  3Q5W A;  1GRF A;  3RED A;  3ABV A;  1BWC A;  2ZM8 A;  4K22 A;  5FYM A;  2PTF A;  3AE7 A;  4YXD A;  2IDO B;  4HKA A;  4GIW A;  5L2L A;  4B66 A;  4EXT A;  2C70 A;  4GUV A;  4TUY E;  3V76 A;  1PJ5 A;  4ICY A;  2WSS V;  1JEH A;  3GDP A;  2RS3 4;  2W2U A;  5AQH B;  4BJY A;  4O4H E;  3RIU A;  2C67 A;  3DME A;  4OVI A;  3EUH A;  3P9U A;  4DR5 T;  3RYI E;  1KNR A;  2ZZB A;  2NPX A;  3TLV A;  5HYM A;  4U3C A;  4X9M A;  3RYF E;  2W0H A;  1WYC A;  4A6N A;  1ZMD A;  2PYL A;  4U2S A;  1YY5 A;  3ZMS B;  3UFG A;  2WOV A;  2A87 A;  4CXW A;  1ZOV A;  3AA1 B;  4BV6 A;  4WBO A;  2CRB A;  3CWZ B;  4JLE A;  4GR1 A;  3RIF A;  2FJA A;  3GMC A;  1D1B A;  2H7V C;  3TLT A;  2Y8D A;  4K0K T;  1E2A A;  3BQL A;  4I43 B;  4ANJ A;  1D7Y A;  1NEK A;  4U8O A;  2LOP A;  2CA5 A;  1UUS A;  3AE5 A;  2VKD A;  2WPE A;  2C73 A;  2HQM A;  3WE0 A;  4C74 A;  3C4A A;  5U25 A;  4WZX A;  2CCQ A;  2L8K A;  5HHF A;  4CRT A;  2W4X A;  3AYL A;  1H8T D;  4X66 T;  2QA1 A;  5JDM A;  2R45 A;  4M1P A;  4HN9 A;  4B63 A;  2C72 A;  1UK5 A;  4IDP A;  1XHX A;  3UP4 A;  3AE2 A;  3K7M X;  2AR8 A;  3D0T A;  3J9X 1;  1HX1 B;  2LRK A;  3EF6 A;  2JB1 A;  3UOY A;  2C5J A;  5H6R B;  3K7T A;  2W67 A;  1LRZ A;  2J62 A;  3PV0 F;  4OFZ A;  3NYE A;  2Q0K A;  3UTH A;  2IW5 B;  3P4W A;  3QB5 K;  3N9M A;  4YKG A;  3PUV F;  5FS9 A;  3EDV A;  3KPK A;  1FIO A;  2BBJ A;  4PK4 A;  1M62 A;  1GND A;  1D0Y A;  4LMJ A;  4A56 A;  4EED A;  2Z5Y A;  4RHV 4;  4GCM A;  1F8W A;  2UXN B;  2XFP A;  2XDO A;  3QFA A;  4HFD A;  4XBF B;  2CUL A;  3DK4 A;  5AQJ B;  1D4E A;  5IYZ E;  5KMQ A;  4HB9 A;  3B5M A;  5AQL B;  5FXV A;  4YTP A;  4J36 A;  4RSL A;  1GRT A;  2A2F X;  3ZN1 B;  2XAS B;  5JVD E;  4X4J A;  3SM8 A;  1FJG T;  4NXN T;  3JCF A;  3M3Z B;  2LHN A;  4K0U A;  4YSX A;  4CXX A;  1YQ3 A;  4EEB A;  1J1J A;  2X9X A;  4DID B;  4UDR A;  3GQK A;  3BI2 A;  4CN1 A;  1YXR A;  2YG4 A;  3P4R A;  5TAO A;  4P09 A;  1CF3 A;  2YN6 A;  4OPC A;  4HWI B;  5GSN A;  1V9D A;  5DQW A;  4IVO B;  2LSK A;  3PU8 A;  4H9R C;  3SZW A;  3UUL A;  2BG9 E;  1HNZ T;  1V59 A;  2UXB T;  1TYT A;  3ALM A;  2APG A;  2Q9Q A;  5FY1 A;  2WM9 A;  4JY3 A;  4HFH A;  3ALL A;  4A65 A;  3M13 A;  2BYB A;  4EMJ A;  5FKY A;  2B76 A;  4YT0 A;  1CJC A;  4EQW A;  3CKD A;  1PS9 A;  3AEG A;  1YQZ A;  2B9Y A;  1D4D A;  4TWD A;  3OVU A;  4EGW A;  3EPT A;  4QX7 B;  1K4Q A;  2MTQ A;  4IA6 A;  1CUN A;  1OED A;  4ZHQ E;  4OYK A;  3NG7 X;  2X9H A;  3GYJ A;  1S3E A;  3PO7 A;  5KDM C;  2FJE A;  3LB8 A;  2X9Y A;  3KKJ A;  3CGD A;  4RG4 A;  3LDQ B;  2H88 A;  3FG2 P;  2WEU A;  3HKD E;  3CPH G;  3ATR A;  2RMU 4;  2V6X A;  2M6B A;  4YJ2 E;  4A97 A;  3B3R A;  3AEA A;  3PUA A;  2EQ6 A;  4JDR A;  4HFV A;  2K24 A;  5JCL A;  3H37 A;  4LML A;  1NHS A;  3SXI A;  2YQU A;  1ZV4 X;  3AE6 A;  1Q1W A;  3GRT A;  4HA6 A;  2GH5 A;  2ZBW A;  4WNK A;  5KMR A;  3NT6 A;  2YIN A;  2OAM A;  3K1S A;  1KSS A;  2BKO A;  2IAK A;  2G0U A;  3NBX X;  4Y4N A;  3T37 A;  3LZX A;  3KLJ A;  1XNR T;  4Y4M A;  3E08 A;  2GR2 A;  1MIV A;  5U1O A;  1NA1 D;  4NZH A;  2C0S A;  1RUI 4;  5AQT B;  4LF9 T;  1MMG A;  4EM4 A;  3SFE A;  1L9C A;  1TDN A;  3EDU A;  2EQ9 A;  4OK0 A;  4DR3 T;  2XQA A;  2X5I D;  4ILA A;  3LK2 B;  2GV8 A;  2R7F A;  4TWH A;  4NUV A;  1S3B A;  2J3N A;  4GOU A;  4ZN0 A;  3CNP A;  2A8X A;  2BAB A;  3K3O A;  2V1D B;  2X0H A;  4FI5 A;  4LU6 A;  1YKH B;  4UEL A;  2JQH A;  4QXB B;  4UV9 B;  4Z24 A;  4X1Y E;  2UUA T;  2NP9 A;  4NUU A;  5EOW A;  5H6Q B;  2R0G A;  5KMP A;  4BK2 A;  4CY6 A;  4KUM B;  3GWD A;  4LF7 T;  3NHO X;  4AP3 A;  2F5Z A;  4I58 A;  3ONJ A;  4HFE A;  5LMN T;  1FEB A;  1RUC 4;  1WFD A;  3UKL A;  3JAF A;  1L9D A;  3CQC B;  5AQQ B;  4LFB T;  1PXC A;  2JIW A;  2M67 A;  3ZMT B;  2XQ9 A;  1OJD A;  1DOE A;  3NKZ A;  4PNI A;  4H9N C;  3N9O A;  4UDP A;  2VKJ A;  4FK1 A;  4ILB A;  2KXP B;  1COV 4;  2PLV 4;  4UIG A;  4BJZ A;  2I6H A;  2P9B A;  2XVJ A;  4JYA T;  1N34 T;  4Q4Y 4;  3C98 B;  4GRT A;  2VQB A;  3N9Q A;  3NK0 X;  3DGZ A;  3M65 A;  4H4V A;  4AXP A;  4J2W A;  5BRT A;  3EVY A;  4B67 A;  4AQG A;  1BF3 A;  4U8I A;  1QSD A;  2BG9 C;  1FMV A;  4O4J E;  2PJQ A;  4E7S A;  4H4T A;  3AD7 B;  3G5R A;  4JI7 T;  1S2Y A;  2IVE A;  3CNS A;  3PDY A;  1DOB A;  4K7Z A;  1LKX A;  1Y0P A;  2BBH A;  3AAI A;  2LSJ A;  2WU5 A;  3ZDN A;  4QXH B;  5KRQ A;  1HRI 4;  4F8H A;  1U5P A;  3ESL A;  3HKC E;  1CC2 A;  3UUM A;  3WAK A;  4OPT A;  2FBW A;  1YD8 G;  3ZYK A;  5CKU A;  5AQI B;  2LLY A;  2A89 A;  1BR4 A;  2I59 A;  3L09 A;  4LFA T;  1HCI A;  3EAB A;  3NKS A;  4XWR A;  4E0V A;  1DXL A;  1XI1 A;  4I0U A;  4PAA A;  3ZT7 A;  2ACZ A;  1EL5 A;  4H4Q A;  3IC9 A;  3LK4 2;  4DR7 T;  3ICS A;  2X67 A;  5J2U E;  3LZW A;  5JRC B;  4X5T A;  4DSH A;  4EZ4 A;  3HYV A;  3B6D A;  1GES A;  3BK9 A;  2NWB A;  2YK0 A;  3ETU A;  5C2T A;  1FOH A;  3AA6 B;  1MIW A;  3AB3 B;  1ZMC A;  1KNZ A;  4G6H A;  3NNE A;  2BCP A;  2DL1 A;  2B7S A;  3KVB A;  3VQR A;  4FX9 A;  3AYJ A;  2ZZC A;  3I9W A;  4CI2 B;  4TLZ A;  3O1J A;  4I50 E;  2YVG A;  2OV9 A;  3ZJ1 A;  4J31 A;  5JTG A;  1S2Q A;  1IJ5 A;  4IE7 A;  1D0X A;  1GRA A;  4IV9 A;  4HWD A;  4FDC B;  2SPC A;  1XDI A;  2Y6Q A;  1R8I A;  5HXS A;  3TLS A;  1XWM A;  3PU3 A;  3T14 A;  5FS6 A;  4AOS A;  4U2Y A;  2YLX A;  3F57 A;  3OKQ A;  2XAG B;  4HWH A;  3ZMV B;  4DV0 T;  1JRY A;  3DK9 A;  1T98 A;  1RUH 4;  5ABH A;  3KBT A;  1M7K A;  2PZS A;  3VHL A;  1PVC 4;  4TLX A;  3GMB A;  3CGC A;  3RQU A;  2V7L A;  1AR6 4;  4O2B E;  3BQI A;  1UKV G;  4ZI3 D;  4JQ9 A;  1QO8 A;  1H6V A;  1GXF A;  1JU2 A;  4KX6 A;  2AAQ A;  3O1H A;  3DGH A;  2A3D A;  2QA7 A;  3H8I A;  1IUX A;  1NAF A;  2WWU A;  3MA9 A;  4JN9 A;  2XM1 A;  1UUR A;  3KVA A;  1IZN B;  4CI1 B;  2V26 A;  2I0Z A;  1HR0 T;  4AKR B;  2M6I A;  3RF1 A;  1BGN A;  2UUB T;  2VL8 A;  4AT0 A;  3SZC A;  5IQ1 A;  3ONX A;  3BNM A;  1PBE A;  3MK7 C;  4X62 T;  2JMK A;  2R9Z A;  3UOX A;  3NZQ A;  2HHH T;  4IST A;  2BG9 B;  1CBO A;  1HTJ F;  5KX5 E;  4YFS A;  1ONF A;  3WI3 A;  4OPD A;  1GQE A;  2LEH A;  3C64 A;  4G63 A;  1S94 A;  1ELI A;  5F8P A;  4TM3 A;  3T31 A;  3TKL B;  2Q0L A;  3AD9 B;  4GDP A;  2WU2 A;  3UTG A;  2EHO C;  1EL7 A;  2VVL A;  4JI3 T;  2X8H A;  4BUR A;  1KDG A;  3K30 A;  4JNA A;  2BK4 A;  4WW0 A;  2O9Z A;  2NVK X;  2RM2 4;  4II2 A;  3IWA A;  4L0R A;  4QH5 A;  4B1B A;  2BA9 A;  3LJC A;  1MND A;  2FUP A;  3AWI A;  4DV6 T;  1KEY A;  2E5V A;  2L9Q A;  2LOS A;  4U2Z A;  3FZL B;  1SEZ A;  2GAG B;  1NAA A;  1GTH A;  2KMF A;  5CGM A;  1HX8 A;  2GK9 A;  2XVE A;  2IC9 A;  3C50 A;  2CDU A;  2CXF A;  4GYR A;  3L3P A;  3K3N A;  4M52 A;  4B3M T;  1XAN A;  4DNA A;  2VK9 A;  5HEO A;  4RG3 A;  2C4C A;  4NTD A;  5FXZ A;  3TLU A;  3AE1 A;  2IUB A;  1JRX A;  3E22 E;  2YDQ A;  4APN A;  4EIQ A;  4G73 A;  1J5W A;  1W09 A;  2Y48 B;  4QH1 A;  2WAU A;  4WYV A;  1H83 A;  4Z25 A;  3UP5 A;  4QWN B;  1PBB A;  4J57 A;  4CQI A;  4U33 A;  1HFA A;  4C5O A;  2H89 A;  3I6D A;  2YG5 A;  3JBG 4;  4MBQ A;  3T1H T;  3ZT5 A;  1GER A;  4F6R C;  4JI1 T;  5KOW A;  3RQW A;  3CPJ G;  5ETW A;  1TRB A;  4AOX A;  2C64 A;  3CX8 B;  1D7L A;  2CHN A;  4U7Y A;  2WET A;  3NIX A;  5E0O A;  4JV5 T;  2W00 A;  5JCM A;  3HR0 A;  2K48 A;  2PW9 A;  3KIN B;  4X1K E;  1COY A;  4O5U A;  3VRA A;  4JBW F;  4YWO A;  1W0B A;  2HPJ A;  4OPG A;  5L46 A;  4HWF A;  1D4M 4;  4C3Y A;  1O5W A;  4D03 A;  1VDC A;  2XHE B;  3NN6 X;  3PJA J;  3AVS A;  1L9E A;  4U8L A;  2VVN A;  2XVF A;  3RP7 A;  4TX5 A;  5BVA A;  4UXN B;  5EZY E;  3BQK A;  2DKH A;  4CCR A;  1P2H A;  1RHI 4;  3IEE A;  3CVR A;  4NTE A;  3C4W A;  3UU6 A;  1CJ4 A;  4I55 E;  4PAG A;  3RC8 A;  1HG2 A;  1H7C A;  2IC6 A;  4U8M A;  4ZZB A;  2KWI B;  2XLS A;  2QGS A;  2WCA A;  3JD7 4;  1VG9 A;  5L3E B;  2XQ6 A;  2WB5 A;  3R9U A;  3HL6 A;  4DV1 T;  4KPR A;  4U72 A;  1NDA A;  1CHU A;  2WP5 A;  2XSB A;  3RLF F;  3F8P A;  1NHQ A;  2JK6 A;  2KSR A;  2Q9Q D;  3UQ4 A;  2C5K T;  3A7M A;  5JRC A;  2CFY A;  2YLW A;  3ZKR A;  4YKF A;  2E9X C;  4XXG A;  3T8O A;  2EHO B;  5LGU B;  2LSY A;  1US7 B;  2UUC T;  2ZM2 A;  5LXT E;  3LAD A;  4ECH A;  2BS4 A;  1PJ7 A;  2WDV A;  3KA7 A;  3JAD A;  3JC6 C;  3P8C D;  2ZM6 T;  1YW0 A;  5FS7 A;  3VR8 A;  3M12 A;  4ZS3 A;  2C65 A;  4QX8 B;  4D04 A;  4CY8 A;  3KPF A;  5IUX A;  1VG0 A;  2PFV A;  1FL2 A;  2J1D G;  3ZT6 A;  3GN5 B;  2X3N A;  1RUJ 4;  3DJE A;  1D5T A;  2GRT A;  2BXR A;  2VKO A;  2WP9 A;  1XDO A;  4UVA B;  2ARD A;  2RP4 A;  2QYW A;  3PUZ F;  2D2S A;  3L39 A;  5IWA T;  4DUY T;  2LHR A;  1LV0 A;  1OJ9 A;  1VBE 4;  3P4Q A;  1F8R A;  5FL0 A;  4GAV A;  5HWY A;  1LQT A;  1FCD A;  4NXM T;  3SWH A;  3NWI A;  3HKE E;  3N2O A;  3C4Z A;  5KXJ A;  3AA0 B;  2KLQ A;  4IDN A;  5LJN A;  5ABE A;  1IUU A;  3C4X A;  3R84 B;  1ZP0 A;  3OBV E;  4PJJ A;  1RP0 A;  1GRG A;  4DV7 T;  1HRV 4;  1CJ2 A;  2VVL G;  4UR9 A;  1MMA A;  3BI4 A;  3CNT A;  3OC4 A;  3FBS A;  1H7W A;  5ER0 A;  1RUG 4;  2XVH A;  4H4S A;  1VCT A;  2VVS A;  3I3L A;  4UP3 A;  4IA5 A;  2DWG A;  2YG3 A;  4AT2 A;  2YU1 A;  3AXJ B;  1UGO A;  2EQ8 A;  3ICR A;  4EQR A;  5EK4 A;  3B57 A;  2VL0 A;  5KWF A;  2JQQ A;  3ZYX A;  4HFI A;  2RGJ A;  1E1L A;  3KV9 A;  1DU2 A;  3FBL A;  5LCY A;  3CX7 B;  3ZMZ B;  1GOS A;  4P0B A;  4C91 A;  4IGU A;  2JRK A;  2LKG A;  2R04 4;  3GDN A;  3OPC A;  3F2E A;  4BJN A;  2QCU A;  4NWZ A;  5KMS A;  1KNP A;  3I0O A;  4OX9 T;  4H2P A;  5FS8 A;  2MBG A;  2C75 A;  2BG9 A;  3QVR A;  3COX A;  4A9W A;  1OJC A;  3FZF B;  2HWB 4;  4CXY A;  4ILU A;  2BVM A;  3N5L A;  5HXR A;  2YR6 A;  2LFC A;  2XAF B;  3GYX A;  4QHO A;  5LGN B;  1AOG A;  2RS1 4;  1XHZ A;  2R6G F;  5M4Y A;  4ADZ A;  5LYJ E;  4G74 A;  1OJA A;  4EV6 A;  4LA1 A;  2VVM A;  1FMW A;  3UKQ A;  4IRE A;  3W15 B;  1AJ3 A;  5LJM A;  4ZI2 D;  4EOZ B;  3QB5 A;  4ZEY A;  1S35 A;  3ANW B;  2NW7 A;  5AQP B;  3NYF A;  1B8S A;  1IJ6 A;  1D1C A;  1AR9 4;  3AAE B;  3GD3 A;  3RNM A;  2DKI A;  3DH9 A;  3RPU A;  2E4G A;  3MKD A;  2WMN A;  2NTX A;  5EBK A;  2ODU A;  5LBM A;  4AI6 A;  4LF6 T;  2E9X B;  3UTE A;  4II3 A;  1GTE A;  2NW8 A;  3MAC A;  2QVA A;  4I4T E;  5LMU T;  4AKL A;  5CA1 E;  4O4I E;  2GF3 A;  4H4P A;  1R08 4;  5LA6 E;  3II4 A;  5JDH A;  5LG3 A;  1AR7 4;  1EV1 4;  5ADX L;  4USQ A;  4J33 A;  1HG5 A;  3U78 A;  1E6E A;  4U8P A;  2V5D A;  4QKN A;  3ZCI A;  2RS5 4;  5KVH A;  2YVF A;  4H50 A;  1CC4 A;  4LF4 T;  4TV8 E;  3N2G E;  1IBL T;  1SHZ C;  1QJD A;  3T2Z A;  3UU8 A;  2WZI A;  4CZZ B;  2XFQ A;  1PBC A;  3NTD A;  4EIP A;  4DND A;  2X8C A;  4USR A;  2NOX A;  3DJG X;  4O2A E;  3NTA A;  4EYU A;  3FB2 A;  1N4U A;  3K7Q X;  2YVJ A;  2W66 A;  4LII A;  2XAQ B;  2XVI A;  3CIR A;  3V3O A;  4Z43 A;  5AQF B;  5LBQ B;  5FY7 A;  2BCG G;  1MIY A;  2NTY A;  3J8F 4;  4L5G A;  4LF5 T;  1BGJ A;  1BZL A;  4U2L A;  2MAW A;  4MFR A;  3GMI A;  5BUL A;  2DWK A;  1MOK A;  3LJP A;  5DJQ C;  4P0A A;  1X79 A;  2K9A A;  3IHR A;  3P50 A;  3RRC A;  2LM9 A;  1GRB A;  2WS3 A;  5AQU B;  4G6G A;  1NWM X;  5CA0 E;  1D4C A;  2V7M A;  4IDO A;  1GET A;  1RYI A;  3RGL A;  1K0L A;  3H8L A;  2VRM A;  3KBU A;  3AB1 A;  1EZ3 A;  3UUX B;  3PTR B;  4HFC A;  2V6Y B;  3AVR A;  4N78 D;  2UXC T;  4Z26 A;  5L47 A;  1ZK7 A;  2BXS A;  5AQR B;  2PYJ A;  4UVC B;  4B65 A;  3GRS A;  4IE5 A;  2AQJ A;  3DJD A;  2X9W A;  5CQF A;  5HY5 A;  3SX6 A;  5HYA A;  1WR6 A;  5KVI A;  4B69 A;  2X0L B;  2X51 A;  4Q25 A;  4PAB A;  3GA8 A;  2BK3 A;  3H3A A;  2YEV C;  2XPK A;  5LP6 E;  4Z2U A;  1ZX9 A;  4KI0 F;  1XZY A;  1E1M A;  4K8D A;  2N9D A;  4JEU B;  4EMI A;  5FNV E;  2YG7 A;  2CLY C;  5C3J A;  2X66 A;  1LVL A;  2EHO A;  2CXD A;  1HNX T;  3RHW A;  1E39 A;  3KV4 A;  1ZOY A;  2RPA A;  2V5C A;  4YLH A;  4Z91 A;  1TDE A;  4YTM A;  3FPZ A;  3RIA A;  2YLZ A;  2UU9 T;  1REO A;  2WHD A;  4GDE A;  3LG7 A;  3Q5E A;  1F3P A;  4GK5 E;  4WX1 A;  2XAJ B;  3CQG B;  3Q9T A;  2GEW A;  2D0T A;  2R06 4;  2YLT A;  4CCQ A;  1QUU A;  4AQF C;  1TYP A;  4Q4W 4;  2GMJ A;  1EBD A;  1TDK A;  2J4G A;  4NTC A;  2CEA A;  3N9P A;  3NH3 X;  4UF0 B;  5AQK B;  4JI8 T;  5J0Z A;  5J60 A;  3VKG A;  2B9X A;  3CK6 A;  4EIW A;  3DTO A;  3KVE A;  3UUB A;  1L0V A;  5M0Z A;  3SFD A;  2A9U A;  5JDG A;  1KSU A;  3C4N A;  2DCF A;  4ZCD A;  3JAE A;  4ERR A;  4DBQ A;  2WP6 A;  2CWY A;  1MQT D;  4IT4 A;  4P1N A;  3AEE A;  4WCT A;  4A5L A;  4HFB A;  4JI5 T;  4DR2 T;  2GQF A;  2VQ7 A;  4H4Y A;  4Z2R A;  3H4K A;  1J5E T;  3AXJ A;  1VBB 4;  1VCS A;  2V6O A;  1NHR A;  2W63 A;  4U8K A;  4A79 A;  1T72 A;  3BHK A;  2LSG A;  2N2N A;  2LM2 A;  3RH3 A;  2XY8 B;  3O4X E;  4OCG A;  2D9D A;  3ZC1 A;  3PS9 A;  3CPZ A;  1CC6 A;  5LGT B;  3T2Y A;  2JPF A;  1N4V A;  1XPQ A;  2V5Z A;  3Q2M A;  4KMC A;  1JRZ A;  5HEU A;  3G5Q A;  3OTO T;  3L8R A;  4QXC B;  4BA9 A;  3PJA A;  4ZS2 A;  5L3C B;  1E1N A;  4YY3 T;  3T2K A;  4KP3 C;  3RYC E;  1Z6L A;  1D0Z A;  1JNR A;  1IUS A;  4XWZ A;  3SS1 A;  2AE9 A;  4GYS A;  5GON E;  2OLT A;  3LBX B;  5F3J A;  3KV5 A;  2VQF T;  1BR1 A;  5HWX A;  4X65 T;  4DV3 T;  4P9S A;  1ZHC A;  2CHO A;  2E2A A;  3PUR A;  3AEC A;  3ATQ A;  4AP1 A;  2RR1 4;  4GKK T;  1UX4 A;  5AQO B;  3P4S A;  2JB2 A;  4IIJ E;  4MLK A;  4TWF A;  1LJ1 A;  1XNQ T;  2Z5X A;  1SUM B;  4K2X A;  3QVP A;  3ANW A;  2BKN A;  3QUJ A;  2IVD A;  1T7S A;  3L8K A;  4YSH A;  2K5B B;  5JCK A;  2XSA A;  2D0U A;  2XZE A;  2V8S V;  1TDF A;  4EB6 E;  1LPF A;  4AKH A;  1D1A A;  4X20 E;  3X1D A;  5L3G B;  4H63 H;  2XQ3 A;  2E5L T;  4G2A A;  3ITJ A;  4TM4 A;  4PK6 A;  1GPE A;  4DR1 T;  2IID A;  1RUD 4;  4C77 A;  2V60 A;  4G9K A;  1N36 T;  1F6M A;  4AQY T;  2E9X A;  2XQ7 A;  2CLY B;  3KV6 A;  3ZCJ A;  1MO9 A;  1Y64 B;  1SE7 A;  3UKK A;  1O3X A;  3UU5 A;  5DBJ A;  3V5U A;  2B7R A;  5HEG A;  2JQK A;  4ILC A;  2R0C A;  3F31 A;  2YDR A;  3QFB A;  3NRY A;  2UXD T;  3BI5 A;  3QOF A;  1VRQ B;  1HYU A;  3HI2 A;  4JNQ A;  1X31 B;  3URH A;  2CWO A;  4A5X A;  1EL8 A;  5C8Y E;  3QSM A;  3FHN A;  3OYX A;  4JY2 A;  1UX5 A;  4H9S E;  2WBA A;  2VB6 A;  1OJT A;  3M0O A;  4Z44 A;  2YM1 A;  1ZKQ A;  3B13 A;  4EZH A;  3CNJ A;  1LQU A;  4QH4 A;  5EB4 A;  3S61 A;  1ASJ 4;  2NW9 A;  5JDL A;  2PBI A;  1P2E A;  4DMV A;  1NPX A;  2V7I A;  4A98 A;  1NG3 A;  2RA1 A;  2WMO A;  4JEH B;  4ZXL A;  5JDF A;  2YR4 A;  3LOV A;  2XFN A;  1W4X A;  3GD4 A;  2EQ7 A;  3D8X A;  3QJ4 A;  3EAN A;  3PUQ A;  2B9W A;  2PY5 A;  4BAY B;  3BHF A;  4IVM B;  1BR2 A;  2VOU A;  4EQS A;  1GV4 A;  2GQW A;  1MXT A;  1H86 A;  3NRX A;  3IF9 A;  3CND A;  5HCM A;  3GSI A;  3BNU A;  1NG4 A;  4H2Q A;  2JKC A;  1KFY A;  1FEC A;  2GB0 A;  1M64 A;  3DP7 A;  4ZCC A;  1NCQ D;  4DBR A;  2VKH A;  5HCJ A;  2V6Y A;  4HEA A;  2YR5 A;  1RMU 4;  5KOX A;  3LFM A;  5JH7 E;  3VU7 H;  4E7Z A;  1B7T A;  3C96 A;  1OWA A;  3AXB A;  3NK1 X;  5JR9 C;  3FZK B;  3EAM A;  4A99 A;  2R4E A;  3RKG A;  2W61 A;  2R46 A;  5JCN A;  3EAO A;  4H4Z A;  4NPP A;  4EMW A;  3SGL A;  3N9N A;  4IE4 A;  4DR4 T;  4IE0 A;  4IL4 A;  3KDS E;  3IF8 B;  3SOL A;  4JUY A;  4DV5 T;  5CFB A;  2XLU A;  1K5M D;  2W62 A;  4NEW A;  2XLR A;  3ZYM A;  3P7I A;  3QSS A;  1WYB A;  2WPC A;  3NYC A;  4U31 A;  1IJH A;  2D5U A;  3FZH B;  3JSK A;  1CJ3 A;  2C3C A;  5ABF B;  4KHP T;  3AE4 A;  3PE0 A;  5U63 A;  3LXD A;  2XCG A;  2DNX A;  4UDQ A;  4UV8 B;  5LHI B;  2I0M A;  3PUX F;  4Q4V 4;  4O5Q A;  2K3W A;  1LVF A;  5IPY A;  2LSI A;  2EX3 A;  3ISH A;  3ADA B;  3PUS A;  5GRT A;  2YKS A;  2ACX A;  3FZM B;  2TPR A;  3DJJ A;  3SZF A;  3FI7 A;  3UKA A;  4UF0 A;  2QA2 A;  3QSE A;  3A8Y C;  4CBQ A;  3RX6 A;  2MPK A;  2GR1 A;  4ZI7 E;  4ZOL E;  4UVB B;  3VRD B;  2XFO A;  3AED A;  5BR8 T;  2DI4 A;  3PUY F;  1Y01 A;  3AEB A;  2YLS A;  3T1Y T;  4K5R A;  1GEU A;  1ZEE A;  2L3L A;  2WOI A;  1MNE A;  2F4V T;  1H82 A;  2FJB A;  4OPL A;  4C90 A;  4X1I E;  4ZI3 C;  3CGB A;  4TZ4 C;  3E0Z A;  4AKG A;  1N32 T;  1B37 A;  4HGA A;  2WES A;  3SQP A;  2LKH A;  3HKB E;  3ZST A;  1WCR A;  4B3R T;  4AKI A;  4AIU A;  3ZYL A;  1GT8 A;  1VQW A;  2WDR A;  2E8I A;  1WLX A;  1QLB A;  2XUE A;  3Q6J A;  4LF8 T;  2AXD S;  4GB3 4;  1U4Q A;  1HNW T;  4B6X A;  1IUT A;  4OHF A;  2W0G A;  3AEF A;  1EAH 4;  5J1G A;  2ZZ0 A;  5HXI A;  4REK A;  4PFP A;  5KNL A;  1G73 A;  5TR3 A;  2OA5 A;  5FXW A;  2Q7V A;  2MYS A;  3Q5D A;  3SY4 A;  3QK6 A;  2JB3 A;  4DMW A;  1IBM T;  3LBX A;  3DA1 A;  3RIU C;  4LFC T;  2LRL A;  4IL9 A;  3CML A;  1E1K A;  5HXH A;  4Z2T A;  1X9B A;  4HE8 A;  3UTF A;  5FL1 A;  4Q4X 4;  2BK5 A;  4TN7 B;  4GAP A;  3HYW A;  2XQ5 A;  2XYO A;  2RGH A;  1HF8 A;  1OED E;  3WAJ A;  4PDW D;  1N33 T;  5L3D B;  1N4W A;  1YKJ A;  2GAH B;  5JR9 B;  3UKF A;  3AE8 A;  1G8X A;  4HTE A;  4IHJ E;  4H63 V;  4O8S A;  1JNZ A;  4CN6 A;  3NK2 X;  3E1T A;  3UTK A;  3CGE A;  4DV4 T;  3NZP A;  5EB5 A;  3NN0 X;  4ISS A;  5L3B B;  2QAE A;  4X9N A;  3UOZ A;  1GRE A;  2VWA A;  3IHG A;  3ETV A;  2YAU A;  2XLP A;  2XAH B;  1PJ6 A;  3AD8 B;  2TMD A;  4BJM A;  3GWF A;  4B3S T;  3MJX A;  1GRH A;  1PXA A;  3RP8 A;  3NRN A; 
#chains in the Genus database with same CATH homology
 3AYL A;  5C3J A;  4TM3 A;  3S5W A;  1H84 A;  3T31 A;  2Q0L A;  2QA1 A;  2R45 A;  1LVL A;  3AD9 B;  4GDP A;  1Y56 B;  2WU2 A;  1E39 A;  3VRB A;  3UTG A;  4B63 A;  4CRT A;  4J34 A;  2C72 A;  1ZOY A;  1EL7 A;  2V61 A;  3PVC A;  2VVL A;  2X8H A;  3UP4 A;  3AE2 A;  4BUR A;  1KDG A;  1TDE A;  4YTM A;  3FPZ A;  2BK4 A;  2AR8 A;  3K7M X;  3K30 A;  2O9Z A;  4JNA A;  3EF6 A;  2YLZ A;  2NVK X;  5JCI A;  2JB1 A;  1REO A;  2WHD A;  4GDE A;  4N9X A;  3K7T A;  3UOY A;  1F3P A;  4II2 A;  3IWA A;  3NYE A;  4B1B A;  2BA9 A;  4WX1 A;  2Q0K A;  1PXB A;  3UTH A;  3Q9T A;  2VRL A;  2GEW A;  4TM0 A;  3AWI A;  2YLT A;  4CCQ A;  5IQ4 A;  2GR3 A;  2E5V A;  4YKG A;  5FS9 A;  1TYP A;  1SEZ A;  2GAG B;  2GMJ A;  1NAA A;  1EBD A;  2YWL A;  3KPK A;  1GTH A;  1TDK A;  2C3D A;  4NTC A;  3NH3 X;  1GND A;  4K5S A;  2YLR A;  4YSY A;  2XVE A;  2Z5Y A;  3CPI G;  5J60 A;  2CDU A;  2B9X A;  2OAL A;  3OZ2 A;  3UCL A;  4GCM A;  1F8W A;  4M52 A;  4A7A A;  2XFP A;  2XDO A;  3QFA A;  1XAN A;  4DNA A;  4BK3 A;  4NNJ A;  3IHM A;  3KVE A;  4RG3 A;  2C4C A;  1L0V A;  2CUL A;  4NTD A;  5M0Z A;  3DK4 A;  3F8D A;  3AE1 A;  3SFD A;  1D4E A;  1KSU A;  5KMQ A;  4HB9 A;  1JRX A;  3C4N A;  4APN A;  4ZCD A;  4EIQ A;  4G73 A;  4YTP A;  1H83 A;  4J36 A;  4RSL A;  3UP5 A;  4Z25 A;  2WP6 A;  1PBB A;  1GRT A;  4J57 A;  2GMH A;  2BC0 A;  3AEE A;  4WCT A;  2UZZ A;  4C5O A;  4A5L A;  2H89 A;  3I6D A;  2YG5 A;  3GYI A;  2GQF A;  2BC1 A;  2VQ7 A;  4H4Y A;  4Z2R A;  4X4J A;  3SM8 A;  3H4K A;  1K0I A;  1GER A;  4YSX A;  5KOW A;  3CPJ G;  1YQ3 A;  1TRB A;  2V6O A;  1NHR A;  4AOX A;  2C64 A;  3CMM A;  4U8K A;  4A79 A;  1D7L A;  3BHK A;  4UDR A;  3GQK A;  3BI2 A;  1DNC A;  2WET A;  3NIX A;  4OCG A;  1KF6 A;  2YG4 A;  4C3X A;  3P4R A;  3PS9 A;  1CF3 A;  5JCM A;  4OPC A;  1CC6 A;  5GSN A;  3T2Y A;  1N4V A;  1COY A;  4DSG A;  1XPQ A;  2V5Z A;  3VRA A;  4O5U A;  1JRZ A;  3G5Q A;  4IVO B;  4OPG A;  4YWO A;  5L46 A;  4C3Y A;  2BS2 A;  1O5W A;  4D03 A;  1VDC A;  3SZW A;  4DGK A;  3NN6 X;  1L9E A;  1E1N A;  4U8L A;  1V59 A;  1NHP A;  1TYT A;  2XVF A;  1Z6L A;  3ALM A;  3RP7 A;  2APG A;  3T2K A;  4JY3 A;  4A65 A;  5BVA A;  1JNR A;  1IUS A;  1H81 A;  3ALL A;  3GQH A;  2XFU A;  2BYB A;  3M13 A;  4XWZ A;  2RAB A;  3NGC X;  2DKH A;  4EMJ A;  2BAC A;  1CJC A;  4YT0 A;  2B76 A;  3ALJ A;  4CCR A;  3KU9 A;  4EQW A;  1P2H A;  1IUW A;  1PS9 A;  3AEG A;  1B4V A;  1YQZ A;  4B64 A;  2B9Y A;  4YSZ A;  4P9S A;  1D4D A;  3V3N A;  4NTE A;  3SYI A;  4AP1 A;  3AEC A;  3ATQ A;  1CJ4 A;  3EPT A;  3KD9 A;  1K4Q A;  1EL9 A;  1O94 A;  4IA6 A;  3HZL A;  3P4S A;  4CNK A;  2JB2 A;  3AE3 A;  3NG7 X;  4A6N B;  2R0P A;  1LJ1 A;  3GYJ A;  2PHH A;  2Z5X A;  1S3E A;  4K2X A;  2RGO A;  3PO7 A;  2FJE A;  3QVP A;  3LB8 A;  4U8J A;  4U8M A;  3SZ0 A;  5LV9 A;  2XLS A;  2IVD A;  1VG9 A;  3CGD A;  3KKJ A;  4OPI A;  4RG4 A;  3RHA A;  3L8K A;  3UOV A;  1DJQ A;  4YSH A;  5JCK A;  3R9U A;  1N1P A;  2H88 A;  1TDF A;  3FG2 P;  1LPF A;  2WEU A;  3CPH G;  3ATR A;  4KPR A;  1NDA A;  1DOD A;  2C76 A;  1CHU A;  3B3R A;  3AEA A;  2EQ6 A;  3ITJ A;  4JDR A;  1Q9I A;  2WP5 A;  3F8P A;  4J56 A;  4TM4 A;  5JCL A;  1GPE A;  3AE9 A;  1NHQ A;  2IID A;  2JK6 A;  1RSG A;  4C77 A;  2V60 A;  4G9K A;  1NHS A;  3SXI A;  1F6M A;  2CFY A;  2GR0 A;  2YQU A;  3AE6 A;  1Q1W A;  2YLW A;  3GRT A;  2GH5 A;  2ZBW A;  4HA6 A;  2R4J A;  1MO9 A;  4YKF A;  2GVC A;  3UKK A;  4XXG A;  5KMR A;  3NT6 A;  5DBJ A;  2B7R A;  2OAM A;  1CL0 A;  1JOA A;  2R0C A;  1KSS A;  3QFB A;  4Y4N A;  3T37 A;  3LZX A;  3UKH A;  3KLJ A;  3LAD A;  3BI5 A;  2BS4 A;  1VRQ B;  1HYU A;  4Y4M A;  4ECH A;  1PJ7 A;  2WDV A;  3KA7 A;  2GR2 A;  1X31 B;  4JNQ A;  4MJW A;  3URH A;  5U1O A;  4NZH A;  5FS7 A;  2FJD A;  3VR8 A;  3M12 A;  1EL8 A;  2WPF A;  1K0J A;  3ICT A;  3QSM A;  2YG6 A;  2C65 A;  4ADW A;  4D04 A;  4EM4 A;  3SFE A;  1L9C A;  1TDN A;  1VG0 A;  3KPF A;  4CY8 A;  4JY2 A;  2EQ9 A;  3FMW A;  1FL2 A;  3VR9 A;  2WBA A;  2X3N A;  3NLC A;  3DJE A;  1D5T A;  2GRT A;  1OJT A;  2E1M A;  2BXR A;  1O95 A;  2XLT A;  3G5S A;  2YM1 A;  3M0O A;  1ZKQ A;  2WP9 A;  2ARD A;  2GV8 A;  4Z44 A;  3CNJ A;  1S3B A;  2X50 A;  1LQU A;  4EQX A;  2J3N A;  5EB4 A;  3S61 A;  4ZN0 A;  3CNP A;  1LV0 A;  1OJ9 A;  2A8X A;  1YQ4 A;  1P2E A;  2BAB A;  4H4W A;  3P4P A;  3P4Q A;  1F8R A;  1NPX A;  4GAV A;  4LU6 A;  1NG3 A;  4H4R A;  1LQT A;  1FCD A;  1B5Q A;  3P1W A;  2YR4 A;  3LOV A;  2XFN A;  1W4X A;  3GD4 A;  4H7U A;  4Z24 A;  2EQ7 A;  3D8X A;  3QJ4 A;  3EAN A;  2WOW A;  2C7G A;  2B9W A;  1Q1R A;  5KXJ A;  3BHF A;  4IVM B;  2VOU A;  4EQS A;  1IUU A;  5EOW A;  1ZP0 A;  1GV4 A;  2GQW A;  2OLO A;  2R0G A;  1MXT A;  1H86 A;  5KMP A;  4BK2 A;  1E7P A;  1RP0 A;  1GRG A;  3IF9 A;  1CJ2 A;  2VVL G;  3CND A;  4CY6 A;  3GSI A;  3GWD A;  3NHO X;  3BNU A;  1PBF A;  1NG4 A;  4H2Q A;  4AP3 A;  2JKC A;  2F5Z A;  1KFY A;  3BI4 A;  1FEC A;  2GB0 A;  3CNT A;  1M64 A;  3OC4 A;  4I58 A;  3RP6 A;  1FEB A;  3FBS A;  2BS3 A;  2YM2 A;  1H7W A;  1PDH A;  5ER0 A;  2XVH A;  3UKL A;  4ZCC A;  4H4S A;  3I3L A;  5BUK A;  1L9D A;  4UP3 A;  4IA5 A;  2PYX A;  2YG3 A;  1PXC A;  4AT2 A;  2WQY A;  3AYI A;  4H2R A;  2EQ8 A;  2YR5 A;  2X99 A;  3ICR A;  1OJD A;  4EQR A;  5KOX A;  1F8S A;  1DOE A;  5KWF A;  4U8N A;  3ZYX A;  2RGJ A;  3C96 A;  2Y6R A;  4Y4L A;  1E1L A;  3AXB A;  4UDP A;  3NK1 X;  4FK1 A;  2CVJ A;  2X8G A;  3D1C A;  4FK1 C;  1GOS A;  4A99 A;  4BJZ A;  2Q6U A;  2R4E A;  3FIM B;  2XVJ A;  2R46 A;  4GRT A;  2VQB A;  5JCN A;  2JAE A;  3EAO A;  3GDN A;  4H4Z A;  4EMW A;  3NK0 X;  2OLN A;  3DGZ A;  3SGL A;  1GSN A;  2QCU A;  4H4V A;  3HYX A;  4NWZ A;  4J2W A;  1KNP A;  5KMS A;  4H2P A;  5FS8 A;  2C75 A;  2V3B A;  3QVR A;  4B67 A;  5BRT A;  1BF3 A;  3COX A;  4U8I A;  4B68 A;  4A9W A;  1IUV A;  1OJC A;  2WDQ A;  4H4T A;  1PN0 A;  3AD7 B;  2XLU A;  3G5R A;  2YR6 A;  4NEV A;  2LFC A;  1S2Y A;  3CNS A;  2IVE A;  3GYX A;  1BKW A;  1DOB A;  4NEW A;  4K7Z A;  2XLR A;  1Y0P A;  1AOG A;  5FMH A;  4G74 A;  1OJA A;  2WU5 A;  3ZDN A;  5KRQ A;  1DOC A;  4LA1 A;  4TM1 A;  2VVM A;  3QSS A;  2WPC A;  3NYC A;  3UKQ A;  1Y56 A;  1IJH A;  4U2T A;  5M10 A;  2V3A A;  1XHC A;  1CC2 A;  3JSK A;  1CJ3 A;  2C3C A;  4BK1 A;  1DJN A;  5U63 A;  3AE4 A;  3LXD A;  2XCG A;  4H4X A;  4UDQ A;  4OPT A;  4YTN A;  2FBW A;  5CKU A;  3NYF A;  4O5Q A;  1B8S A;  4I59 A;  2A89 A;  5IPY A;  2BRY A;  4CNJ A;  1LTX R;  3ISH A;  3NKS A;  4XWR A;  3GD3 A;  4E0V A;  1DXL A;  1NEN A;  3ADA B;  5GRT A;  3RNM A;  4PAA A;  2DKI A;  1FEA A;  3DH9 A;  2ACZ A;  2E4G A;  1EL5 A;  1M6I A;  2TPR A;  3DJJ A;  1PBD A;  4H4Q A;  3SZF A;  3UKA A;  3IC9 A;  2QA2 A;  3ICS A;  3QSE A;  4CBQ A;  5EBK A;  3LZW A;  4DSH A;  2GR1 A;  3UTE A;  4II3 A;  3HYV A;  1GTE A;  3VRD B;  2XFO A;  4OPU A;  3B6D A;  1GES A;  3F8R A;  3DK8 A;  5C2T A;  3AED A;  1FOH A;  3AEB A;  2C66 A;  1GAL A;  1ZMC A;  2YLS A;  4G6H A;  1GEU A;  4K5R A;  1PHH A;  2GF3 A;  1TDO A;  2WOI A;  4H4P A;  3NNE A;  2BCP A;  2BRA A;  3II4 A;  1H82 A;  4EM3 A;  2FJB A;  2B7S A;  5J7X A;  4OPL A;  3VQR A;  4FX9 A;  4USQ A;  3AYJ A;  2OA1 A;  2ZZC A;  4J33 A;  3CGB A;  1E6E A;  4U8P A;  1B37 A;  1ZDL A;  4TLZ A;  5KVH A;  2YVF A;  4H50 A;  2WES A;  3SQP A;  1CC4 A;  2YVG A;  3O0H A;  3CN8 A;  3UKP A;  4J31 A;  1QJD A;  1S2Q A;  1ZY8 A;  3T0K A;  3T2Z A;  1GRA A;  2XFQ A;  3CTY A;  4IV9 A;  1PBC A;  3NTD A;  4FDC B;  4EIP A;  1GT8 A;  2X8C A;  1VQW A;  1XDI A;  2WDR A;  3L1R A;  4H2N A;  4USR A;  3DJG X;  2Y6Q A;  4GF7 A;  1H7X A;  1QLB A;  2JBV A;  1N4U A;  3NTA A;  3K7Q X;  2YVJ A;  3Q6J A;  3SUC A;  4LII A;  4Z43 A;  2XVI A;  3CIR A;  3V3O A;  3T14 A;  5FS6 A;  4AOS A;  2BCG G;  2YLX A;  1BGJ A;  2VZ2 A;  1BZL A;  4H4U A;  1JRY A;  1GRF A;  4U2L A;  3RED A;  3DK9 A;  1IUT A;  5BUL A;  3ABV A;  1BWC A;  4K22 A;  3AEF A;  3AE7 A;  1MOK A;  3LJP A;  4YXD A;  2ZZ0 A;  5HXI A;  4B66 A;  4REK A;  4GUV A;  2C70 A;  3V76 A;  4TLX A;  5KNL A;  3GMB A;  1PJ5 A;  4ICY A;  5TR3 A;  1JEH A;  3CGC A;  3GDP A;  1GRB A;  2Q7V A;  2WS3 A;  4G6G A;  3SY4 A;  2JB3 A;  4BJY A;  1UKV G;  1D4C A;  2C67 A;  3DA1 A;  4JQ9 A;  1QO8 A;  3DME A;  1H6V A;  4OVI A;  1GXF A;  1JU2 A;  1GET A;  4KX6 A;  1RYI A;  2AAQ A;  1K0L A;  3P9U A;  1E1K A;  3DGH A;  3H8L A;  2VRM A;  4Z2T A;  3AB1 A;  3UTF A;  3H8I A;  1IUX A;  2BK5 A;  1KNR A;  2ZZB A;  2NPX A;  4GAP A;  3HYW A;  4JN9 A;  2XYO A;  5HYM A;  2RGH A;  4X9M A;  4Z26 A;  2W0H A;  1ZK7 A;  2BXS A;  1N4W A;  1YKJ A;  2I0Z A;  2GAH B;  1ZMD A;  4A6N A;  4U2S A;  1YY5 A;  3UKF A;  3AE8 A;  4B65 A;  3GRS A;  2WOV A;  2AQJ A;  3DJD A;  2A87 A;  1BGN A;  1JNZ A;  5CQF A;  4AT0 A;  3SZC A;  5IQ1 A;  1ZOV A;  3BNM A;  1PBE A;  3NK2 X;  3SX6 A;  3E1T A;  4BV6 A;  5HY5 A;  5KVI A;  3CGE A;  4B69 A;  4GR1 A;  5EB5 A;  2YG7 A;  2R9Z A;  2FJA A;  3NN0 X;  3GMC A;  4X9N A;  2QAE A;  3UOX A;  3UOZ A;  4PAB A;  1GRE A;  2BK3 A;  3IHG A;  1CBO A;  2YAU A;  2XLP A;  1D7Y A;  4U8O A;  1NEK A;  4Z2U A;  1ZX9 A;  1PJ6 A;  1ONF A;  2TMD A;  3AD8 B;  3AE5 A;  1E1M A;  4OPD A;  4K8D A;  2WPE A;  2C73 A;  2HQM A;  3WE0 A;  4C74 A;  3C4A A;  3GWF A;  5U25 A;  4EMI A;  1GRH A;  3RP8 A;  1PXA A;  1ELI A;  5HHF A;  3NRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...