5C2TA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 5c2tA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5c2tA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5c2tA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 5c2tA04
1COYA 3V3NA 2EQ8A 1DOCA 1K4QA 4YT0A 2EQ7A 2BXRA 3BNMA 4YSZA 1YY5A 3DH9A 2IVEA 4XWRA 2OLNA 1EL9A 4A99A 2XCGA 4B66A 2YM2A 5J60A 2C3CA 1D4CA 3II4A 4K5SA 4Z26A 3T37A 1NEKA 3GDPA 1CJ3A 2A87A 3DMEA 1FECA 2V60A 4USRA 4X9NA 2E5VA 3SFEA 2WP5A 3NYFA 4GF7A 4H4UA 1QLBA 2Q6UA 1K0IA 1PDHA 5BVAA 1S2QA 2I0ZA 4U2LA 3NIXA 4TLXA 4H2PA 1Y56B 2PHHA 5KWFA 1JRXA 1PBBA 4NTEA 1H83A 3ADAB 1D7YA 3AB1A 2YLSA 4LA1A 4NTCA 2Q0KA 1HYUA 5KOWA 3NNEA 5JCKA 4YSXA 4UP3A 3Q9TA 1CF3A 4BK2A 3GRSA 4OPGA 3SFDA 2CULA 2RGOA 3G5RA 1TDFA 2XVJA 2RGJA 1E39A 2VOUA 3RHAA 1B8SA 3UOXA 1N4WA 2YG3A 1F3PA 1P2EA 4GDPA 5BRTA 3L8KA 4H50A 3GYXA 1E6EA 3VR9A 2GAHB 3I6DA 2ZZCA 1BZLA 1FL2A 1IUSA 2QCUA 1DOBA 3R9UA 3CNDA 4JY2A 5FS6A 3UOVA 1OJCA 2WP9A 4H4VA 4FDCB 1CC4A 2V61A 3FPZA 3UKAA 4J57A 1RP0A 4K22A 1L9EA 2WDVA 1GEUA 2BABA 3ZYXA 1ZK7A 2V6OA 2X99A 2YG5A 2YM1A 4H4XA 5CKUA 1MO9A 2AQJA 1NENA 1PS9A 2WOVA 1Q9IA 2EQ9A 4HB9A 3K30A 3NN0X 3BNUA 3NH3X 4H4YA 4EM4A 2BS2A 1JEHA 3KVEA 3GRTA 3CGBA 2JB2A 1REOA 3CTYA 1YQ4A 5KVIA 2YR6A 4BK3A 3HZLA 2FJAA 4BURA 4IV9A 2ZBWA 2A8XA 3AECA 3NHOX 4OPCA 2JK6A 3CNPA 4YSHA 3VRDB 2GV8A 1NHPA 5C2TA 4JN9A 2XLUA 5BULA 3GYIA 1SEZA 3UTEA 3QSMA 2C75A 1NG3A 1DOEA 2X8HA 4O5UA 1KF6A 1H84A 3CNJA 4REKA 1DODA 2VVMA 2Z5YA 4J36A 3RP6A 1VQWA 1ONFA 1GXFA 1DNCA 2PYXA 2XFQA 1W4XA 1DXLA 2QA1A 1KNRA 4U8LA 4H4WA 2C70A 2XVEA 4EMWA 3AD8B 1PBCA 1DJNA 2X50A 3AE5A 2YLWA 3AD7B 3D1CA 2C7GA 4AOSA 3AEAA 1H82A 5U1OA 4ECHA 1KNPA 3BI5A 3KKJA 1S3BA 2W0HA 1PHHA 4IA6A 4N9XA 4A6NB 4I59A 3AE2A 1EL7A 2C72A 3SUCA 1LQUA 2DKHA 2X3NA 2OALA 4P9SA 1GSNA 1YQ3A 2C3DA 3EAOA 4OVIA 3GQKA 4USQA 2WPCA 3AD9B 3BI4A 1YKJA 2YLXA 2ZZ0A 2IIDA 4H4TA 4CCQA 4YSYA 3DGHA 1UKVG 1BGNA 4RSLA 2JKCA 4TM3A 2LFCA 4B64A 4FK1A 3H8LA 2R0GA 3AE9A 2WDRA 1GRFA 3UP5A 4DNAA 4EIPA 1RSGA 3LZXA 2YG6A 3AEDA 4WCTA 3V76A 2J3NA 2OA1A 2CFYA 3GWDA 3NKSA 3NLCA 2BK3A 1CJ2A 1PJ5A 3L1RA 4KX6A 4K2XA 2XLTA 3VRBA 3FG2P 4A7AA 4H4ZA 1GTEA 5C3JA 1TDNA 3C4AA 4C77A 4GRTA 4J34A 1ZX9A 3H8IA 3Q6JA 4H2RA 5JCNA 5U63A 1NPXA 2VRLA 3NK2X 5HYMA 4BJZA 2R4JA 2VZ2A 5M0ZA 4H4SA 5FS8A 2WP6A 4OPLA 3NYCA 4K5RA 3UP4A 2BK5A 2C65A 2Y6QA 3GD3A 2XFOA 2BCGG 3KA7A 2R0CA 4O5QA 1LV0A 1H7XA 4CBQA 4XXGA 1JRZA 3K7QX 2YVGA 4APNA 1CJ4A 1D5TA 1V59A 3DK8A 3ICSA 3DA1A 1E1LA 3NG7X 1KDGA 4U8PA 2BS4A 4YWOA 4OPIA 2C66A 2YQUA 2A89A 3OC4A 4FX9A 4A9WA 3IWAA 2YWLA 4A79A 2WPFA 4RG4A 4KPRA 2GF3A 2VQBA 2QAEA 3NGCX 5KOXA 1NHSA 1PXBA 1RYIA 4U8OA 5GRTA 1JRYA 3GWFA 1GV4A 4U2TA 2JB3A 4EMIA 4EQWA 3UTFA 3CPHG 3AE4A 3NN6X 3V3OA 1E1MA 1D4EA 4D03A 2WBAA 1PN0A 1JNRA 3LZWA 1OJ9A 1TDOA 2WPEA 3KD9A 4JNQA 3FMWA 2XFPA 1CL0A 4M52A 4ZCCA 4E0VA 3EANA 1F8SA 3GQHA 2GR1A 2WU2A 3AEEA 1ZMCA 2XFUA 2VVLG 3CGDA 2R45A 2TMDA 3CN8A 5U25A 1PJ6A 4A6NA 2B76A 1X31B 1M6IA 4ZCDA 3RNMA 4C3YA 2Q0LA 3F8PA 1IJHA 1MXTA 4Z43A 5JCIA 4ADWA 1JNZA 3KPFA 4YTNA 2Y6RA 3P1WA 1LVLA 2BXSA 3AE7A 3NTDA 1B4VA 2YLTA 1FEAA 4A65A 2JB1A 3P4PA 3M0OA 4OCGA 1E1KA 1PBDA 2WOWA 2E1MA 2WU5A 1H86A 1GETA 2B7RA 3F8RA 4U8NA 2XLPA 4PABA 1TDEA 2R46A 2YAUA 4EM3A 3QJ4A 4GCMA 1QO8A 1K0LA 1PBFA 2JAEA 4B69A 1JU2A 2YVFA 3AWIA 1LTXR 3K7TA 1TYTA 1ZKQA 2UZZA 1NG4A 2QA2A 1GT8A 2XLRA 2WOIA 5JCLA 1M64A 1BWCA 1K0JA 4AT2A 4C5OA 1XANA 2Z5XA 4WX1A 3UKFA 3ITJA 5FS7A 3ATRA 3C4NA 4CNKA 1CC2A 2VQ7A 3P9UA 4GUVA 3AYIA 1E7PA 1L0VA 1IUVA 1GESA 2CDUA 3RP7A 2GRTA 1PXCA 4B63A 2VVLA 1NHQA 2YVJA 3ICRA 3DJGX 5LV9A 4GR1A 1YQZA 3EF6A 3SQPA 5TR3A 3AE6A 1L9CA 2GR3A 3BHFA 2YG7A 4D04A 4OPDA 3QVRA 1O5WA 1XHCA 1Y0PA 1LJ1A 3GMBA 4J33A 1VG9A 2OLOA 3QSEA 4FK1C 4IVOB 1LPFA 2R4EA 5JCMA 4X9MA 4J31A 3ISHA 3P4RA 5GSNA 2YR5A 3LADA 1XPQA 3IF9A 1GTHA 2XVFA 3BI2A 4NTDA 2FJEA 1CJCA 5FS9A 1JOAA 3LB8A 1Q1RA 3UKHA 3QVPA 2BS3A 3DJEA 3IHMA 3PS9A 1GRHA 1ZOVA 2HQMA 2FJBA 2V3AA 4TM4A 3RP8A 3UTHA 4CY6A 3B3RA 2BCPA 3DK9A 3DGZA 1KSSA 3DJDA 3CGCA 1F6MA 4J56A 3JSKA 1OJAA 2GAGB 5IQ4A 3AEBA 2WEUA 5EB5A 3AEFA 3VRAA 3VR8A 1PXAA 2ACZA 2C73A 3G5QA 3UCLA 1TYPA 3UTGA 4B67A 4AP1A 2B9YA 4B65A 1IUTA 2RABA 1NHRA 2GQWA 4GDEA 1EBDA 2C76A 4TLZA 1KFYA 1N1PA 4BV6A 1H6VA 3LJPA 1O95A 1B37A 2CVJA 1IUUA 3URHA 3G5SA 4CRTA 3FBSA 4Y4LA 5KXJA 1QJDA 2F5ZA 4LU6A 2NVKX 4EQXA 3LOVA 3UKQA 3ZDNA 3GYJA 3NK0X 4PAAA 1GRGA 3ABVA 4AP3A 2WDQA 2R0PA 3FIMB 1ZY8A 1MOKA 2ARDA 2BYBA 2APGA 3NT6A 2FJDA 2GEWA 4Z2UA 2O9ZA 3S61A 3S5WA 3VQRA 2WHDA 3BHKA 1BF3A 5L46A 1BGJA 5BUKA 2GQFA 2BC0A 3QFAA 4IA5A 2GMJA 4YKGA 2XVIA 3SGLA 1EL8A 5M10A 2XDOA 1S3EA 3P4QA 3CNTA 4J2WA 3UKKA 4ICYA 1F8RA 2GVCA 2IVDA 2WQYA 1H81A 3P4SA 2YLZA 5EBKA 2WS3A 4B1BA 2YLRA 1BKWA 1H7WA 2V3BA 2V5ZA 3QFBA 2FBWA 1GNDA 4UDPA 2YG4A 1GOSA 3AE3A 4JQ9A 3CGEA 4I58A 1D7LA 4JY3A 2C64A 3B6DA 1IUXA 4RG3A 3LXDA 1PBEA 1GALA 3PVCA 1D4DA 4NZHA 4K7ZA 4AOXA 1VG0A 3ATQA 4JDRA 5EB4A 3UOYA 4H2NA 4Z25A 5KRQA 1ZP0A 4LIIA 1N4VA 1CHUA 2B9WA 2B7SA 2XYOA 3CIRA 4NEVA 2E4GA 4UDRA 4AT0A 1GERA 2ZZBA 4Z2RA 4YTMA 2AR8A 2GMHA 3M12A 4BK1A 4JNAA 3AE8A 4Z44A 3OZ2A 4HA6A 4EMJA 4DSHA 2BC1A 4YXDA 2JBVA 3GMCA 4MJWA 5ER0A 4EIQA 2H88A 3COXA 3AXBA 3EPTA 4CNJA 5IPYA 3NK1X 1XDIA 1PJ7A 2RGHA 1CBOA 1Y56A 2EQ6A 3GDNA 4U8JA 4YKFA 1F8WA 1GRAA 1N4UA 3WE0A 4B68A 4DGKA 4U8KA 2BA9A 3O0HA 4K8DA 4XWZA 3QSSA 5FMHA 3AEGA 5HY5A 4Y4NA 4CCRA 3E1TA 1EL5A 3GSIA 1GPEA 5EOWA 4Z24A 1ZDLA 1ZMDA 3CPIG 3F8DA 4U2SA 2AAQA 5HHFA 4H4PA 1VRQB 1FEBA 1VDCA 3C96A 4CY8A 1DJQA 3KLJA 4H4RA 4X4JA 3D8XA 3AE1A 3ALLA 5DBJA 3ICTA 4DSGA 3REDA 1E1NA 1FOHA 4TM1A 1KSUA 2B9XA 2NPXA 3DJJA 1NDAA 3NRNA 1CC6A 4H2QA 5HXIA 2BACA 2BK4A 4U8MA 4H4QA 4NEWA 2C67A 3ALMA 5J7XA 1IUWA 1GRTA 2R9ZA 2VRMA 2XVHA 1NAAA 2Q7VA 4C74A 1GREA 1TRBA 4BJYA 4EQSA 2OAMA 4EQRA 1Q1WA 2GB0A 4YTPA 2GR2A 2XFNA 3NYEA 1B5QA 4TM0A 4Z2TA 4IVMB 3IC9A 3GD4A 2GH5A 2GR0A 3I3LA 5CQFA 2DKIA 4OPTA 4H7UA 4OPUA 5KVHA 4U8IA 2XLSA 1O94A 3CNSA 4UDQA 1L9DA 1FCDA 2TPRA 3CPJG 1ZOYA 4A5LA 1OJDA 3UKLA 3DK4A 4ZN0A 4Y4MA 1TDKA 3IHGA 1P2HA 1ELIA 3K7MX 1OJTA 1GRBA 2X8CA 3SM8A 1S2YA 2WESA 1Z6LA 2WETA 3ALJA 2H89A 3H4KA 2X8GA 3PO7A 3UOZA 3KU9A 3AYLA 5IQ1A 2YR4A 3NTAA 3M13A 1LQTA 3UKPA 1AOGA 4C3XA 3AYJA
chains in the Genus database with same CATH superfamily
3I0QA 1DOCA 2EQ7A 4YSZA 2IVEA 4A99A 2UXNB 3II4A 1NCQD 4Z26A 1NEKA 4YLHA 5J2TE 1CJ3A 4USRA 4X9NA 3NYFA 3PUSA 1T72A 1K0IA 1S2QA 5DABA 4TLXA 3SOLA 4JI1T 4WBOA 3ZMVB 4NTEA 5F5WA 1H83A 3ADAB 3N2OA 2YLSA 1HX8A 5KOWA 4JI5T 4UP3A 1CF3A 2BVMA 3GRSA 4OPGA 3SFDA 3ESLA 2D2SA 3N9OA 2RGJA 3PU3A 1MIVA 1B8SA 4I50E 5AQQB 3SY4A 1F3PA 5EK2A 5BRTA 3L8KA 3HKEE 1MIYA 2W2UA 3VR9A 3O9XA 3KV5A 2LHNA 3ONXA 3ZMTB 1IUSA 2KMFA 4H9OC 1DOBA 3R9UA 3CNDA 4ZHQE 3NZPA 3FI7A 4LF9T 3N9PA 1R094 4J57A 3S4UA 4DV1T 2WDVA 1GEUA 4LF5T 4H4XA 4HB9A 3NN0X 3NH3X 1MMDA 2JB2A 1REOA 4AKHA 4BK3A 3HZLA 2FJAA 4BURA 2ZBWA 4UF0B 2PLV4 3ZJ2A 4ZS3A 3N9QA 1NHPA 2YK0A 2Y8DA 4CI1B 3RX6A 4AKLA 2X67A 3GYIA 1NG3A 2X8HA 4DV7T 4DR2T 3CNJA 4DR5T 4KBMB 2CXFA 2WM9A 3MA9A 3PDYA 4DBQA 4LF4T 1ONFA 2PYLA 1BEV4 2QA7A 1W4XA 1WRDA 2NW7A 2XVEA 4EMWA 1PBCA 4TNWA 2C7GA 2UUBT 3BI5A 3DP7A 4IA6A 4I59A 1EL7A 3RRCA 4P9SA 1YQ3A 4C90A 4K0KT 4USQA 1UGOA 5L3GB 3JAEA 5HWYA 3BI4A 3OVUA 3V5SA 2X9XA 1BGNA 2JKCA 4ILUA 2JIWA 3SZFA 2WDRA 4X64T 3J9X1 2V5CA 3UP5A 2CLYB 2KSRA 4IDNA 3RF1A 2YG6A 4WCTA 3V76A 2PBIA 2OA1A 1HXS4 3HKCE 3GWDA 3NLCA 2PG8A 4K2XA 5LMNT 2LRKA 4H4ZA 4BA9A 2AE9A 2KWHA 3C4AA 4TV8E 3UFGA 3HL6A 4AISA 1NPXA 5U63A 5HAXA 2HN2A 2IIUA 3ZSSA 5FS8A 2H7VC 4OPLA 1V9DA 1IBLT 5ABFB 2BCGG 4TN7B 3ZN1B 5FL1A 2NTYA 1IZNB 1JRZA 2YVGA 1CJ4A 2M6BA 2BBJA 4YWOA 2BS4A 4OPIA 5JDGA 3OC4A 4FX9A 2YWLA 4KPRA 3OPCA 2QAEA 4DV6T 3UU8A 4NXMT 3FXEB 5GRTA 3BQIA 1RYIA 1HG2A 1JRYA 3CMMA 2JMKA 2Q9QA 5HXCA 1D4EA 1JNRA 5F8PA 4IDPA 1OJ9A 1TDOA 3KD9A 4M52A 1CL0A 4I43B 1F8SA 3EANA 2XUEA 4U72A 2VVLG 2DL1A 5U25A 1T7SA 5L3BB 4EXTA 3UFEA 1YKEB 5FXVA 2B76A 1UX5A 2YN6A 4ZCDA 4C3YA 3UT5E 2I59A 2XAQB 2Q0LA 3F8PA 4LFBT 1IJHA 1MXTA 4Z43A 3P1WA 1VBD4 2YLTA 4A65A 4O4LE 4OCGA 4IT4A 2CWOA 2R7FA 2XLPA 2XSAA 2VL8A 3FZLB 4HFBA 2V6XA 1K0LA 2JAEA 4EB6E 1D1CA 2LSJA 1N32T 3PE0A 4X65T 3AXJA 1WR0A 3K7TA 4OHFA 2WOIA 4WX1A 1S35A 4JYAT 1CC2A 3P9UA 1GESA 2D9DA 1IUVA 3R84B 5JR9C 4NUVA 5LOVE 1PXCA 4UV9B 2WWVA 3W15B 4GIWA 3ZT5A 2NWBA 3TLVA 5LV9A 4GR1A 2J62A 3AE6A 3Q5EA 3RYHE 1GQEA 4GAPA 2WSSV 2K9AA 4D04A 1I94T 3UQ7A 1Y0PA 2OLOA 4LFAT 3H3MA 4ZZCA 5FNVE 2QYWA 2BG9A 3MXZA 1IJ6A 2ZM0A 3SZCA 5DQWA 2RPAA 2VWAA 3T2YA 1RMU4 1JOAA 3LB8A 4A97A 3IHMA 3RP8A 2HQMA 5JRCB 4TM4A 5H6RB 4B3MT 5LB7B 3O4XE 4QX8B 1OJAA 3JSKA 5EB5A 3AEFA 4QXBB 3UCLA 4B67A 4EIWA 2BKOA 1NHRA 1U4QA 4GDEA 1CUNA 5LNKA 4TLZA 2BG9C 3KV4A 4LMJA 4BV6A 3KBUA 2UXBT 1O95A 5JQGE 5AQUB 2EHOA 2RM24 1QJDA 4EQXA 3UKQA 3GYJA 2KLQA 3ABVA 2WDQA 5GONE 4PJLA 4Z90A 1MMNA 2R0PA 3AB3B 2BYBA 3NT6A 2FJDA 2B1EA 3VQRA 1ZEEA 1BF3A 5L46A 5BUKA 2IW5B 4ZOLE 2GQFA 2UXCT 3QFAA 3TKLB 3SRZA 3SXIA 2RP4A 4LF7T 2HN1A 5ABEA 4KI0F 4IHJE 2WZHA 4J2WA 3L39A 3JD74 2IVDA 2WQYA 4AQGA 1EV14 1H7WA 3QFBA 4JQ9A 2K3WA 1SA0E 4JY3A 1IUXA 3LXDA 1XDPA 1PBEA 3OYZA 4AOXA 1VG0A 4Z25A 5KRQA 2LOSA 1VRH4 4UV8B 4UVCB 2XYOA 5AQFB 3ZC0A 5L2LA 4NEVA 3HKBE 4AT0A 2AR8A 5JH7E 3AE8A 4K0UA 3IBPA 5ETWA 5ER0A 2LSKA 1MNEA 4EV6A 3COXA 1AJ3A 2IMLA 2WCAA 3AXBA 4CNJA 3NK1X 1PJ7A 2RGHA 4OK0A 2EQ6A 4YKFA 1F8WA 1N4UA 3NRXA 2V7KA 1MMAA 2YOEA 3UUXB 5HY5A 4CCRA 2J47A 3GSIA 1VCSA 1ZMDA 3EAMA 2V26A 2YDQA 4U2SA 2HH7A 1VRQB 4YJ2E 1UCUA 1FJGT 4ZI3C 3ALLA 4EGWA 2NP9A 1WLXA 1FOHA 5AQVB 1H7CA 4IREA 5LMUT 5HWXA 2A3DA 4DMVA 2JRKA 2QVAA 5HXIA 4IIJE 2BK4A 2XQYA 3T31A 2ZLYA 3QC9A 3UULA 1RUH4 3J8F4 5J7XA 2CHOA 2UU9T 2VRMA 2XVHA 2IAKA 1NAAA 2DNXA 4IGUA 2C0SA 4BJYA 1Q1WA 4YTPA 3FZKB 2E9XD 2LM2A 4NPPA 5CQFA 2DKIA 4H7UA 2PJQA 4CN4A 3JCFA 3TLUA 5IWAT 4A5LA 4ZN0A 4Y4MA 2RR14 1TDKA 2V8SV 2XHEB 3T2KA 1GRBA 5FP3A 4MLKA 2WESA 1Z6LA 5HYAA 1BR1A 4LF6T 3RQUA 2NOXA 3FHNA 5KX5E 4A9WA 3V3NA 2UXXB 4HN9A 1K4QA 2EQ8A 2BXRA 3DH9A 2DCFA 4EMIA 2OLNA 2BDEA 2X9HA 5ADXL 1D4CA 3RI5A 3BK9A 1VBE4 3GDPA 2A87A 3DMEA 2XZEA 1ASJ4 4H4UA 1QLBA 2V7IA 2I0ZA 4GKKT 4H2PA 2I6HA 2PHHA 4U7IA 2IC6A 2XQ8A 4ZI2D 1D7YA 4NTCA 2YINA 3NNEA 4U31A 5AQLB 5LG4A 4UIGA 4CN1A 2CBJA 4ERRA 3PJAJ 4DR3T 1XMOT 1E39A 3GN5B 2JQHA 2YG3A 3UOXA 2LM9A 4GDPA 1W0AA 4H50A 3UUMA 3DJBA 2DLRA 3I6DA 1YD8G 2W63A 1FL2A 2XQ9A 5JR9A 2PYJA 4ANJA 2WP9A 3FPZA 4GAVA 4AKIA 3UKAA 4X66T 4K22A 1L9EA 2X99A 2V6OA 2YG5A 5CKUA 3HYXA 2AQJA 4CZZB 2EQ9A 3BNUA 2BS2A 2A2FX 4QXCB 1ZHCA 2VK9A 2YR6A 3AECA 2HHHT 2XAGB 3ETVA 1M7KA 4YSHA 3QK6A 3VRDB 1WFDA 5C2TA 4DV4T 4JN9A 4BJNA 5BULA 4TX5A 1SEZA 2YU1A 3QSMA 4QHOA 5FXZA 4CQIA 4O5UA 3UTEA 1KF6A 2VKDA 3TLTA 4WZXA 1DODA 2VKOA 3MACA 3ZYKA 2PYXA 4DR6T 1DXLA 4UF0A 1KNRA 2C70A 5JDQA 2JQ9A 2VVNA 1SHZC 4EZ4A 2YLWA 3AD7B 4AOSA 5U1OA 4ECHA 1KNPA 2LHRA 3KKJA 1S3BA 4N9XA 4O2AE 2C72A 2DKHA 4XZCA 2X3NA 3ZN0B 1GSNA 2C3DA 3GQKA 2WPCA 2E5LT 3HI2A 4IDZA 3RLFF 4CCQA 3ZYLA 4YSYA 2LSGA 4RSLA 4TM3A 2LFCA 3T14A 4B64A 3AE9A 1GRFA 1RSGA 2PW9A 3AVSA 4CI3B 3AEDA 3LK2B 3CVRA 4NUUA 2XM1A 1HS7A 3NKSA 2BK3A 4P09A 3D0TA 1XWMA 4C77A 4HWFA 1ZX9A 2XAFB 1Y01A 3NK2X 3CK6A 1YW0A 3CX6B 2FUPA 5FYMA 2HPJA 4HWHA 2Y6QA 3GD3A 2XM2A 2XFOA 3KA7A 2R0CA 1X9BA 2G0UA 3Q9DA 1LV0A 1OEDE 1H7XA 2R074 3N2KE 5EK4A 3K7QX 1G8XA 3UQ4A 1D5TA 3ICSA 2X5ID 1KK7A 5JDMA 3AA6B 2V7JA 4A79A 1WCRA 2WPFA 3NGCX 1B7TA 5KOXA 1NHSA 1PXBA 1WR6A 2XSBA 2VVSA 2VB6A 4WBNE 5ABFA 5E0OA 4EQWA 5HEGA 3AE4A 5FY7A 3NN6X 2HWC4 4A98A 4JNQA 2R064 2CMRA 3HKDE 4IE0A 2XFPA 1XMQT 5FMNA 2WU2A 4TWDA 3CGDA 3GMIA 3CN8A 2BKNA 2D0TA 4A6NA 4Q4X4 1COV4 3RNMA 3O1IA 4QX7B 5JCIA 4L0RA 4AIUA 4JBWF 3NTDA 3OBVE 4TWHA 4HFHA 1FMVA 2JB1A 4EEDA 3L09A 2E1MA 2WU5A 1H86A 4U8NA 4PABA 2R46A 5LP6E 2YAUA 4EM3A 4MBQA 5DQVA 4II3A 4X1IE 5FKYA 3IA3A 1JU2A 2YVFA 4JV5T 1XNRT 5LHIB 2UZZA 2QA2A 3JC6D 4E7SA 4AT2A 2XPKA 1K0JA 1XANA 4X5TA 3UU5A 3FZFB 3ATRA 2VQ7A 2LJLA 4PJMA 5AQIB 4ZEYA 1L0VA 1EZ3A 1I6ZA 3H37A 1OEDB 3EDVA 4CXYA 2W66A 1HNZT 4G73A 1L9CA 1XHCA 3RKGA 3QSEA 4FK1C 4IVOB 2V7MA 1LPFA 4QH5A 3ISHA 3P4RA 5GSNA 4ILCA 3IF9A 3LBXA 3ONLC 3BI2A 4NTDA 2XJ7A 2BS3A 4BJMA 3PS9A 1GRHA 1ZOVA 4CY6A 1VOMA 2I0MA 2W4XA 4J56A 2GAGB 1T98A 3VRAA 2C73A 1OWAA 2CHNA 3V5UA 4KUMB 2B9YA 4B65A 1IUTA 2RABA 5AQTB 2M67A 5FY1A 1Z8UA 1EBDA 3VHLA 1N1PA 1IUUA 4CRTA 3G5SA 3EI0A 5KXJA 4UXNB 4LU6A 3SZWA 2IC9A 2NW8A 3ZDNA 4AP3A 4PAAA 1GRGA 1Z7S4 5AQOB 3M3ZB 5FY0A 4P1NA 2VQFT 1ZY8A 4AKRB 2ARDA 2GEWA 1HCIA 2W67A 3ZKRA 4GB34 4PK4A 4FI5A 3S5WA 1OOPD 4A5XA 3BHKA 1BGJA 5AQRB 3RC8A 4IA5A 2BVLA 2BC0A 1HR0T 1EL8A 2KWIB 4MHCA 5LG3A 1S3EA 4DUYT 4HFCA 2X0HA 3CNTA 5CB4E 4ICYA 2YLZA 4QWNB 2H3RA 4G74A 2XAJB 2V5ZA 1GNDA 3HYVA 2YG4A 4NWZA 1GOSA 3AE3A 4WYVA 4X20E 3QB5A 5LBQB 3K3NA 4ILBA 2C64A 4QH1A 1GALA 4HTEA 4LMLA 4K7ZA 3ATQA 5EB4A 1OXZA 3SS1A 1CHUA 3KFWX 4UDRA 2ZZBA 4Z2RA 4YTMA 3M12A 2GMHA 2RMU4 3U78A 3RPUA 5C8YE 4BK1A 1PVC4 3R6NA 4HEAA 2L8KA 4HA6A 4EMJA 2BC1A 4YXDA 1S94A 2H88A 3UU4A 4H63H 3LDQB 3EPTA 5IPYA 1XDIA 4MFRA 5LCYA 1CBOA 4U8JA 5H6QB 4B68A 3UUBA 5AQSB 2BA9A 4HFIA 3QSSA 5HEUA 3P7IA 4YHHT 1EL5A 1GPEA 1XZYA 1ZDLA 3F8DA 4H4PA 1VDCA 5TAOA 4CY8A 4JLEA 4H4RA 4X4JA 2SPCA 1HFAA 4PNIA 5DBJA 3REDA 1NA1D 2C5JA 1E1NA 5JREA 3NBXX 5AQHB 4TM1A 3RKOA 1NDAA 3L3PA 3ZLIA 1CC6A 4H4QA 2C67A 3ALMA 1GRTA 3GWHA 4DR7T 1GREA 1TRBA 2OAMA 4N78D 2L3LA 4ZI3D 3AA0B 4TM0A 4Z2TA 2EHOD 4IVMB 4IDQA 3GD4A 3LSVA 2GR0A 5KVHA 2OA5A 4U8IA 2JPFA 3CPJG 3IEEA 1XHZA 2M6IA 1K5MD 3UKLA 3IHGA 2LSIA 4O2BE 3SM8A 1FIOA 4JEUB 3H4KA 2H89A 4H9QC 1N36T 2X8GA 3KU9A 2MOZA 5IQ1A 2YR4A 1AOGA 4C3XA 1RUC4 3AYJA 5KMRA 3L1RA 4YT0A 4XWRA 2MTQA 2AXDS 4MALA 2XCGA 4B66A 5J60A 2CXDA 2WZIA 5BR8T 1NAFA 4K5SA 5LJNA 4LFCT 2VKHA 2XQ4A 1FEWA 3P8CD 3P50A 2E5VA 3SFEA 2WP5A 3O1HA 4GF7A 1D4M4 4YFSA 2Q6UA 3C51A 1Y56B 1XNQT 4OYKA 3KV9A 1JRXA 1PBBA 4OFZA 1AR84 3AB1A 3LJCA 2Q0KA 1HYUA 3T2ZA 5JCKA 3I1AA 3ZMZB 2H7OA 3Q9TA 4BK2A 3N9MA 1AL24 3MK7C 1TDFA 2XVJA 3N9LA 2CA5A 1VBB4 1P2EA 1AR64 3E08A 4QH4A 3GYXA 3ZT6A 2GAHB 5CA0E 1VRBA 4DIDB 5IUXA 2QCUA 1RUD4 4ZXLA 3TLSA 4EEBA 2JQQA 4TNVA 5FL0A 4JY2A 3UOVA 4GKJT 2DHRA 3ANWB 1OJCA 1HRV4 4FDCB 3GA8A 2WMOA 3OJAA 2X68A 1RP0A 4JI0T 5A1LA 2BABA 3ZYXA 2YM1A 3UU6A 3SYIA 4A56A 1NENA 3RQWA 2WOVA 1VCTA 3PUGA 2OV9A 4XAXB 2XTLA 2LRLA 3KVEA 3CGBA 2BKPA 4DV0T 5FVKA 4HWCA 3CTYA 1DU2A 1SUMB 5HEHA 5AQGB 4GYRA 2YEVC 4QXHB 2JK6A 1VBA4 1FMWA 2GV8A 3RRWA 2XQ5A 2RS54 4AQFA 4PJJA 5HXRA 4H9RC 2X9YA 3O1JA 2C75A 3UKPA 3EABA 4UVAB 3WI3A 2E9XA 2Q9QB 1GXFA 1DNCA 2LSYA 4PFPA 1HNXT 2ZM6T 4HWIB 4U8LA 1D1BA 3AD8B 2K48A 3L8RA 1DJNA 2NTXA 2X50A 4WW0A 4E7ZA 3OKQA 3PUXF 4LF8T 1PHHA 1RUE4 3AE2A 4AQFC 2BRAA 3SUCA 1LQUA 4JI4T 1M62A 3EAOA 5J2UE 4OVIA 2ODVA 3H3AA 4HKAA 5KMPA 3RYCE 4NNJA 3Q5XA 1YKJA 3U3IA 2ODUA 1UKVG 4I55E 3EDUA 1AR74 4PFOA 3RHWA 5JDLA 3LZXA 3KBTA 2J3NA 4XBFB 2KT9A 3AXJB 1LVFA 5KMQA 3Q5DA 2DWKA 3FG2P 3JADA 2E2AA 1ZV4X 3J7Yq 4DR4T 5C3JA 1TDNA 3M65A 3Q6JA 2OLTA 2VRLA 2R4JA 3ZMUB 2VZ2A 5M0ZA 4H4SA 3NYCA 4K5RA 3UP4A 3HA4A 4CBQA 2BRYA 4XXGA 1V59A 4G6GA 1KDGA 3N2GE 3VKHA 4GK5E 2YQUA 3RGLA 3KINB 2Y6XA 2V7LA 2GF3A 2VQBA 2CWYA 4CI2B 3ZMSB 1GV4A 2JB3A 3CQGB 5JRCA 4NXNT 2WAUA 2QGSA 1E1MA 5L3DB 4D03A 2WBAA 3LZWA 1G73A 2LT3A 4ZCCA 3GQHA 3AEEA 2CLYC 2W00A 2R45A 4M1PA 1J5WA 1PJ6A 4FJOA 2XQ6A 3KVAA 5EZYE 4G6HA 3OYXA 1JNZA 4YTNA 1LVLA 2BXSA 3AE7A 4UVBB 1XHXA 2KNDA 3PUZF 1N33T 3KPKA 1E1KA 2WOWA 2B7RA 2X66A 1TDEA 5LYJE 3QJ4A 5HXEA 1IAPA 4DV2T 4IL4A 2MYSA 5JDHA 4B69A 1T8BA 2W61A 4TV9E 4B3RT 1RUI4 4DUZT 3FXDB 1LTXR 4L5GA 2DWGA 2YU2A 3KV6A 1TYTA 4J2CA 2JJ9A 1ZKQA 1NG4A 3ZSTA 1GT8A 5JCLA 1M64A 3A5XA 4OYJA 2V5DA 4U7YA 3C4NA 5LHHB 2VL0A 4U2YA 3PUWF 3AYIA 4GUVA 3PUYF 2CDUA 2KINB 3NKZA 3ONJA 2D5UA 3T8OA 1NHQA 2IUBA 3CX8B 3ICRA 3F2EA 3DJGX 3Q2MA 1W9RA 2CM0A 2GR3A 5KMSA 3E22E 3QVRA 1O5WA 4AI6A 4J33A 2E8IA 4G2AA 4X9MA 2Q9QD 2XVFA 1OEDA 2FJEA 4TUYE 5F3JA 5FS9A 3UKHA 3QVPA 2X51A 3DJEA 2V3AA 2FJBA 3UTHA 1UX4A 4F6RC 5FXWA 3DK9A 3DJDA 4JUYA 3CGCA 4U74A 1UK5A 1XI1A 2CCQA 2CPTA 2WEUA 2LLYA 3UTGA 2ACZA 3G5QA 3DTOA 1TYPA 3FZMB 3MZKB 3ZT7A 3LBXB 2GQWA 2C76A 1KFYA 1MNDA 5LJMA 4IE4A 3EHZA 5IHYA 3LJPA 4C91A 1B37A 2CVJA 2F5ZA 4CXWA 3LOVA 3K8PC 1BR2A 5L4EA 1UURA 2APGA 5KNLA 4Z2UA 2XQ7A 1Y64B 1W0BA 3B13A 2XQ3A 2Z6EA 5L47A 3ZCJA 5M10A 3RIAA 2WY2A 4F8HA 4AXPA 1H81A 4B1BA 3P4SA 5EBKA 2NW9A 3SZ0A 4ZS2A 5DJQC 4I58A 3AA1B 3LK3B 5CFBA 4RG3A 3PVCA 1J1JA 2WWUA 4H2NA 4DBRA 1ZP0A 3TLWA 4L9IA 2BG9B 2B7SA 3CIRA 2E4GA 4JEHB 4JNAA 3NZQA 3RYFE 3OZ2A 5LGUB 3OTOT 2VURA 4DV5T 2JBVA 3ZYMA 4OX9T 4H63V 2D0UA 1SE7A 3HYWA 5AFUL 2PFVA 4PJNA 4U8KA 3O0HA 4K8DA 3SX6A 3UTKA 5HXSA 1LVKA 5FMHA 3AEGA 3JBG4 5HEJA 3RH3A 2XQAA 3ZCIA 4Y4NA 4Z24A 5AQJB 5M4YA 4G9KA 1N34T 3CPIG 2HWB4 5HHFA 1US7B 2EHOB 2R6GF 3N5LA 1FEBA 3C96A 2MBGA 4CXXA 2W0GA 4JI6T 2LE8A 3GN5A 5LBMA 1U5PA 1WYCA 5CA1E 3D8XA 3QNUA 3AE1A 4DSGA 2J4GA 3C4WA 1AR94 5L4HA 1KSUA 2B9XA 2NPXA 4U8MA 4NEWA 4TWFA 5FXXA 2MAWA 1IUWA 2Q7VA 2V6YB 2GB0A 3A7MA 2GR2A 2XFNA 3NYEA 4PAGA 3IC9A 1ZKEA 4OPTA 4JI2T 2C4CA 4OPUA 3MJXA 2XLSA 3CNSA 3NVOA 2N9DA 2TPRA 1ZOYA 1OJDA 4ISSA 3K7MX 1OJTA 2X8CA 3MKDA 2WETA 2WBLA 3PO7A 1EAH4 3NTAA 2LKHA 1LQTA 3M13A 2LOPA 1COYA 2ZM8A 1YXRA 3BNMA 1YY5A 1EL9A 3P4WA 3WAJA 1D0XA 2YM2A 2C3CA 4JI8T 1QUUA 4HE8A 2UUAT 4ASKA 3UUNA 3T37A 4GYSA 1FECA 2V60A 3PUAA 2PZSA 2RS14 3T1YT 4ZI7E 1PDHA 3LK42 5BVAA 4U2LA 3CX7B 3FBLA 3NIXA 4B3ST 4PK6A 4AKGA 5KWFA 3QB5K 4LA1A 4O8SA 3B5MA 4GK0E 2RA1A 4YSXA 3Q5WA 1RUJ4 2JMHA 5ABGA 1RVF4 2CULA 1POV0 2RGOA 3G5RA 3RHAA 5AQNB 2VOUA 4DMWA 2KZ7B 2LEHA 1N4WA 4EYYR 1E6EA 3BQLA 2ZZCA 1BZLA 4Q4W4 4KMCA 4DNDA 5FS6A 3QOFA 2CBIA 4H4VA 5L3CB 2XASB 2CEAA 1CC4A 2V61A 1BR0A 4IDOA 4ADZA 5JTGA 2YDSA 2IDOB 1ZK7A 3KDSE 1MO9A 5JVDE 5CJ5A 1PS9A 3PURA 1Q9IA 3I9WA 3K30A 4H4YA 4EM4A 2N1GA 2UUCT 1JEHA 3GRTA 1YQ4A 5KVIA 5LHGB 2P9BA 1MMGA 2NR4A 3WAKA 1RHI4 3PTRB 3AAEB 4IV9A 5ABHA 2A8XA 3NHOX 4OPCA 3PU8A 3CNPA 1D1AA 3LG7A 4II2A 3C64A 1PIV4 3SWHA 3CKDA 4BAYB 4PW8A 2XLUA 4LMKA 3AVRA 2RS34 1DOEA 4REKA 4UDPA 4PK5A 1H84A 4AP1A 3RP6A 2VVMA 2Z5YA 4J36A 1D0YA 1VQWA 2XFQA 5AQKB 2QA1A 2VKJA 4Z91A 4H4WA 3IF8B 3AE5A 3KVBA 3D1CA 3AEAA 1H82A 4EYUA 2W0HA 4A6NB 2KXPB 5JDFA 2OALA 3C98B 2E9XB 3AD9B 3K3QC 3A8YC 2YLXA 2A9UA 2IIDA 2ZZ0A 4H4TA 3DGHA 3E0ZA 4IE5A 5BMVE 3VKGA 2WMNA 4FK1A 3H8LA 1KNZA 4RHV4 2R0GA 2F4VT 2L9QA 2W62A 4DNAA 4EIPA 5JR9B 2EHOC 3NRYA 2CFYA 1CJ2A 1PJ5A 4KX6A 4B6XA 4ZI2C 4X1KE 2XLTA 3VRBA 4A7AA 2X9WA 1GTEA 2CRBA 4GRTA 4J34A 5JCNA 3H8IA 4H2RA 1D0ZA 5HYMA 2PTFA 4BJZA 3RC3A 3JAFA 4X62T 4Q4Y4 2WP6A 2EX3A 2BK5A 2C65A 3RIUC 4KP3C 2YDRA 4O5QA 4JI7T 4AQYT 4U2ZA 4APNA 3DK8A 4H9NC 1E1LA 3DA1A 4NIQA 3NG7X 1NWMX 4U8PA 3FB2A 2C66A 2A89A 5CGMA 3B57A 3IWAA 3I0OA 4Q25A 4RG4A 4IL9A 4O4IE 3AA7B 4QKNA 4U8OA 2K24A 3GWFA 4U2TA 4ZZBA 4HWDA 3UTFA 3CPHG 3V3OA 2X0YA 1WYBA 3RIUA 2VQET 1PN0A 2WPEA 4E0VA 3FMWA 4GOUA 2A72A 2JQKA 4HFVA 2V1DB 3C4ZA 2GR1A 1ZMCA 2XFUA 2TMDA 1PO24 1X31B 1M6IA 3K1SA 5J1GA 5LGTB 4U33A 1HX1B 4HFEA 5LA6E 4ADWA 3KPFA 2HPLA 2Y6RA 3T0KA 1B4VA 2ACXA 1FEAA 1RUF4 3P4PA 3M0OA 1PBDA 1MQTD 1GETA 3F8RA 2PY5A 4V1Av 5EK3A 4GCMA 1QO8A 1PBFA 3CWZB 5L3FB 4CN6A 3BQKA 4KHPT 2LKGA 3EVYA 3PV0F 4EAHA 3AWIA 4X1YE 3HR0A 4WNKA 1E2AA 4O4JE 2XLRA 4COFA 1BWCA 4P0BA 2K5BB 4C5OA 5J0ZA 2Z5XA 3UKFA 3ITJA 5FS7A 3JC6C 4CNKA 4TZ4C 1R084 3I9YA 1E7PA 1RUG4 4UR9A 4EOZB 3RP7A 2GRTA 2R044 4B63A 2VVLA 3UU3A 2YVJA 5JDNA 1YQZA 2E9XC 3CQXC 3EF6A 5TR3A 3SQPA 3BHFA 2YG7A 3FBZA 4OPDA 3GMBA 3G06A 1LJ1A 1VG9A 2CE7A 1HTJF 2BG9E 5KDMC 2R4EA 5JCMA 4IE7A 4J31A 3ETUA 2YR5A 5HXHA 1XPQA 3LADA 1GTHA 4I4TE 1VBC4 2BZBA 2ZMAA 4UEMA 4YHJA 2XAHB 1CJCA 1Q1RA 2J1DG 3S61A 2GK9A 1HG5A 3B3RA 2BCPA 4DO0A 3F31A 1KSSA 3DGZA 1F6MA 1KEYA 4YJ3E 1W09A 3AEBA 3VR8A 1PXAA 3N9NA 5FVLA 4G63A 4HGAA 4YY3T 4PDWD 1H6VA 2BBHA 3URHA 4IE6A 3PUQA 3FBSA 4Y4LA 5KMGP 3VU7H 4EZHA 3RIFA 2NVKX 1LRZA 3NK0X 3PUVF 5L3EB 3CQCB 4H9PC 4ILAA 4HFDA 3FIMB 1MOKA 1OEDC 3ZEFB 2O9ZA 1HF8A 2Q9QC 4UELA 2WHDA 3LFMA 5IYZE 2GMJA 4YKGA 2XVIA 2ES0A 3SGLA 1O3XA 2IHR1 1HNWT 2YKSA 3AAIA 2XDOA 3ZC1A 3P4QA 3UKKA 2Y48B 1F8RA 2GVCA 5IQ4A 3QUJA 1YKHB 2WS3A 4H9SE 2YLRA 1BKWA 1IJ5A 2V3BA 5HEOA 2C5IT 2FBWA 1R8IA 1XDOA 1MIWA 5AQMB 3CGEA 1D7LA 5AQPB 3B6DA 1Z0PA 1J5ET 4DV3T 1D4DA 4NZHA 3UOYA 4JDRA 1PO14 4LIIA 1N4VA 1IBMT 2B9WA 2ZM2A 4O4HE 3EUHA 2N2NA 1GERA 1BR4A 4Z44A 2CXLA 4DSHA 2WB5A 4EIQA 3GMCA 4MJWA 4KHZF 3K3OA 1UUSA 1IBKT 1Y56A 3GDNA 3WE0A 4DGKA 1GRAA 2UXDT 5LGNB 1QSDA 5HCJA 4XWZA 4I0UA 3C4XA 3FZHB 1LKXA 3C50A 2VASA 3E1TA 5EOWA 3PJAA 2C5KT 2DI4A 3CPZA 2AAQA 2X0LB 4P0AA 2QRXA 3RYIE 2XY8B 4DVDA 3IHRA 3NWIA 1DJQA 3KLJA 4JI3T 3ICTA 4Z8XA 3DJJA 3NRNA 3ANWA 4H2QA 2BACA 4B3TT 4U3CA 2R9ZA 3T1HT 1X79A 4C74A 1E1HB 5LXTE 4EQSA 4EQRA 1B5QA 3ZJ1A 2MPKA 4DR1T 2GH5A 3I3LA 3ZPOA 4Q4V4 1O94A 4UDQA 1L9DA 1FCDA 3DK4A 3CMLA 1P2HA 3AAAB 1ELIA 1HRI4 4ISTA 1S2YA 2V6YA 3ALJA 3UOZA 1H8TD 3X1DA 3F57A 3AYLA 5HCMA
chains in the Genus database with same CATH topology
1COYA 3V3NA 2EQ8A 1DOCA 1K4QA 4YT0A 2EQ7A 2BXRA 3BNMA 4YSZA 1YY5A 3DH9A 2IVEA 4XWRA 2OLNA 1EL9A 4A99A 2XCGA 4B66A 2YM2A 5J60A 2C3CA 1D4CA 3II4A 4K5SA 4Z26A 3T37A 1NEKA 3GDPA 1CJ3A 2A87A 3DMEA 1FECA 2V60A 4USRA 4X9NA 2E5VA 3SFEA 2WP5A 3NYFA 4GF7A 4H4UA 1QLBA 2Q6UA 1K0IA 1PDHA 5BVAA 1S2QA 2I0ZA 4U2LA 3NIXA 4TLXA 4H2PA 1Y56B 2PHHA 5KWFA 1JRXA 1PBBA 4NTEA 1H83A 3ADAB 1D7YA 3AB1A 2YLSA 4LA1A 4NTCA 2Q0KA 1HYUA 5KOWA 3NNEA 3T2ZA 5JCKA 4YSXA 4UP3A 3Q9TA 1CF3A 4BK2A 3GRSA 4OPGA 3SFDA 2CULA 2RGOA 3G5RA 1TDFA 2XVJA 2RGJA 1E39A 2VOUA 3RHAA 1B8SA 3SY4A 3UOXA 1N4WA 2YG3A 1F3PA 1P2EA 4GDPA 5BRTA 3L8KA 4H50A 3GYXA 1E6EA 3VR9A 2GAHB 3I6DA 2ZZCA 1BZLA 1FL2A 1IUSA 2QCUA 1DOBA 3R9UA 3CNDA 4JY2A 5FS6A 3UOVA 1OJCA 2WP9A 4H4VA 4FDCB 1CC4A 2V61A 3FPZA 4GAVA 3UKAA 4J57A 1RP0A 4K22A 1L9EA 2WDVA 1GEUA 2BABA 3ZYXA 1ZK7A 2V6OA 2X99A 2YG5A 2YM1A 4H4XA 5CKUA 3SYIA 1MO9A 3HYXA 2AQJA 1NENA 1PS9A 2WOVA 1Q9IA 2EQ9A 4HB9A 3K30A 3NN0X 3BNUA 3NH3X 4H4YA 4EM4A 2BS2A 1JEHA 3KVEA 3GRTA 3CGBA 2JB2A 1REOA 3CTYA 1YQ4A 5KVIA 2YR6A 4BK3A 3HZLA 2FJAA 4BURA 4IV9A 2ZBWA 2A8XA 3AECA 3NHOX 4OPCA 2JK6A 3CNPA 4YSHA 4II2A 3VRDB 2GV8A 1NHPA 5C2TA 4JN9A 2XLUA 5BULA 3GYIA 1SEZA 3UTEA 3QSMA 2C75A 1NG3A 1DOEA 2X8HA 4O5UA 1KF6A 1H84A 3CNJA 4REKA 1DODA 2VVMA 2Z5YA 4J36A 3RP6A 1VQWA 1ONFA 1GXFA 1DNCA 2PYXA 2XFQA 1W4XA 1DXLA 2QA1A 1KNRA 4U8LA 4H4WA 2C70A 2XVEA 4EMWA 3AD8B 1PBCA 1DJNA 2X50A 3AE5A 2YLWA 3AD7B 3D1CA 2C7GA 4AOSA 3AEAA 1H82A 5U1OA 4ECHA 1KNPA 3BI5A 3KKJA 1S3BA 2W0HA 1PHHA 4IA6A 4N9XA 4A6NB 4I59A 3AE2A 1EL7A 2C72A 2BRAA 3SUCA 1LQUA 2DKHA 2X3NA 2OALA 4P9SA 1GSNA 1YQ3A 2C3DA 3EAOA 4OVIA 3GQKA 4USQA 5KMPA 4NNJA 2WPCA 3AD9B 3BI4A 1YKJA 2YLXA 2ZZ0A 2IIDA 4H4TA 4CCQA 4YSYA 3DGHA 1UKVG 1BGNA 4RSLA 2JKCA 4TM3A 2LFCA 3T14A 4B64A 4FK1A 3H8LA 2R0GA 3AE9A 3SZFA 2WDRA 1GRFA 3UP5A 4DNAA 4EIPA 1RSGA 3LZXA 2YG6A 3AEDA 4WCTA 3V76A 2J3NA 2OA1A 2CFYA 3GWDA 3NKSA 3NLCA 2BK3A 1CJ2A 1PJ5A 5KMQA 3L1RA 4KX6A 4K2XA 2XLTA 3VRBA 3FG2P 4A7AA 4H4ZA 1GTEA 5C3JA 1TDNA 3C4AA 4C77A 4GRTA 4J34A 1ZX9A 3H8IA 3Q6JA 4H2RA 5JCNA 5U63A 1NPXA 2VRLA 3NK2X 5HYMA 4BJZA 2R4JA 2VZ2A 5M0ZA 4H4SA 5FS8A 2WP6A 4OPLA 3NYCA 4K5RA 3UP4A 2BK5A 2C65A 2Y6QA 3GD3A 2XFOA 2BCGG 3KA7A 2R0CA 4O5QA 1LV0A 1H7XA 4CBQA 2BRYA 4XXGA 1JRZA 3K7QX 2YVGA 4APNA 1CJ4A 1D5TA 1V59A 3DK8A 3ICSA 3DA1A 1E1LA 3NG7X 1KDGA 4G6GA 2BS4A 4U8PA 4YWOA 4OPIA 2C66A 2YQUA 2A89A 3OC4A 4FX9A 4A9WA 3IWAA 2YWLA 4A79A 2WPFA 4RG4A 4KPRA 2GF3A 2VQBA 2QAEA 3NGCX 5KOXA 1NHSA 1PXBA 1RYIA 4U8OA 5GRTA 1JRYA 3CMMA 3GWFA 1GV4A 4U2TA 2JB3A 4EMIA 4EQWA 3UTFA 3CPHG 3AE4A 3NN6X 3V3OA 1E1MA 1D4EA 4D03A 2WBAA 1PN0A 1JNRA 3LZWA 1OJ9A 1TDOA 2WPEA 3KD9A 4JNQA 3FMWA 2XFPA 1CL0A 4M52A 4ZCCA 4E0VA 3EANA 1F8SA 3GQHA 2GR1A 2WU2A 3AEEA 1ZMCA 2XFUA 2VVLG 3CGDA 2R45A 2TMDA 3CN8A 5U25A 1PJ6A 4A6NA 2B76A 1X31B 1M6IA 4ZCDA 3RNMA 4C3YA 2Q0LA 3F8PA 1IJHA 1MXTA 4G6HA 4Z43A 4ADWA 5JCIA 1JNZA 3KPFA 4YTNA 2Y6RA 3P1WA 1LVLA 3T0KA 2BXSA 3AE7A 3NTDA 1B4VA 2YLTA 1FEAA 4A65A 3KPKA 2JB1A 3P4PA 3M0OA 4OCGA 1E1KA 1PBDA 2WOWA 2E1MA 2WU5A 1H86A 1GETA 2B7RA 3F8RA 4U8NA 2XLPA 4PABA 1TDEA 2R46A 2YAUA 4EM3A 3QJ4A 4GCMA 1QO8A 1K0LA 4II3A 1PBFA 2JAEA 4B69A 1JU2A 2YVFA 3AWIA 1LTXR 3K7TA 1TYTA 1ZKQA 2UZZA 1NG4A 2QA2A 1GT8A 2XLRA 2WOIA 5JCLA 1M64A 1BWCA 1K0JA 4AT2A 4C5OA 1XANA 2Z5XA 4WX1A 3UKFA 3ITJA 5FS7A 3ATRA 3C4NA 4CNKA 1CC2A 2VQ7A 3P9UA 4GUVA 3AYIA 1E7PA 1L0VA 1IUVA 1GESA 2CDUA 3RP7A 2GRTA 1PXCA 4B63A 2VVLA 1NHQA 2YVJA 3ICRA 3DJGX 5LV9A 4GR1A 1YQZA 4G73A 3EF6A 3SQPA 5TR3A 3AE6A 1L9CA 2GR3A 3BHFA 2YG7A 4GAPA 5KMSA 4D04A 4OPDA 3QVRA 1O5WA 1XHCA 1Y0PA 1LJ1A 3GMBA 4J33A 1VG9A 2OLOA 3QSEA 4FK1C 4IVOB 1LPFA 2R4EA 5JCMA 4X9MA 4J31A 3ISHA 3P4RA 5GSNA 2YR5A 3LADA 1XPQA 3IF9A 1GTHA 3SZCA 2XVFA 3BI2A 4NTDA 3T2YA 2FJEA 1CJCA 5FS9A 1JOAA 3LB8A 1Q1RA 3UKHA 3QVPA 2BS3A 3DJEA 3IHMA 3PS9A 1GRHA 1ZOVA 2HQMA 2FJBA 2V3AA 4TM4A 3RP8A 3UTHA 4CY6A 3B3RA 2BCPA 3DK9A 3DGZA 1KSSA 3DJDA 3CGCA 1F6MA 4J56A 3JSKA 1OJAA 2GAGB 5IQ4A 3AEBA 2WEUA 5EB5A 3AEFA 3VRAA 3VR8A 1PXAA 2ACZA 2C73A 3G5QA 3UCLA 1TYPA 3UTGA 4B67A 4AP1A 2B9YA 4B65A 1IUTA 2RABA 1NHRA 2GQWA 4GDEA 1EBDA 2C76A 4TLZA 1KFYA 1N1PA 4BV6A 1H6VA 3LJPA 1O95A 1B37A 2CVJA 1IUUA 3URHA 3G5SA 4CRTA 3FBSA 4Y4LA 5KXJA 1QJDA 2F5ZA 4LU6A 3SZWA 2NVKX 4EQXA 3LOVA 3UKQA 3ZDNA 3GYJA 3NK0X 4PAAA 1GRGA 3ABVA 4AP3A 2WDQA 2R0PA 3FIMB 1ZY8A 1MOKA 2ARDA 2BYBA 2APGA 3NT6A 2FJDA 2GEWA 5KNLA 4Z2UA 2O9ZA 3S61A 3S5WA 3VQRA 2WHDA 3BHKA 1BF3A 5L46A 1BGJA 5BUKA 2GQFA 2BC0A 3QFAA 4IA5A 2GMJA 4YKGA 2XVIA 3SGLA 1EL8A 5M10A 3SXIA 2XDOA 1S3EA 3P4QA 3CNTA 4J2WA 3UKKA 4ICYA 1F8RA 2GVCA 2IVDA 2WQYA 1H81A 3P4SA 2YLZA 5EBKA 2WS3A 4B1BA 4G74A 3SZ0A 2YLRA 1BKWA 1H7WA 2V3BA 2V5ZA 3QFBA 2FBWA 1GNDA 3HYVA 2YG4A 4NWZA 1GOSA 3AE3A 4UDPA 4JQ9A 3CGEA 4I58A 1D7LA 4JY3A 2C64A 3B6DA 1IUXA 4RG3A 3LXDA 1PBEA 1GALA 3PVCA 1D4DA 4NZHA 4K7ZA 4AOXA 1VG0A 3ATQA 4JDRA 5EB4A 3UOYA 4H2NA 4Z25A 5KRQA 1ZP0A 4LIIA 1N4VA 1CHUA 2B9WA 2B7SA 2XYOA 3CIRA 4NEVA 2E4GA 4UDRA 4AT0A 1GERA 2ZZBA 4Z2RA 4YTMA 2AR8A 2GMHA 3M12A 4BK1A 4JNAA 3AE8A 4Z44A 3OZ2A 4HA6A 4EMJA 4DSHA 2BC1A 4YXDA 2JBVA 3GMCA 4MJWA 5ER0A 4EIQA 2H88A 3COXA 3AXBA 3EPTA 4CNJA 5IPYA 3HYWA 3NK1X 1XDIA 1PJ7A 2RGHA 1CBOA 1Y56A 2EQ6A 3GDNA 4U8JA 4YKFA 1F8WA 1GRAA 1N4UA 3WE0A 4B68A 4DGKA 4U8KA 2BA9A 3O0HA 4K8DA 4XWZA 3SX6A 3QSSA 5FMHA 3AEGA 5HY5A 4Y4NA 4CCRA 3E1TA 1EL5A 3GSIA 1GPEA 5EOWA 4G9KA 4Z24A 1ZDLA 1ZMDA 3CPIG 3F8DA 4U2SA 2AAQA 5HHFA 4H4PA 1VRQB 1FEBA 1VDCA 3C96A 4CY8A 1DJQA 3KLJA 4H4RA 4X4JA 3D8XA 3AE1A 3ALLA 5DBJA 3ICTA 4DSGA 3REDA 1E1NA 1FOHA 4TM1A 1KSUA 2B9XA 2NPXA 3DJJA 1NDAA 3NRNA 1CC6A 4H2QA 5HXIA 2BACA 2BK4A 4U8MA 4H4QA 4NEWA 3T31A 2C67A 3ALMA 5J7XA 1IUWA 1GRTA 2R9ZA 2VRMA 2XVHA 1NAAA 2Q7VA 4C74A 1GREA 1TRBA 4BJYA 4EQSA 2OAMA 4EQRA 1Q1WA 2GB0A 4YTPA 2GR2A 2XFNA 3NYEA 1B5QA 4TM0A 4Z2TA 4IVMB 3IC9A 3GD4A 2GH5A 2GR0A 3I3LA 5CQFA 2DKIA 4OPTA 4H7UA 2C4CA 4OPUA 4U8IA 5KVHA 2XLSA 1O94A 3CNSA 4UDQA 1L9DA 1FCDA 2TPRA 3CPJG 1ZOYA 4A5LA 1OJDA 3UKLA 3DK4A 4ZN0A 4Y4MA 1TDKA 3IHGA 1P2HA 1ELIA 3K7MX 3T2KA 1OJTA 1GRBA 2X8CA 3SM8A 1S2YA 2WESA 1Z6LA 2WETA 3ALJA 2H89A 3H4KA 2X8GA 3PO7A 3UOZA 3KU9A 3AYLA 5IQ1A 2YR4A 3NTAA 3M13A 1LQTA 3UKPA 1AOGA 4C3XA 3AYJA 5KMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COY A;  3V3N A;  2EQ8 A;  1DOC A;  1K4Q A;  4YT0 A;  2EQ7 A;  2BXR A;  3BNM A;  4YSZ A;  1YY5 A;  3DH9 A;  2IVE A;  4XWR A;  2OLN A;  1EL9 A;  4A99 A;  2XCG A;  4B66 A;  2YM2 A;  5J60 A;  2C3C A;  1D4C A;  3II4 A;  4K5S A;  4Z26 A;  3T37 A;  1NEK A;  3GDP A;  1CJ3 A;  2A87 A;  3DME A;  1FEC A;  2V60 A;  4USR A;  4X9N A;  2E5V A;  3SFE A;  2WP5 A;  3NYF A;  4GF7 A;  4H4U A;  1QLB A;  2Q6U A;  1K0I A;  1PDH A;  5BVA A;  1S2Q A;  2I0Z A;  4U2L A;  3NIX A;  4TLX A;  4H2P A;  1Y56 B;  2PHH A;  5KWF A;  1JRX A;  1PBB A;  4NTE A;  1H83 A;  3ADA B;  1D7Y A;  3AB1 A;  2YLS A;  4LA1 A;  4NTC A;  2Q0K A;  1HYU A;  5KOW A;  3NNE A;  5JCK A;  4YSX A;  4UP3 A;  3Q9T A;  1CF3 A;  4BK2 A;  3GRS A;  4OPG A;  3SFD A;  2CUL A;  2RGO A;  3G5R A;  1TDF A;  2XVJ A;  2RGJ A;  1E39 A;  2VOU A;  3RHA A;  1B8S A;  3UOX A;  1N4W A;  2YG3 A;  1F3P A;  1P2E A;  4GDP A;  5BRT A;  3L8K A;  4H50 A;  3GYX A;  1E6E A;  3VR9 A;  2GAH B;  3I6D A;  2ZZC A;  1BZL A;  1FL2 A;  1IUS A;  2QCU A;  1DOB A;  3R9U A;  3CND A;  4JY2 A;  5FS6 A;  3UOV A;  1OJC A;  2WP9 A;  4H4V A;  4FDC B;  1CC4 A;  2V61 A;  3FPZ A;  3UKA A;  4J57 A;  1RP0 A;  4K22 A;  1L9E A;  2WDV A;  1GEU A;  2BAB A;  3ZYX A;  1ZK7 A;  2V6O A;  2X99 A;  2YG5 A;  2YM1 A;  4H4X A;  5CKU A;  1MO9 A;  2AQJ A;  1NEN A;  1PS9 A;  2WOV A;  1Q9I A;  2EQ9 A;  4HB9 A;  3K30 A;  3NN0 X;  3BNU A;  3NH3 X;  4H4Y A;  4EM4 A;  2BS2 A;  1JEH A;  3KVE A;  3GRT A;  3CGB A;  2JB2 A;  1REO A;  3CTY A;  1YQ4 A;  5KVI A;  2YR6 A;  4BK3 A;  3HZL A;  2FJA A;  4BUR A;  4IV9 A;  2ZBW A;  2A8X A;  3AEC A;  3NHO X;  4OPC A;  2JK6 A;  3CNP A;  4YSH A;  3VRD B;  2GV8 A;  1NHP A;  5C2T A;  4JN9 A;  2XLU A;  5BUL A;  3GYI A;  1SEZ A;  3UTE A;  3QSM A;  2C75 A;  1NG3 A;  1DOE A;  2X8H A;  4O5U A;  1KF6 A;  1H84 A;  3CNJ A;  4REK A;  1DOD A;  2VVM A;  2Z5Y A;  4J36 A;  3RP6 A;  1VQW A;  1ONF A;  1GXF A;  1DNC A;  2PYX A;  2XFQ A;  1W4X A;  1DXL A;  2QA1 A;  1KNR A;  4U8L A;  4H4W A;  2C70 A;  2XVE A;  4EMW A;  3AD8 B;  1PBC A;  1DJN A;  2X50 A;  3AE5 A;  2YLW A;  3AD7 B;  3D1C A;  2C7G A;  4AOS A;  3AEA A;  1H82 A;  5U1O A;  4ECH A;  1KNP A;  3BI5 A;  3KKJ A;  1S3B A;  2W0H A;  1PHH A;  4IA6 A;  4N9X A;  4A6N B;  4I59 A;  3AE2 A;  1EL7 A;  2C72 A;  3SUC A;  1LQU A;  2DKH A;  2X3N A;  2OAL A;  4P9S A;  1GSN A;  1YQ3 A;  2C3D A;  3EAO A;  4OVI A;  3GQK A;  4USQ A;  2WPC A;  3AD9 B;  3BI4 A;  1YKJ A;  2YLX A;  2ZZ0 A;  2IID A;  4H4T A;  4CCQ A;  4YSY A;  3DGH A;  1UKV G;  1BGN A;  4RSL A;  2JKC A;  4TM3 A;  2LFC A;  4B64 A;  4FK1 A;  3H8L A;  2R0G A;  3AE9 A;  2WDR A;  1GRF A;  3UP5 A;  4DNA A;  4EIP A;  1RSG A;  3LZX A;  2YG6 A;  3AED A;  4WCT A;  3V76 A;  2J3N A;  2OA1 A;  2CFY A;  3GWD A;  3NKS A;  3NLC A;  2BK3 A;  1CJ2 A;  1PJ5 A;  3L1R A;  4KX6 A;  4K2X A;  2XLT A;  3VRB A;  3FG2 P;  4A7A A;  4H4Z A;  1GTE A;  5C3J A;  1TDN A;  3C4A A;  4C77 A;  4GRT A;  4J34 A;  1ZX9 A;  3H8I A;  3Q6J A;  4H2R A;  5JCN A;  5U63 A;  1NPX A;  2VRL A;  3NK2 X;  5HYM A;  4BJZ A;  2R4J A;  2VZ2 A;  5M0Z A;  4H4S A;  5FS8 A;  2WP6 A;  4OPL A;  3NYC A;  4K5R A;  3UP4 A;  2BK5 A;  2C65 A;  2Y6Q A;  3GD3 A;  2XFO A;  2BCG G;  3KA7 A;  2R0C A;  4O5Q A;  1LV0 A;  1H7X A;  4CBQ A;  4XXG A;  1JRZ A;  3K7Q X;  2YVG A;  4APN A;  1CJ4 A;  1D5T A;  1V59 A;  3DK8 A;  3ICS A;  3DA1 A;  1E1L A;  3NG7 X;  1KDG A;  4U8P A;  2BS4 A;  4YWO A;  4OPI A;  2C66 A;  2YQU A;  2A89 A;  3OC4 A;  4FX9 A;  4A9W A;  3IWA A;  2YWL A;  4A79 A;  2WPF A;  4RG4 A;  4KPR A;  2GF3 A;  2VQB A;  2QAE A;  3NGC X;  5KOX A;  1NHS A;  1PXB A;  1RYI A;  4U8O A;  5GRT A;  1JRY A;  3GWF A;  1GV4 A;  4U2T A;  2JB3 A;  4EMI A;  4EQW A;  3UTF A;  3CPH G;  3AE4 A;  3NN6 X;  3V3O A;  1E1M A;  1D4E A;  4D03 A;  2WBA A;  1PN0 A;  1JNR A;  3LZW A;  1OJ9 A;  1TDO A;  2WPE A;  3KD9 A;  4JNQ A;  3FMW A;  2XFP A;  1CL0 A;  4M52 A;  4ZCC A;  4E0V A;  3EAN A;  1F8S A;  3GQH A;  2GR1 A;  2WU2 A;  3AEE A;  1ZMC A;  2XFU A;  2VVL G;  3CGD A;  2R45 A;  2TMD A;  3CN8 A;  5U25 A;  1PJ6 A;  4A6N A;  2B76 A;  1X31 B;  1M6I A;  4ZCD A;  3RNM A;  4C3Y A;  2Q0L A;  3F8P A;  1IJH A;  1MXT A;  4Z43 A;  5JCI A;  4ADW A;  1JNZ A;  3KPF A;  4YTN A;  2Y6R A;  3P1W A;  1LVL A;  2BXS A;  3AE7 A;  3NTD A;  1B4V A;  2YLT A;  1FEA A;  4A65 A;  2JB1 A;  3P4P A;  3M0O A;  4OCG A;  1E1K A;  1PBD A;  2WOW A;  2E1M A;  2WU5 A;  1H86 A;  1GET A;  2B7R A;  3F8R A;  4U8N A;  2XLP A;  4PAB A;  1TDE A;  2R46 A;  2YAU A;  4EM3 A;  3QJ4 A;  4GCM A;  1QO8 A;  1K0L A;  1PBF A;  2JAE A;  4B69 A;  1JU2 A;  2YVF A;  3AWI A;  1LTX R;  3K7T A;  1TYT A;  1ZKQ A;  2UZZ A;  1NG4 A;  2QA2 A;  1GT8 A;  2XLR A;  2WOI A;  5JCL A;  1M64 A;  1BWC A;  1K0J A;  4AT2 A;  4C5O A;  1XAN A;  2Z5X A;  4WX1 A;  3UKF A;  3ITJ A;  5FS7 A;  3ATR A;  3C4N A;  4CNK A;  1CC2 A;  2VQ7 A;  3P9U A;  4GUV A;  3AYI A;  1E7P A;  1L0V A;  1IUV A;  1GES A;  2CDU A;  3RP7 A;  2GRT A;  1PXC A;  4B63 A;  2VVL A;  1NHQ A;  2YVJ A;  3ICR A;  3DJG X;  5LV9 A;  4GR1 A;  1YQZ A;  3EF6 A;  3SQP A;  5TR3 A;  3AE6 A;  1L9C A;  2GR3 A;  3BHF A;  2YG7 A;  4D04 A;  4OPD A;  3QVR A;  1O5W A;  1XHC A;  1Y0P A;  1LJ1 A;  3GMB A;  4J33 A;  1VG9 A;  2OLO A;  3QSE A;  4FK1 C;  4IVO B;  1LPF A;  2R4E A;  5JCM A;  4X9M A;  4J31 A;  3ISH A;  3P4R A;  5GSN A;  2YR5 A;  3LAD A;  1XPQ A;  3IF9 A;  1GTH A;  2XVF A;  3BI2 A;  4NTD A;  2FJE A;  1CJC A;  5FS9 A;  1JOA A;  3LB8 A;  1Q1R A;  3UKH A;  3QVP A;  2BS3 A;  3DJE A;  3IHM A;  3PS9 A;  1GRH A;  1ZOV A;  2HQM A;  2FJB A;  2V3A A;  4TM4 A;  3RP8 A;  3UTH A;  4CY6 A;  3B3R A;  2BCP A;  3DK9 A;  3DGZ A;  1KSS A;  3DJD A;  3CGC A;  1F6M A;  4J56 A;  3JSK A;  1OJA A;  2GAG B;  5IQ4 A;  3AEB A;  2WEU A;  5EB5 A;  3AEF A;  3VRA A;  3VR8 A;  1PXA A;  2ACZ A;  2C73 A;  3G5Q A;  3UCL A;  1TYP A;  3UTG A;  4B67 A;  4AP1 A;  2B9Y A;  4B65 A;  1IUT A;  2RAB A;  1NHR A;  2GQW A;  4GDE A;  1EBD A;  2C76 A;  4TLZ A;  1KFY A;  1N1P A;  4BV6 A;  1H6V A;  3LJP A;  1O95 A;  1B37 A;  2CVJ A;  1IUU A;  3URH A;  3G5S A;  4CRT A;  3FBS A;  4Y4L A;  5KXJ A;  1QJD A;  2F5Z A;  4LU6 A;  2NVK X;  4EQX A;  3LOV A;  3UKQ A;  3ZDN A;  3GYJ A;  3NK0 X;  4PAA A;  1GRG A;  3ABV A;  4AP3 A;  2WDQ A;  2R0P A;  3FIM B;  1ZY8 A;  1MOK A;  2ARD A;  2BYB A;  2APG A;  3NT6 A;  2FJD A;  2GEW A;  4Z2U A;  2O9Z A;  3S61 A;  3S5W A;  3VQR A;  2WHD A;  3BHK A;  1BF3 A;  5L46 A;  1BGJ A;  5BUK A;  2GQF A;  2BC0 A;  3QFA A;  4IA5 A;  2GMJ A;  4YKG A;  2XVI A;  3SGL A;  1EL8 A;  5M10 A;  2XDO A;  1S3E A;  3P4Q A;  3CNT A;  4J2W A;  3UKK A;  4ICY A;  1F8R A;  2GVC A;  2IVD A;  2WQY A;  1H81 A;  3P4S A;  2YLZ A;  5EBK A;  2WS3 A;  4B1B A;  2YLR A;  1BKW A;  1H7W A;  2V3B A;  2V5Z A;  3QFB A;  2FBW A;  1GND A;  4UDP A;  2YG4 A;  1GOS A;  3AE3 A;  4JQ9 A;  3CGE A;  4I58 A;  1D7L A;  4JY3 A;  2C64 A;  3B6D A;  1IUX A;  4RG3 A;  3LXD A;  1PBE A;  1GAL A;  3PVC A;  1D4D A;  4NZH A;  4K7Z A;  4AOX A;  1VG0 A;  3ATQ A;  4JDR A;  5EB4 A;  3UOY A;  4H2N A;  4Z25 A;  5KRQ A;  1ZP0 A;  4LII A;  1N4V A;  1CHU A;  2B9W A;  2B7S A;  2XYO A;  3CIR A;  4NEV A;  2E4G A;  4UDR A;  4AT0 A;  1GER A;  2ZZB A;  4Z2R A;  4YTM A;  2AR8 A;  2GMH A;  3M12 A;  4BK1 A;  4JNA A;  3AE8 A;  4Z44 A;  3OZ2 A;  4HA6 A;  4EMJ A;  4DSH A;  2BC1 A;  4YXD A;  2JBV A;  3GMC A;  4MJW A;  5ER0 A;  4EIQ A;  2H88 A;  3COX A;  3AXB A;  3EPT A;  4CNJ A;  5IPY A;  3NK1 X;  1XDI A;  1PJ7 A;  2RGH A;  1CBO A;  1Y56 A;  2EQ6 A;  3GDN A;  4U8J A;  4YKF A;  1F8W A;  1GRA A;  1N4U A;  3WE0 A;  4B68 A;  4DGK A;  4U8K A;  2BA9 A;  3O0H A;  4K8D A;  4XWZ A;  3QSS A;  5FMH A;  3AEG A;  5HY5 A;  4Y4N A;  4CCR A;  3E1T A;  1EL5 A;  3GSI A;  1GPE A;  5EOW A;  4Z24 A;  1ZDL A;  1ZMD A;  3CPI G;  3F8D A;  4U2S A;  2AAQ A;  5HHF A;  4H4P A;  1VRQ B;  1FEB A;  1VDC A;  3C96 A;  4CY8 A;  1DJQ A;  3KLJ A;  4H4R A;  4X4J A;  3D8X A;  3AE1 A;  3ALL A;  5DBJ A;  3ICT A;  4DSG A;  3RED A;  1E1N A;  1FOH A;  4TM1 A;  1KSU A;  2B9X A;  2NPX A;  3DJJ A;  1NDA A;  3NRN A;  1CC6 A;  4H2Q A;  5HXI A;  2BAC A;  2BK4 A;  4U8M A;  4H4Q A;  4NEW A;  2C67 A;  3ALM A;  5J7X A;  1IUW A;  1GRT A;  2R9Z A;  2VRM A;  2XVH A;  1NAA A;  2Q7V A;  4C74 A;  1GRE A;  1TRB A;  4BJY A;  4EQS A;  2OAM A;  4EQR A;  1Q1W A;  2GB0 A;  4YTP A;  2GR2 A;  2XFN A;  3NYE A;  1B5Q A;  4TM0 A;  4Z2T A;  4IVM B;  3IC9 A;  3GD4 A;  2GH5 A;  2GR0 A;  3I3L A;  5CQF A;  2DKI A;  4OPT A;  4H7U A;  4OPU A;  5KVH A;  4U8I A;  2XLS A;  1O94 A;  3CNS A;  4UDQ A;  1L9D A;  1FCD A;  2TPR A;  3CPJ G;  1ZOY A;  4A5L A;  1OJD A;  3UKL A;  3DK4 A;  4ZN0 A;  4Y4M A;  1TDK A;  3IHG A;  1P2H A;  1ELI A;  3K7M X;  1OJT A;  1GRB A;  2X8C A;  3SM8 A;  1S2Y A;  2WES A;  1Z6L A;  2WET A;  3ALJ A;  2H89 A;  3H4K A;  2X8G A;  3PO7 A;  3UOZ A;  3KU9 A;  3AYL A;  5IQ1 A;  2YR4 A;  3NTA A;  3M13 A;  1LQT A;  3UKP A;  1AOG A;  4C3X A;  3AYJ A; 
#chains in the Genus database with same CATH topology
 3I0Q A;  1DOC A;  2EQ7 A;  4YSZ A;  2IVE A;  4A99 A;  2UXN B;  3II4 A;  1NCQ D;  4Z26 A;  1NEK A;  4YLH A;  5J2T E;  1CJ3 A;  4USR A;  4X9N A;  3NYF A;  3PUS A;  1T72 A;  1K0I A;  1S2Q A;  5DAB A;  4TLX A;  3SOL A;  4JI1 T;  4WBO A;  3ZMV B;  4NTE A;  5F5W A;  1H83 A;  3ADA B;  3N2O A;  2YLS A;  1HX8 A;  5KOW A;  4JI5 T;  4UP3 A;  1CF3 A;  2BVM A;  3GRS A;  4OPG A;  3SFD A;  3ESL A;  2D2S A;  3N9O A;  2RGJ A;  3PU3 A;  1MIV A;  1B8S A;  4I50 E;  5AQQ B;  3SY4 A;  1F3P A;  5EK2 A;  5BRT A;  3L8K A;  3HKE E;  1MIY A;  2W2U A;  3VR9 A;  3O9X A;  3KV5 A;  2LHN A;  3ONX A;  3ZMT B;  1IUS A;  2KMF A;  4H9O C;  1DOB A;  3R9U A;  3CND A;  4ZHQ E;  3NZP A;  3FI7 A;  4LF9 T;  3N9P A;  1R09 4;  4J57 A;  3S4U A;  4DV1 T;  2WDV A;  1GEU A;  4LF5 T;  4H4X A;  4HB9 A;  3NN0 X;  3NH3 X;  1MMD A;  2JB2 A;  1REO A;  4AKH A;  4BK3 A;  3HZL A;  2FJA A;  4BUR A;  2ZBW A;  4UF0 B;  2PLV 4;  3ZJ2 A;  4ZS3 A;  3N9Q A;  1NHP A;  2YK0 A;  2Y8D A;  4CI1 B;  3RX6 A;  4AKL A;  2X67 A;  3GYI A;  1NG3 A;  2X8H A;  4DV7 T;  4DR2 T;  3CNJ A;  4DR5 T;  4KBM B;  2CXF A;  2WM9 A;  3MA9 A;  3PDY A;  4DBQ A;  4LF4 T;  1ONF A;  2PYL A;  1BEV 4;  2QA7 A;  1W4X A;  1WRD A;  2NW7 A;  2XVE A;  4EMW A;  1PBC A;  4TNW A;  2C7G A;  2UUB T;  3BI5 A;  3DP7 A;  4IA6 A;  4I59 A;  1EL7 A;  3RRC A;  4P9S A;  1YQ3 A;  4C90 A;  4K0K T;  4USQ A;  1UGO A;  5L3G B;  3JAE A;  5HWY A;  3BI4 A;  3OVU A;  3V5S A;  2X9X A;  1BGN A;  2JKC A;  4ILU A;  2JIW A;  3SZF A;  2WDR A;  4X64 T;  3J9X 1;  2V5C A;  3UP5 A;  2CLY B;  2KSR A;  4IDN A;  3RF1 A;  2YG6 A;  4WCT A;  3V76 A;  2PBI A;  2OA1 A;  1HXS 4;  3HKC E;  3GWD A;  3NLC A;  2PG8 A;  4K2X A;  5LMN T;  2LRK A;  4H4Z A;  4BA9 A;  2AE9 A;  2KWH A;  3C4A A;  4TV8 E;  3UFG A;  3HL6 A;  4AIS A;  1NPX A;  5U63 A;  5HAX A;  2HN2 A;  2IIU A;  3ZSS A;  5FS8 A;  2H7V C;  4OPL A;  1V9D A;  1IBL T;  5ABF B;  2BCG G;  4TN7 B;  3ZN1 B;  5FL1 A;  2NTY A;  1IZN B;  1JRZ A;  2YVG A;  1CJ4 A;  2M6B A;  2BBJ A;  4YWO A;  2BS4 A;  4OPI A;  5JDG A;  3OC4 A;  4FX9 A;  2YWL A;  4KPR A;  3OPC A;  2QAE A;  4DV6 T;  3UU8 A;  4NXM T;  3FXE B;  5GRT A;  3BQI A;  1RYI A;  1HG2 A;  1JRY A;  3CMM A;  2JMK A;  2Q9Q A;  5HXC A;  1D4E A;  1JNR A;  5F8P A;  4IDP A;  1OJ9 A;  1TDO A;  3KD9 A;  4M52 A;  1CL0 A;  4I43 B;  1F8S A;  3EAN A;  2XUE A;  4U72 A;  2VVL G;  2DL1 A;  5U25 A;  1T7S A;  5L3B B;  4EXT A;  3UFE A;  1YKE B;  5FXV A;  2B76 A;  1UX5 A;  2YN6 A;  4ZCD A;  4C3Y A;  3UT5 E;  2I59 A;  2XAQ B;  2Q0L A;  3F8P A;  4LFB T;  1IJH A;  1MXT A;  4Z43 A;  3P1W A;  1VBD 4;  2YLT A;  4A65 A;  4O4L E;  4OCG A;  4IT4 A;  2CWO A;  2R7F A;  2XLP A;  2XSA A;  2VL8 A;  3FZL B;  4HFB A;  2V6X A;  1K0L A;  2JAE A;  4EB6 E;  1D1C A;  2LSJ A;  1N32 T;  3PE0 A;  4X65 T;  3AXJ A;  1WR0 A;  3K7T A;  4OHF A;  2WOI A;  4WX1 A;  1S35 A;  4JYA T;  1CC2 A;  3P9U A;  1GES A;  2D9D A;  1IUV A;  3R84 B;  5JR9 C;  4NUV A;  5LOV E;  1PXC A;  4UV9 B;  2WWV A;  3W15 B;  4GIW A;  3ZT5 A;  2NWB A;  3TLV A;  5LV9 A;  4GR1 A;  2J62 A;  3AE6 A;  3Q5E A;  3RYH E;  1GQE A;  4GAP A;  2WSS V;  2K9A A;  4D04 A;  1I94 T;  3UQ7 A;  1Y0P A;  2OLO A;  4LFA T;  3H3M A;  4ZZC A;  5FNV E;  2QYW A;  2BG9 A;  3MXZ A;  1IJ6 A;  2ZM0 A;  3SZC A;  5DQW A;  2RPA A;  2VWA A;  3T2Y A;  1RMU 4;  1JOA A;  3LB8 A;  4A97 A;  3IHM A;  3RP8 A;  2HQM A;  5JRC B;  4TM4 A;  5H6R B;  4B3M T;  5LB7 B;  3O4X E;  4QX8 B;  1OJA A;  3JSK A;  5EB5 A;  3AEF A;  4QXB B;  3UCL A;  4B67 A;  4EIW A;  2BKO A;  1NHR A;  1U4Q A;  4GDE A;  1CUN A;  5LNK A;  4TLZ A;  2BG9 C;  3KV4 A;  4LMJ A;  4BV6 A;  3KBU A;  2UXB T;  1O95 A;  5JQG E;  5AQU B;  2EHO A;  2RM2 4;  1QJD A;  4EQX A;  3UKQ A;  3GYJ A;  2KLQ A;  3ABV A;  2WDQ A;  5GON E;  4PJL A;  4Z90 A;  1MMN A;  2R0P A;  3AB3 B;  2BYB A;  3NT6 A;  2FJD A;  2B1E A;  3VQR A;  1ZEE A;  1BF3 A;  5L46 A;  5BUK A;  2IW5 B;  4ZOL E;  2GQF A;  2UXC T;  3QFA A;  3TKL B;  3SRZ A;  3SXI A;  2RP4 A;  4LF7 T;  2HN1 A;  5ABE A;  4KI0 F;  4IHJ E;  2WZH A;  4J2W A;  3L39 A;  3JD7 4;  2IVD A;  2WQY A;  4AQG A;  1EV1 4;  1H7W A;  3QFB A;  4JQ9 A;  2K3W A;  1SA0 E;  4JY3 A;  1IUX A;  3LXD A;  1XDP A;  1PBE A;  3OYZ A;  4AOX A;  1VG0 A;  4Z25 A;  5KRQ A;  2LOS A;  1VRH 4;  4UV8 B;  4UVC B;  2XYO A;  5AQF B;  3ZC0 A;  5L2L A;  4NEV A;  3HKB E;  4AT0 A;  2AR8 A;  5JH7 E;  3AE8 A;  4K0U A;  3IBP A;  5ETW A;  5ER0 A;  2LSK A;  1MNE A;  4EV6 A;  3COX A;  1AJ3 A;  2IML A;  2WCA A;  3AXB A;  4CNJ A;  3NK1 X;  1PJ7 A;  2RGH A;  4OK0 A;  2EQ6 A;  4YKF A;  1F8W A;  1N4U A;  3NRX A;  2V7K A;  1MMA A;  2YOE A;  3UUX B;  5HY5 A;  4CCR A;  2J47 A;  3GSI A;  1VCS A;  1ZMD A;  3EAM A;  2V26 A;  2YDQ A;  4U2S A;  2HH7 A;  1VRQ B;  4YJ2 E;  1UCU A;  1FJG T;  4ZI3 C;  3ALL A;  4EGW A;  2NP9 A;  1WLX A;  1FOH A;  5AQV B;  1H7C A;  4IRE A;  5LMU T;  5HWX A;  2A3D A;  4DMV A;  2JRK A;  2QVA A;  5HXI A;  4IIJ E;  2BK4 A;  2XQY A;  3T31 A;  2ZLY A;  3QC9 A;  3UUL A;  1RUH 4;  3J8F 4;  5J7X A;  2CHO A;  2UU9 T;  2VRM A;  2XVH A;  2IAK A;  1NAA A;  2DNX A;  4IGU A;  2C0S A;  4BJY A;  1Q1W A;  4YTP A;  3FZK B;  2E9X D;  2LM2 A;  4NPP A;  5CQF A;  2DKI A;  4H7U A;  2PJQ A;  4CN4 A;  3JCF A;  3TLU A;  5IWA T;  4A5L A;  4ZN0 A;  4Y4M A;  2RR1 4;  1TDK A;  2V8S V;  2XHE B;  3T2K A;  1GRB A;  5FP3 A;  4MLK A;  2WES A;  1Z6L A;  5HYA A;  1BR1 A;  4LF6 T;  3RQU A;  2NOX A;  3FHN A;  5KX5 E;  4A9W A;  3V3N A;  2UXX B;  4HN9 A;  1K4Q A;  2EQ8 A;  2BXR A;  3DH9 A;  2DCF A;  4EMI A;  2OLN A;  2BDE A;  2X9H A;  5ADX L;  1D4C A;  3RI5 A;  3BK9 A;  1VBE 4;  3GDP A;  2A87 A;  3DME A;  2XZE A;  1ASJ 4;  4H4U A;  1QLB A;  2V7I A;  2I0Z A;  4GKK T;  4H2P A;  2I6H A;  2PHH A;  4U7I A;  2IC6 A;  2XQ8 A;  4ZI2 D;  1D7Y A;  4NTC A;  2YIN A;  3NNE A;  4U31 A;  5AQL B;  5LG4 A;  4UIG A;  4CN1 A;  2CBJ A;  4ERR A;  3PJA J;  4DR3 T;  1XMO T;  1E39 A;  3GN5 B;  2JQH A;  2YG3 A;  3UOX A;  2LM9 A;  4GDP A;  1W0A A;  4H50 A;  3UUM A;  3DJB A;  2DLR A;  3I6D A;  1YD8 G;  2W63 A;  1FL2 A;  2XQ9 A;  5JR9 A;  2PYJ A;  4ANJ A;  2WP9 A;  3FPZ A;  4GAV A;  4AKI A;  3UKA A;  4X66 T;  4K22 A;  1L9E A;  2X99 A;  2V6O A;  2YG5 A;  5CKU A;  3HYX A;  2AQJ A;  4CZZ B;  2EQ9 A;  3BNU A;  2BS2 A;  2A2F X;  4QXC B;  1ZHC A;  2VK9 A;  2YR6 A;  3AEC A;  2HHH T;  2XAG B;  3ETV A;  1M7K A;  4YSH A;  3QK6 A;  3VRD B;  1WFD A;  5C2T A;  4DV4 T;  4JN9 A;  4BJN A;  5BUL A;  4TX5 A;  1SEZ A;  2YU1 A;  3QSM A;  4QHO A;  5FXZ A;  4CQI A;  4O5U A;  3UTE A;  1KF6 A;  2VKD A;  3TLT A;  4WZX A;  1DOD A;  2VKO A;  3MAC A;  3ZYK A;  2PYX A;  4DR6 T;  1DXL A;  4UF0 A;  1KNR A;  2C70 A;  5JDQ A;  2JQ9 A;  2VVN A;  1SHZ C;  4EZ4 A;  2YLW A;  3AD7 B;  4AOS A;  5U1O A;  4ECH A;  1KNP A;  2LHR A;  3KKJ A;  1S3B A;  4N9X A;  4O2A E;  2C72 A;  2DKH A;  4XZC A;  2X3N A;  3ZN0 B;  1GSN A;  2C3D A;  3GQK A;  2WPC A;  2E5L T;  3HI2 A;  4IDZ A;  3RLF F;  4CCQ A;  3ZYL A;  4YSY A;  2LSG A;  4RSL A;  4TM3 A;  2LFC A;  3T14 A;  4B64 A;  3AE9 A;  1GRF A;  1RSG A;  2PW9 A;  3AVS A;  4CI3 B;  3AED A;  3LK2 B;  3CVR A;  4NUU A;  2XM1 A;  1HS7 A;  3NKS A;  2BK3 A;  4P09 A;  3D0T A;  1XWM A;  4C77 A;  4HWF A;  1ZX9 A;  2XAF B;  1Y01 A;  3NK2 X;  3CK6 A;  1YW0 A;  3CX6 B;  2FUP A;  5FYM A;  2HPJ A;  4HWH A;  2Y6Q A;  3GD3 A;  2XM2 A;  2XFO A;  3KA7 A;  2R0C A;  1X9B A;  2G0U A;  3Q9D A;  1LV0 A;  1OED E;  1H7X A;  2R07 4;  3N2K E;  5EK4 A;  3K7Q X;  1G8X A;  3UQ4 A;  1D5T A;  3ICS A;  2X5I D;  1KK7 A;  5JDM A;  3AA6 B;  2V7J A;  4A79 A;  1WCR A;  2WPF A;  3NGC X;  1B7T A;  5KOX A;  1NHS A;  1PXB A;  1WR6 A;  2XSB A;  2VVS A;  2VB6 A;  4WBN E;  5ABF A;  5E0O A;  4EQW A;  5HEG A;  3AE4 A;  5FY7 A;  3NN6 X;  2HWC 4;  4A98 A;  4JNQ A;  2R06 4;  2CMR A;  3HKD E;  4IE0 A;  2XFP A;  1XMQ T;  5FMN A;  2WU2 A;  4TWD A;  3CGD A;  3GMI A;  3CN8 A;  2BKN A;  2D0T A;  4A6N A;  4Q4X 4;  1COV 4;  3RNM A;  3O1I A;  4QX7 B;  5JCI A;  4L0R A;  4AIU A;  4JBW F;  3NTD A;  3OBV E;  4TWH A;  4HFH A;  1FMV A;  2JB1 A;  4EED A;  3L09 A;  2E1M A;  2WU5 A;  1H86 A;  4U8N A;  4PAB A;  2R46 A;  5LP6 E;  2YAU A;  4EM3 A;  4MBQ A;  5DQV A;  4II3 A;  4X1I E;  5FKY A;  3IA3 A;  1JU2 A;  2YVF A;  4JV5 T;  1XNR T;  5LHI B;  2UZZ A;  2QA2 A;  3JC6 D;  4E7S A;  4AT2 A;  2XPK A;  1K0J A;  1XAN A;  4X5T A;  3UU5 A;  3FZF B;  3ATR A;  2VQ7 A;  2LJL A;  4PJM A;  5AQI B;  4ZEY A;  1L0V A;  1EZ3 A;  1I6Z A;  3H37 A;  1OED B;  3EDV A;  4CXY A;  2W66 A;  1HNZ T;  4G73 A;  1L9C A;  1XHC A;  3RKG A;  3QSE A;  4FK1 C;  4IVO B;  2V7M A;  1LPF A;  4QH5 A;  3ISH A;  3P4R A;  5GSN A;  4ILC A;  3IF9 A;  3LBX A;  3ONL C;  3BI2 A;  4NTD A;  2XJ7 A;  2BS3 A;  4BJM A;  3PS9 A;  1GRH A;  1ZOV A;  4CY6 A;  1VOM A;  2I0M A;  2W4X A;  4J56 A;  2GAG B;  1T98 A;  3VRA A;  2C73 A;  1OWA A;  2CHN A;  3V5U A;  4KUM B;  2B9Y A;  4B65 A;  1IUT A;  2RAB A;  5AQT B;  2M67 A;  5FY1 A;  1Z8U A;  1EBD A;  3VHL A;  1N1P A;  1IUU A;  4CRT A;  3G5S A;  3EI0 A;  5KXJ A;  4UXN B;  4LU6 A;  3SZW A;  2IC9 A;  2NW8 A;  3ZDN A;  4AP3 A;  4PAA A;  1GRG A;  1Z7S 4;  5AQO B;  3M3Z B;  5FY0 A;  4P1N A;  2VQF T;  1ZY8 A;  4AKR B;  2ARD A;  2GEW A;  1HCI A;  2W67 A;  3ZKR A;  4GB3 4;  4PK4 A;  4FI5 A;  3S5W A;  1OOP D;  4A5X A;  3BHK A;  1BGJ A;  5AQR B;  3RC8 A;  4IA5 A;  2BVL A;  2BC0 A;  1HR0 T;  1EL8 A;  2KWI B;  4MHC A;  5LG3 A;  1S3E A;  4DUY T;  4HFC A;  2X0H A;  3CNT A;  5CB4 E;  4ICY A;  2YLZ A;  4QWN B;  2H3R A;  4G74 A;  2XAJ B;  2V5Z A;  1GND A;  3HYV A;  2YG4 A;  4NWZ A;  1GOS A;  3AE3 A;  4WYV A;  4X20 E;  3QB5 A;  5LBQ B;  3K3N A;  4ILB A;  2C64 A;  4QH1 A;  1GAL A;  4HTE A;  4LML A;  4K7Z A;  3ATQ A;  5EB4 A;  1OXZ A;  3SS1 A;  1CHU A;  3KFW X;  4UDR A;  2ZZB A;  4Z2R A;  4YTM A;  3M12 A;  2GMH A;  2RMU 4;  3U78 A;  3RPU A;  5C8Y E;  4BK1 A;  1PVC 4;  3R6N A;  4HEA A;  2L8K A;  4HA6 A;  4EMJ A;  2BC1 A;  4YXD A;  1S94 A;  2H88 A;  3UU4 A;  4H63 H;  3LDQ B;  3EPT A;  5IPY A;  1XDI A;  4MFR A;  5LCY A;  1CBO A;  4U8J A;  5H6Q B;  4B68 A;  3UUB A;  5AQS B;  2BA9 A;  4HFI A;  3QSS A;  5HEU A;  3P7I A;  4YHH T;  1EL5 A;  1GPE A;  1XZY A;  1ZDL A;  3F8D A;  4H4P A;  1VDC A;  5TAO A;  4CY8 A;  4JLE A;  4H4R A;  4X4J A;  2SPC A;  1HFA A;  4PNI A;  5DBJ A;  3RED A;  1NA1 D;  2C5J A;  1E1N A;  5JRE A;  3NBX X;  5AQH B;  4TM1 A;  3RKO A;  1NDA A;  3L3P A;  3ZLI A;  1CC6 A;  4H4Q A;  2C67 A;  3ALM A;  1GRT A;  3GWH A;  4DR7 T;  1GRE A;  1TRB A;  2OAM A;  4N78 D;  2L3L A;  4ZI3 D;  3AA0 B;  4TM0 A;  4Z2T A;  2EHO D;  4IVM B;  4IDQ A;  3GD4 A;  3LSV A;  2GR0 A;  5KVH A;  2OA5 A;  4U8I A;  2JPF A;  3CPJ G;  3IEE A;  1XHZ A;  2M6I A;  1K5M D;  3UKL A;  3IHG A;  2LSI A;  4O2B E;  3SM8 A;  1FIO A;  4JEU B;  3H4K A;  2H89 A;  4H9Q C;  1N36 T;  2X8G A;  3KU9 A;  2MOZ A;  5IQ1 A;  2YR4 A;  1AOG A;  4C3X A;  1RUC 4;  3AYJ A;  5KMR A;  3L1R A;  4YT0 A;  4XWR A;  2MTQ A;  2AXD S;  4MAL A;  2XCG A;  4B66 A;  5J60 A;  2CXD A;  2WZI A;  5BR8 T;  1NAF A;  4K5S A;  5LJN A;  4LFC T;  2VKH A;  2XQ4 A;  1FEW A;  3P8C D;  3P50 A;  2E5V A;  3SFE A;  2WP5 A;  3O1H A;  4GF7 A;  1D4M 4;  4YFS A;  2Q6U A;  3C51 A;  1Y56 B;  1XNQ T;  4OYK A;  3KV9 A;  1JRX A;  1PBB A;  4OFZ A;  1AR8 4;  3AB1 A;  3LJC A;  2Q0K A;  1HYU A;  3T2Z A;  5JCK A;  3I1A A;  3ZMZ B;  2H7O A;  3Q9T A;  4BK2 A;  3N9M A;  1AL2 4;  3MK7 C;  1TDF A;  2XVJ A;  3N9L A;  2CA5 A;  1VBB 4;  1P2E A;  1AR6 4;  3E08 A;  4QH4 A;  3GYX A;  3ZT6 A;  2GAH B;  5CA0 E;  1VRB A;  4DID B;  5IUX A;  2QCU A;  1RUD 4;  4ZXL A;  3TLS A;  4EEB A;  2JQQ A;  4TNV A;  5FL0 A;  4JY2 A;  3UOV A;  4GKJ T;  2DHR A;  3ANW B;  1OJC A;  1HRV 4;  4FDC B;  3GA8 A;  2WMO A;  3OJA A;  2X68 A;  1RP0 A;  4JI0 T;  5A1L A;  2BAB A;  3ZYX A;  2YM1 A;  3UU6 A;  3SYI A;  4A56 A;  1NEN A;  3RQW A;  2WOV A;  1VCT A;  3PUG A;  2OV9 A;  4XAX B;  2XTL A;  2LRL A;  3KVE A;  3CGB A;  2BKP A;  4DV0 T;  5FVK A;  4HWC A;  3CTY A;  1DU2 A;  1SUM B;  5HEH A;  5AQG B;  4GYR A;  2YEV C;  4QXH B;  2JK6 A;  1VBA 4;  1FMW A;  2GV8 A;  3RRW A;  2XQ5 A;  2RS5 4;  4AQF A;  4PJJ A;  5HXR A;  4H9R C;  2X9Y A;  3O1J A;  2C75 A;  3UKP A;  3EAB A;  4UVA B;  3WI3 A;  2E9X A;  2Q9Q B;  1GXF A;  1DNC A;  2LSY A;  4PFP A;  1HNX T;  2ZM6 T;  4HWI B;  4U8L A;  1D1B A;  3AD8 B;  2K48 A;  3L8R A;  1DJN A;  2NTX A;  2X50 A;  4WW0 A;  4E7Z A;  3OKQ A;  3PUX F;  4LF8 T;  1PHH A;  1RUE 4;  3AE2 A;  4AQF C;  2BRA A;  3SUC A;  1LQU A;  4JI4 T;  1M62 A;  3EAO A;  5J2U E;  4OVI A;  2ODV A;  3H3A A;  4HKA A;  5KMP A;  3RYC E;  4NNJ A;  3Q5X A;  1YKJ A;  3U3I A;  2ODU A;  1UKV G;  4I55 E;  3EDU A;  1AR7 4;  4PFO A;  3RHW A;  5JDL A;  3LZX A;  3KBT A;  2J3N A;  4XBF B;  2KT9 A;  3AXJ B;  1LVF A;  5KMQ A;  3Q5D A;  2DWK A;  3FG2 P;  3JAD A;  2E2A A;  1ZV4 X;  3J7Y q;  4DR4 T;  5C3J A;  1TDN A;  3M65 A;  3Q6J A;  2OLT A;  2VRL A;  2R4J A;  3ZMU B;  2VZ2 A;  5M0Z A;  4H4S A;  3NYC A;  4K5R A;  3UP4 A;  3HA4 A;  4CBQ A;  2BRY A;  4XXG A;  1V59 A;  4G6G A;  1KDG A;  3N2G E;  3VKH A;  4GK5 E;  2YQU A;  3RGL A;  3KIN B;  2Y6X A;  2V7L A;  2GF3 A;  2VQB A;  2CWY A;  4CI2 B;  3ZMS B;  1GV4 A;  2JB3 A;  3CQG B;  5JRC A;  4NXN T;  2WAU A;  2QGS A;  1E1M A;  5L3D B;  4D03 A;  2WBA A;  3LZW A;  1G73 A;  2LT3 A;  4ZCC A;  3GQH A;  3AEE A;  2CLY C;  2W00 A;  2R45 A;  4M1P A;  1J5W A;  1PJ6 A;  4FJO A;  2XQ6 A;  3KVA A;  5EZY E;  4G6H A;  3OYX A;  1JNZ A;  4YTN A;  1LVL A;  2BXS A;  3AE7 A;  4UVB B;  1XHX A;  2KND A;  3PUZ F;  1N33 T;  3KPK A;  1E1K A;  2WOW A;  2B7R A;  2X66 A;  1TDE A;  5LYJ E;  3QJ4 A;  5HXE A;  1IAP A;  4DV2 T;  4IL4 A;  2MYS A;  5JDH A;  4B69 A;  1T8B A;  2W61 A;  4TV9 E;  4B3R T;  1RUI 4;  4DUZ T;  3FXD B;  1LTX R;  4L5G A;  2DWG A;  2YU2 A;  3KV6 A;  1TYT A;  4J2C A;  2JJ9 A;  1ZKQ A;  1NG4 A;  3ZST A;  1GT8 A;  5JCL A;  1M64 A;  3A5X A;  4OYJ A;  2V5D A;  4U7Y A;  3C4N A;  5LHH B;  2VL0 A;  4U2Y A;  3PUW F;  3AYI A;  4GUV A;  3PUY F;  2CDU A;  2KIN B;  3NKZ A;  3ONJ A;  2D5U A;  3T8O A;  1NHQ A;  2IUB A;  3CX8 B;  3ICR A;  3F2E A;  3DJG X;  3Q2M A;  1W9R A;  2CM0 A;  2GR3 A;  5KMS A;  3E22 E;  3QVR A;  1O5W A;  4AI6 A;  4J33 A;  2E8I A;  4G2A A;  4X9M A;  2Q9Q D;  2XVF A;  1OED A;  2FJE A;  4TUY E;  5F3J A;  5FS9 A;  3UKH A;  3QVP A;  2X51 A;  3DJE A;  2V3A A;  2FJB A;  3UTH A;  1UX4 A;  4F6R C;  5FXW A;  3DK9 A;  3DJD A;  4JUY A;  3CGC A;  4U74 A;  1UK5 A;  1XI1 A;  2CCQ A;  2CPT A;  2WEU A;  2LLY A;  3UTG A;  2ACZ A;  3G5Q A;  3DTO A;  1TYP A;  3FZM B;  3MZK B;  3ZT7 A;  3LBX B;  2GQW A;  2C76 A;  1KFY A;  1MND A;  5LJM A;  4IE4 A;  3EHZ A;  5IHY A;  3LJP A;  4C91 A;  1B37 A;  2CVJ A;  2F5Z A;  4CXW A;  3LOV A;  3K8P C;  1BR2 A;  5L4E A;  1UUR A;  2APG A;  5KNL A;  4Z2U A;  2XQ7 A;  1Y64 B;  1W0B A;  3B13 A;  2XQ3 A;  2Z6E A;  5L47 A;  3ZCJ A;  5M10 A;  3RIA A;  2WY2 A;  4F8H A;  4AXP A;  1H81 A;  4B1B A;  3P4S A;  5EBK A;  2NW9 A;  3SZ0 A;  4ZS2 A;  5DJQ C;  4I58 A;  3AA1 B;  3LK3 B;  5CFB A;  4RG3 A;  3PVC A;  1J1J A;  2WWU A;  4H2N A;  4DBR A;  1ZP0 A;  3TLW A;  4L9I A;  2BG9 B;  2B7S A;  3CIR A;  2E4G A;  4JEH B;  4JNA A;  3NZQ A;  3RYF E;  3OZ2 A;  5LGU B;  3OTO T;  2VUR A;  4DV5 T;  2JBV A;  3ZYM A;  4OX9 T;  4H63 V;  2D0U A;  1SE7 A;  3HYW A;  5AFU L;  2PFV A;  4PJN A;  4U8K A;  3O0H A;  4K8D A;  3SX6 A;  3UTK A;  5HXS A;  1LVK A;  5FMH A;  3AEG A;  3JBG 4;  5HEJ A;  3RH3 A;  2XQA A;  3ZCI A;  4Y4N A;  4Z24 A;  5AQJ B;  5M4Y A;  4G9K A;  1N34 T;  3CPI G;  2HWB 4;  5HHF A;  1US7 B;  2EHO B;  2R6G F;  3N5L A;  1FEB A;  3C96 A;  2MBG A;  4CXX A;  2W0G A;  4JI6 T;  2LE8 A;  3GN5 A;  5LBM A;  1U5P A;  1WYC A;  5CA1 E;  3D8X A;  3QNU A;  3AE1 A;  4DSG A;  2J4G A;  3C4W A;  1AR9 4;  5L4H A;  1KSU A;  2B9X A;  2NPX A;  4U8M A;  4NEW A;  4TWF A;  5FXX A;  2MAW A;  1IUW A;  2Q7V A;  2V6Y B;  2GB0 A;  3A7M A;  2GR2 A;  2XFN A;  3NYE A;  4PAG A;  3IC9 A;  1ZKE A;  4OPT A;  4JI2 T;  2C4C A;  4OPU A;  3MJX A;  2XLS A;  3CNS A;  3NVO A;  2N9D A;  2TPR A;  1ZOY A;  1OJD A;  4ISS A;  3K7M X;  1OJT A;  2X8C A;  3MKD A;  2WET A;  2WBL A;  3PO7 A;  1EAH 4;  3NTA A;  2LKH A;  1LQT A;  3M13 A;  2LOP A;  1COY A;  2ZM8 A;  1YXR A;  3BNM A;  1YY5 A;  1EL9 A;  3P4W A;  3WAJ A;  1D0X A;  2YM2 A;  2C3C A;  4JI8 T;  1QUU A;  4HE8 A;  2UUA T;  4ASK A;  3UUN A;  3T37 A;  4GYS A;  1FEC A;  2V60 A;  3PUA A;  2PZS A;  2RS1 4;  3T1Y T;  4ZI7 E;  1PDH A;  3LK4 2;  5BVA A;  4U2L A;  3CX7 B;  3FBL A;  3NIX A;  4B3S T;  4PK6 A;  4AKG A;  5KWF A;  3QB5 K;  4LA1 A;  4O8S A;  3B5M A;  4GK0 E;  2RA1 A;  4YSX A;  3Q5W A;  1RUJ 4;  2JMH A;  5ABG A;  1RVF 4;  2CUL A;  1POV 0;  2RGO A;  3G5R A;  3RHA A;  5AQN B;  2VOU A;  4DMW A;  2KZ7 B;  2LEH A;  1N4W A;  4EYY R;  1E6E A;  3BQL A;  2ZZC A;  1BZL A;  4Q4W 4;  4KMC A;  4DND A;  5FS6 A;  3QOF A;  2CBI A;  4H4V A;  5L3C B;  2XAS B;  2CEA A;  1CC4 A;  2V61 A;  1BR0 A;  4IDO A;  4ADZ A;  5JTG A;  2YDS A;  2IDO B;  1ZK7 A;  3KDS E;  1MO9 A;  5JVD E;  5CJ5 A;  1PS9 A;  3PUR A;  1Q9I A;  3I9W A;  3K30 A;  4H4Y A;  4EM4 A;  2N1G A;  2UUC T;  1JEH A;  3GRT A;  1YQ4 A;  5KVI A;  5LHG B;  2P9B A;  1MMG A;  2NR4 A;  3WAK A;  1RHI 4;  3PTR B;  3AAE B;  4IV9 A;  5ABH A;  2A8X A;  3NHO X;  4OPC A;  3PU8 A;  3CNP A;  1D1A A;  3LG7 A;  4II2 A;  3C64 A;  1PIV 4;  3SWH A;  3CKD A;  4BAY B;  4PW8 A;  2XLU A;  4LMK A;  3AVR A;  2RS3 4;  1DOE A;  4REK A;  4UDP A;  4PK5 A;  1H84 A;  4AP1 A;  3RP6 A;  2VVM A;  2Z5Y A;  4J36 A;  1D0Y A;  1VQW A;  2XFQ A;  5AQK B;  2QA1 A;  2VKJ A;  4Z91 A;  4H4W A;  3IF8 B;  3AE5 A;  3KVB A;  3D1C A;  3AEA A;  1H82 A;  4EYU A;  2W0H A;  4A6N B;  2KXP B;  5JDF A;  2OAL A;  3C98 B;  2E9X B;  3AD9 B;  3K3Q C;  3A8Y C;  2YLX A;  2A9U A;  2IID A;  2ZZ0 A;  4H4T A;  3DGH A;  3E0Z A;  4IE5 A;  5BMV E;  3VKG A;  2WMN A;  4FK1 A;  3H8L A;  1KNZ A;  4RHV 4;  2R0G A;  2F4V T;  2L9Q A;  2W62 A;  4DNA A;  4EIP A;  5JR9 B;  2EHO C;  3NRY A;  2CFY A;  1CJ2 A;  1PJ5 A;  4KX6 A;  4B6X A;  4ZI2 C;  4X1K E;  2XLT A;  3VRB A;  4A7A A;  2X9W A;  1GTE A;  2CRB A;  4GRT A;  4J34 A;  5JCN A;  3H8I A;  4H2R A;  1D0Z A;  5HYM A;  2PTF A;  4BJZ A;  3RC3 A;  3JAF A;  4X62 T;  4Q4Y 4;  2WP6 A;  2EX3 A;  2BK5 A;  2C65 A;  3RIU C;  4KP3 C;  2YDR A;  4O5Q A;  4JI7 T;  4AQY T;  4U2Z A;  4APN A;  3DK8 A;  4H9N C;  1E1L A;  3DA1 A;  4NIQ A;  3NG7 X;  1NWM X;  4U8P A;  3FB2 A;  2C66 A;  2A89 A;  5CGM A;  3B57 A;  3IWA A;  3I0O A;  4Q25 A;  4RG4 A;  4IL9 A;  4O4I E;  3AA7 B;  4QKN A;  4U8O A;  2K24 A;  3GWF A;  4U2T A;  4ZZB A;  4HWD A;  3UTF A;  3CPH G;  3V3O A;  2X0Y A;  1WYB A;  3RIU A;  2VQE T;  1PN0 A;  2WPE A;  4E0V A;  3FMW A;  4GOU A;  2A72 A;  2JQK A;  4HFV A;  2V1D B;  3C4Z A;  2GR1 A;  1ZMC A;  2XFU A;  2TMD A;  1PO2 4;  1X31 B;  1M6I A;  3K1S A;  5J1G A;  5LGT B;  4U33 A;  1HX1 B;  4HFE A;  5LA6 E;  4ADW A;  3KPF A;  2HPL A;  2Y6R A;  3T0K A;  1B4V A;  2ACX A;  1FEA A;  1RUF 4;  3P4P A;  3M0O A;  1PBD A;  1MQT D;  1GET A;  3F8R A;  2PY5 A;  4V1A v;  5EK3 A;  4GCM A;  1QO8 A;  1PBF A;  3CWZ B;  5L3F B;  4CN6 A;  3BQK A;  4KHP T;  2LKG A;  3EVY A;  3PV0 F;  4EAH A;  3AWI A;  4X1Y E;  3HR0 A;  4WNK A;  1E2A A;  4O4J E;  2XLR A;  4COF A;  1BWC A;  4P0B A;  2K5B B;  4C5O A;  5J0Z A;  2Z5X A;  3UKF A;  3ITJ A;  5FS7 A;  3JC6 C;  4CNK A;  4TZ4 C;  1R08 4;  3I9Y A;  1E7P A;  1RUG 4;  4UR9 A;  4EOZ B;  3RP7 A;  2GRT A;  2R04 4;  4B63 A;  2VVL A;  3UU3 A;  2YVJ A;  5JDN A;  1YQZ A;  2E9X C;  3CQX C;  3EF6 A;  5TR3 A;  3SQP A;  3BHF A;  2YG7 A;  3FBZ A;  4OPD A;  3GMB A;  3G06 A;  1LJ1 A;  1VG9 A;  2CE7 A;  1HTJ F;  2BG9 E;  5KDM C;  2R4E A;  5JCM A;  4IE7 A;  4J31 A;  3ETU A;  2YR5 A;  5HXH A;  1XPQ A;  3LAD A;  1GTH A;  4I4T E;  1VBC 4;  2BZB A;  2ZMA A;  4UEM A;  4YHJ A;  2XAH B;  1CJC A;  1Q1R A;  2J1D G;  3S61 A;  2GK9 A;  1HG5 A;  3B3R A;  2BCP A;  4DO0 A;  3F31 A;  1KSS A;  3DGZ A;  1F6M A;  1KEY A;  4YJ3 E;  1W09 A;  3AEB A;  3VR8 A;  1PXA A;  3N9N A;  5FVL A;  4G63 A;  4HGA A;  4YY3 T;  4PDW D;  1H6V A;  2BBH A;  3URH A;  4IE6 A;  3PUQ A;  3FBS A;  4Y4L A;  5KMG P;  3VU7 H;  4EZH A;  3RIF A;  2NVK X;  1LRZ A;  3NK0 X;  3PUV F;  5L3E B;  3CQC B;  4H9P C;  4ILA A;  4HFD A;  3FIM B;  1MOK A;  1OED C;  3ZEF B;  2O9Z A;  1HF8 A;  2Q9Q C;  4UEL A;  2WHD A;  3LFM A;  5IYZ E;  2GMJ A;  4YKG A;  2XVI A;  2ES0 A;  3SGL A;  1O3X A;  2IHR 1;  1HNW T;  2YKS A;  3AAI A;  2XDO A;  3ZC1 A;  3P4Q A;  3UKK A;  2Y48 B;  1F8R A;  2GVC A;  5IQ4 A;  3QUJ A;  1YKH B;  2WS3 A;  4H9S E;  2YLR A;  1BKW A;  1IJ5 A;  2V3B A;  5HEO A;  2C5I T;  2FBW A;  1R8I A;  1XDO A;  1MIW A;  5AQM B;  3CGE A;  1D7L A;  5AQP B;  3B6D A;  1Z0P A;  1J5E T;  4DV3 T;  1D4D A;  4NZH A;  3UOY A;  4JDR A;  1PO1 4;  4LII A;  1N4V A;  1IBM T;  2B9W A;  2ZM2 A;  4O4H E;  3EUH A;  2N2N A;  1GER A;  1BR4 A;  4Z44 A;  2CXL A;  4DSH A;  2WB5 A;  4EIQ A;  3GMC A;  4MJW A;  4KHZ F;  3K3O A;  1UUS A;  1IBK T;  1Y56 A;  3GDN A;  3WE0 A;  4DGK A;  1GRA A;  2UXD T;  5LGN B;  1QSD A;  5HCJ A;  4XWZ A;  4I0U A;  3C4X A;  3FZH B;  1LKX A;  3C50 A;  2VAS A;  3E1T A;  5EOW A;  3PJA A;  2C5K T;  2DI4 A;  3CPZ A;  2AAQ A;  2X0L B;  4P0A A;  2QRX A;  3RYI E;  2XY8 B;  4DVD A;  3IHR A;  3NWI A;  1DJQ A;  3KLJ A;  4JI3 T;  3ICT A;  4Z8X A;  3DJJ A;  3NRN A;  3ANW A;  4H2Q A;  2BAC A;  4B3T T;  4U3C A;  2R9Z A;  3T1H T;  1X79 A;  4C74 A;  1E1H B;  5LXT E;  4EQS A;  4EQR A;  1B5Q A;  3ZJ1 A;  2MPK A;  4DR1 T;  2GH5 A;  3I3L A;  3ZPO A;  4Q4V 4;  1O94 A;  4UDQ A;  1L9D A;  1FCD A;  3DK4 A;  3CML A;  1P2H A;  3AAA B;  1ELI A;  1HRI 4;  4IST A;  1S2Y A;  2V6Y A;  3ALJ A;  3UOZ A;  1H8T D;  3X1D A;  3F57 A;  3AYL A;  5HCM A; 
#chains in the Genus database with same CATH homology
 1COY A;  3V3N A;  2EQ8 A;  1DOC A;  1K4Q A;  4YT0 A;  2EQ7 A;  2BXR A;  3BNM A;  4YSZ A;  1YY5 A;  3DH9 A;  2IVE A;  4XWR A;  2OLN A;  1EL9 A;  4A99 A;  2XCG A;  4B66 A;  2YM2 A;  5J60 A;  2C3C A;  1D4C A;  3II4 A;  4K5S A;  4Z26 A;  3T37 A;  1NEK A;  3GDP A;  1CJ3 A;  2A87 A;  3DME A;  1FEC A;  2V60 A;  4USR A;  4X9N A;  2E5V A;  3SFE A;  2WP5 A;  3NYF A;  4GF7 A;  4H4U A;  1QLB A;  2Q6U A;  1K0I A;  1PDH A;  5BVA A;  1S2Q A;  2I0Z A;  4U2L A;  3NIX A;  4TLX A;  4H2P A;  1Y56 B;  2PHH A;  5KWF A;  1JRX A;  1PBB A;  4NTE A;  1H83 A;  3ADA B;  1D7Y A;  3AB1 A;  2YLS A;  4LA1 A;  4NTC A;  2Q0K A;  1HYU A;  5KOW A;  3NNE A;  3T2Z A;  5JCK A;  4YSX A;  4UP3 A;  3Q9T A;  1CF3 A;  4BK2 A;  3GRS A;  4OPG A;  3SFD A;  2CUL A;  2RGO A;  3G5R A;  1TDF A;  2XVJ A;  2RGJ A;  1E39 A;  2VOU A;  3RHA A;  1B8S A;  3SY4 A;  3UOX A;  1N4W A;  2YG3 A;  1F3P A;  1P2E A;  4GDP A;  5BRT A;  3L8K A;  4H50 A;  3GYX A;  1E6E A;  3VR9 A;  2GAH B;  3I6D A;  2ZZC A;  1BZL A;  1FL2 A;  1IUS A;  2QCU A;  1DOB A;  3R9U A;  3CND A;  4JY2 A;  5FS6 A;  3UOV A;  1OJC A;  2WP9 A;  4H4V A;  4FDC B;  1CC4 A;  2V61 A;  3FPZ A;  4GAV A;  3UKA A;  4J57 A;  1RP0 A;  4K22 A;  1L9E A;  2WDV A;  1GEU A;  2BAB A;  3ZYX A;  1ZK7 A;  2V6O A;  2X99 A;  2YG5 A;  2YM1 A;  4H4X A;  5CKU A;  3SYI A;  1MO9 A;  3HYX A;  2AQJ A;  1NEN A;  1PS9 A;  2WOV A;  1Q9I A;  2EQ9 A;  4HB9 A;  3K30 A;  3NN0 X;  3BNU A;  3NH3 X;  4H4Y A;  4EM4 A;  2BS2 A;  1JEH A;  3KVE A;  3GRT A;  3CGB A;  2JB2 A;  1REO A;  3CTY A;  1YQ4 A;  5KVI A;  2YR6 A;  4BK3 A;  3HZL A;  2FJA A;  4BUR A;  4IV9 A;  2ZBW A;  2A8X A;  3AEC A;  3NHO X;  4OPC A;  2JK6 A;  3CNP A;  4YSH A;  4II2 A;  3VRD B;  2GV8 A;  1NHP A;  5C2T A;  4JN9 A;  2XLU A;  5BUL A;  3GYI A;  1SEZ A;  3UTE A;  3QSM A;  2C75 A;  1NG3 A;  1DOE A;  2X8H A;  4O5U A;  1KF6 A;  1H84 A;  3CNJ A;  4REK A;  1DOD A;  2VVM A;  2Z5Y A;  4J36 A;  3RP6 A;  1VQW A;  1ONF A;  1GXF A;  1DNC A;  2PYX A;  2XFQ A;  1W4X A;  1DXL A;  2QA1 A;  1KNR A;  4U8L A;  4H4W A;  2C70 A;  2XVE A;  4EMW A;  3AD8 B;  1PBC A;  1DJN A;  2X50 A;  3AE5 A;  2YLW A;  3AD7 B;  3D1C A;  2C7G A;  4AOS A;  3AEA A;  1H82 A;  5U1O A;  4ECH A;  1KNP A;  3BI5 A;  3KKJ A;  1S3B A;  2W0H A;  1PHH A;  4IA6 A;  4N9X A;  4A6N B;  4I59 A;  3AE2 A;  1EL7 A;  2C72 A;  2BRA A;  3SUC A;  1LQU A;  2DKH A;  2X3N A;  2OAL A;  4P9S A;  1GSN A;  1YQ3 A;  2C3D A;  3EAO A;  4OVI A;  3GQK A;  4USQ A;  5KMP A;  4NNJ A;  2WPC A;  3AD9 B;  3BI4 A;  1YKJ A;  2YLX A;  2ZZ0 A;  2IID A;  4H4T A;  4CCQ A;  4YSY A;  3DGH A;  1UKV G;  1BGN A;  4RSL A;  2JKC A;  4TM3 A;  2LFC A;  3T14 A;  4B64 A;  4FK1 A;  3H8L A;  2R0G A;  3AE9 A;  3SZF A;  2WDR A;  1GRF A;  3UP5 A;  4DNA A;  4EIP A;  1RSG A;  3LZX A;  2YG6 A;  3AED A;  4WCT A;  3V76 A;  2J3N A;  2OA1 A;  2CFY A;  3GWD A;  3NKS A;  3NLC A;  2BK3 A;  1CJ2 A;  1PJ5 A;  5KMQ A;  3L1R A;  4KX6 A;  4K2X A;  2XLT A;  3VRB A;  3FG2 P;  4A7A A;  4H4Z A;  1GTE A;  5C3J A;  1TDN A;  3C4A A;  4C77 A;  4GRT A;  4J34 A;  1ZX9 A;  3H8I A;  3Q6J A;  4H2R A;  5JCN A;  5U63 A;  1NPX A;  2VRL A;  3NK2 X;  5HYM A;  4BJZ A;  2R4J A;  2VZ2 A;  5M0Z A;  4H4S A;  5FS8 A;  2WP6 A;  4OPL A;  3NYC A;  4K5R A;  3UP4 A;  2BK5 A;  2C65 A;  2Y6Q A;  3GD3 A;  2XFO A;  2BCG G;  3KA7 A;  2R0C A;  4O5Q A;  1LV0 A;  1H7X A;  4CBQ A;  2BRY A;  4XXG A;  1JRZ A;  3K7Q X;  2YVG A;  4APN A;  1CJ4 A;  1D5T A;  1V59 A;  3DK8 A;  3ICS A;  3DA1 A;  1E1L A;  3NG7 X;  1KDG A;  4G6G A;  2BS4 A;  4U8P A;  4YWO A;  4OPI A;  2C66 A;  2YQU A;  2A89 A;  3OC4 A;  4FX9 A;  4A9W A;  3IWA A;  2YWL A;  4A79 A;  2WPF A;  4RG4 A;  4KPR A;  2GF3 A;  2VQB A;  2QAE A;  3NGC X;  5KOX A;  1NHS A;  1PXB A;  1RYI A;  4U8O A;  5GRT A;  1JRY A;  3CMM A;  3GWF A;  1GV4 A;  4U2T A;  2JB3 A;  4EMI A;  4EQW A;  3UTF A;  3CPH G;  3AE4 A;  3NN6 X;  3V3O A;  1E1M A;  1D4E A;  4D03 A;  2WBA A;  1PN0 A;  1JNR A;  3LZW A;  1OJ9 A;  1TDO A;  2WPE A;  3KD9 A;  4JNQ A;  3FMW A;  2XFP A;  1CL0 A;  4M52 A;  4ZCC A;  4E0V A;  3EAN A;  1F8S A;  3GQH A;  2GR1 A;  2WU2 A;  3AEE A;  1ZMC A;  2XFU A;  2VVL G;  3CGD A;  2R45 A;  2TMD A;  3CN8 A;  5U25 A;  1PJ6 A;  4A6N A;  2B76 A;  1X31 B;  1M6I A;  4ZCD A;  3RNM A;  4C3Y A;  2Q0L A;  3F8P A;  1IJH A;  1MXT A;  4G6H A;  4Z43 A;  4ADW A;  5JCI A;  1JNZ A;  3KPF A;  4YTN A;  2Y6R A;  3P1W A;  1LVL A;  3T0K A;  2BXS A;  3AE7 A;  3NTD A;  1B4V A;  2YLT A;  1FEA A;  4A65 A;  3KPK A;  2JB1 A;  3P4P A;  3M0O A;  4OCG A;  1E1K A;  1PBD A;  2WOW A;  2E1M A;  2WU5 A;  1H86 A;  1GET A;  2B7R A;  3F8R A;  4U8N A;  2XLP A;  4PAB A;  1TDE A;  2R46 A;  2YAU A;  4EM3 A;  3QJ4 A;  4GCM A;  1QO8 A;  1K0L A;  4II3 A;  1PBF A;  2JAE A;  4B69 A;  1JU2 A;  2YVF A;  3AWI A;  1LTX R;  3K7T A;  1TYT A;  1ZKQ A;  2UZZ A;  1NG4 A;  2QA2 A;  1GT8 A;  2XLR A;  2WOI A;  5JCL A;  1M64 A;  1BWC A;  1K0J A;  4AT2 A;  4C5O A;  1XAN A;  2Z5X A;  4WX1 A;  3UKF A;  3ITJ A;  5FS7 A;  3ATR A;  3C4N A;  4CNK A;  1CC2 A;  2VQ7 A;  3P9U A;  4GUV A;  3AYI A;  1E7P A;  1L0V A;  1IUV A;  1GES A;  2CDU A;  3RP7 A;  2GRT A;  1PXC A;  4B63 A;  2VVL A;  1NHQ A;  2YVJ A;  3ICR A;  3DJG X;  5LV9 A;  4GR1 A;  1YQZ A;  4G73 A;  3EF6 A;  3SQP A;  5TR3 A;  3AE6 A;  1L9C A;  2GR3 A;  3BHF A;  2YG7 A;  4GAP A;  5KMS A;  4D04 A;  4OPD A;  3QVR A;  1O5W A;  1XHC A;  1Y0P A;  1LJ1 A;  3GMB A;  4J33 A;  1VG9 A;  2OLO A;  3QSE A;  4FK1 C;  4IVO B;  1LPF A;  2R4E A;  5JCM A;  4X9M A;  4J31 A;  3ISH A;  3P4R A;  5GSN A;  2YR5 A;  3LAD A;  1XPQ A;  3IF9 A;  1GTH A;  3SZC A;  2XVF A;  3BI2 A;  4NTD A;  3T2Y A;  2FJE A;  1CJC A;  5FS9 A;  1JOA A;  3LB8 A;  1Q1R A;  3UKH A;  3QVP A;  2BS3 A;  3DJE A;  3IHM A;  3PS9 A;  1GRH A;  1ZOV A;  2HQM A;  2FJB A;  2V3A A;  4TM4 A;  3RP8 A;  3UTH A;  4CY6 A;  3B3R A;  2BCP A;  3DK9 A;  3DGZ A;  1KSS A;  3DJD A;  3CGC A;  1F6M A;  4J56 A;  3JSK A;  1OJA A;  2GAG B;  5IQ4 A;  3AEB A;  2WEU A;  5EB5 A;  3AEF A;  3VRA A;  3VR8 A;  1PXA A;  2ACZ A;  2C73 A;  3G5Q A;  3UCL A;  1TYP A;  3UTG A;  4B67 A;  4AP1 A;  2B9Y A;  4B65 A;  1IUT A;  2RAB A;  1NHR A;  2GQW A;  4GDE A;  1EBD A;  2C76 A;  4TLZ A;  1KFY A;  1N1P A;  4BV6 A;  1H6V A;  3LJP A;  1O95 A;  1B37 A;  2CVJ A;  1IUU A;  3URH A;  3G5S A;  4CRT A;  3FBS A;  4Y4L A;  5KXJ A;  1QJD A;  2F5Z A;  4LU6 A;  3SZW A;  2NVK X;  4EQX A;  3LOV A;  3UKQ A;  3ZDN A;  3GYJ A;  3NK0 X;  4PAA A;  1GRG A;  3ABV A;  4AP3 A;  2WDQ A;  2R0P A;  3FIM B;  1ZY8 A;  1MOK A;  2ARD A;  2BYB A;  2APG A;  3NT6 A;  2FJD A;  2GEW A;  5KNL A;  4Z2U A;  2O9Z A;  3S61 A;  3S5W A;  3VQR A;  2WHD A;  3BHK A;  1BF3 A;  5L46 A;  1BGJ A;  5BUK A;  2GQF A;  2BC0 A;  3QFA A;  4IA5 A;  2GMJ A;  4YKG A;  2XVI A;  3SGL A;  1EL8 A;  5M10 A;  3SXI A;  2XDO A;  1S3E A;  3P4Q A;  3CNT A;  4J2W A;  3UKK A;  4ICY A;  1F8R A;  2GVC A;  2IVD A;  2WQY A;  1H81 A;  3P4S A;  2YLZ A;  5EBK A;  2WS3 A;  4B1B A;  4G74 A;  3SZ0 A;  2YLR A;  1BKW A;  1H7W A;  2V3B A;  2V5Z A;  3QFB A;  2FBW A;  1GND A;  3HYV A;  2YG4 A;  4NWZ A;  1GOS A;  3AE3 A;  4UDP A;  4JQ9 A;  3CGE A;  4I58 A;  1D7L A;  4JY3 A;  2C64 A;  3B6D A;  1IUX A;  4RG3 A;  3LXD A;  1PBE A;  1GAL A;  3PVC A;  1D4D A;  4NZH A;  4K7Z A;  4AOX A;  1VG0 A;  3ATQ A;  4JDR A;  5EB4 A;  3UOY A;  4H2N A;  4Z25 A;  5KRQ A;  1ZP0 A;  4LII A;  1N4V A;  1CHU A;  2B9W A;  2B7S A;  2XYO A;  3CIR A;  4NEV A;  2E4G A;  4UDR A;  4AT0 A;  1GER A;  2ZZB A;  4Z2R A;  4YTM A;  2AR8 A;  2GMH A;  3M12 A;  4BK1 A;  4JNA A;  3AE8 A;  4Z44 A;  3OZ2 A;  4HA6 A;  4EMJ A;  4DSH A;  2BC1 A;  4YXD A;  2JBV A;  3GMC A;  4MJW A;  5ER0 A;  4EIQ A;  2H88 A;  3COX A;  3AXB A;  3EPT A;  4CNJ A;  5IPY A;  3HYW A;  3NK1 X;  1XDI A;  1PJ7 A;  2RGH A;  1CBO A;  1Y56 A;  2EQ6 A;  3GDN A;  4U8J A;  4YKF A;  1F8W A;  1GRA A;  1N4U A;  3WE0 A;  4B68 A;  4DGK A;  4U8K A;  2BA9 A;  3O0H A;  4K8D A;  4XWZ A;  3SX6 A;  3QSS A;  5FMH A;  3AEG A;  5HY5 A;  4Y4N A;  4CCR A;  3E1T A;  1EL5 A;  3GSI A;  1GPE A;  5EOW A;  4G9K A;  4Z24 A;  1ZDL A;  1ZMD A;  3CPI G;  3F8D A;  4U2S A;  2AAQ A;  5HHF A;  4H4P A;  1VRQ B;  1FEB A;  1VDC A;  3C96 A;  4CY8 A;  1DJQ A;  3KLJ A;  4H4R A;  4X4J A;  3D8X A;  3AE1 A;  3ALL A;  5DBJ A;  3ICT A;  4DSG A;  3RED A;  1E1N A;  1FOH A;  4TM1 A;  1KSU A;  2B9X A;  2NPX A;  3DJJ A;  1NDA A;  3NRN A;  1CC6 A;  4H2Q A;  5HXI A;  2BAC A;  2BK4 A;  4U8M A;  4H4Q A;  4NEW A;  3T31 A;  2C67 A;  3ALM A;  5J7X A;  1IUW A;  1GRT A;  2R9Z A;  2VRM A;  2XVH A;  1NAA A;  2Q7V A;  4C74 A;  1GRE A;  1TRB A;  4BJY A;  4EQS A;  2OAM A;  4EQR A;  1Q1W A;  2GB0 A;  4YTP A;  2GR2 A;  2XFN A;  3NYE A;  1B5Q A;  4TM0 A;  4Z2T A;  4IVM B;  3IC9 A;  3GD4 A;  2GH5 A;  2GR0 A;  3I3L A;  5CQF A;  2DKI A;  4OPT A;  4H7U A;  2C4C A;  4OPU A;  4U8I A;  5KVH A;  2XLS A;  1O94 A;  3CNS A;  4UDQ A;  1L9D A;  1FCD A;  2TPR A;  3CPJ G;  1ZOY A;  4A5L A;  1OJD A;  3UKL A;  3DK4 A;  4ZN0 A;  4Y4M A;  1TDK A;  3IHG A;  1P2H A;  1ELI A;  3K7M X;  3T2K A;  1OJT A;  1GRB A;  2X8C A;  3SM8 A;  1S2Y A;  2WES A;  1Z6L A;  2WET A;  3ALJ A;  2H89 A;  3H4K A;  2X8G A;  3PO7 A;  3UOZ A;  3KU9 A;  3AYL A;  5IQ1 A;  2YR4 A;  3NTA A;  3M13 A;  1LQT A;  3UKP A;  1AOG A;  4C3X A;  3AYJ A;  5KMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...