4YSYA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[(2,4-dichlorophenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 213
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ysyA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ysyA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ysyA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ysyA04
4E0VA 3AEAA 1DODA 1P2EA 2BC1A 5JCKA 4EQRA 2EQ6A 1FCDA 3I6DA 3C4AA 3NGCX 4U8JA 3UCLA 2C73A 3KA7A 5IPYA 1PS9A 1B5QA 1VQWA 1CJ2A 2VVLG 4AOSA 3CN8A 5HHFA 2YG7A 1ZP0A 2YG6A 4USRA 5JCLA 4TM4A 1NHQA 4U8NA 1IUUA 4U8IA 4YKFA 2XFPA 3AD7B 2YG5A 1JNRA 1LJ1A 3AE9A 3AEFA 4KX6A 2FJBA 1TRBA 2VRLA 3S5WA 3D1CA 2HQMA 1GTHA 2YR6A 4DSGA 3GMCA 4LU6A 2EQ7A 1GRAA 4GRTA 3ALLA 3DA1A 3QVPA 4H7UA 1DOCA 3AEEA 1O94A 4AP1A 4IVOB 3CTYA 4IV9A 4U2LA 4AP3A 4D03A 1TYTA 2RGOA 3FMWA 1D4EA 3UKKA 1IUTA 4O5UA 2JB2A 2A87A 2F5ZA 4U2TA 4B69A 1PXBA 1B37A 5EBKA 4Z26A 2YLSA 2B7SA 2R46A 1ZMDA 1LVLA 1S3BA 3NNEA 3C96A 2WOIA 3IHMA 1ZMCA 2V6OA 3L8KA 2WS3A 3KLJA 4BJYA 3K7MX 2X99A 2BACA 4C3YA 3AYIA 3UP4A 3UOYA 1MXTA 1ZX9A 3NKSA 4BV6A 3LZWA 1GERA 2YVGA 4KPRA 1NDAA 3AE4A 3PO7A 4IVMB 4K8DA 2WESA 1TDFA 4J56A 4J33A 3UKHA 2WQYA 1KDGA 3CGEA 2Q7VA 2WPCA 4H4PA 2WETA 4ZCDA 1M64A 3AE1A 1S2YA 2AR8A 2YM1A 4H4QA 1Q1WA 4JNAA 4EM3A 1PJ6A 3PVCA 2E4GA 3DGHA 3LB8A 1CL0A 3UTEA 4Z44A 4M52A 5C3JA 5JCMA 2NPXA 2APGA 3UOZA 4FK1C 5U63A 4OPLA 4U8LA 4A6NA 1XHCA 2QCUA 1ZDLA 1H86A 1ZOVA 3P4QA 3GD4A 3OZ2A 1B4VA 2WBAA 3GSIA 5GRTA 1OJTA 4A65A 3ZDNA 1X31B 3ABVA 2VZ2A 3CPIG 1D4DA 2XLRA 3P4SA 4BK2A 3B6DA 5EB4A 4A7AA 4B1BA 2W0HA 4OVIA 1GRGA 2BK5A 3NLCA 4NEWA 4EIPA 1PN0A 3CGDA 1GRBA 5BVAA 1GREA 3BI5A 1SEZA 4CRTA 2BA9A 2XFQA 3ALJA 5M10A 2ZZ0A 3F8RA 4GDPA 2CFYA 3AE5A 4EIQA 2B9XA 1LPFA 2PHHA 1E1MA 2C70A 4YSYA 4REKA 3DJJA 4GF7A 2R0CA 4EM4A 4FX9A 4Y4MA 2YVFA 4PABA 3ITJA 4H2NA 3IF9A 4BK3A 3IHGA 3GQHA 2XLSA 1Q1RA 3DJDA 3F8PA 3IC9A 4H2PA 2ZBWA 3UOVA 1H83A 3EAOA 3URHA 4J57A 1GALA 1BF3A 3BI4A 2IVDA 5FS9A 2YVJA 1O5WA 1DNCA 1N1PA 3M0OA 1CJ4A 1NPXA 3NYFA 5HY5A 1GXFA 2BCPA 1PBBA 4LA1A 2C67A 1LTXR 3NN6X 4YSHA 3GYIA 1L0VA 2GR1A 5JCIA 3AE6A 1YQ4A 5KXJA 1CC4A 1F6MA 2UZZA 1UKVG 5EOWA 3DH9A 5GSNA 3AECA 4NZHA 1FL2A 4XXGA 1CJCA 5J60A 5ER0A 1FEAA 2B9WA 2VQBA 2X8GA 3DMEA 3AE2A 3NN0X 1CC2A 1DOBA 2JKCA 2Y6QA 3UKPA 2XVIA 1F8WA 4IA5A 2FJDA 1K0LA 2RGJA 1QJDA 1ZKQA 2WP6A 2XVFA 4RG3A 5KOXA 4YTNA 2YR4A 1E1LA 1F8RA 2PYXA 3M13A 1OJ9A 3G5QA 4CY8A 1RP0A 3AE3A 2GRTA 2Q0KA 4J31A 1DJQA 1OJDA 1W4XA 3P4PA 2GR3A 4JQ9A 1F8SA 1GEUA 3RNMA 5HXIA 3CNSA 1XPQA 2QA2A 3FPZA 1TDOA 4NEVA 2WEUA 4TM1A 3GYXA 3AEDA 4ICYA 4IA6A 1H7XA 4ADWA 1YQ3A 1RSGA 2CDUA 2OAMA 2AQJA 3DJGX 3H8IA 3KKJA 4B65A 4K5SA 3GQKA 5BUKA 3H4KA 4A79A 2C3DA 4USQA 2H88A 3AE7A 2YAUA 3NTAA 4JY2A 4YSZA 1LQUA 4EMWA 5U1OA 3UKQA 4BURA 1BKWA 4X9MA 4B67A 1COYA 5CKUA 2BK4A 5JCNA 4I59A 3SFDA 3AYLA 1EL7A 4U8OA 3K30A 3CNPA 3NH3X 2A8XA 4APNA 1B8SA 2R4EA 3CGBA 3CNJA 3ALMA 2FBWA 5C2TA 1CBOA 1GV4A 3NTDA 2GH5A 4CY6A 4A5LA 1PXAA 2VOUA 3NK2X 1PJ7A 4OPIA 4A6NB 4Z2RA 3CPJG 1GOSA 1N4WA 4H4RA 2NVKX 4H4UA 2XLPA 3WE0A 2B9YA 1E6EA 1KFYA 1MO9A 4GCMA 2BABA 1H84A 3Q9TA 4CNKA 4EMIA 2WU5A 3QVRA 1OJAA 2V3AA 5FS7A 4Z2UA 2LFCA 1JU2A 2XCGA 4H2RA 1DOEA 1S3EA 3GWDA 1H7WA 1DJNA 1E1KA 3JSKA 2CVJA 2R4JA 1VG9A 4JDRA 3AD8B 4GR1A 2WDVA 1BWCA 4K7ZA 1NENA 3DK4A 3GRSA 2VQ7A 4H4VA 4ZCCA 1RYIA 3P4RA 4C3XA 4Y4LA 4BK1A 2X8HA 2A89A 4FK1A 4N9XA 1ZK7A 2XVHA 4TM3A 3GRTA 1TYPA 4AOXA 3PS9A 4H4XA 3SM8A 5EB5A 5HYMA 3CNDA 2GAGB 3QSMA 4WX1A 5KVIA 4UDPA 4H4SA 2IIDA 2GMHA 4ECHA 4B63A 1E7PA 1OJCA 2C64A 1L9DA 3SGLA 3NT6A 2XFUA 3RP7A 4Z25A 1Y56B 2YLTA 3II4A 1NG3A 2XVJA 1TDNA 2FJAA 1REOA 3ISHA 4YT0A 3ATRA 3ATQA 1NAAA 3L1RA 3BHFA 3QSEA 2Z5XA 2VVMA 1IUVA 4NTEA 1D7LA 5J7XA 1VDCA 3ADAB 5M0ZA 2C3CA 2DKIA 2GB0A 3UOXA 4AT2A 3AB1A 1GESA 2X8CA 4H4WA 2H89A 3DJEA 3R9UA 1D7YA 4U2SA 2WDQA 3GDPA 2WU2A 4RG4A 4U8MA 3GMBA 3VR9A 4OCGA 2RGHA 1IUXA 1K4QA 2YLWA 5BRTA 1KSSA 1H82A 2V3BA 1K0JA 3AXBA 4CNJA 2BYBA 4XWRA 1VRQB 2V61A 2YG4A 1L9EA 2WPEA 2C7GA 2RABA 4A99A 4HA6A 1E39A 2R0PA 1IJHA 2QAEA 2GR2A 4J2WA 4GUVA 1PJ5A 1KSUA 4OPUA 3EF6A 4EQSA 3CGCA 2BS4A 1JEHA 1EL8A 1YY5A 2XDOA 2YLRA 4B68A 3RHAA 5IQ1A 4OPGA 2BS2A 3LZXA 3LXDA 1AOGA 4P9SA 5FS8A 3EANA 1YKJA 3SQPA 3V3OA 4H50A 2CULA 2Y6RA 3KVEA 3COXA 1GNDA 2GVCA 4TLZA 5IQ4A 2C65A 3VRAA 1PXCA 3NG7X 4X9NA 3BNMA 1BZLA 5KOWA 1JRXA 1FEBA 3CPHG 3VR8A 3OC4A 1QO8A 4HB9A 4Z24A 5L46A 1PHHA 1H81A 3QSSA 3VRBA 1XDIA 4J34A 4FDCB 1GT8A 3AYJA 3S61A 4Z2TA 1ZOYA 3FG2P 1QLBA 3AEGA 1GRHA 4CCRA 4H2QA 2BC0A 2B76A 2GQWA 3GWFA 3ICTA 2V5ZA 4LIIA 3E1TA 1PBEA 4OPDA 2WOVA 3NYEA 1CC6A 3ICSA 4OPTA 3UTHA 5U25A 3K7QX 2FJEA 4B64A 2OALA 2V60A 3RP8A 2WHDA 1S2QA 3GD3A 3BHKA 1JRZA 2GEWA 2DKHA 2YLXA 1EBDA 5CQFA 3BNUA 1JRYA 2TPRA 2X3NA 3FIMB 3P1WA 2IVEA 3F8DA 2GR0A 1MOKA 4RSLA 2EQ8A 3UTFA 1FOHA 1O95A 3DK9A 2BXRA 4J36A 3GYJA 4MJWA 4UDQA 2XFNA 1ELIA 1NHRA 2QA1A 4YXDA 4H4TA 1KNPA 1F3PA 4OPCA 4UDRA 3QFAA 4H4YA 4CBQA 1LV0A 2GMJA 2JBVA 3O0HA 2VVLA 2BS3A 3NRNA 1YQZA 2C76A 3AD9B 1CHUA 4YWOA 2ARDA 4I58A 4C77A 2XVEA 4C74A 2OLOA 4ZN0A 2JAEA 1NHSA 3LADA 1FECA 1NEKA 3D8XA 1Y0PA 3M12A 2ACZA 4D04A 2JK6A 3Q6JA 1K0IA 1EL5A 2C75A 2BCGG 2Q6UA 3CNTA 3P9UA 2XYOA 4XWZA 1IUSA 2XLTA 1LQTA 2B7RA 3BI2A 4DNAA 4EQXA 3SUCA 3QJ4A 3V76A 1H6VA 2O9ZA 3H8LA 3NIXA 1E1NA 2AAQA 1GPEA 3EPTA 3IWAA 4WCTA 5KVHA 1V59A 3T37A 1DXLA 3AE8A 1KNRA 1IUWA 3NK0X 1D4CA 4Y4NA 5TR3A 4YTPA 4YSXA 3LOVA 4UP3A 3NK1X 4O5QA 1D5TA 1EL9A 1NG4A 1NHPA 3FBSA 4EMJA 4Z43A 2YWLA 4JN9A 3LJPA 5KRQA 4JNQA 2OA1A 3UKFA 3AEBA 3RP6A 2OLNA 1PDHA 1GRTA 2XFOA 4K5RA 2R0GA 4BJZA 4DGKA 4H4ZA 5LV9A 2E5VA 1ZY8A 3UTGA 3REDA 1JOAA 1GETA 2YQUA 5FMHA 2GV8A 3KU9A 4JY3A 2E1MA 3DK8A 2WP9A 4DSHA 2Z5YA 1CJ3A 2YG3A 2YLZA 3UKAA 1KF6A 4C5OA 4YKGA 1PBDA 2R9ZA 2JB1A 2XLUA 1ONFA 4NTCA 4PAAA 4GDEA 3KPFA 2I0ZA 2WP5A 4EQWA 4X4JA 4TM0A 3C4NA 4K2XA 3ICRA 1VG0A 2WOWA 1CF3A 2VRMA 4NTDA 4CCQA 2WDRA 3V3NA 3VQRA 1HYUA 2BXSA 2X50A 3DGZA 4YTMA 3NHOX 2GQFA 1BGNA 1Y56A 3G5SA 2ZZCA 3GDNA 2Q0LA 4K22A 4A9WA 2C72A 4TLXA 3UP5A 3VRDB 2JB3A 2GF3A 3UKLA 1Q9IA 4AT0A 3ZYXA 3SFEA 1N4UA 2J3NA 2YM2A 1XANA 1Z6LA 4U8KA 1N4VA 1PBCA 2WPFA 4B66A 3B3RA 1GRFA 3AWIA 2C66A 3HZLA 2ZZBA 3CIRA 1BGJA 5BULA 1P2HA 3K7TA 2YR5A 1GSNA 1GTEA 3G5RA 5DBJA 3I3LA 1L9CA 2EQ9A 1PBFA 2TMDA 5FS6A 2R45A 1TDEA 1JNZA 4U8PA 5KWFA 2GAHB 3NYCA 3KD9A 1TDKA 1M6IA 3QFBA 2BK3A
chains in the Genus database with same CATH superfamily
3ZPOA 4EQRA 2MYSA 3C4AA 3NVOA 3KA7A 4A97A 1PS9A 3T1HT 1VQWA 1D1CA 4OHFA 3VHLA 4JI4T 2VVLG 4USRA 5JCLA 4TM4A 1NHQA 3N2GE 3WI3A 3ANWB 1LJ1A 4KX6A 3N9LA 1HX1B 3S5WA 1GTHA 3GMCA 3KV4A 1DOCA 3S4UA 2BG9C 3CTYA 4QHOA 3UKKA 2V6YA 4EIWA 1V9DA 3ZKRA 3PUGA 5EBKA 2YLSA 2B7SA 3K3NA 1LVLA 2AE9A 3PJAA 2WOIA 2KNDA 1XMOT 2JPFA 2W4XA 2BACA 4C3YA 3AYIA 1MMAA 1XNRT 2XUEA 4X65T 1MMDA 2N9DA 2VQFT 4CN4A 2QA7A 5KMQA 3AE1A 3C4ZA 4TWFA 4EM3A 1T8BA 3PVCA 2E4GA 1Y64B 3FB2A 5JCMA 1RUH4 2JQKA 2APGA 5U63A 4HWCA 2NWBA 5FY7A 2V6XA 1ZDLA 1XZYA 1H86A 3GD4A 4A65A 1B4VA 2WBAA 3ZJ1A 5GRTA 3ZDNA 4JI5T 2KT9A 3ZT5A 2C5IT 2ZM2A 3T14A 4IDNA 3MKDA 2CM0A 3RH3A 4X62T 4HWHA 4B1BA 4EIPA 1RMU4 2CLYC 3ETVA 5FY1A 3I9YA 4PW8A 3BI5A 4P0AA 2XFQA 5KMSA 2CWOA 4EB6E 4FI5A 2HWB4 4JUYA 2NOXA 4TX5A 5KX5E 1E1MA 2C70A 2MBGA 4DMWA 4YSYA 3UUXB 4EM4A 1NCQD 3ITJA 1AR74 1Q1RA 4H2PA 3UOVA 4J57A 1GALA 5BR8T 3I0QA 1HCIA 5FS9A 4EOZB 1DNCA 3KDSE 1CJ4A 3CX6B 5EK2A 3IHRA 4CI1B 1LTXR 2G0UA 3NN6X 3AA7B 4NNJA 1IZNB 2X68A 2XPKA 4X5TA 1HRV4 2XQ5A 1F6MA 3B5MA 1UKVG 4Z91A 2IIUA 1XDPA 4XAXB 2N1GA 4DO0A 2B9WA 2X8GA 4O8SA 5CGMA 4JYAT 1DOBA 1HF8A 2FJDA 4JEHB 4HFVA 2RGJA 2XVFA 2LJLA 3N5LA 4EXTA 4YTNA 1F8RA 3M13A 1UUSA 1MQTD 4J31A 3DJBA 4U7YA 1W4XA 1RUD4 1F8SA 5HXIA 1XPQA 2QA2A 3GYXA 4TM1A 4GKJT 4IA6A 1RSGA 2OAMA 1J5ET 2AQJA 4O4JE 4K5SA 2H88A 2YAUA 4JY2A 4DV1T 1LQUA 3UKQA 4BURA 3UU3A 3RYFE 2K24A 4GK5E 4ZI2D 5CKUA 5ABFB 2WZIA 1VOMA 1EL7A 4O2AE 4U8OA 2XQYA 2A8XA 3JD74 3CGBA 2RPAA 3ZT6A 2ZM8A 3UFEA 5HWYA 2GH5A 4CY6A 1G73A 2LHRA 3QOFA 4A5LA 1Z0PA 1PXAA 1PJ7A 3WE0A 1MO9A 5FL0A 3RQUA 4GCMA 1H84A 2BVMA 4DR6T 1XHXA 2VL0A 4QH1A 5L4HA 2YDQA 3R6NA 1JU2A 4X64T 1H7WA 3JSKA 1E1KA 4JDRA 2RM24 4DUYT 4HFHA 3I1AA 3BQIA 4ZOLE 4GR1A 2WDVA 4BA9A 3CK6A 3Q5DA 3KVBA 3DK4A 4H4VA 4ZCCA 1RYIA 4C3XA 4LFBT 4E7ZA 4BK1A 4N9XA 1ZK7A 1TYPA 5KVIA 1N32T 3CMMA 2WB5A 4H4SA 5J0ZA 4IDQA 4B63A 1E7PA 4Z25A 4U72A 4JI8T 2V7IA 5FXVA 2XHEB 1W0BA 2X51A 3L1RA 2I59A 3EUHA 2DWGA 3BHFA 4G6HA 5BMVE 1VBC4 5ADXL 3OKQA 2C3CA 2X8CA 4H4WA 4CN1A 2H89A 3DJEA 3R9UA 1D7YA 2KMFA 4U2SA 2YDSA 4LF5T 5FMNA 5HEGA 4QXBB 4OCGA 3PUWF 1K4QA 1H7CA 1KSSA 3AXBA 3C98B 4DV5T 2BYBA 4JBWF 2NTYA 5LJNA 1L9EA 4HA6A 2HPJA 1PIV4 1E39A 2MAWA 3FHNA 4A5XA 1PJ5A 1KSUA 4EQSA 3CGCA 2YLRA 3RKGA 1AOGA 2BS2A 3FZFB 4H9NC 4QX8B 2WM9A 2VVSA 3ZLIA 1EZ3A 4LMLA 3KVEA 1MMNA 1UK5A 1GNDA 5IQ4A 2C65A 1HTJF 4UIGA 5HXSA 2LRKA 2WWUA 3PU8A 2XSBA 2V26A 2Q9QD 3C64A 3SRZA 3FBZA 3RHWA 1XDIA 2ACXA 2PFVA 3SXIA 4DR2T 3RIFA 3UU6A 3MA9A 3AEGA 5J2TE 3TLTA 3GWFA 4LIIA 5ABGA 3JC6C 4OPTA 5F8PA 3UTHA 5U25A 2FJEA 4B64A 3RP8A 2WHDA 2PZSA 1JRZA 2DKHA 2YLXA 2IW5B 1JRYA 3BNUA 2TPRA 2JMKA 5CFBA 2X3NA 2EHOB 4ERRA 3B57A 2IVEA 3UTFA 4HN9A 4J36A 4WBOA 3GYJA 2E9XC 1NHRA 2CHOA 4BAYB 4H9SE 4AQFA 1W9RA 1F3PA 4OPCA 4UDRA 3L09A 1LV0A 2JBVA 2ZLYA 1YQZA 2LT3A 2JJ9A 4I58A 4C77A 5KMPA 2BDEA 2XVEA 3D8XA 1AL24 2YINA 4UR9A 4L0RA 3AA0B 1HXS4 5FVKA 2C5JA 2C75A 2XLTA 1LQTA 2B7RA 3N2OA 3QJ4A 4Q4X4 1AR94 3H8LA 3NIXA 4EYYR 1E1NA 4WCTA 2R044 2VK9A 2K5BB 1DXLA 1KNRA 4Y4NA 3IA3A 4YSXA 3HI2A 4TV9E 3JBG4 3SZCA 4JNQA 4PJLA 3RP6A 1PDHA 3M65A 1GRTA 4DGKA 5LV9A 2E5VA 1GETA 2AXDS 2QRXA 3KU9A 2E1MA 3DK8A 2NW8A 2YLZA 3UKAA 3ZMSB 2JB1A 1EV14 1ONFA 3KFWX 4CI3B 3ONLC 4PFPA 3EAMA 2I0ZA 4U3CA 2HN1A 3C4NA 4K2XA 1VG0A 2W2UA 4H63V 4G73A 4NTDA 4CCQA 3T2YA 5HEHA 1AR64 4DV2T 4Z90A 2R074 3DGZA 4YTMA 2P9BA 3CVRA 2Q0LA 4H63H 1FMWA 3QB5K 4EAHA 2GF3A 1VBA4 3PV0F 4K0KT 2V7LA 2VKOA 1VCTA 2Y8DA 1IBKT 3ZYXA 3RYIE 2WPFA 4H9OC 3AWIA 2ZZBA 3LK3B 4I55E 1P2HA 3K7TA 3QB5A 3G5RA 3NWIA 4AKIA 5DQWA 2EQ9A 2XAFB 2KINB 2J62A 3NYCA 3KD9A 2C3DA 3QFBA 5JVDE 3AEAA 2RS54 1DODA 5LCYA 5JCKA 2BG9B 2H7OA 1UGOA 5JRCA 4JI0T 4U8JA 1VBB4 5KNLA 1ZKEA 4AXPA 5DABA 1S35A 2YG6A 4YKFA 3GN5B 1JNRA 3AE9A 3AEFA 1TRBA 1SUMB 2FJBA 3T31A 3D1CA 4RHV4 2YR6A 4DV3T 4GRTA 3DA1A 4U2LA 4A56A 1TYTA 1MNEA 3OYZA 1D4EA 3RRWA 3UULA 3HA4A 2JB2A 2A87A 4U2TA 3VU7H 1HNXT 3NKZA 1PXBA 3EDUA 5L3GB 1S3BA 3X1DA 3IHMA 4CXYA 3L8KA 4BJYA 3K7MX 5AQSB 3NKSA 1SE7A 4F8HA 5LMNT 2YVGA 3TLWA 3K3QC 1NDAA 3PO7A 4KPRA 2WESA 3ZMTB 5AQLB 4J56A 5JR9A 2CBIA 2Q7VA 2WPCA 1ZEEA 2X67A 2CLYB 2EHOA 2I0MA 2AR8A 1RUF4 2UXCT 2CPTA 1PJ6A 3DGHA 4BJNA 2H3RA 4M52A 4Q4Y4 1M62A 3EVYA 3E22E 2XM2A 4U8LA 4A6NA 2QCUA 4IDOA 3OZ2A 3GSIA 4C91A 4YHJA 5EZYE 1X31B 2VZ2A 3CPIG 1D4DA 4BK2A 5KDMC 3B6DA 1WCRA 1D0XA 2F4VT 4A7AA 2W67A 4ADZA 2W0HA 5L3CB 3NLCA 3ZEFB 3G06A 2BA9A 3Q2MA 1PVC4 1YKHB 2NTXA 4I50E 5L3BB 4NUVA 2ZZ0A 2CFYA 2CA5A 4Q4W4 2B9XA 1LPFA 2PHHA 1BR4A 4JLEA 4IE7A 3SWHA 2C0SA 4II3A 4REKA 2R0CA 2J47A 3AXJA 3FZHB 5AQHB 1W09A 5LGUB 2W61A 3BI4A 3FXDB 4KBMB 3ZSSA 1R084 5FY0A 1HFAA 5AQQB 1N33T 1N1PA 1KEYA 2CXLA 2BCPA 1PBBA 5LJMA 4LA1A 1OEDC 4GAPA 2X0HA 5JDGA 3GYIA 2VKJA 4XZCA 1L0VA 2GR1A 5JCIA 3AE6A 4PJJA 4IE5A 2PJQA 2X66A 3DH9A 2YOEA 4DVDA 4XXGA 1FL2A 2LLYA 5ER0A 4AQGA 2VQBA 4TN7B 1AJ3A 1Y01A 4JV5T 2JKCA 3UUNA 4KUMB 2CCQA 4ILBA 4IA5A 4NPPA 3UTKA 2CXFA 1QJDA 4TNWA 1ZKQA 4RG3A 3N9MA 4ZS2A 1E1LA 3PUVF 2LM2A 4OYJA 3AE3A 2GRTA 4JI7T 1GQEA 3UUBA 3P4PA 4F6RC 1BR0A 3NZPA 1OJDA 5AQRB 4TZ4C 3PUSA 3CNSA 2WEUA 2LKHA 1H8TD 4U7IA 1YQ3A 2CDUA 3H4KA 4USQA 3JAFA 1D1BA 1UCUA 4HWDA 1VBD4 3NTAA 4YSZA 3AAIA 3EABA 3F2EA 4B67A 3RKOA 4UELA 3PJAJ 1COYA 5JCNA 4I59A 3SFDA 1OWAA 2L8KA 4EYUA 3CWZB 3NH3X 4APNA 4CZZB 4HFBA 2N2NA 3ALMA 4OYKA 1CBOA 4JI2T 2Q9QC 4DR4T 1HR0T 3NK2X 3CQXC 1GOSA 1N4WA 2WBLA 4M1PA 4H4RA 3GN5A 5CA0E 2XLPA 1E6EA 2NW9A 3KV9A 2XTLA 3N2KE 4QXCB 2CMRA 4CNKA 2WU5A 4ZZBA 1OJAA 3QC9A 3OPCA 2LFCA 3AD8B 4GYSA 2IHR1 4IE4A 2A9UA 3NRYA 2YU1A 2I6HA 3GRSA 3KV6A 2W63A 3HYWA 2PYLA 2X8HA 3SM8A 4L5GA 3CNDA 3QSMA 5LB7B 4WX1A 3UU5A 2WCAA 4G2AA 1LVKA 3IEEA 3ZMZB 4B3MT 1J5WA 2UUAT 5FXXA 3SGLA 1UX5A 3RP7A 1Y56B 5AQTB 2LSGA 2FJAA 4X1YE 4KMCA 4YT0A 3ISHA 3ATRA 2WMNA 2LHNA 5JDLA 4OX9T 3QSEA 2VVMA 5AQJB 4NTEA 1D7LA 5J7XA 1VDCA 2JIWA 2LOSA 3N9OA 2DKIA 5FYMA 3GDPA 2VL8A 5L47A 3GMBA 1K5MD 2HN2A 2X9WA 2RGHA 1H82A 1K0JA 4CNJA 2BKNA 1VRQB 5E0OA 2YG4A 2WPEA 3HR0A 5DJQC 2X9YA 1NWMX 2DHRA 4DNDA 3ZC0A 2R0PA 1D4M4 2GR2A 4GUVA 4OPUA 1FJGT 1JEHA 1EL8A 3RIUA 5FS8A 4U2ZA 3EANA 4ISTA 2V1DB 5CB4E 4IL9A 3HYXA 5IHYA 3C51A 3COXA 4TLZA 3F31A 1PXCA 4EEDA 3PUXF 4OFZA 5KOWA 4QX7B 1B7TA 3VR8A 3OC4A 4O4LE 1QO8A 5L46A 2BBJA 2LM9A 1H81A 2Y6XA 2E9XB 4J34A 4CI2B 1AR84 1VRH4 3AYJA 1ZOYA 3FG2P 1LRZA 4ZHQE 3OVUA 5LNKA 2BC0A 2GQWA 3ICTA 2V5ZA 3E1TA 4HGAA 3ICSA 2V60A 4WNKA 2GEWA 5CQFA 1EBDA 3PU3A 3F8DA 1MOKA 2XQAA 4UV9B 5FNVE 4LMJA 5IWAT 1YD8G 2YKSA 3GA8A 4JI3T 2CE7A 4H4YA 3ANWA 3NRNA 2D0UA 3AD9B 1CHUA 3N9QA 2ARDA 4C74A 4ZN0A 5JDFA 3LADA 1FIOA 1FECA 1BR2A 5J2UE 3M12A 3I0OA 4D04A 3Q6JA 2IUBA 4KP3C 1K0IA 4Q25A 1EL5A 2Q6UA 2BCGG 3CNTA 3AB3B 3P9UA 2XYOA 4CY8A 4EQXA 4K0UA 3ZMVB 3SUCA 5LGNB 3V76A 1H6VA 1WR0A 4G74A 3Q5WA 2AAQA 3EPTA 2UU9T 5AQIB 2Z6EA 3NZQA 1SA0E 4ANJA 1IUWA 1D4CA 4G63A 3LOVA 5ABHA 1EL9A 4Z43A 1NG4A 3FBSA 4DR7T 3SX6A 4DBRA 2YWLA 1OXZA 4EMJA 4JI6T 2CRBA 3AEBA 2OLNA 2LKGA 5LMUT 3SZWA 4DMVA 2DLRA 1ZY8A 2GV8A 1W0AA 4BJMA 4JY3A 4DV7T 4JI1T 2RMU4 2YG3A 2M6BA 1KF6A 4C5OA 5LG4A 1PBDA 3P50A 3UQ7A 4CXWA 1UURA 3CKDA 1WLXA 1WYCA 2HHHT 1HS7A 2RR14 4GIWA 4EQWA 1G8XA 2NR4A 1RUG4 3ICRA 3J8F4 3RI5A 1HYUA 3LG7A 1X79A 1COV4 2X50A 5LHIB 2ZMAA 2WSSV 4AISA 1Y56A 5HCMA 2ZZCA 3GDNA 1VBE4 2C72A 3VRDB 3VKGA 4ZZCA 3JCFA 3V5UA 5CJ5A 4AT0A 2J3NA 1XANA 3LJCA 1SHZC 1BGJA 5HEOA 4EV6A 4LF4T 2YR5A 3AVSA 1GSNA 2MPKA 3I3LA 2YN6A 1HNWT 2M67A 2RP4A 5FS6A 4U8PA 5KWFA 2GAHB 2JQQA 1PO14 3LDQB 2BK3A 3KBUA 3MXZA 5HYAA 1P2EA 2BC1A 3CX8B 3I6DA 3NGCX 3UCLA 2XQ3A 4B3RT 3QNUA 5AQUB 1B5QA 2V8SV 4IDZA 4LF8T 4AOSA 3CN8A 5HHFA 2YG7A 1ZP0A 3C4XA 2XFPA 3AD7B 2YG5A 2E8IA 3CPZA 2HQMA 5AQNB 4HKAA 1GRAA 4HFDA 3ALLA 2QGSA 4H7UA 4HTEA 2DI4A 3ZN1B 2BKPA 1T72A 1O94A 4IV9A 4AP3A 2RGOA 1E1HB 4B6XA 4O5UA 2UUBT 2X9XA 4B69A 5JQGE 5GONE 4EGWA 2E9XA 4AQFC 1ZMDA 3NNEA 3HKDE 2KLQA 3ZMUB 3KLJA 2X99A 1MXTA 2V5CA 4BV6A 3J7Yq 1GERA 2XASB 5ABFA 5JDMA 1KDGA 4H4PA 4II2A 2WETA 2C5KT 5HEUA 2YM1A 1MIYA 3LB8A 4CN6A 5C3JA 5AQOB 3I9WA 4FK1C 4OPLA 3SZ0A 1UX4A 1XHCA 4HFEA 3ABVA 5EB4A 3OJAA 5AQMB 1D0ZA 4IL4A 1XHZA 4NEWA 2D9DA 3LFMA 1HNZT 4IHJE 3CGDA 1GRBA 5BVAA 1NA1D 1GREA 4CRTA 2X5ID 1OEDB 3ALJA 4I43B 4GDPA 3F8RA 4TWDA 5LHHB 4GYRA 3MJXA 2ODVA 4IREA 3KPKA 3DJJA 4FX9A 4Y4MA 2YVFA 2OLTA 4H2NA 3OTOT 3F8PA 2CHNA 1CUNA 3DJDA 2ZBWA 1H83A 3EAOA 4IGUA 1NPXA 4AKRB 3NYFA 5HY5A 2DNXA 4GKKT 2K3WA 3U3IA 4YSHA 4ZEYA 2B1EA 1YQ4A 4WW0A 2UZZA 4V1Av 5AQPB 4NZHA 1CJCA 5J60A 2LSYA 2VB6A 1FEAA 4U31A 4MHCA 4PDWD 2PYJA 4C90A 3AE2A 3NN0X 3C4WA 3UKPA 4TWHA 2XVIA 1F8WA 2LSJA 3NBXX 5HEJA 1LKXA 5KOXA 2YR4A 2DCFA 3BQLA 4NXNT 1OJ9A 2JQHA 3Q5EA 2V6YB 3OYXA 4O2BE 4KHPT 4WZXA 3FPZA 2ZM0A 4ICYA 4ADWA 2Q9QB 3DJGX 3EDVA 3KKJA 4B65A 3GQKA 4LF6T 2RA1A 2BVLA 3AE7A 5JDHA 3HKEE 3V5SA 4EMWA 2FUPA 5U1OA 1BKWA 4X9MA 3CMLA 5JDQA 5EK4A 4ISSA 3UU4A 1B8SA 2R4EA 2GK9A 1HG5A 2IC9A 1YXRA 3CNJA 2FBWA 2VVNA 2XQ9A 2BRAA 2VASA 3HKCE 4YJ3E 2KXPB 3NTDA 5HAXA 4HFCA 2UXNB 2VOUA 4G6GA 4H4UA 2B9YA 2D2SA 1XDOA 1ZV4X 3ZCIA 2BABA 3QVRA 3VKHA 2V3AA 2MOZA 3TLVA 5FS7A 4Z2UA 2XCGA 2CEAA 4H2RA 2KZ7B 5JR9C 1S3EA 3GWDA 2R4JA 2E2AA 5EK3A 4K7ZA 1RUJ4 3P4RA 2VKDA 2A89A 5L3EB 2XVHA 2LSKA 3GRTA 3PS9A 4TV8E 5JREA 3Q9DA 4PK5A 4UDPA 1R094 3GMIA 2IIDA 2GMHA 4XBFB 4WYVA 3NT6A 2XFUA 2YEVC 3ONJA 1NG3A 4AKGA 1REOA 1S94A 3P8CD 1RUI4 2QVAA 2Z5XA 1IUVA 2HWC4 2BG9E 3T8OA 3ADAB 2MTQA 3UUMA 1I94T 1ASJ4 5C8YE 2XAQB 4TNVA 4RG4A 4U8MA 1RVF4 3VR9A 4ZI3C 1IUXA 2X0YA 4LMKA 4UXNB 2YLWA 3ZYMA 3PDYA 2C7GA 3AVRA 4A99A 3ESLA 3MACA 2E5LT 1IJHA 2QAEA 5FKYA 4X1IE 1YY5A 2IDOB 4B68A 3RHAA 5IQ1A 5AQGB 3FBLA 4LF7T 2L3LA 4IDPA 3V3OA 4H50A 1MMGA 3WAKA 5M4YA 5JTGA 2Y6RA 1POV0 5L2LA 2WMOA 4DR3T 5J1GA 3VRAA 5F3JA 3NG7X 3BNMA 4G9KA 3E0ZA 4UVAB 3PUZF 1FEWA 3QSSA 3VRBA 1GT8A 3S61A 4I4TE 4P0BA 1GRHA 4MBQA 1BEV4 4H2QA 5AQFB 3LSVA 4H9QC 1PBEA 5FXWA 3NYEA 4Z8XA 3K7QX 1PO24 1O3XA 4J2CA 3BHKA 3FZKB 2BG9A 4ZI7E 4UV8B 3P1WA 2GR0A 4RSLA 2EQ8A 1FOHA 1O95A 3DK9A 3K8PC 4MJWA 2YK0A 1ELIA 2YDRA 3SS1A 2XY8B 4WBNE 4LFCT 1KNPA 3KBTA 3ZJ2A 1QSDA 3O1HA 1WFDA 3QFAA 2C4CA 4UVCB 4E7SA 4DR5T 2XAJB 2LSIA 4YWOA 3L8RA 2Q9QA 3HL6A 2XZEA 2OLOA 5LBQB 1XI1A 3AA1B 1NEKA 3N9PA 2ACZA 2CBJA 3D0TA 4KHZF 2JK6A 4DV4T 4X20E 3CQCB 5A1LA 1KK7A 4XWZA 3UP4A 4DNAA 2PLV4 5JDNA 1IUSA 2XJ7A 3ZT7A 1GPEA 3IWAA 1V59A 2UXBT 5TR3A 3H3AA 4PAGA 3NK1X 2XQ4A 5LP6E 1IBMT 4ILAA 1D5TA 3NRXA 3LJPA 4QH4A 4O4HE 5KRQA 2XFOA 1U5PA 4K5RA 4CQIA 4H4ZA 4PK6A 5LBMA 1DU2A 3AAAB 3AAEB 3JADA 3H37A 1CJ3A 2V7JA 2R9ZA 2XLUA 2D0TA 4PAAA 4GDEA 3RRCA 2RS14 4IIJE 4AKLA 2WP5A 5IYZE 4X4JA 3O9XA 4TM0A 2VRMA 2ES0A 2WDRA 3VQRA 3ONXA 4L9IA 4MLKA 1M7KA 1WR6A 3C50A 2BXSA 4HE8A 3UFGA 1BGNA 3G5SA 1QUUA 4FJOA 4K22A 4PNIA 4A9WA 1IJ5A 2J4GA 5LA6E 1Q9IA 4YJ2E 5JH7E 3IBPA 2DWKA 1PBCA 4B66A 2C66A 5ETWA 3CIRA 3PUQA 5BULA 3RIUC 4ILCA 2XQ7A 1L9CA 3U78A 2TMDA 5L3DB 2K9AA 2VWAA 4A98A 1TDKA 1N36T 3AE8A 1M6IA 3AB1A 4E0VA 2L9QA 4HWIB 4HFIA 1ZHCA 2EQ6A 1FCDA 4DUZT 4U74A 2C73A 2BZBA 3L39A 5IPYA 4EEBA 3BQKA 1CJ2A 1HG2A 5L3FB 2EHOD 1FMVA 4PK4A 4AIUA 2XAGB 2PY5A 4U8NA 1IUUA 4U8IA 3Q5XA 5FP3A 2VRLA 3AA6B 3RC3A 1VRBA 4DSGA 3QK6A 4LU6A 3WAJA 2EQ7A 3UQ4A 3B13A 3QVPA 1RUE4 4LF9T 3AEEA 4AP1A 4IVOB 2KWHA 3RPUA 4D03A 3FMWA 1IUTA 3O1IA 5HCJA 1WRDA 2WZHA 2F5ZA 1IBLT 1B37A 4Z26A 2R46A 3C96A 4GOUA 1ZMCA 3PURA 2V6OA 2WS3A 4KI0F 3UOYA 1ZX9A 2A72A 3LZWA 3AE4A 4IVMB 4K8DA 2IC6A 1TDFA 4IE0A 3TLUA 4J33A 3UKHA 2WQYA 3CGEA 3HYVA 4ZCDA 1M64A 1S2YA 4H4QA 4JNAA 1Q1WA 2KSRA 4ZI3D 1D1AA 1CL0A 5HXHA 3UTEA 4Z44A 5F5WA 2NPXA 3UOZA 4MALA 3QUJA 4DV0T 3RF1A 1MIVA 2IMLA 1ZOVA 3P4QA 3PUYF 1OJTA 2UXDT 4GAVA 1Z8UA 4GK0E 2XLRA 3P4SA 3ZSTA 2V7MA 5LOVE 4HEAA 4OVIA 1GRGA 2BK5A 2V5DA 1PN0A 4PJNA 3JAEA 2OA5A 3UU8A 1SEZA 3A5XA 3RLFF 5M10A 3H3MA 2K48A 3AE5A 2VQET 4EIQA 5HXCA 2CWYA 1I6ZA 2W66A 4P1NA 1HRI4 4GF7A 4PABA 1XNQT 4BK3A 3IF9A 3IHGA 2JMHA 3GQHA 2XLSA 2HPLA 3IC9A 2KWIB 1X9BA 3URHA 1BF3A 2IVDA 2JRKA 5AQKB 2YVJA 1O5WA 3M0OA 4NIQA 1GXFA 5AQVB 3T2KA 2C67A 3CQGB 5KMRA 3LBXB 4YFSA 3TKLB 5KXJA 1CC4A 5EOWA 5GSNA 5HXEA 3AECA 5KMGP 5JRCB 2WAUA 4QWNB 4JEUB 2BRYA 3DMEA 4O4IE 1CC2A 4AQYT 4ZXLA 2Y6QA 3BK9A 5FL1A 1K0LA 2WP6A 3EI0A 4COFA 1XMQT 5LG3A 2PYXA 2VKHA 3G5QA 3W15B 1RP0A 2Q0KA 1DJQA 2GR3A 4JQ9A 1GEUA 3RNMA 2RS34 3RIAA 2VURA 4TUYE 1TDOA 4NEVA 4IE6A 4YY3T 3AEDA 4GB34 3FI7A 5LYJE 1H7XA 3A8YC 3H8IA 5BUKA 4A79A 3CX7B 5H6QB 3SY4A 5LGTB 1U4QA 1KNZA 5LHGB 4U33A 3T0KA 5LXTE 3A7MA 2V7KA 3SOLA 3ZC1A 2BK4A 5JR9B 1YKEB 3AYLA 4N78D 3L3PA 3K30A 3CNPA 2LE8A 4B3TT 4YHHT 2Y48B 5C2TA 3KINB 1GV4A 4DV6T 3ZCJA 2XM1A 5FVLA 4A6NB 4OPIA 4Z2RA 3CPJG 2PG8A 2NVKX 1IJ6A 3KV5A 1KFYA 3Q9TA 3RGLA 4EMIA 2LRLA 5FXZA 1DOEA 3LK42 3PE0A 1DJNA 2CVJA 4MFRA 1VG9A 4DIDB 3DTOA 3KVAA 4P09A 1LVFA 4AKHA 1BWCA 1NENA 2VQ7A 2WWVA 4Y4LA 4FK1A 4TM3A 2XSAA 4AOXA 4H4XA 2LEHA 4AI6A 5EB5A 5HYMA 3AXJB 2GAGB 1T7SA 3PTRB 5HWXA 4ECHA 1OJCA 3UT5E 1L9DA 2C64A 1J1JA 4UF0B 2YLTA 3II4A 2XVJA 1TDNA 2BKOA 4ILUA 3ATQA 1NAAA 2A3DA 5CA1E 4B3ST 5L4EA 5M0ZA 2GB0A 3UOXA 3O4XE 4AT2A 1GESA 2WDQA 2WU2A 3FZMB 5BRTA 2V3BA 3RQWA 4XWRA 2V61A 2RABA 4ASKA 2D5UA 2XQ6A 4J2WA 2QYWA 1D0YA 3EF6A 2J1DG 2BS4A 2XDOA 2M6IA 4UVBB 4OPGA 3MZKB 3LXDA 3LZXA 4P9SA 2R064 1NAFA 2R7FA 1YKJA 3SQPA 3ZYKA 5IUXA 2CULA 1US7B 4EZHA 2XQ8A 2GVCA 2YU2A 4QH5A 4X9NA 3K3OA 1BZLA 1EAH4 4QKNA 4X66T 1IAPA 1JRXA 4HWFA 1FEBA 3CPHG 2DL1A 3SYIA 2NW7A 3LBXA 4Z24A 4HB9A 1PHHA 1RUC4 2IAKA 4LFAT 3F57A 3P7IA 4FDCB 4NXMT 1R8IA 4Z2TA 1QLBA 3EHZA 2PW9A 4CCRA 4PJMA 3O1JA 3LK2B 2B76A 2X0LB 2ZM6T 4OPDA 1VCSA 2WOVA 1E2AA 4DR1T 1CC6A 2OALA 1S2QA 3GD3A 3IF8B 3MK7C 4Q4V4 2HH7A 2BBHA 3FIMB 1XWMA 5H6RB 3OBVE 1MIWA 2BXRA 4UDQA 4OK0A 2XFNA 2WY2A 2QA1A 1BR1A 2OV9A 4YXDA 4H4TA 3DP7A 3GWHA 1OEDE 2W00A 4U2YA 3RC8A 2NP9A 4CBQA 2GMJA 3O0HA 2VVLA 2BS3A 2C76A 3RYHE 4CXXA 4NUUA 4QXHB 3R84B 3PUAA 2JAEA 1NHSA 2EHOC 5TAOA 1Y0PA 4H9PC 3BI2A 4I0UA 4NWZA 4UEMA 2O9ZA 2R6GF 2UUCT 5KVHA 3T37A 5DQVA 3RYCE 2W0GA 3TLSA 3NK0X 4YTPA 4UP3A 4O5QA 1NHPA 1HX8A 4JN9A 2PTFA 2JQ9A 3UKFA 2OA1A 3FZLB 4ZI2C 2SPCA 2PBIA 5ABEA 2R0GA 4BJZA 3ZYLA 4EZ4A 2XAHB 3UTGA 3REDA 1JOAA 2YQUA 5FMHA 1OOPD 1RHI4 3ZN0B 1YW0A 2WP9A 4DSHA 2Z5YA 3RX6A 5AFUL 4YKGA 3ETUA 3J9X1 4NTCA 3FXEB 3KPFA 1T98A 2EX3A 3M3ZB 1MNDA 1N34T 2WOWA 1CF3A 4H9RC 3V3NA 2UXXB 1OEDA 2A2FX 4IT4A 3P4WA 1Z7S4 3E08A 3T1YT 2LOPA 4YLHA 3NHOX 3K1SA 2GQFA 4UF0A 2H7VC 4PFOA 4TLXA 3UP5A 2X9HA 2JB3A 3JC6D 3UKLA 4DBQA 2CXDA 3SFEA 1N4UA 2YM2A 1WYBA 3N9NA 4X1KE 1Z6LA 4U8KA 3T2ZA 1N4VA 3B3RA 3HKBE 1GRFA 3HZLA 3SZFA 2W62A 1GTEA 5DBJA 2ODUA 2E9XD 1PBFA 2R45A 1TDEA 1JNZA 4ZS3A 5HXRA
chains in the Genus database with same CATH topology
4E0VA 3AEAA 1DODA 1P2EA 2BC1A 5JCKA 4EQRA 2EQ6A 1FCDA 3I6DA 3C4AA 3NGCX 4U8JA 3UCLA 2C73A 3KA7A 5IPYA 1PS9A 5KNLA 1B5QA 1VQWA 1CJ2A 2VVLG 4AOSA 3CN8A 5HHFA 2YG7A 1ZP0A 2YG6A 4USRA 5JCLA 4TM4A 1NHQA 4U8NA 1IUUA 4U8IA 4YKFA 2XFPA 3AD7B 2YG5A 1JNRA 1LJ1A 3AE9A 3AEFA 4KX6A 2FJBA 1TRBA 2VRLA 3S5WA 3T31A 3D1CA 2HQMA 1GTHA 2YR6A 4DSGA 3GMCA 4LU6A 2EQ7A 1GRAA 4GRTA 3ALLA 3DA1A 3QVPA 4H7UA 1DOCA 3AEEA 1O94A 4AP1A 4IVOB 3CTYA 4IV9A 4U2LA 4AP3A 4D03A 1TYTA 2RGOA 3FMWA 1D4EA 3UKKA 1IUTA 4O5UA 2JB2A 2A87A 2F5ZA 4U2TA 4B69A 1PXBA 1B37A 5EBKA 4Z26A 2YLSA 2B7SA 2R46A 1ZMDA 1LVLA 1S3BA 3NNEA 3C96A 2WOIA 3IHMA 1ZMCA 2V6OA 3L8KA 2WS3A 3KLJA 4BJYA 3K7MX 2X99A 2BACA 4C3YA 3AYIA 3UP4A 3UOYA 1MXTA 1ZX9A 3NKSA 4BV6A 3LZWA 1GERA 2YVGA 4KPRA 1NDAA 3AE4A 3PO7A 4IVMB 4K8DA 2WESA 1TDFA 4J56A 4J33A 3UKHA 2WQYA 1KDGA 3CGEA 2Q7VA 2WPCA 3HYVA 2WETA 4H4PA 4II2A 4ZCDA 5KMQA 1M64A 3AE1A 1S2YA 2AR8A 2YM1A 4H4QA 1Q1WA 4JNAA 4EM3A 1PJ6A 3PVCA 2E4GA 3DGHA 3LB8A 1CL0A 3UTEA 4Z44A 4M52A 5C3JA 5JCMA 2NPXA 2APGA 3UOZA 4FK1C 5U63A 4OPLA 4U8LA 3SZ0A 4A6NA 1XHCA 2QCUA 1ZDLA 1H86A 1ZOVA 3P4QA 3GD4A 3OZ2A 1B4VA 2WBAA 3GSIA 5GRTA 1OJTA 4A65A 4GAVA 3ZDNA 1X31B 3ABVA 2VZ2A 3CPIG 1D4DA 2XLRA 3P4SA 4BK2A 3B6DA 5EB4A 4A7AA 3T14A 4B1BA 2W0HA 4OVIA 1GRGA 2BK5A 3NLCA 4NEWA 4EIPA 1PN0A 3CGDA 1GRBA 5BVAA 1GREA 3BI5A 1SEZA 4CRTA 2BA9A 2XFQA 3ALJA 5KMSA 5M10A 2ZZ0A 3F8RA 4GDPA 2CFYA 3AE5A 4EIQA 2B9XA 1LPFA 2PHHA 1E1MA 2C70A 4II3A 3KPKA 4YSYA 4REKA 3DJJA 4GF7A 2R0CA 4EM4A 4FX9A 4Y4MA 2YVFA 4PABA 3ITJA 4H2NA 3IF9A 4BK3A 3IHGA 3GQHA 2XLSA 1Q1RA 3DJDA 3F8PA 3IC9A 4H2PA 2ZBWA 3UOVA 1H83A 3EAOA 3URHA 4J57A 1GALA 1BF3A 3BI4A 2IVDA 5FS9A 2YVJA 1O5WA 1DNCA 1N1PA 3M0OA 1CJ4A 1NPXA 3NYFA 5HY5A 1GXFA 2BCPA 1PBBA 4LA1A 3T2KA 2C67A 1LTXR 4GAPA 3NN6X 4NNJA 4YSHA 5KMRA 3GYIA 1L0VA 2GR1A 5JCIA 3AE6A 1YQ4A 5KXJA 1CC4A 1F6MA 2UZZA 1UKVG 5EOWA 3DH9A 5GSNA 3AECA 4NZHA 1FL2A 4XXGA 1CJCA 5J60A 5ER0A 1FEAA 2B9WA 2VQBA 2BRYA 2X8GA 3DMEA 3AE2A 3NN0X 1CC2A 1DOBA 2JKCA 2Y6QA 3UKPA 2XVIA 1F8WA 4IA5A 2FJDA 1K0LA 2RGJA 1QJDA 1ZKQA 2WP6A 2XVFA 4RG3A 5KOXA 4YTNA 2YR4A 1E1LA 1F8RA 2PYXA 3M13A 1OJ9A 3G5QA 4CY8A 1RP0A 3AE3A 2GRTA 2Q0KA 4J31A 1DJQA 1OJDA 1W4XA 3P4PA 2GR3A 4JQ9A 1F8SA 1GEUA 3RNMA 5HXIA 3CNSA 1XPQA 2QA2A 3FPZA 1TDOA 3GYXA 2WEUA 4NEVA 4TM1A 3AEDA 4ICYA 4IA6A 1H7XA 4ADWA 1YQ3A 1RSGA 2CDUA 2OAMA 2AQJA 3DJGX 3H8IA 3KKJA 4B65A 4K5SA 3GQKA 5BUKA 3H4KA 4A79A 3SY4A 2C3DA 4USQA 2H88A 3AE7A 3T0KA 2YAUA 3NTAA 4JY2A 4YSZA 1LQUA 4EMWA 5U1OA 3UKQA 4BURA 1BKWA 4X9MA 4B67A 1COYA 5CKUA 2BK4A 5JCNA 4I59A 3SFDA 3AYLA 1EL7A 4U8OA 3K30A 3CNPA 3NH3X 2A8XA 4APNA 1B8SA 2R4EA 3CGBA 3CNJA 3ALMA 2FBWA 2BRAA 5C2TA 1CBOA 1GV4A 3NTDA 2GH5A 4CY6A 4A5LA 1PXAA 2VOUA 3NK2X 1PJ7A 4OPIA 4G6GA 4A6NB 3CPJG 1GOSA 1N4WA 4H4RA 4Z2RA 2NVKX 4H4UA 2XLPA 3WE0A 2B9YA 1E6EA 1KFYA 1MO9A 4GCMA 2BABA 1H84A 3Q9TA 4CNKA 4EMIA 2WU5A 3QVRA 1OJAA 2V3AA 5FS7A 4Z2UA 2LFCA 1JU2A 2XCGA 4H2RA 1DOEA 1S3EA 3GWDA 1H7WA 1DJNA 1E1KA 3JSKA 2CVJA 2R4JA 1VG9A 4JDRA 3AD8B 4GR1A 2WDVA 1BWCA 4K7ZA 1NENA 3DK4A 3GRSA 2VQ7A 4H4VA 4ZCCA 1RYIA 3P4RA 4C3XA 4Y4LA 3HYWA 4BK1A 2X8HA 2A89A 4FK1A 4N9XA 1ZK7A 2XVHA 4TM3A 3GRTA 1TYPA 4AOXA 3PS9A 4H4XA 3SM8A 5EB5A 5HYMA 3CNDA 2GAGB 3QSMA 4WX1A 5KVIA 4UDPA 3CMMA 4H4SA 2IIDA 2GMHA 4ECHA 4B63A 1E7PA 1OJCA 2C64A 1L9DA 3SGLA 3NT6A 2XFUA 3RP7A 4Z25A 1Y56B 2YLTA 3II4A 1NG3A 2XVJA 1TDNA 2FJAA 1REOA 3ISHA 4YT0A 3ATRA 3ATQA 1NAAA 3L1RA 3BHFA 4G6HA 3QSEA 2Z5XA 2VVMA 1IUVA 4NTEA 1D7LA 5J7XA 1VDCA 3ADAB 5M0ZA 2C3CA 2DKIA 2GB0A 3UOXA 4AT2A 3AB1A 1GESA 2X8CA 4H4WA 2H89A 3DJEA 3R9UA 1D7YA 4U2SA 2WDQA 3GDPA 2WU2A 4RG4A 4U8MA 3GMBA 3VR9A 4OCGA 2RGHA 1IUXA 1K4QA 2YLWA 5BRTA 1KSSA 1H82A 2V3BA 1K0JA 3AXBA 4CNJA 2BYBA 4XWRA 1VRQB 2V61A 2YG4A 1L9EA 2WPEA 2C7GA 2RABA 4A99A 4HA6A 1E39A 2R0PA 1IJHA 2QAEA 2GR2A 4J2WA 4GUVA 1PJ5A 1KSUA 4OPUA 3EF6A 4EQSA 3CGCA 2BS4A 1JEHA 1EL8A 1YY5A 2XDOA 2YLRA 4B68A 3RHAA 5IQ1A 4OPGA 2BS2A 3LZXA 3LXDA 1AOGA 4P9SA 5FS8A 3EANA 1YKJA 3SQPA 3V3OA 4H50A 3HYXA 2CULA 2Y6RA 3KVEA 3COXA 1GNDA 2GVCA 4TLZA 5IQ4A 2C65A 3VRAA 1PXCA 3NG7X 4X9NA 3BNMA 1BZLA 4G9KA 5KOWA 1JRXA 1FEBA 3CPHG 3VR8A 3SYIA 3OC4A 1QO8A 4HB9A 4Z24A 5L46A 1PHHA 1H81A 3QSSA 3VRBA 1XDIA 4J34A 4FDCB 1GT8A 3AYJA 3SXIA 3S61A 4Z2TA 1ZOYA 3FG2P 1QLBA 3AEGA 1GRHA 4CCRA 4H2QA 2BC0A 2B76A 2GQWA 3GWFA 3ICTA 2V5ZA 4LIIA 3E1TA 1PBEA 4OPDA 2WOVA 3NYEA 1CC6A 3ICSA 4OPTA 3UTHA 5U25A 3K7QX 2FJEA 4B64A 2OALA 2V60A 3RP8A 2WHDA 1S2QA 3GD3A 3BHKA 1JRZA 2GEWA 2DKHA 2YLXA 1EBDA 5CQFA 3BNUA 1JRYA 2TPRA 2X3NA 3FIMB 3P1WA 2IVEA 3F8DA 2GR0A 1MOKA 4RSLA 2EQ8A 3UTFA 1FOHA 1O95A 3DK9A 2BXRA 4J36A 3GYJA 4MJWA 4UDQA 2XFNA 1ELIA 1NHRA 2QA1A 4YXDA 4H4TA 1KNPA 1F3PA 4OPCA 4UDRA 3QFAA 4H4YA 2C4CA 4CBQA 1LV0A 2GMJA 2JBVA 3O0HA 2VVLA 2BS3A 3NRNA 1YQZA 2C76A 3AD9B 1CHUA 4YWOA 2ARDA 4I58A 4C77A 5KMPA 2XVEA 4C74A 2OLOA 4ZN0A 2JAEA 1NHSA 3LADA 1FECA 1NEKA 3D8XA 1Y0PA 3M12A 2ACZA 4D04A 2JK6A 3Q6JA 1K0IA 1EL5A 2C75A 2BCGG 2Q6UA 3CNTA 3P9UA 2XYOA 4XWZA 1IUSA 2XLTA 1LQTA 2B7RA 3BI2A 4DNAA 4EQXA 3SUCA 4NWZA 3QJ4A 3V76A 1H6VA 2O9ZA 3H8LA 3NIXA 4G74A 1E1NA 2AAQA 1GPEA 3EPTA 3IWAA 4WCTA 5KVHA 1V59A 3T37A 1DXLA 3AE8A 1KNRA 1IUWA 3NK0X 1D4CA 4Y4NA 5TR3A 4YTPA 4YSXA 3LOVA 4UP3A 3NK1X 4O5QA 1D5TA 1EL9A 1NG4A 1NHPA 3FBSA 3SX6A 4EMJA 2YWLA 4Z43A 4JN9A 3LJPA 3SZCA 5KRQA 4JNQA 2OA1A 3UKFA 3AEBA 3RP6A 2OLNA 1PDHA 1GRTA 2XFOA 4K5RA 2R0GA 4BJZA 3SZWA 4DGKA 4H4ZA 5LV9A 2E5VA 1ZY8A 3UTGA 3REDA 1JOAA 1GETA 2YQUA 5FMHA 2GV8A 3KU9A 4JY3A 2E1MA 3DK8A 2WP9A 4DSHA 2Z5YA 1CJ3A 2YG3A 2YLZA 3UKAA 1KF6A 4C5OA 4YKGA 1PBDA 2R9ZA 2JB1A 2XLUA 1ONFA 4NTCA 4PAAA 4GDEA 3KPFA 2I0ZA 2WP5A 4EQWA 4X4JA 4TM0A 3C4NA 4K2XA 3ICRA 1VG0A 2WOWA 1CF3A 2VRMA 4G73A 4NTDA 4CCQA 2WDRA 3V3NA 3VQRA 3T2YA 1HYUA 2BXSA 2X50A 3DGZA 4YTMA 3NHOX 2GQFA 1BGNA 1Y56A 3G5SA 2ZZCA 3GDNA 2Q0LA 4K22A 4A9WA 2C72A 4TLXA 3UP5A 3VRDB 2JB3A 2GF3A 3UKLA 1Q9IA 4AT0A 3ZYXA 3SFEA 1N4UA 2J3NA 2YM2A 1XANA 1Z6LA 4U8KA 3T2ZA 1N4VA 1PBCA 2WPFA 4B66A 3B3RA 1GRFA 3AWIA 2C66A 3HZLA 2ZZBA 3CIRA 1BGJA 5BULA 3SZFA 1P2HA 3K7TA 2YR5A 1GSNA 1GTEA 3G5RA 5DBJA 3I3LA 1L9CA 2EQ9A 1PBFA 2TMDA 5FS6A 2R45A 1TDEA 1JNZA 4U8PA 5KWFA 2GAHB 3NYCA 3KD9A 1TDKA 1M6IA 3QFBA 2BK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0V A;  3AEA A;  1DOD A;  1P2E A;  2BC1 A;  5JCK A;  4EQR A;  2EQ6 A;  1FCD A;  3I6D A;  3C4A A;  3NGC X;  4U8J A;  3UCL A;  2C73 A;  3KA7 A;  5IPY A;  1PS9 A;  1B5Q A;  1VQW A;  1CJ2 A;  2VVL G;  4AOS A;  3CN8 A;  5HHF A;  2YG7 A;  1ZP0 A;  2YG6 A;  4USR A;  5JCL A;  4TM4 A;  1NHQ A;  4U8N A;  1IUU A;  4U8I A;  4YKF A;  2XFP A;  3AD7 B;  2YG5 A;  1JNR A;  1LJ1 A;  3AE9 A;  3AEF A;  4KX6 A;  2FJB A;  1TRB A;  2VRL A;  3S5W A;  3D1C A;  2HQM A;  1GTH A;  2YR6 A;  4DSG A;  3GMC A;  4LU6 A;  2EQ7 A;  1GRA A;  4GRT A;  3ALL A;  3DA1 A;  3QVP A;  4H7U A;  1DOC A;  3AEE A;  1O94 A;  4AP1 A;  4IVO B;  3CTY A;  4IV9 A;  4U2L A;  4AP3 A;  4D03 A;  1TYT A;  2RGO A;  3FMW A;  1D4E A;  3UKK A;  1IUT A;  4O5U A;  2JB2 A;  2A87 A;  2F5Z A;  4U2T A;  4B69 A;  1PXB A;  1B37 A;  5EBK A;  4Z26 A;  2YLS A;  2B7S A;  2R46 A;  1ZMD A;  1LVL A;  1S3B A;  3NNE A;  3C96 A;  2WOI A;  3IHM A;  1ZMC A;  2V6O A;  3L8K A;  2WS3 A;  3KLJ A;  4BJY A;  3K7M X;  2X99 A;  2BAC A;  4C3Y A;  3AYI A;  3UP4 A;  3UOY A;  1MXT A;  1ZX9 A;  3NKS A;  4BV6 A;  3LZW A;  1GER A;  2YVG A;  4KPR A;  1NDA A;  3AE4 A;  3PO7 A;  4IVM B;  4K8D A;  2WES A;  1TDF A;  4J56 A;  4J33 A;  3UKH A;  2WQY A;  1KDG A;  3CGE A;  2Q7V A;  2WPC A;  4H4P A;  2WET A;  4ZCD A;  1M64 A;  3AE1 A;  1S2Y A;  2AR8 A;  2YM1 A;  4H4Q A;  1Q1W A;  4JNA A;  4EM3 A;  1PJ6 A;  3PVC A;  2E4G A;  3DGH A;  3LB8 A;  1CL0 A;  3UTE A;  4Z44 A;  4M52 A;  5C3J A;  5JCM A;  2NPX A;  2APG A;  3UOZ A;  4FK1 C;  5U63 A;  4OPL A;  4U8L A;  4A6N A;  1XHC A;  2QCU A;  1ZDL A;  1H86 A;  1ZOV A;  3P4Q A;  3GD4 A;  3OZ2 A;  1B4V A;  2WBA A;  3GSI A;  5GRT A;  1OJT A;  4A65 A;  3ZDN A;  1X31 B;  3ABV A;  2VZ2 A;  3CPI G;  1D4D A;  2XLR A;  3P4S A;  4BK2 A;  3B6D A;  5EB4 A;  4A7A A;  4B1B A;  2W0H A;  4OVI A;  1GRG A;  2BK5 A;  3NLC A;  4NEW A;  4EIP A;  1PN0 A;  3CGD A;  1GRB A;  5BVA A;  1GRE A;  3BI5 A;  1SEZ A;  4CRT A;  2BA9 A;  2XFQ A;  3ALJ A;  5M10 A;  2ZZ0 A;  3F8R A;  4GDP A;  2CFY A;  3AE5 A;  4EIQ A;  2B9X A;  1LPF A;  2PHH A;  1E1M A;  2C70 A;  4YSY A;  4REK A;  3DJJ A;  4GF7 A;  2R0C A;  4EM4 A;  4FX9 A;  4Y4M A;  2YVF A;  4PAB A;  3ITJ A;  4H2N A;  3IF9 A;  4BK3 A;  3IHG A;  3GQH A;  2XLS A;  1Q1R A;  3DJD A;  3F8P A;  3IC9 A;  4H2P A;  2ZBW A;  3UOV A;  1H83 A;  3EAO A;  3URH A;  4J57 A;  1GAL A;  1BF3 A;  3BI4 A;  2IVD A;  5FS9 A;  2YVJ A;  1O5W A;  1DNC A;  1N1P A;  3M0O A;  1CJ4 A;  1NPX A;  3NYF A;  5HY5 A;  1GXF A;  2BCP A;  1PBB A;  4LA1 A;  2C67 A;  1LTX R;  3NN6 X;  4YSH A;  3GYI A;  1L0V A;  2GR1 A;  5JCI A;  3AE6 A;  1YQ4 A;  5KXJ A;  1CC4 A;  1F6M A;  2UZZ A;  1UKV G;  5EOW A;  3DH9 A;  5GSN A;  3AEC A;  4NZH A;  1FL2 A;  4XXG A;  1CJC A;  5J60 A;  5ER0 A;  1FEA A;  2B9W A;  2VQB A;  2X8G A;  3DME A;  3AE2 A;  3NN0 X;  1CC2 A;  1DOB A;  2JKC A;  2Y6Q A;  3UKP A;  2XVI A;  1F8W A;  4IA5 A;  2FJD A;  1K0L A;  2RGJ A;  1QJD A;  1ZKQ A;  2WP6 A;  2XVF A;  4RG3 A;  5KOX A;  4YTN A;  2YR4 A;  1E1L A;  1F8R A;  2PYX A;  3M13 A;  1OJ9 A;  3G5Q A;  4CY8 A;  1RP0 A;  3AE3 A;  2GRT A;  2Q0K A;  4J31 A;  1DJQ A;  1OJD A;  1W4X A;  3P4P A;  2GR3 A;  4JQ9 A;  1F8S A;  1GEU A;  3RNM A;  5HXI A;  3CNS A;  1XPQ A;  2QA2 A;  3FPZ A;  1TDO A;  4NEV A;  2WEU A;  4TM1 A;  3GYX A;  3AED A;  4ICY A;  4IA6 A;  1H7X A;  4ADW A;  1YQ3 A;  1RSG A;  2CDU A;  2OAM A;  2AQJ A;  3DJG X;  3H8I A;  3KKJ A;  4B65 A;  4K5S A;  3GQK A;  5BUK A;  3H4K A;  4A79 A;  2C3D A;  4USQ A;  2H88 A;  3AE7 A;  2YAU A;  3NTA A;  4JY2 A;  4YSZ A;  1LQU A;  4EMW A;  5U1O A;  3UKQ A;  4BUR A;  1BKW A;  4X9M A;  4B67 A;  1COY A;  5CKU A;  2BK4 A;  5JCN A;  4I59 A;  3SFD A;  3AYL A;  1EL7 A;  4U8O A;  3K30 A;  3CNP A;  3NH3 X;  2A8X A;  4APN A;  1B8S A;  2R4E A;  3CGB A;  3CNJ A;  3ALM A;  2FBW A;  5C2T A;  1CBO A;  1GV4 A;  3NTD A;  2GH5 A;  4CY6 A;  4A5L A;  1PXA A;  2VOU A;  3NK2 X;  1PJ7 A;  4OPI A;  4A6N B;  4Z2R A;  3CPJ G;  1GOS A;  1N4W A;  4H4R A;  2NVK X;  4H4U A;  2XLP A;  3WE0 A;  2B9Y A;  1E6E A;  1KFY A;  1MO9 A;  4GCM A;  2BAB A;  1H84 A;  3Q9T A;  4CNK A;  4EMI A;  2WU5 A;  3QVR A;  1OJA A;  2V3A A;  5FS7 A;  4Z2U A;  2LFC A;  1JU2 A;  2XCG A;  4H2R A;  1DOE A;  1S3E A;  3GWD A;  1H7W A;  1DJN A;  1E1K A;  3JSK A;  2CVJ A;  2R4J A;  1VG9 A;  4JDR A;  3AD8 B;  4GR1 A;  2WDV A;  1BWC A;  4K7Z A;  1NEN A;  3DK4 A;  3GRS A;  2VQ7 A;  4H4V A;  4ZCC A;  1RYI A;  3P4R A;  4C3X A;  4Y4L A;  4BK1 A;  2X8H A;  2A89 A;  4FK1 A;  4N9X A;  1ZK7 A;  2XVH A;  4TM3 A;  3GRT A;  1TYP A;  4AOX A;  3PS9 A;  4H4X A;  3SM8 A;  5EB5 A;  5HYM A;  3CND A;  2GAG B;  3QSM A;  4WX1 A;  5KVI A;  4UDP A;  4H4S A;  2IID A;  2GMH A;  4ECH A;  4B63 A;  1E7P A;  1OJC A;  2C64 A;  1L9D A;  3SGL A;  3NT6 A;  2XFU A;  3RP7 A;  4Z25 A;  1Y56 B;  2YLT A;  3II4 A;  1NG3 A;  2XVJ A;  1TDN A;  2FJA A;  1REO A;  3ISH A;  4YT0 A;  3ATR A;  3ATQ A;  1NAA A;  3L1R A;  3BHF A;  3QSE A;  2Z5X A;  2VVM A;  1IUV A;  4NTE A;  1D7L A;  5J7X A;  1VDC A;  3ADA B;  5M0Z A;  2C3C A;  2DKI A;  2GB0 A;  3UOX A;  4AT2 A;  3AB1 A;  1GES A;  2X8C A;  4H4W A;  2H89 A;  3DJE A;  3R9U A;  1D7Y A;  4U2S A;  2WDQ A;  3GDP A;  2WU2 A;  4RG4 A;  4U8M A;  3GMB A;  3VR9 A;  4OCG A;  2RGH A;  1IUX A;  1K4Q A;  2YLW A;  5BRT A;  1KSS A;  1H82 A;  2V3B A;  1K0J A;  3AXB A;  4CNJ A;  2BYB A;  4XWR A;  1VRQ B;  2V61 A;  2YG4 A;  1L9E A;  2WPE A;  2C7G A;  2RAB A;  4A99 A;  4HA6 A;  1E39 A;  2R0P A;  1IJH A;  2QAE A;  2GR2 A;  4J2W A;  4GUV A;  1PJ5 A;  1KSU A;  4OPU A;  3EF6 A;  4EQS A;  3CGC A;  2BS4 A;  1JEH A;  1EL8 A;  1YY5 A;  2XDO A;  2YLR A;  4B68 A;  3RHA A;  5IQ1 A;  4OPG A;  2BS2 A;  3LZX A;  3LXD A;  1AOG A;  4P9S A;  5FS8 A;  3EAN A;  1YKJ A;  3SQP A;  3V3O A;  4H50 A;  2CUL A;  2Y6R A;  3KVE A;  3COX A;  1GND A;  2GVC A;  4TLZ A;  5IQ4 A;  2C65 A;  3VRA A;  1PXC A;  3NG7 X;  4X9N A;  3BNM A;  1BZL A;  5KOW A;  1JRX A;  1FEB A;  3CPH G;  3VR8 A;  3OC4 A;  1QO8 A;  4HB9 A;  4Z24 A;  5L46 A;  1PHH A;  1H81 A;  3QSS A;  3VRB A;  1XDI A;  4J34 A;  4FDC B;  1GT8 A;  3AYJ A;  3S61 A;  4Z2T A;  1ZOY A;  3FG2 P;  1QLB A;  3AEG A;  1GRH A;  4CCR A;  4H2Q A;  2BC0 A;  2B76 A;  2GQW A;  3GWF A;  3ICT A;  2V5Z A;  4LII A;  3E1T A;  1PBE A;  4OPD A;  2WOV A;  3NYE A;  1CC6 A;  3ICS A;  4OPT A;  3UTH A;  5U25 A;  3K7Q X;  2FJE A;  4B64 A;  2OAL A;  2V60 A;  3RP8 A;  2WHD A;  1S2Q A;  3GD3 A;  3BHK A;  1JRZ A;  2GEW A;  2DKH A;  2YLX A;  1EBD A;  5CQF A;  3BNU A;  1JRY A;  2TPR A;  2X3N A;  3FIM B;  3P1W A;  2IVE A;  3F8D A;  2GR0 A;  1MOK A;  4RSL A;  2EQ8 A;  3UTF A;  1FOH A;  1O95 A;  3DK9 A;  2BXR A;  4J36 A;  3GYJ A;  4MJW A;  4UDQ A;  2XFN A;  1ELI A;  1NHR A;  2QA1 A;  4YXD A;  4H4T A;  1KNP A;  1F3P A;  4OPC A;  4UDR A;  3QFA A;  4H4Y A;  4CBQ A;  1LV0 A;  2GMJ A;  2JBV A;  3O0H A;  2VVL A;  2BS3 A;  3NRN A;  1YQZ A;  2C76 A;  3AD9 B;  1CHU A;  4YWO A;  2ARD A;  4I58 A;  4C77 A;  2XVE A;  4C74 A;  2OLO A;  4ZN0 A;  2JAE A;  1NHS A;  3LAD A;  1FEC A;  1NEK A;  3D8X A;  1Y0P A;  3M12 A;  2ACZ A;  4D04 A;  2JK6 A;  3Q6J A;  1K0I A;  1EL5 A;  2C75 A;  2BCG G;  2Q6U A;  3CNT A;  3P9U A;  2XYO A;  4XWZ A;  1IUS A;  2XLT A;  1LQT A;  2B7R A;  3BI2 A;  4DNA A;  4EQX A;  3SUC A;  3QJ4 A;  3V76 A;  1H6V A;  2O9Z A;  3H8L A;  3NIX A;  1E1N A;  2AAQ A;  1GPE A;  3EPT A;  3IWA A;  4WCT A;  5KVH A;  1V59 A;  3T37 A;  1DXL A;  3AE8 A;  1KNR A;  1IUW A;  3NK0 X;  1D4C A;  4Y4N A;  5TR3 A;  4YTP A;  4YSX A;  3LOV A;  4UP3 A;  3NK1 X;  4O5Q A;  1D5T A;  1EL9 A;  1NG4 A;  1NHP A;  3FBS A;  4EMJ A;  4Z43 A;  2YWL A;  4JN9 A;  3LJP A;  5KRQ A;  4JNQ A;  2OA1 A;  3UKF A;  3AEB A;  3RP6 A;  2OLN A;  1PDH A;  1GRT A;  2XFO A;  4K5R A;  2R0G A;  4BJZ A;  4DGK A;  4H4Z A;  5LV9 A;  2E5V A;  1ZY8 A;  3UTG A;  3RED A;  1JOA A;  1GET A;  2YQU A;  5FMH A;  2GV8 A;  3KU9 A;  4JY3 A;  2E1M A;  3DK8 A;  2WP9 A;  4DSH A;  2Z5Y A;  1CJ3 A;  2YG3 A;  2YLZ A;  3UKA A;  1KF6 A;  4C5O A;  4YKG A;  1PBD A;  2R9Z A;  2JB1 A;  2XLU A;  1ONF A;  4NTC A;  4PAA A;  4GDE A;  3KPF A;  2I0Z A;  2WP5 A;  4EQW A;  4X4J A;  4TM0 A;  3C4N A;  4K2X A;  3ICR A;  1VG0 A;  2WOW A;  1CF3 A;  2VRM A;  4NTD A;  4CCQ A;  2WDR A;  3V3N A;  3VQR A;  1HYU A;  2BXS A;  2X50 A;  3DGZ A;  4YTM A;  3NHO X;  2GQF A;  1BGN A;  1Y56 A;  3G5S A;  2ZZC A;  3GDN A;  2Q0L A;  4K22 A;  4A9W A;  2C72 A;  4TLX A;  3UP5 A;  3VRD B;  2JB3 A;  2GF3 A;  3UKL A;  1Q9I A;  4AT0 A;  3ZYX A;  3SFE A;  1N4U A;  2J3N A;  2YM2 A;  1XAN A;  1Z6L A;  4U8K A;  1N4V A;  1PBC A;  2WPF A;  4B66 A;  3B3R A;  1GRF A;  3AWI A;  2C66 A;  3HZL A;  2ZZB A;  3CIR A;  1BGJ A;  5BUL A;  1P2H A;  3K7T A;  2YR5 A;  1GSN A;  1GTE A;  3G5R A;  5DBJ A;  3I3L A;  1L9C A;  2EQ9 A;  1PBF A;  2TMD A;  5FS6 A;  2R45 A;  1TDE A;  1JNZ A;  4U8P A;  5KWF A;  2GAH B;  3NYC A;  3KD9 A;  1TDK A;  1M6I A;  3QFB A;  2BK3 A; 
#chains in the Genus database with same CATH topology
 3ZPO A;  4EQR A;  2MYS A;  3C4A A;  3NVO A;  3KA7 A;  4A97 A;  1PS9 A;  3T1H T;  1VQW A;  1D1C A;  4OHF A;  3VHL A;  4JI4 T;  2VVL G;  4USR A;  5JCL A;  4TM4 A;  1NHQ A;  3N2G E;  3WI3 A;  3ANW B;  1LJ1 A;  4KX6 A;  3N9L A;  1HX1 B;  3S5W A;  1GTH A;  3GMC A;  3KV4 A;  1DOC A;  3S4U A;  2BG9 C;  3CTY A;  4QHO A;  3UKK A;  2V6Y A;  4EIW A;  1V9D A;  3ZKR A;  3PUG A;  5EBK A;  2YLS A;  2B7S A;  3K3N A;  1LVL A;  2AE9 A;  3PJA A;  2WOI A;  2KND A;  1XMO T;  2JPF A;  2W4X A;  2BAC A;  4C3Y A;  3AYI A;  1MMA A;  1XNR T;  2XUE A;  4X65 T;  1MMD A;  2N9D A;  2VQF T;  4CN4 A;  2QA7 A;  5KMQ A;  3AE1 A;  3C4Z A;  4TWF A;  4EM3 A;  1T8B A;  3PVC A;  2E4G A;  1Y64 B;  3FB2 A;  5JCM A;  1RUH 4;  2JQK A;  2APG A;  5U63 A;  4HWC A;  2NWB A;  5FY7 A;  2V6X A;  1ZDL A;  1XZY A;  1H86 A;  3GD4 A;  4A65 A;  1B4V A;  2WBA A;  3ZJ1 A;  5GRT A;  3ZDN A;  4JI5 T;  2KT9 A;  3ZT5 A;  2C5I T;  2ZM2 A;  3T14 A;  4IDN A;  3MKD A;  2CM0 A;  3RH3 A;  4X62 T;  4HWH A;  4B1B A;  4EIP A;  1RMU 4;  2CLY C;  3ETV A;  5FY1 A;  3I9Y A;  4PW8 A;  3BI5 A;  4P0A A;  2XFQ A;  5KMS A;  2CWO A;  4EB6 E;  4FI5 A;  2HWB 4;  4JUY A;  2NOX A;  4TX5 A;  5KX5 E;  1E1M A;  2C70 A;  2MBG A;  4DMW A;  4YSY A;  3UUX B;  4EM4 A;  1NCQ D;  3ITJ A;  1AR7 4;  1Q1R A;  4H2P A;  3UOV A;  4J57 A;  1GAL A;  5BR8 T;  3I0Q A;  1HCI A;  5FS9 A;  4EOZ B;  1DNC A;  3KDS E;  1CJ4 A;  3CX6 B;  5EK2 A;  3IHR A;  4CI1 B;  1LTX R;  2G0U A;  3NN6 X;  3AA7 B;  4NNJ A;  1IZN B;  2X68 A;  2XPK A;  4X5T A;  1HRV 4;  2XQ5 A;  1F6M A;  3B5M A;  1UKV G;  4Z91 A;  2IIU A;  1XDP A;  4XAX B;  2N1G A;  4DO0 A;  2B9W A;  2X8G A;  4O8S A;  5CGM A;  4JYA T;  1DOB A;  1HF8 A;  2FJD A;  4JEH B;  4HFV A;  2RGJ A;  2XVF A;  2LJL A;  3N5L A;  4EXT A;  4YTN A;  1F8R A;  3M13 A;  1UUS A;  1MQT D;  4J31 A;  3DJB A;  4U7Y A;  1W4X A;  1RUD 4;  1F8S A;  5HXI A;  1XPQ A;  2QA2 A;  3GYX A;  4TM1 A;  4GKJ T;  4IA6 A;  1RSG A;  2OAM A;  1J5E T;  2AQJ A;  4O4J E;  4K5S A;  2H88 A;  2YAU A;  4JY2 A;  4DV1 T;  1LQU A;  3UKQ A;  4BUR A;  3UU3 A;  3RYF E;  2K24 A;  4GK5 E;  4ZI2 D;  5CKU A;  5ABF B;  2WZI A;  1VOM A;  1EL7 A;  4O2A E;  4U8O A;  2XQY A;  2A8X A;  3JD7 4;  3CGB A;  2RPA A;  3ZT6 A;  2ZM8 A;  3UFE A;  5HWY A;  2GH5 A;  4CY6 A;  1G73 A;  2LHR A;  3QOF A;  4A5L A;  1Z0P A;  1PXA A;  1PJ7 A;  3WE0 A;  1MO9 A;  5FL0 A;  3RQU A;  4GCM A;  1H84 A;  2BVM A;  4DR6 T;  1XHX A;  2VL0 A;  4QH1 A;  5L4H A;  2YDQ A;  3R6N A;  1JU2 A;  4X64 T;  1H7W A;  3JSK A;  1E1K A;  4JDR A;  2RM2 4;  4DUY T;  4HFH A;  3I1A A;  3BQI A;  4ZOL E;  4GR1 A;  2WDV A;  4BA9 A;  3CK6 A;  3Q5D A;  3KVB A;  3DK4 A;  4H4V A;  4ZCC A;  1RYI A;  4C3X A;  4LFB T;  4E7Z A;  4BK1 A;  4N9X A;  1ZK7 A;  1TYP A;  5KVI A;  1N32 T;  3CMM A;  2WB5 A;  4H4S A;  5J0Z A;  4IDQ A;  4B63 A;  1E7P A;  4Z25 A;  4U72 A;  4JI8 T;  2V7I A;  5FXV A;  2XHE B;  1W0B A;  2X51 A;  3L1R A;  2I59 A;  3EUH A;  2DWG A;  3BHF A;  4G6H A;  5BMV E;  1VBC 4;  5ADX L;  3OKQ A;  2C3C A;  2X8C A;  4H4W A;  4CN1 A;  2H89 A;  3DJE A;  3R9U A;  1D7Y A;  2KMF A;  4U2S A;  2YDS A;  4LF5 T;  5FMN A;  5HEG A;  4QXB B;  4OCG A;  3PUW F;  1K4Q A;  1H7C A;  1KSS A;  3AXB A;  3C98 B;  4DV5 T;  2BYB A;  4JBW F;  2NTY A;  5LJN A;  1L9E A;  4HA6 A;  2HPJ A;  1PIV 4;  1E39 A;  2MAW A;  3FHN A;  4A5X A;  1PJ5 A;  1KSU A;  4EQS A;  3CGC A;  2YLR A;  3RKG A;  1AOG A;  2BS2 A;  3FZF B;  4H9N C;  4QX8 B;  2WM9 A;  2VVS A;  3ZLI A;  1EZ3 A;  4LML A;  3KVE A;  1MMN A;  1UK5 A;  1GND A;  5IQ4 A;  2C65 A;  1HTJ F;  4UIG A;  5HXS A;  2LRK A;  2WWU A;  3PU8 A;  2XSB A;  2V26 A;  2Q9Q D;  3C64 A;  3SRZ A;  3FBZ A;  3RHW A;  1XDI A;  2ACX A;  2PFV A;  3SXI A;  4DR2 T;  3RIF A;  3UU6 A;  3MA9 A;  3AEG A;  5J2T E;  3TLT A;  3GWF A;  4LII A;  5ABG A;  3JC6 C;  4OPT A;  5F8P A;  3UTH A;  5U25 A;  2FJE A;  4B64 A;  3RP8 A;  2WHD A;  2PZS A;  1JRZ A;  2DKH A;  2YLX A;  2IW5 B;  1JRY A;  3BNU A;  2TPR A;  2JMK A;  5CFB A;  2X3N A;  2EHO B;  4ERR A;  3B57 A;  2IVE A;  3UTF A;  4HN9 A;  4J36 A;  4WBO A;  3GYJ A;  2E9X C;  1NHR A;  2CHO A;  4BAY B;  4H9S E;  4AQF A;  1W9R A;  1F3P A;  4OPC A;  4UDR A;  3L09 A;  1LV0 A;  2JBV A;  2ZLY A;  1YQZ A;  2LT3 A;  2JJ9 A;  4I58 A;  4C77 A;  5KMP A;  2BDE A;  2XVE A;  3D8X A;  1AL2 4;  2YIN A;  4UR9 A;  4L0R A;  3AA0 B;  1HXS 4;  5FVK A;  2C5J A;  2C75 A;  2XLT A;  1LQT A;  2B7R A;  3N2O A;  3QJ4 A;  4Q4X 4;  1AR9 4;  3H8L A;  3NIX A;  4EYY R;  1E1N A;  4WCT A;  2R04 4;  2VK9 A;  2K5B B;  1DXL A;  1KNR A;  4Y4N A;  3IA3 A;  4YSX A;  3HI2 A;  4TV9 E;  3JBG 4;  3SZC A;  4JNQ A;  4PJL A;  3RP6 A;  1PDH A;  3M65 A;  1GRT A;  4DGK A;  5LV9 A;  2E5V A;  1GET A;  2AXD S;  2QRX A;  3KU9 A;  2E1M A;  3DK8 A;  2NW8 A;  2YLZ A;  3UKA A;  3ZMS B;  2JB1 A;  1EV1 4;  1ONF A;  3KFW X;  4CI3 B;  3ONL C;  4PFP A;  3EAM A;  2I0Z A;  4U3C A;  2HN1 A;  3C4N A;  4K2X A;  1VG0 A;  2W2U A;  4H63 V;  4G73 A;  4NTD A;  4CCQ A;  3T2Y A;  5HEH A;  1AR6 4;  4DV2 T;  4Z90 A;  2R07 4;  3DGZ A;  4YTM A;  2P9B A;  3CVR A;  2Q0L A;  4H63 H;  1FMW A;  3QB5 K;  4EAH A;  2GF3 A;  1VBA 4;  3PV0 F;  4K0K T;  2V7L A;  2VKO A;  1VCT A;  2Y8D A;  1IBK T;  3ZYX A;  3RYI E;  2WPF A;  4H9O C;  3AWI A;  2ZZB A;  3LK3 B;  4I55 E;  1P2H A;  3K7T A;  3QB5 A;  3G5R A;  3NWI A;  4AKI A;  5DQW A;  2EQ9 A;  2XAF B;  2KIN B;  2J62 A;  3NYC A;  3KD9 A;  2C3D A;  3QFB A;  5JVD E;  3AEA A;  2RS5 4;  1DOD A;  5LCY A;  5JCK A;  2BG9 B;  2H7O A;  1UGO A;  5JRC A;  4JI0 T;  4U8J A;  1VBB 4;  5KNL A;  1ZKE A;  4AXP A;  5DAB A;  1S35 A;  2YG6 A;  4YKF A;  3GN5 B;  1JNR A;  3AE9 A;  3AEF A;  1TRB A;  1SUM B;  2FJB A;  3T31 A;  3D1C A;  4RHV 4;  2YR6 A;  4DV3 T;  4GRT A;  3DA1 A;  4U2L A;  4A56 A;  1TYT A;  1MNE A;  3OYZ A;  1D4E A;  3RRW A;  3UUL A;  3HA4 A;  2JB2 A;  2A87 A;  4U2T A;  3VU7 H;  1HNX T;  3NKZ A;  1PXB A;  3EDU A;  5L3G B;  1S3B A;  3X1D A;  3IHM A;  4CXY A;  3L8K A;  4BJY A;  3K7M X;  5AQS B;  3NKS A;  1SE7 A;  4F8H A;  5LMN T;  2YVG A;  3TLW A;  3K3Q C;  1NDA A;  3PO7 A;  4KPR A;  2WES A;  3ZMT B;  5AQL B;  4J56 A;  5JR9 A;  2CBI A;  2Q7V A;  2WPC A;  1ZEE A;  2X67 A;  2CLY B;  2EHO A;  2I0M A;  2AR8 A;  1RUF 4;  2UXC T;  2CPT A;  1PJ6 A;  3DGH A;  4BJN A;  2H3R A;  4M52 A;  4Q4Y 4;  1M62 A;  3EVY A;  3E22 E;  2XM2 A;  4U8L A;  4A6N A;  2QCU A;  4IDO A;  3OZ2 A;  3GSI A;  4C91 A;  4YHJ A;  5EZY E;  1X31 B;  2VZ2 A;  3CPI G;  1D4D A;  4BK2 A;  5KDM C;  3B6D A;  1WCR A;  1D0X A;  2F4V T;  4A7A A;  2W67 A;  4ADZ A;  2W0H A;  5L3C B;  3NLC A;  3ZEF B;  3G06 A;  2BA9 A;  3Q2M A;  1PVC 4;  1YKH B;  2NTX A;  4I50 E;  5L3B B;  4NUV A;  2ZZ0 A;  2CFY A;  2CA5 A;  4Q4W 4;  2B9X A;  1LPF A;  2PHH A;  1BR4 A;  4JLE A;  4IE7 A;  3SWH A;  2C0S A;  4II3 A;  4REK A;  2R0C A;  2J47 A;  3AXJ A;  3FZH B;  5AQH B;  1W09 A;  5LGU B;  2W61 A;  3BI4 A;  3FXD B;  4KBM B;  3ZSS A;  1R08 4;  5FY0 A;  1HFA A;  5AQQ B;  1N33 T;  1N1P A;  1KEY A;  2CXL A;  2BCP A;  1PBB A;  5LJM A;  4LA1 A;  1OED C;  4GAP A;  2X0H A;  5JDG A;  3GYI A;  2VKJ A;  4XZC A;  1L0V A;  2GR1 A;  5JCI A;  3AE6 A;  4PJJ A;  4IE5 A;  2PJQ A;  2X66 A;  3DH9 A;  2YOE A;  4DVD A;  4XXG A;  1FL2 A;  2LLY A;  5ER0 A;  4AQG A;  2VQB A;  4TN7 B;  1AJ3 A;  1Y01 A;  4JV5 T;  2JKC A;  3UUN A;  4KUM B;  2CCQ A;  4ILB A;  4IA5 A;  4NPP A;  3UTK A;  2CXF A;  1QJD A;  4TNW A;  1ZKQ A;  4RG3 A;  3N9M A;  4ZS2 A;  1E1L A;  3PUV F;  2LM2 A;  4OYJ A;  3AE3 A;  2GRT A;  4JI7 T;  1GQE A;  3UUB A;  3P4P A;  4F6R C;  1BR0 A;  3NZP A;  1OJD A;  5AQR B;  4TZ4 C;  3PUS A;  3CNS A;  2WEU A;  2LKH A;  1H8T D;  4U7I A;  1YQ3 A;  2CDU A;  3H4K A;  4USQ A;  3JAF A;  1D1B A;  1UCU A;  4HWD A;  1VBD 4;  3NTA A;  4YSZ A;  3AAI A;  3EAB A;  3F2E A;  4B67 A;  3RKO A;  4UEL A;  3PJA J;  1COY A;  5JCN A;  4I59 A;  3SFD A;  1OWA A;  2L8K A;  4EYU A;  3CWZ B;  3NH3 X;  4APN A;  4CZZ B;  4HFB A;  2N2N A;  3ALM A;  4OYK A;  1CBO A;  4JI2 T;  2Q9Q C;  4DR4 T;  1HR0 T;  3NK2 X;  3CQX C;  1GOS A;  1N4W A;  2WBL A;  4M1P A;  4H4R A;  3GN5 A;  5CA0 E;  2XLP A;  1E6E A;  2NW9 A;  3KV9 A;  2XTL A;  3N2K E;  4QXC B;  2CMR A;  4CNK A;  2WU5 A;  4ZZB A;  1OJA A;  3QC9 A;  3OPC A;  2LFC A;  3AD8 B;  4GYS A;  2IHR 1;  4IE4 A;  2A9U A;  3NRY A;  2YU1 A;  2I6H A;  3GRS A;  3KV6 A;  2W63 A;  3HYW A;  2PYL A;  2X8H A;  3SM8 A;  4L5G A;  3CND A;  3QSM A;  5LB7 B;  4WX1 A;  3UU5 A;  2WCA A;  4G2A A;  1LVK A;  3IEE A;  3ZMZ B;  4B3M T;  1J5W A;  2UUA T;  5FXX A;  3SGL A;  1UX5 A;  3RP7 A;  1Y56 B;  5AQT B;  2LSG A;  2FJA A;  4X1Y E;  4KMC A;  4YT0 A;  3ISH A;  3ATR A;  2WMN A;  2LHN A;  5JDL A;  4OX9 T;  3QSE A;  2VVM A;  5AQJ B;  4NTE A;  1D7L A;  5J7X A;  1VDC A;  2JIW A;  2LOS A;  3N9O A;  2DKI A;  5FYM A;  3GDP A;  2VL8 A;  5L47 A;  3GMB A;  1K5M D;  2HN2 A;  2X9W A;  2RGH A;  1H82 A;  1K0J A;  4CNJ A;  2BKN A;  1VRQ B;  5E0O A;  2YG4 A;  2WPE A;  3HR0 A;  5DJQ C;  2X9Y A;  1NWM X;  2DHR A;  4DND A;  3ZC0 A;  2R0P A;  1D4M 4;  2GR2 A;  4GUV A;  4OPU A;  1FJG T;  1JEH A;  1EL8 A;  3RIU A;  5FS8 A;  4U2Z A;  3EAN A;  4IST A;  2V1D B;  5CB4 E;  4IL9 A;  3HYX A;  5IHY A;  3C51 A;  3COX A;  4TLZ A;  3F31 A;  1PXC A;  4EED A;  3PUX F;  4OFZ A;  5KOW A;  4QX7 B;  1B7T A;  3VR8 A;  3OC4 A;  4O4L E;  1QO8 A;  5L46 A;  2BBJ A;  2LM9 A;  1H81 A;  2Y6X A;  2E9X B;  4J34 A;  4CI2 B;  1AR8 4;  1VRH 4;  3AYJ A;  1ZOY A;  3FG2 P;  1LRZ A;  4ZHQ E;  3OVU A;  5LNK A;  2BC0 A;  2GQW A;  3ICT A;  2V5Z A;  3E1T A;  4HGA A;  3ICS A;  2V60 A;  4WNK A;  2GEW A;  5CQF A;  1EBD A;  3PU3 A;  3F8D A;  1MOK A;  2XQA A;  4UV9 B;  5FNV E;  4LMJ A;  5IWA T;  1YD8 G;  2YKS A;  3GA8 A;  4JI3 T;  2CE7 A;  4H4Y A;  3ANW A;  3NRN A;  2D0U A;  3AD9 B;  1CHU A;  3N9Q A;  2ARD A;  4C74 A;  4ZN0 A;  5JDF A;  3LAD A;  1FIO A;  1FEC A;  1BR2 A;  5J2U E;  3M12 A;  3I0O A;  4D04 A;  3Q6J A;  2IUB A;  4KP3 C;  1K0I A;  4Q25 A;  1EL5 A;  2Q6U A;  2BCG G;  3CNT A;  3AB3 B;  3P9U A;  2XYO A;  4CY8 A;  4EQX A;  4K0U A;  3ZMV B;  3SUC A;  5LGN B;  3V76 A;  1H6V A;  1WR0 A;  4G74 A;  3Q5W A;  2AAQ A;  3EPT A;  2UU9 T;  5AQI B;  2Z6E A;  3NZQ A;  1SA0 E;  4ANJ A;  1IUW A;  1D4C A;  4G63 A;  3LOV A;  5ABH A;  1EL9 A;  4Z43 A;  1NG4 A;  3FBS A;  4DR7 T;  3SX6 A;  4DBR A;  2YWL A;  1OXZ A;  4EMJ A;  4JI6 T;  2CRB A;  3AEB A;  2OLN A;  2LKG A;  5LMU T;  3SZW A;  4DMV A;  2DLR A;  1ZY8 A;  2GV8 A;  1W0A A;  4BJM A;  4JY3 A;  4DV7 T;  4JI1 T;  2RMU 4;  2YG3 A;  2M6B A;  1KF6 A;  4C5O A;  5LG4 A;  1PBD A;  3P50 A;  3UQ7 A;  4CXW A;  1UUR A;  3CKD A;  1WLX A;  1WYC A;  2HHH T;  1HS7 A;  2RR1 4;  4GIW A;  4EQW A;  1G8X A;  2NR4 A;  1RUG 4;  3ICR A;  3J8F 4;  3RI5 A;  1HYU A;  3LG7 A;  1X79 A;  1COV 4;  2X50 A;  5LHI B;  2ZMA A;  2WSS V;  4AIS A;  1Y56 A;  5HCM A;  2ZZC A;  3GDN A;  1VBE 4;  2C72 A;  3VRD B;  3VKG A;  4ZZC A;  3JCF A;  3V5U A;  5CJ5 A;  4AT0 A;  2J3N A;  1XAN A;  3LJC A;  1SHZ C;  1BGJ A;  5HEO A;  4EV6 A;  4LF4 T;  2YR5 A;  3AVS A;  1GSN A;  2MPK A;  3I3L A;  2YN6 A;  1HNW T;  2M67 A;  2RP4 A;  5FS6 A;  4U8P A;  5KWF A;  2GAH B;  2JQQ A;  1PO1 4;  3LDQ B;  2BK3 A;  3KBU A;  3MXZ A;  5HYA A;  1P2E A;  2BC1 A;  3CX8 B;  3I6D A;  3NGC X;  3UCL A;  2XQ3 A;  4B3R T;  3QNU A;  5AQU B;  1B5Q A;  2V8S V;  4IDZ A;  4LF8 T;  4AOS A;  3CN8 A;  5HHF A;  2YG7 A;  1ZP0 A;  3C4X A;  2XFP A;  3AD7 B;  2YG5 A;  2E8I A;  3CPZ A;  2HQM A;  5AQN B;  4HKA A;  1GRA A;  4HFD A;  3ALL A;  2QGS A;  4H7U A;  4HTE A;  2DI4 A;  3ZN1 B;  2BKP A;  1T72 A;  1O94 A;  4IV9 A;  4AP3 A;  2RGO A;  1E1H B;  4B6X A;  4O5U A;  2UUB T;  2X9X A;  4B69 A;  5JQG E;  5GON E;  4EGW A;  2E9X A;  4AQF C;  1ZMD A;  3NNE A;  3HKD E;  2KLQ A;  3ZMU B;  3KLJ A;  2X99 A;  1MXT A;  2V5C A;  4BV6 A;  3J7Y q;  1GER A;  2XAS B;  5ABF A;  5JDM A;  1KDG A;  4H4P A;  4II2 A;  2WET A;  2C5K T;  5HEU A;  2YM1 A;  1MIY A;  3LB8 A;  4CN6 A;  5C3J A;  5AQO B;  3I9W A;  4FK1 C;  4OPL A;  3SZ0 A;  1UX4 A;  1XHC A;  4HFE A;  3ABV A;  5EB4 A;  3OJA A;  5AQM B;  1D0Z A;  4IL4 A;  1XHZ A;  4NEW A;  2D9D A;  3LFM A;  1HNZ T;  4IHJ E;  3CGD A;  1GRB A;  5BVA A;  1NA1 D;  1GRE A;  4CRT A;  2X5I D;  1OED B;  3ALJ A;  4I43 B;  4GDP A;  3F8R A;  4TWD A;  5LHH B;  4GYR A;  3MJX A;  2ODV A;  4IRE A;  3KPK A;  3DJJ A;  4FX9 A;  4Y4M A;  2YVF A;  2OLT A;  4H2N A;  3OTO T;  3F8P A;  2CHN A;  1CUN A;  3DJD A;  2ZBW A;  1H83 A;  3EAO A;  4IGU A;  1NPX A;  4AKR B;  3NYF A;  5HY5 A;  2DNX A;  4GKK T;  2K3W A;  3U3I A;  4YSH A;  4ZEY A;  2B1E A;  1YQ4 A;  4WW0 A;  2UZZ A;  4V1A v;  5AQP B;  4NZH A;  1CJC A;  5J60 A;  2LSY A;  2VB6 A;  1FEA A;  4U31 A;  4MHC A;  4PDW D;  2PYJ A;  4C90 A;  3AE2 A;  3NN0 X;  3C4W A;  3UKP A;  4TWH A;  2XVI A;  1F8W A;  2LSJ A;  3NBX X;  5HEJ A;  1LKX A;  5KOX A;  2YR4 A;  2DCF A;  3BQL A;  4NXN T;  1OJ9 A;  2JQH A;  3Q5E A;  2V6Y B;  3OYX A;  4O2B E;  4KHP T;  4WZX A;  3FPZ A;  2ZM0 A;  4ICY A;  4ADW A;  2Q9Q B;  3DJG X;  3EDV A;  3KKJ A;  4B65 A;  3GQK A;  4LF6 T;  2RA1 A;  2BVL A;  3AE7 A;  5JDH A;  3HKE E;  3V5S A;  4EMW A;  2FUP A;  5U1O A;  1BKW A;  4X9M A;  3CML A;  5JDQ A;  5EK4 A;  4ISS A;  3UU4 A;  1B8S A;  2R4E A;  2GK9 A;  1HG5 A;  2IC9 A;  1YXR A;  3CNJ A;  2FBW A;  2VVN A;  2XQ9 A;  2BRA A;  2VAS A;  3HKC E;  4YJ3 E;  2KXP B;  3NTD A;  5HAX A;  4HFC A;  2UXN B;  2VOU A;  4G6G A;  4H4U A;  2B9Y A;  2D2S A;  1XDO A;  1ZV4 X;  3ZCI A;  2BAB A;  3QVR A;  3VKH A;  2V3A A;  2MOZ A;  3TLV A;  5FS7 A;  4Z2U A;  2XCG A;  2CEA A;  4H2R A;  2KZ7 B;  5JR9 C;  1S3E A;  3GWD A;  2R4J A;  2E2A A;  5EK3 A;  4K7Z A;  1RUJ 4;  3P4R A;  2VKD A;  2A89 A;  5L3E B;  2XVH A;  2LSK A;  3GRT A;  3PS9 A;  4TV8 E;  5JRE A;  3Q9D A;  4PK5 A;  4UDP A;  1R09 4;  3GMI A;  2IID A;  2GMH A;  4XBF B;  4WYV A;  3NT6 A;  2XFU A;  2YEV C;  3ONJ A;  1NG3 A;  4AKG A;  1REO A;  1S94 A;  3P8C D;  1RUI 4;  2QVA A;  2Z5X A;  1IUV A;  2HWC 4;  2BG9 E;  3T8O A;  3ADA B;  2MTQ A;  3UUM A;  1I94 T;  1ASJ 4;  5C8Y E;  2XAQ B;  4TNV A;  4RG4 A;  4U8M A;  1RVF 4;  3VR9 A;  4ZI3 C;  1IUX A;  2X0Y A;  4LMK A;  4UXN B;  2YLW A;  3ZYM A;  3PDY A;  2C7G A;  3AVR A;  4A99 A;  3ESL A;  3MAC A;  2E5L T;  1IJH A;  2QAE A;  5FKY A;  4X1I E;  1YY5 A;  2IDO B;  4B68 A;  3RHA A;  5IQ1 A;  5AQG B;  3FBL A;  4LF7 T;  2L3L A;  4IDP A;  3V3O A;  4H50 A;  1MMG A;  3WAK A;  5M4Y A;  5JTG A;  2Y6R A;  1POV 0;  5L2L A;  2WMO A;  4DR3 T;  5J1G A;  3VRA A;  5F3J A;  3NG7 X;  3BNM A;  4G9K A;  3E0Z A;  4UVA B;  3PUZ F;  1FEW A;  3QSS A;  3VRB A;  1GT8 A;  3S61 A;  4I4T E;  4P0B A;  1GRH A;  4MBQ A;  1BEV 4;  4H2Q A;  5AQF B;  3LSV A;  4H9Q C;  1PBE A;  5FXW A;  3NYE A;  4Z8X A;  3K7Q X;  1PO2 4;  1O3X A;  4J2C A;  3BHK A;  3FZK B;  2BG9 A;  4ZI7 E;  4UV8 B;  3P1W A;  2GR0 A;  4RSL A;  2EQ8 A;  1FOH A;  1O95 A;  3DK9 A;  3K8P C;  4MJW A;  2YK0 A;  1ELI A;  2YDR A;  3SS1 A;  2XY8 B;  4WBN E;  4LFC T;  1KNP A;  3KBT A;  3ZJ2 A;  1QSD A;  3O1H A;  1WFD A;  3QFA A;  2C4C A;  4UVC B;  4E7S A;  4DR5 T;  2XAJ B;  2LSI A;  4YWO A;  3L8R A;  2Q9Q A;  3HL6 A;  2XZE A;  2OLO A;  5LBQ B;  1XI1 A;  3AA1 B;  1NEK A;  3N9P A;  2ACZ A;  2CBJ A;  3D0T A;  4KHZ F;  2JK6 A;  4DV4 T;  4X20 E;  3CQC B;  5A1L A;  1KK7 A;  4XWZ A;  3UP4 A;  4DNA A;  2PLV 4;  5JDN A;  1IUS A;  2XJ7 A;  3ZT7 A;  1GPE A;  3IWA A;  1V59 A;  2UXB T;  5TR3 A;  3H3A A;  4PAG A;  3NK1 X;  2XQ4 A;  5LP6 E;  1IBM T;  4ILA A;  1D5T A;  3NRX A;  3LJP A;  4QH4 A;  4O4H E;  5KRQ A;  2XFO A;  1U5P A;  4K5R A;  4CQI A;  4H4Z A;  4PK6 A;  5LBM A;  1DU2 A;  3AAA B;  3AAE B;  3JAD A;  3H37 A;  1CJ3 A;  2V7J A;  2R9Z A;  2XLU A;  2D0T A;  4PAA A;  4GDE A;  3RRC A;  2RS1 4;  4IIJ E;  4AKL A;  2WP5 A;  5IYZ E;  4X4J A;  3O9X A;  4TM0 A;  2VRM A;  2ES0 A;  2WDR A;  3VQR A;  3ONX A;  4L9I A;  4MLK A;  1M7K A;  1WR6 A;  3C50 A;  2BXS A;  4HE8 A;  3UFG A;  1BGN A;  3G5S A;  1QUU A;  4FJO A;  4K22 A;  4PNI A;  4A9W A;  1IJ5 A;  2J4G A;  5LA6 E;  1Q9I A;  4YJ2 E;  5JH7 E;  3IBP A;  2DWK A;  1PBC A;  4B66 A;  2C66 A;  5ETW A;  3CIR A;  3PUQ A;  5BUL A;  3RIU C;  4ILC A;  2XQ7 A;  1L9C A;  3U78 A;  2TMD A;  5L3D B;  2K9A A;  2VWA A;  4A98 A;  1TDK A;  1N36 T;  3AE8 A;  1M6I A;  3AB1 A;  4E0V A;  2L9Q A;  4HWI B;  4HFI A;  1ZHC A;  2EQ6 A;  1FCD A;  4DUZ T;  4U74 A;  2C73 A;  2BZB A;  3L39 A;  5IPY A;  4EEB A;  3BQK A;  1CJ2 A;  1HG2 A;  5L3F B;  2EHO D;  1FMV A;  4PK4 A;  4AIU A;  2XAG B;  2PY5 A;  4U8N A;  1IUU A;  4U8I A;  3Q5X A;  5FP3 A;  2VRL A;  3AA6 B;  3RC3 A;  1VRB A;  4DSG A;  3QK6 A;  4LU6 A;  3WAJ A;  2EQ7 A;  3UQ4 A;  3B13 A;  3QVP A;  1RUE 4;  4LF9 T;  3AEE A;  4AP1 A;  4IVO B;  2KWH A;  3RPU A;  4D03 A;  3FMW A;  1IUT A;  3O1I A;  5HCJ A;  1WRD A;  2WZH A;  2F5Z A;  1IBL T;  1B37 A;  4Z26 A;  2R46 A;  3C96 A;  4GOU A;  1ZMC A;  3PUR A;  2V6O A;  2WS3 A;  4KI0 F;  3UOY A;  1ZX9 A;  2A72 A;  3LZW A;  3AE4 A;  4IVM B;  4K8D A;  2IC6 A;  1TDF A;  4IE0 A;  3TLU A;  4J33 A;  3UKH A;  2WQY A;  3CGE A;  3HYV A;  4ZCD A;  1M64 A;  1S2Y A;  4H4Q A;  4JNA A;  1Q1W A;  2KSR A;  4ZI3 D;  1D1A A;  1CL0 A;  5HXH A;  3UTE A;  4Z44 A;  5F5W A;  2NPX A;  3UOZ A;  4MAL A;  3QUJ A;  4DV0 T;  3RF1 A;  1MIV A;  2IML A;  1ZOV A;  3P4Q A;  3PUY F;  1OJT A;  2UXD T;  4GAV A;  1Z8U A;  4GK0 E;  2XLR A;  3P4S A;  3ZST A;  2V7M A;  5LOV E;  4HEA A;  4OVI A;  1GRG A;  2BK5 A;  2V5D A;  1PN0 A;  4PJN A;  3JAE A;  2OA5 A;  3UU8 A;  1SEZ A;  3A5X A;  3RLF F;  5M10 A;  3H3M A;  2K48 A;  3AE5 A;  2VQE T;  4EIQ A;  5HXC A;  2CWY A;  1I6Z A;  2W66 A;  4P1N A;  1HRI 4;  4GF7 A;  4PAB A;  1XNQ T;  4BK3 A;  3IF9 A;  3IHG A;  2JMH A;  3GQH A;  2XLS A;  2HPL A;  3IC9 A;  2KWI B;  1X9B A;  3URH A;  1BF3 A;  2IVD A;  2JRK A;  5AQK B;  2YVJ A;  1O5W A;  3M0O A;  4NIQ A;  1GXF A;  5AQV B;  3T2K A;  2C67 A;  3CQG B;  5KMR A;  3LBX B;  4YFS A;  3TKL B;  5KXJ A;  1CC4 A;  5EOW A;  5GSN A;  5HXE A;  3AEC A;  5KMG P;  5JRC B;  2WAU A;  4QWN B;  4JEU B;  2BRY A;  3DME A;  4O4I E;  1CC2 A;  4AQY T;  4ZXL A;  2Y6Q A;  3BK9 A;  5FL1 A;  1K0L A;  2WP6 A;  3EI0 A;  4COF A;  1XMQ T;  5LG3 A;  2PYX A;  2VKH A;  3G5Q A;  3W15 B;  1RP0 A;  2Q0K A;  1DJQ A;  2GR3 A;  4JQ9 A;  1GEU A;  3RNM A;  2RS3 4;  3RIA A;  2VUR A;  4TUY E;  1TDO A;  4NEV A;  4IE6 A;  4YY3 T;  3AED A;  4GB3 4;  3FI7 A;  5LYJ E;  1H7X A;  3A8Y C;  3H8I A;  5BUK A;  4A79 A;  3CX7 B;  5H6Q B;  3SY4 A;  5LGT B;  1U4Q A;  1KNZ A;  5LHG B;  4U33 A;  3T0K A;  5LXT E;  3A7M A;  2V7K A;  3SOL A;  3ZC1 A;  2BK4 A;  5JR9 B;  1YKE B;  3AYL A;  4N78 D;  3L3P A;  3K30 A;  3CNP A;  2LE8 A;  4B3T T;  4YHH T;  2Y48 B;  5C2T A;  3KIN B;  1GV4 A;  4DV6 T;  3ZCJ A;  2XM1 A;  5FVL A;  4A6N B;  4OPI A;  4Z2R A;  3CPJ G;  2PG8 A;  2NVK X;  1IJ6 A;  3KV5 A;  1KFY A;  3Q9T A;  3RGL A;  4EMI A;  2LRL A;  5FXZ A;  1DOE A;  3LK4 2;  3PE0 A;  1DJN A;  2CVJ A;  4MFR A;  1VG9 A;  4DID B;  3DTO A;  3KVA A;  4P09 A;  1LVF A;  4AKH A;  1BWC A;  1NEN A;  2VQ7 A;  2WWV A;  4Y4L A;  4FK1 A;  4TM3 A;  2XSA A;  4AOX A;  4H4X A;  2LEH A;  4AI6 A;  5EB5 A;  5HYM A;  3AXJ B;  2GAG B;  1T7S A;  3PTR B;  5HWX A;  4ECH A;  1OJC A;  3UT5 E;  1L9D A;  2C64 A;  1J1J A;  4UF0 B;  2YLT A;  3II4 A;  2XVJ A;  1TDN A;  2BKO A;  4ILU A;  3ATQ A;  1NAA A;  2A3D A;  5CA1 E;  4B3S T;  5L4E A;  5M0Z A;  2GB0 A;  3UOX A;  3O4X E;  4AT2 A;  1GES A;  2WDQ A;  2WU2 A;  3FZM B;  5BRT A;  2V3B A;  3RQW A;  4XWR A;  2V61 A;  2RAB A;  4ASK A;  2D5U A;  2XQ6 A;  4J2W A;  2QYW A;  1D0Y A;  3EF6 A;  2J1D G;  2BS4 A;  2XDO A;  2M6I A;  4UVB B;  4OPG A;  3MZK B;  3LXD A;  3LZX A;  4P9S A;  2R06 4;  1NAF A;  2R7F A;  1YKJ A;  3SQP A;  3ZYK A;  5IUX A;  2CUL A;  1US7 B;  4EZH A;  2XQ8 A;  2GVC A;  2YU2 A;  4QH5 A;  4X9N A;  3K3O A;  1BZL A;  1EAH 4;  4QKN A;  4X66 T;  1IAP A;  1JRX A;  4HWF A;  1FEB A;  3CPH G;  2DL1 A;  3SYI A;  2NW7 A;  3LBX A;  4Z24 A;  4HB9 A;  1PHH A;  1RUC 4;  2IAK A;  4LFA T;  3F57 A;  3P7I A;  4FDC B;  4NXM T;  1R8I A;  4Z2T A;  1QLB A;  3EHZ A;  2PW9 A;  4CCR A;  4PJM A;  3O1J A;  3LK2 B;  2B76 A;  2X0L B;  2ZM6 T;  4OPD A;  1VCS A;  2WOV A;  1E2A A;  4DR1 T;  1CC6 A;  2OAL A;  1S2Q A;  3GD3 A;  3IF8 B;  3MK7 C;  4Q4V 4;  2HH7 A;  2BBH A;  3FIM B;  1XWM A;  5H6R B;  3OBV E;  1MIW A;  2BXR A;  4UDQ A;  4OK0 A;  2XFN A;  2WY2 A;  2QA1 A;  1BR1 A;  2OV9 A;  4YXD A;  4H4T A;  3DP7 A;  3GWH A;  1OED E;  2W00 A;  4U2Y A;  3RC8 A;  2NP9 A;  4CBQ A;  2GMJ A;  3O0H A;  2VVL A;  2BS3 A;  2C76 A;  3RYH E;  4CXX A;  4NUU A;  4QXH B;  3R84 B;  3PUA A;  2JAE A;  1NHS A;  2EHO C;  5TAO A;  1Y0P A;  4H9P C;  3BI2 A;  4I0U A;  4NWZ A;  4UEM A;  2O9Z A;  2R6G F;  2UUC T;  5KVH A;  3T37 A;  5DQV A;  3RYC E;  2W0G A;  3TLS A;  3NK0 X;  4YTP A;  4UP3 A;  4O5Q A;  1NHP A;  1HX8 A;  4JN9 A;  2PTF A;  2JQ9 A;  3UKF A;  2OA1 A;  3FZL B;  4ZI2 C;  2SPC A;  2PBI A;  5ABE A;  2R0G A;  4BJZ A;  3ZYL A;  4EZ4 A;  2XAH B;  3UTG A;  3RED A;  1JOA A;  2YQU A;  5FMH A;  1OOP D;  1RHI 4;  3ZN0 B;  1YW0 A;  2WP9 A;  4DSH A;  2Z5Y A;  3RX6 A;  5AFU L;  4YKG A;  3ETU A;  3J9X 1;  4NTC A;  3FXE B;  3KPF A;  1T98 A;  2EX3 A;  3M3Z B;  1MND A;  1N34 T;  2WOW A;  1CF3 A;  4H9R C;  3V3N A;  2UXX B;  1OED A;  2A2F X;  4IT4 A;  3P4W A;  1Z7S 4;  3E08 A;  3T1Y T;  2LOP A;  4YLH A;  3NHO X;  3K1S A;  2GQF A;  4UF0 A;  2H7V C;  4PFO A;  4TLX A;  3UP5 A;  2X9H A;  2JB3 A;  3JC6 D;  3UKL A;  4DBQ A;  2CXD A;  3SFE A;  1N4U A;  2YM2 A;  1WYB A;  3N9N A;  4X1K E;  1Z6L A;  4U8K A;  3T2Z A;  1N4V A;  3B3R A;  3HKB E;  1GRF A;  3HZL A;  3SZF A;  2W62 A;  1GTE A;  5DBJ A;  2ODU A;  2E9X D;  1PBF A;  2R45 A;  1TDE A;  1JNZ A;  4ZS3 A;  5HXR A; 
#chains in the Genus database with same CATH homology
 4E0V A;  3AEA A;  1DOD A;  1P2E A;  2BC1 A;  5JCK A;  4EQR A;  2EQ6 A;  1FCD A;  3I6D A;  3C4A A;  3NGC X;  4U8J A;  3UCL A;  2C73 A;  3KA7 A;  5IPY A;  1PS9 A;  5KNL A;  1B5Q A;  1VQW A;  1CJ2 A;  2VVL G;  4AOS A;  3CN8 A;  5HHF A;  2YG7 A;  1ZP0 A;  2YG6 A;  4USR A;  5JCL A;  4TM4 A;  1NHQ A;  4U8N A;  1IUU A;  4U8I A;  4YKF A;  2XFP A;  3AD7 B;  2YG5 A;  1JNR A;  1LJ1 A;  3AE9 A;  3AEF A;  4KX6 A;  2FJB A;  1TRB A;  2VRL A;  3S5W A;  3T31 A;  3D1C A;  2HQM A;  1GTH A;  2YR6 A;  4DSG A;  3GMC A;  4LU6 A;  2EQ7 A;  1GRA A;  4GRT A;  3ALL A;  3DA1 A;  3QVP A;  4H7U A;  1DOC A;  3AEE A;  1O94 A;  4AP1 A;  4IVO B;  3CTY A;  4IV9 A;  4U2L A;  4AP3 A;  4D03 A;  1TYT A;  2RGO A;  3FMW A;  1D4E A;  3UKK A;  1IUT A;  4O5U A;  2JB2 A;  2A87 A;  2F5Z A;  4U2T A;  4B69 A;  1PXB A;  1B37 A;  5EBK A;  4Z26 A;  2YLS A;  2B7S A;  2R46 A;  1ZMD A;  1LVL A;  1S3B A;  3NNE A;  3C96 A;  2WOI A;  3IHM A;  1ZMC A;  2V6O A;  3L8K A;  2WS3 A;  3KLJ A;  4BJY A;  3K7M X;  2X99 A;  2BAC A;  4C3Y A;  3AYI A;  3UP4 A;  3UOY A;  1MXT A;  1ZX9 A;  3NKS A;  4BV6 A;  3LZW A;  1GER A;  2YVG A;  4KPR A;  1NDA A;  3AE4 A;  3PO7 A;  4IVM B;  4K8D A;  2WES A;  1TDF A;  4J56 A;  4J33 A;  3UKH A;  2WQY A;  1KDG A;  3CGE A;  2Q7V A;  2WPC A;  3HYV A;  2WET A;  4H4P A;  4II2 A;  4ZCD A;  5KMQ A;  1M64 A;  3AE1 A;  1S2Y A;  2AR8 A;  2YM1 A;  4H4Q A;  1Q1W A;  4JNA A;  4EM3 A;  1PJ6 A;  3PVC A;  2E4G A;  3DGH A;  3LB8 A;  1CL0 A;  3UTE A;  4Z44 A;  4M52 A;  5C3J A;  5JCM A;  2NPX A;  2APG A;  3UOZ A;  4FK1 C;  5U63 A;  4OPL A;  4U8L A;  3SZ0 A;  4A6N A;  1XHC A;  2QCU A;  1ZDL A;  1H86 A;  1ZOV A;  3P4Q A;  3GD4 A;  3OZ2 A;  1B4V A;  2WBA A;  3GSI A;  5GRT A;  1OJT A;  4A65 A;  4GAV A;  3ZDN A;  1X31 B;  3ABV A;  2VZ2 A;  3CPI G;  1D4D A;  2XLR A;  3P4S A;  4BK2 A;  3B6D A;  5EB4 A;  4A7A A;  3T14 A;  4B1B A;  2W0H A;  4OVI A;  1GRG A;  2BK5 A;  3NLC A;  4NEW A;  4EIP A;  1PN0 A;  3CGD A;  1GRB A;  5BVA A;  1GRE A;  3BI5 A;  1SEZ A;  4CRT A;  2BA9 A;  2XFQ A;  3ALJ A;  5KMS A;  5M10 A;  2ZZ0 A;  3F8R A;  4GDP A;  2CFY A;  3AE5 A;  4EIQ A;  2B9X A;  1LPF A;  2PHH A;  1E1M A;  2C70 A;  4II3 A;  3KPK A;  4YSY A;  4REK A;  3DJJ A;  4GF7 A;  2R0C A;  4EM4 A;  4FX9 A;  4Y4M A;  2YVF A;  4PAB A;  3ITJ A;  4H2N A;  3IF9 A;  4BK3 A;  3IHG A;  3GQH A;  2XLS A;  1Q1R A;  3DJD A;  3F8P A;  3IC9 A;  4H2P A;  2ZBW A;  3UOV A;  1H83 A;  3EAO A;  3URH A;  4J57 A;  1GAL A;  1BF3 A;  3BI4 A;  2IVD A;  5FS9 A;  2YVJ A;  1O5W A;  1DNC A;  1N1P A;  3M0O A;  1CJ4 A;  1NPX A;  3NYF A;  5HY5 A;  1GXF A;  2BCP A;  1PBB A;  4LA1 A;  3T2K A;  2C67 A;  1LTX R;  4GAP A;  3NN6 X;  4NNJ A;  4YSH A;  5KMR A;  3GYI A;  1L0V A;  2GR1 A;  5JCI A;  3AE6 A;  1YQ4 A;  5KXJ A;  1CC4 A;  1F6M A;  2UZZ A;  1UKV G;  5EOW A;  3DH9 A;  5GSN A;  3AEC A;  4NZH A;  1FL2 A;  4XXG A;  1CJC A;  5J60 A;  5ER0 A;  1FEA A;  2B9W A;  2VQB A;  2BRY A;  2X8G A;  3DME A;  3AE2 A;  3NN0 X;  1CC2 A;  1DOB A;  2JKC A;  2Y6Q A;  3UKP A;  2XVI A;  1F8W A;  4IA5 A;  2FJD A;  1K0L A;  2RGJ A;  1QJD A;  1ZKQ A;  2WP6 A;  2XVF A;  4RG3 A;  5KOX A;  4YTN A;  2YR4 A;  1E1L A;  1F8R A;  2PYX A;  3M13 A;  1OJ9 A;  3G5Q A;  4CY8 A;  1RP0 A;  3AE3 A;  2GRT A;  2Q0K A;  4J31 A;  1DJQ A;  1OJD A;  1W4X A;  3P4P A;  2GR3 A;  4JQ9 A;  1F8S A;  1GEU A;  3RNM A;  5HXI A;  3CNS A;  1XPQ A;  2QA2 A;  3FPZ A;  1TDO A;  3GYX A;  2WEU A;  4NEV A;  4TM1 A;  3AED A;  4ICY A;  4IA6 A;  1H7X A;  4ADW A;  1YQ3 A;  1RSG A;  2CDU A;  2OAM A;  2AQJ A;  3DJG X;  3H8I A;  3KKJ A;  4B65 A;  4K5S A;  3GQK A;  5BUK A;  3H4K A;  4A79 A;  3SY4 A;  2C3D A;  4USQ A;  2H88 A;  3AE7 A;  3T0K A;  2YAU A;  3NTA A;  4JY2 A;  4YSZ A;  1LQU A;  4EMW A;  5U1O A;  3UKQ A;  4BUR A;  1BKW A;  4X9M A;  4B67 A;  1COY A;  5CKU A;  2BK4 A;  5JCN A;  4I59 A;  3SFD A;  3AYL A;  1EL7 A;  4U8O A;  3K30 A;  3CNP A;  3NH3 X;  2A8X A;  4APN A;  1B8S A;  2R4E A;  3CGB A;  3CNJ A;  3ALM A;  2FBW A;  2BRA A;  5C2T A;  1CBO A;  1GV4 A;  3NTD A;  2GH5 A;  4CY6 A;  4A5L A;  1PXA A;  2VOU A;  3NK2 X;  1PJ7 A;  4OPI A;  4G6G A;  4A6N B;  3CPJ G;  1GOS A;  1N4W A;  4H4R A;  4Z2R A;  2NVK X;  4H4U A;  2XLP A;  3WE0 A;  2B9Y A;  1E6E A;  1KFY A;  1MO9 A;  4GCM A;  2BAB A;  1H84 A;  3Q9T A;  4CNK A;  4EMI A;  2WU5 A;  3QVR A;  1OJA A;  2V3A A;  5FS7 A;  4Z2U A;  2LFC A;  1JU2 A;  2XCG A;  4H2R A;  1DOE A;  1S3E A;  3GWD A;  1H7W A;  1DJN A;  1E1K A;  3JSK A;  2CVJ A;  2R4J A;  1VG9 A;  4JDR A;  3AD8 B;  4GR1 A;  2WDV A;  1BWC A;  4K7Z A;  1NEN A;  3DK4 A;  3GRS A;  2VQ7 A;  4H4V A;  4ZCC A;  1RYI A;  3P4R A;  4C3X A;  4Y4L A;  3HYW A;  4BK1 A;  2X8H A;  2A89 A;  4FK1 A;  4N9X A;  1ZK7 A;  2XVH A;  4TM3 A;  3GRT A;  1TYP A;  4AOX A;  3PS9 A;  4H4X A;  3SM8 A;  5EB5 A;  5HYM A;  3CND A;  2GAG B;  3QSM A;  4WX1 A;  5KVI A;  4UDP A;  3CMM A;  4H4S A;  2IID A;  2GMH A;  4ECH A;  4B63 A;  1E7P A;  1OJC A;  2C64 A;  1L9D A;  3SGL A;  3NT6 A;  2XFU A;  3RP7 A;  4Z25 A;  1Y56 B;  2YLT A;  3II4 A;  1NG3 A;  2XVJ A;  1TDN A;  2FJA A;  1REO A;  3ISH A;  4YT0 A;  3ATR A;  3ATQ A;  1NAA A;  3L1R A;  3BHF A;  4G6H A;  3QSE A;  2Z5X A;  2VVM A;  1IUV A;  4NTE A;  1D7L A;  5J7X A;  1VDC A;  3ADA B;  5M0Z A;  2C3C A;  2DKI A;  2GB0 A;  3UOX A;  4AT2 A;  3AB1 A;  1GES A;  2X8C A;  4H4W A;  2H89 A;  3DJE A;  3R9U A;  1D7Y A;  4U2S A;  2WDQ A;  3GDP A;  2WU2 A;  4RG4 A;  4U8M A;  3GMB A;  3VR9 A;  4OCG A;  2RGH A;  1IUX A;  1K4Q A;  2YLW A;  5BRT A;  1KSS A;  1H82 A;  2V3B A;  1K0J A;  3AXB A;  4CNJ A;  2BYB A;  4XWR A;  1VRQ B;  2V61 A;  2YG4 A;  1L9E A;  2WPE A;  2C7G A;  2RAB A;  4A99 A;  4HA6 A;  1E39 A;  2R0P A;  1IJH A;  2QAE A;  2GR2 A;  4J2W A;  4GUV A;  1PJ5 A;  1KSU A;  4OPU A;  3EF6 A;  4EQS A;  3CGC A;  2BS4 A;  1JEH A;  1EL8 A;  1YY5 A;  2XDO A;  2YLR A;  4B68 A;  3RHA A;  5IQ1 A;  4OPG A;  2BS2 A;  3LZX A;  3LXD A;  1AOG A;  4P9S A;  5FS8 A;  3EAN A;  1YKJ A;  3SQP A;  3V3O A;  4H50 A;  3HYX A;  2CUL A;  2Y6R A;  3KVE A;  3COX A;  1GND A;  2GVC A;  4TLZ A;  5IQ4 A;  2C65 A;  3VRA A;  1PXC A;  3NG7 X;  4X9N A;  3BNM A;  1BZL A;  4G9K A;  5KOW A;  1JRX A;  1FEB A;  3CPH G;  3VR8 A;  3SYI A;  3OC4 A;  1QO8 A;  4HB9 A;  4Z24 A;  5L46 A;  1PHH A;  1H81 A;  3QSS A;  3VRB A;  1XDI A;  4J34 A;  4FDC B;  1GT8 A;  3AYJ A;  3SXI A;  3S61 A;  4Z2T A;  1ZOY A;  3FG2 P;  1QLB A;  3AEG A;  1GRH A;  4CCR A;  4H2Q A;  2BC0 A;  2B76 A;  2GQW A;  3GWF A;  3ICT A;  2V5Z A;  4LII A;  3E1T A;  1PBE A;  4OPD A;  2WOV A;  3NYE A;  1CC6 A;  3ICS A;  4OPT A;  3UTH A;  5U25 A;  3K7Q X;  2FJE A;  4B64 A;  2OAL A;  2V60 A;  3RP8 A;  2WHD A;  1S2Q A;  3GD3 A;  3BHK A;  1JRZ A;  2GEW A;  2DKH A;  2YLX A;  1EBD A;  5CQF A;  3BNU A;  1JRY A;  2TPR A;  2X3N A;  3FIM B;  3P1W A;  2IVE A;  3F8D A;  2GR0 A;  1MOK A;  4RSL A;  2EQ8 A;  3UTF A;  1FOH A;  1O95 A;  3DK9 A;  2BXR A;  4J36 A;  3GYJ A;  4MJW A;  4UDQ A;  2XFN A;  1ELI A;  1NHR A;  2QA1 A;  4YXD A;  4H4T A;  1KNP A;  1F3P A;  4OPC A;  4UDR A;  3QFA A;  4H4Y A;  2C4C A;  4CBQ A;  1LV0 A;  2GMJ A;  2JBV A;  3O0H A;  2VVL A;  2BS3 A;  3NRN A;  1YQZ A;  2C76 A;  3AD9 B;  1CHU A;  4YWO A;  2ARD A;  4I58 A;  4C77 A;  5KMP A;  2XVE A;  4C74 A;  2OLO A;  4ZN0 A;  2JAE A;  1NHS A;  3LAD A;  1FEC A;  1NEK A;  3D8X A;  1Y0P A;  3M12 A;  2ACZ A;  4D04 A;  2JK6 A;  3Q6J A;  1K0I A;  1EL5 A;  2C75 A;  2BCG G;  2Q6U A;  3CNT A;  3P9U A;  2XYO A;  4XWZ A;  1IUS A;  2XLT A;  1LQT A;  2B7R A;  3BI2 A;  4DNA A;  4EQX A;  3SUC A;  4NWZ A;  3QJ4 A;  3V76 A;  1H6V A;  2O9Z A;  3H8L A;  3NIX A;  4G74 A;  1E1N A;  2AAQ A;  1GPE A;  3EPT A;  3IWA A;  4WCT A;  5KVH A;  1V59 A;  3T37 A;  1DXL A;  3AE8 A;  1KNR A;  1IUW A;  3NK0 X;  1D4C A;  4Y4N A;  5TR3 A;  4YTP A;  4YSX A;  3LOV A;  4UP3 A;  3NK1 X;  4O5Q A;  1D5T A;  1EL9 A;  1NG4 A;  1NHP A;  3FBS A;  3SX6 A;  4EMJ A;  2YWL A;  4Z43 A;  4JN9 A;  3LJP A;  3SZC A;  5KRQ A;  4JNQ A;  2OA1 A;  3UKF A;  3AEB A;  3RP6 A;  2OLN A;  1PDH A;  1GRT A;  2XFO A;  4K5R A;  2R0G A;  4BJZ A;  3SZW A;  4DGK A;  4H4Z A;  5LV9 A;  2E5V A;  1ZY8 A;  3UTG A;  3RED A;  1JOA A;  1GET A;  2YQU A;  5FMH A;  2GV8 A;  3KU9 A;  4JY3 A;  2E1M A;  3DK8 A;  2WP9 A;  4DSH A;  2Z5Y A;  1CJ3 A;  2YG3 A;  2YLZ A;  3UKA A;  1KF6 A;  4C5O A;  4YKG A;  1PBD A;  2R9Z A;  2JB1 A;  2XLU A;  1ONF A;  4NTC A;  4PAA A;  4GDE A;  3KPF A;  2I0Z A;  2WP5 A;  4EQW A;  4X4J A;  4TM0 A;  3C4N A;  4K2X A;  3ICR A;  1VG0 A;  2WOW A;  1CF3 A;  2VRM A;  4G73 A;  4NTD A;  4CCQ A;  2WDR A;  3V3N A;  3VQR A;  3T2Y A;  1HYU A;  2BXS A;  2X50 A;  3DGZ A;  4YTM A;  3NHO X;  2GQF A;  1BGN A;  1Y56 A;  3G5S A;  2ZZC A;  3GDN A;  2Q0L A;  4K22 A;  4A9W A;  2C72 A;  4TLX A;  3UP5 A;  3VRD B;  2JB3 A;  2GF3 A;  3UKL A;  1Q9I A;  4AT0 A;  3ZYX A;  3SFE A;  1N4U A;  2J3N A;  2YM2 A;  1XAN A;  1Z6L A;  4U8K A;  3T2Z A;  1N4V A;  1PBC A;  2WPF A;  4B66 A;  3B3R A;  1GRF A;  3AWI A;  2C66 A;  3HZL A;  2ZZB A;  3CIR A;  1BGJ A;  5BUL A;  3SZF A;  1P2H A;  3K7T A;  2YR5 A;  1GSN A;  1GTE A;  3G5R A;  5DBJ A;  3I3L A;  1L9C A;  2EQ9 A;  1PBF A;  2TMD A;  5FS6 A;  2R45 A;  1TDE A;  1JNZ A;  4U8P A;  5KWF A;  2GAH B;  3NYC A;  3KD9 A;  1TDK A;  1M6I A;  3QFB A;  2BK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...