4YSYA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[(2,4-dichlorophenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 213
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ysyA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ysyA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ysyA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ysyA04
1E1NA 3RNMA 3OZ2A 1Z6LA 4Z25A 3IWAA 3IHGA 1KSUA 4USRA 5EB5A 1IUWA 4OVIA 3KKJA 4OPTA 2YQUA 4H2QA 2YG3A 2XDOA 4H2PA 3UKLA 4A9WA 4YKFA 3ITJA 3K7MX 3QSMA 2R46A 1NENA 2CVJA 2FJDA 5GSNA 3G5SA 5HHFA 5U1OA 2ZZ0A 5JCIA 4J2WA 2YLWA 2GB0A 2C76A 4K5RA 1GRHA 5L46A 1TDKA 2YAUA 1E39A 3VR8A 2B9XA 2C7GA 3GDNA 3NYCA 2OLNA 3PS9A 1D4CA 1PXCA 1GOSA 1B4VA 3HZLA 4A7AA 3ATRA 4YXDA 3NLCA 2Q0LA 2YG7A 4B67A 3AEDA 2GR0A 2CFYA 1M6IA 1TYTA 3PO7A 1NHQA 2XLPA 4EQWA 2WP9A 4YT0A 2C72A 4RG4A 4BJYA 3NYEA 3ZYXA 3AD9B 4AOXA 4U8KA 5HYMA 3CNDA 2VQ7A 3FMWA 4E0VA 1FCDA 3AE8A 1L9DA 1V59A 3UP4A 4K22A 2A89A 1GRFA 1K0IA 2EQ8A 3P4RA 4LU6A 1JRXA 2I0ZA 1OJDA 1QJDA 3ADAB 4UDRA 1D7LA 2JAEA 1LVLA 2RGOA 4BURA 3GRSA 4H50A 1VQWA 4Z2UA 2A8XA 2JK6A 5HY5A 2C75A 4A99A 4JQ9A 1NG3A 1FEBA 3GDPA 3AEFA 3GMBA 1P2HA 3NGCX 2AAQA 4ADWA 1SEZA 2APGA 2WBAA 3UKQA 3M12A 4YTPA 4CY6A 1TYPA 2F5ZA 5EB4A 3KD9A 5IQ4A 5KOWA 3CN8A 4ZCCA 1CJ2A 2ZZBA 4XWRA 3ICRA 1PJ5A 3CGDA 3LZWA 1E1KA 3REDA 3IC9A 5BUKA 1LPFA 1IUTA 4Y4LA 1D7YA 2GF3A 2TMDA 1Y56A 4WCTA 2XFOA 3BI2A 2ACZA 2H88A 2BABA 3BNMA 1DXLA 4BV6A 2GEWA 2BK3A 3G5QA 4H4VA 3C96A 1VRQB 5J7XA 1ZOYA 1F8WA 2B7SA 1LV0A 4JDRA 4CNJA 1L0VA 2DKIA 2XFPA 2R0GA 1GSNA 1JRYA 2JB3A 4AP3A 3AYLA 4HA6A 4EQXA 2TPRA 4A6NA 3AE3A 2O9ZA 4MJWA 3P4SA 4DGKA 4HB9A 2X99A 1VDCA 3UP5A 1PJ7A 1PBDA 3SM8A 4U2TA 4GCMA 1NPXA 4TM4A 1CL0A 4K7ZA 1Y0PA 3UTGA 4K5SA 1OJCA 3GYIA 3Q6JA 5CQFA 2XFUA 3IHMA 2QA1A 1TDEA 2VVMA 2WPCA 2BXRA 3JSKA 3OC4A 3QVPA 1PXBA 1GERA 3KU9A 2X3NA 4U8JA 3AEGA 5CKUA 4D03A 1CHUA 1TDOA 4B64A 1DOBA 3LADA 1K0JA 4U8OA 4EMWA 3GSIA 1GALA 5FS6A 4GUVA 3NK2X 1S3BA 4YTNA 3C4AA 3R9UA 3UKKA 1H7XA 1CF3A 1YKJA 2C64A 2R4EA 4H4YA 5ER0A 2WPEA 3IF9A 3B6DA 2V6OA 4I59A 3ATQA 2VVLG 4O5UA 3COXA 1H6VA 1JNZA 3ICSA 1TRBA 2XVFA 2XVIA 1GT8A 3II4A 4FDCB 2R45A 1IUXA 3O0HA 4H4PA 1H7WA 2BACA 4BK1A 1E1MA 4IV9A 5M10A 3GQKA 1LQTA 3CPHG 3ZDNA 2JB2A 2V3AA 2BK4A 2LFCA 2JB1A 4GRTA 1X31B 4EM4A 4REKA 2XVEA 4A65A 2DKHA 2ZZCA 4Z26A 3ALJA 3AE2A 4CBQA 2QCUA 2R9ZA 3EPTA 2GQFA 2BYBA 4H4QA 3CPJG 4TLXA 1JNRA 5KWFA 2BS4A 1YY5A 5TR3A 4X4JA 4DNAA 3RHAA 5JCLA 4YSHA 3VRAA 3GD4A 4J34A 3GYXA 5LV9A 1N4VA 3QJ4A 1GEUA 4C3XA 1N4UA 5KVIA 4KPRA 2E1MA 2JKCA 3DMEA 3F8DA 2GAHB 3M13A 1FECA 1FEAA 4EMIA 1D5TA 1GXFA 1ZKQA 3VRBA 1DJQA 3GYJA 3WE0A 4BJZA 1PBBA 3F8PA 3SFDA 2XVHA 1O94A 4H4UA 4TM1A 1LQUA 5FS9A 2PHHA 1PS9A 2YVFA 2YG6A 3P9UA 3CPIG 4NTCA 2YVGA 1ZY8A 4B63A 3F8RA 4WX1A 3EF6A 2IIDA 3ISHA 5JCMA 1K0LA 1Q1RA 4USQA 1TDNA 4B1BA 3AE5A 3SQPA 2GVCA 3P4PA 1GRTA 2JBVA 1DOEA 2PYXA 4I58A 4YSZA 3UTHA 1COYA 2H89A 1F6MA 2C3CA 5JCNA 2YR6A 1ONFA 2R0CA 1MO9A 2YM2A 1GNDA 1ZP0A 2GR2A 2XLRA 1LJ1A 2RABA 3BHKA 3AE6A 4XWZA 2XYOA 3AXBA 2NPXA 4ZCDA 2HQMA 1DJNA 3G5RA 4FK1A 4TLZA 3V3OA 3VRDB 1E6EA 1O5WA 4EIQA 3BI4A 1KSSA 1CC6A 1YQZA 4H4SA 3AEAA 1MXTA 4YTMA 4H7UA 5FS8A 4DSGA 2YWLA 1ZOVA 1D4EA 3UTEA 4ECHA 1GV4A 4YSYA 3B3RA 2YLZA 2WESA 2GRTA 4J33A 3DA1A 2FJAA 4KX6A 4EQSA 1KF6A 1Y56B 4RSLA 4H4RA 2YG5A 2YR4A 2XFNA 2WOWA 4XXGA 1GPEA 1PHHA 4A79A 2BC1A 2R0PA 3BHFA 2V60A 1QO8A 1OJTA 3I3LA 4CNKA 3T37A 2X8CA 2V61A 3BNUA 4EMJA 3SUCA 2OALA 3LOVA 3P1WA 4J57A 1GETA 3KPFA 3AE7A 3AE1A 1KDGA 3RP8A 1KFYA 4DSHA 3UTFA 3GQHA 1H86A 1E7PA 3UOXA 1XDIA 3UOVA 4A6NB 3V3NA 5U63A 3AYJA 3FBSA 1PN0A 3AE9A 4H4WA 3S5WA 3UKFA 2AR8A 3BI5A 4NZHA 2WEUA 3NKSA 4U8PA 4BK3A 2YR5A 1H82A 2QA2A 2WP5A 3AB1A 4H4XA 1H83A 2FJBA 2VRLA 4BK2A 3PVCA 3GD3A 3UCLA 3AD7B 1RP0A 3DK4A 2VOUA 1S3EA 3I6DA 2A87A 2Z5XA 4U8IA 1IUSA 4H2NA 4EM3A 2XLTA 3NN6X 3RP7A 4JNQA 3S61A 4U8NA 1PDHA 3CNTA 4JN9A 2VQBA 2GR3A 3DGHA 4IA5A 1K4QA 4Z24A 2IVDA 4NTDA 4CRTA 3EANA 1EL8A 2Y6RA 2IVEA 5U25A 5KXJA 2GMHA 4X9MA 4B69A 3NN0X 2C66A 2OA1A 4J56A 3NTAA 4PAAA 5KVHA 1PXAA 2V5ZA 3LXDA 3QVRA 3GRTA 2XLSA 1AOGA 1NHPA 1XPQA 4FK1C 4NEVA 1NAAA 5FMHA 1KNRA 3ALLA 3AWIA 3EAOA 4J31A 3D8XA 4Y4NA 4OPCA 2XVJA 5HXIA 2W0HA 4EQRA 5C2TA 1ZMDA 5GRTA 2WDRA 3AECA 1GRAA 4C5OA 2EQ7A 4AT2A 4OPDA 4GDEA 4N9XA 1O95A 3LJPA 5FS7A 1EBDA 2B7RA 4YKGA 1NHRA 1ZMCA 3KA7A 3KVEA 2WQYA 1H84A 2BK5A 3AD8B 3C4NA 3DK8A 1MOKA 2R4JA 4GDPA 4Y4MA 5EBKA 2BCPA 2C65A 3NG7X 1UKVG 2WU2A 4M52A 2GMJA 3LZXA 1YQ4A 1RYIA 2ARDA 1JOAA 4AP1A 1M64A 2WP6A 2WDQA 4UP3A 4H4TA 1CJCA 1S2QA 4YSXA 4B68A 2X50A 2VZ2A 4Z2TA 3DH9A 4U2LA 1NDAA 3CGCA 3DJDA 4LA1A 3GMCA 3ALMA 5EOWA 1GESA 3KLJA 3NRNA 4IA6A 1ZX9A 4IVMB 3VQRA 2GH5A 4X9NA 1W4XA 1B8SA 1GRBA 5C3JA 3RP6A 1BF3A 4TM3A 4FX9A 1BWCA 4RG3A 4D04A 1IUUA 3UKHA 1CJ4A 2XLUA 4CCRA 2BC0A 1EL9A 2C3DA 1F8SA 1NEKA 1H81A 1CC2A 1ELIA 2J3NA 3DGZA 3NK1X 4O5QA 4U2SA 2E4GA 4U8LA 1RSGA 1B37A 2NVKX 2Q0KA 4GR1A 5KOXA 3AYIA 2B9WA 3H8IA 1Q9IA 3D1CA 3NIXA 4OCGA 3QSEA 4NTEA 1GTEA 2BXSA 2X8HA 2RGJA 1NHSA 3AEBA 1JEHA 3DJJA 1D4DA 2VVLA 3GWDA 3DJEA 4Z44A 3NTDA 2CULA 3K30A 1BKWA 4C3YA 1YQ3A 4C77A 3VR9A 2WU5A 3K7TA 4P9SA 3DJGX 4Z2RA 2AQJA 3L1RA 1EL7A 2FBWA 4EIPA 1BGNA 1XHCA 3ICTA 1JU2A 5IQ1A 3NNEA 2ZBWA 2XCGA 4PABA 3M0OA 3SFEA 2EQ9A 3ABVA 1JRZA 4OPLA 5J60A 3FIMB 1PBCA 5IPYA 2B76A 3CIRA 4OPIA 2WDVA 1B5QA 1DOCA 1FL2A 1REOA 3LB8A 1ZK7A 3QSSA 4U8MA 3UKPA 1OJAA 5BRTA 2WPFA 3P4QA 3QFBA 4OPUA 1CC4A 3URHA 1TDFA 2B9YA 4IVOB 3H8LA 2GR1A 3H4KA 4J36A 1F8RA 1PJ6A 2YLSA 1VG0A 2C70A 3V76A 4K8DA 4AT0A 4C74A 2FJEA 1NG4A 1CJ3A 1S2YA 2OAMA 4CCQA 4B65A 1CBOA 2YLXA 3CGBA 4B66A 1L9EA 3CGEA 3CTYA 3SGLA 5BVAA 3AE4A 3UKAA 1GRGA 3E1TA 1BGJA 2YLTA 3GWFA 3FPZA 2WOVA 4TM0A 4K2XA 1BZLA 2YVJA 2UZZA 2WETA 1Q1WA 3NH3X 1PBEA 4LIIA 3UOZA 2Q7VA 1P2EA 1FOHA 1QLBA 4APNA 5DBJA 2X8GA 2BCGG 4JY2A 2E5VA 3UOYA 1GREA 1LTXR 2GAGB 2GV8A 1DNCA 2Q6UA 1F3PA 2CDUA 3Q9TA 5JCKA 2C67A 3CNJA 3NYFA 1E1LA 3DK9A 2YG4A 3FG2P 3NHOX 4A5LA 4AOSA 5KRQA 1GTHA 2Y6QA 1VG9A 1XANA 3AEEA 3K7QX 2XFQA 2C73A 1PBFA 4NEWA 4OPGA 2VRMA 4YWOA 4CY8A 4JNAA 4GF7A 2YM1A 4UDQA 2BA9A 4JY3A 1ZDLA 2YLRA 2BS3A 3CNPA 3NT6A 4H2RA 4Z43A 2WS3A 4H4ZA 5M0ZA 1EL5A 4UDPA 2OLOA 2Z5YA 5BULA 2QAEA 2V3BA 1KNPA 3NK0X 3L8KA 1N4WA 2WOIA 1IJHA 1IUVA 1HYUA 2EQ6A 2BS2A 3QFAA 2WHDA 1OJ9A 1N1PA 2GQWA 3CNSA 4ICYA 4ZN0A 2RGHA 1L9CA 1DODA
chains in the Genus database with same CATH superfamily
3CQCB 3RNMA 1Z6LA 2X9YA 3UU5A 3K3QC 3IHGA 4USRA 4YLHA 3PUZF 1VOMA 3JC6C 1VBA4 4OVIA 1I6ZA 4CI1B 3ANWA 4OPTA 2H7VC 4H2QA 4H2PA 3UKLA 4YKFA 3P8CD 3K7MX 1NENA 5JVDE 4X1IE 5M4YA 3RGLA 5HHFA 5U1OA 5JCIA 2YLWA 5AQGB 2C4CA 2C76A 5L46A 2G0UA 3T1HT 2B9XA 2C7GA 2NTYA 4ADZA 3NYCA 3Q2MA 1B4VA 2K3WA 3HZLA 1ZHCA 4MLKA 3ZCJA 3NLCA 1BR0A 2YG7A 1RHI4 2PW9A 3FBLA 5BMVE 1M6IA 1TYTA 2V7JA 4Z90A 2LKHA 3NYEA 1POV0 5HXSA 4DR7T 3NZQA 3CNDA 2A89A 1K0IA 3EI0A 3ZJ2A 5A1LA 4OX9T 3P4RA 5ADXL 1JRXA 1VCTA 4UDRA 2JAEA 4Q4X4 2XAJB 4A99A 1FEBA 3EDUA 2WBAA 3KD9A 4F8HA 5HWYA 2SPCA 4Z91A 1NAFA 5CB4E 5L2LA 2CA5A 1HG2A 3QC9A 5JREA 4JYAT 1Y56A 2VKDA 4UVCB 4DR4T 4JUYA 2IAKA 3UU4A 1AR74 3OVUA 2X0YA 2DKIA 2LSGA 4AP3A 4U31A 3AYLA 5AQFB 2O9ZA 3A7MA 4U2TA 1MMGA 1LVKA 4TM4A 1CL0A 1Y0PA 4II2A 3AA7B 3RYHE 4PW8A 4OYJA 3JSKA 1RMU4 2XQ9A 1DOBA 3LADA 1K0JA 3NK2X 1N33T 1YKJA 2C64A 2R4EA 4NIQA 3B6DA 2V6OA 4TNWA 4AXPA 3COXA 5FY7A 1TRBA 2XVFA 4DV6T 2LSJA 2OA5A 4H4PA 5M10A 3ZDNA 3N9NA 3CX7B 2D2SA 4REKA 3KPKA 3CQGB 5L3GB 3ZMTB 4I43B 2WWUA 4CBQA 5AQRB 4Q4W4 4BAYB 4XBFB 2GQFA 2IIUA 3CPJG 2CHNA 2UUCT 3FB2A 5JR9A 3RHAA 3VRAA 1E1HB 2Q9QB 1N4VA 1WYCA 2X0LB 2ZLYA 3DMEA 2GAHB 4LMLA 4AQFC 5AQKB 2VVNA 2XQ7A 3GYJA 4JV5T 3WE0A 1R094 4TM1A 2PHHA 1PS9A 3P9UA 4NTCA 1ZY8A 4WX1A 1UURA 2BG9E 3MXZA 1K0LA 4USQA 4B1BA 3SQPA 3I9WA 3P4PA 1DOEA 4I58A 4UV9B 2QVAA 3ZMZB 2YM2A 4HN9A 2XYOA 4KI0F 3G5RA 4TLZA 3VRDB 3V3OA 2NOXA 1RUI4 4EIQA 3BI4A 1KSSA 4H4SA 4DSGA 1VRBA 1D4EA 4TNVA 3UTEA 4ECHA 3C50A 5ETWA 5LNKA 2CXDA 1D0XA 2RA1A 3HKBE 3KINB 4A79A 4TWFA 1XMQT 4DR5T 5HEJA 3BNUA 3SUCA 4EMJA 3TKLB 2HN2A 2ODVA 1KDGA 1E7PA 2WM9A 3UOXA 3UOVA 4A6NB 5U63A 3AYJA 3FBSA 3S5WA 3UKFA 2KT9A 1ZV4X 1H83A 3PVCA 3UCLA 3AD7B 3DK4A 5LGUB 2Z5XA 4U8IA 1IUSA 1FJGT 4ZI2C 5FVKA 5H6RB 1PDHA 2IVDA 4IA5A 1K4QA 1M62A 4NTDA 4IDPA 4E7SA 1EL8A 2Y6RA 2IVEA 5KXJA 3IHRA 4TZ4C 3NN0X 5L3FB 2OA1A 3TLWA 3NTAA 4PAAA 1YW0A 1IBKT 2V5ZA 3LXDA 3GRTA 2XLSA 4PFPA 2BVLA 1NHPA 4FK1C 2V7LA 4HFHA 4DBQA 3R84B 2X66A 3AECA 1BR2A 4NNJA 4G73A 2EQ7A 3CKDA 4AT2A 4B3RT 4GDEA 2DI4A 4TN7B 5J2TE 1ZMCA 3KA7A 4KMCA 2BK5A 5EBKA 1MOKA 2BCPA 4WNKA 4IIJE 3K3NA 2GMJA 2M6BA 1JOAA 3JADA 3RIUC 4OK0A 2CWYA 4DR2T 2LKGA 3RYFE 4IHJE 3QK6A 4H4TA 4AQYT 5JRCB 3RRWA 2VZ2A 1NDAA 5AQIB 1OXZA 1X9BA 4CZZB 1GESA 2X9HA 1GRBA 5C3JA 5HXEA 4TM3A 4D04A 4RG3A 5HCMA 2IMLA 2JIWA 3C4ZA 4DV2T 3I0QA 1COV4 1NEKA 1H81A 1ELIA 4U8LA 4UELA 3SY4A 4U2SA 2E4GA 1RSGA 3IBPA 3LK2B 2NW8A 2E9XD 1BR4A 2RGJA 3BQLA 1JEHA 2IHR1 3GWDA 4G74A 2CULA 4GYRA 4C77A 2WU5A 3K7TA 2WAUA 2WZIA 3UFGA 1EL7A 2X5ID 4EIPA 4AIUA 1JU2A 2WB5A 4LF7T 2ZBWA 2XCGA 2EQ9A 2XQ6A 5JDMA 2Z6EA 2EHOC 1PBCA 3FZKB 3T2KA 2YK0A 5CJ5A 2MTQA 2LSYA 1B5QA 1REOA 4TWHA 1ZK7A 3LBXB 4HEAA 4I55E 4I4TE 2VQFT 4JI5T 3AAEB 3H8LA 2GR1A 3N9LA 3DP7A 1F8RA 2YLSA 2YN6A 4U7IA 2OV9A 4H63V 4OHFA 5LA6E 1CJ3A 1S2YA 4CCQA 2YLXA 3RYIE 3CGEA 3CTYA 1M7KA 3RKGA 3AE4A 3SZFA 3UUBA 2KXPB 3GWFA 2CEAA 3FPZA 4TM0A 2V6XA 4JI4T 1HRV4 1GQEA 2YVJA 5AQOB 3M65A 3UOZA 1QLBA 5DBJA 3C98B 4P09A 4JY2A 4UEMA 1D1BA 1F3PA 1D1AA 3CNJA 3K3OA 4PDWD 4EOZB 2DL1A 3DK9A 3FG2P 3NHOX 4A5LA 3RX6A 4Q4Y4 2EHOB 2Y6QA 2BKPA 1RUJ4 5AQPB 3W15B 1XANA 3KBUA 2XFQA 2C73A 2W67A 4NEWA 1W0BA 3T0KA 2YM1A 2D0UA 3UQ4A 1ZDLA 3GWHA 2YLRA 2BS3A 3RC3A 2OLOA 1RUH4 4QHOA 2JMHA 4JEHB 3ETUA 3QFAA 1NCQD 3PUYF 1OJ9A 2GQWA 4ICYA 3ADAB 3RF1A 1E1NA 3OZ2A 2XAHB 1N32T 2CLYC 3EABA 3TLSA 3ZN1B 3ETVA 2V1DB 3AA1B 1UGOA 4A9WA 5EK2A 3ITJA 1FMVA 4HFIA 1PIV4 1S35A 2HWB4 1MIWA 4J2WA 2GB0A 3F57A 4IDOA 1GRHA 4KHPT 1SUMB 3GDNA 3PS9A 1XHZA 4A5XA 4AKHA 1GOSA 3ATRA 4YXDA 2Q0LA 4B67A 1S94A 2GR0A 3ZYKA 5LHGB 2AXDS 3PO7A 1FEWA 4EQWA 4YT0A 1HFAA 4RG4A 2PFVA 4AOXA 5HYMA 3P7IA 3L3PA 2IW5B 1HX1B 1HNZT 1N34T 2X0HA 1HNWT 1FCDA 1L9DA 4B3ST 1GRFA 2LLYA 3HKEE 4HKAA 3HI2A 1QJDA 4DV5T 2PG8A 2A8XA 4I50E 2PLV4 2C75A 3PTRB 3GMBA 3NGCX 1P2HA 2CM0A 1SEZA 2PYJA 2LE8A 3M12A 4YTPA 4CY6A 2F5ZA 3U3IA 2XASB 2Y48B 4P1NA 2ZZBA 4HGAA 2CCQA 3ICRA 4DIDB 1E1KA 5DQVA 2GF3A 1G73A 3AAIA 2LSIA 2H88A 2GEWA 2YDSA 3LFMA 5KX5E 1F8WA 4QKNA 1LV0A 1L0VA 3SYIA 1XHXA 1GSNA 1JRYA 2MYSA 4EQXA 2TPRA 3T8OA 4A6NA 3AE3A 4AQFA 3P4SA 2YDQA 2X99A 1VDCA 3UP5A 4ZS3A 5EK4A 4DUYT 5HEOA 3RH3A 3Q6JA 2M6IA 1YKEB 1TDEA 1O3XA 2BKOA 5JDLA 3OC4A 3QVPA 2L9QA 3NRXA 1XDOA 3KU9A 4OYKA 3ZMVB 4U8OA 4EMWA 1S3BA 3R9UA 4GYSA 5LGNB 1H7XA 4EZHA 3Q9DA 2WPEA 3IF9A 4I59A 4O4IE 3ATQA 4O5UA 2XQYA 2XVIA 5AQTB 1GT8A 3II4A 4FDCB 2E9XB 1H7WA 2BACA 3OBVE 4BK1A 4IV9A 3GQKA 1LQTA 4ZI3C 2JB2A 4B3MT 2V3AA 2KWIB 4DV1T 2ZZCA 4NUUA 4Z26A 3AE2A 3LSVA 2QCUA 2N1GA 2R9ZA 2BYBA 4TLXA 1JNRA 5KWFA 4GKKT 1YY5A 4X4JA 4YSHA 3JAEA 4NWZA 4DO0A 5JH7E 4JBWF 2R6GF 3UFEA 4IE4A 5FL1A 2E1MA 2GK9A 3KFWX 4UV8B 3FXDB 2W63A 2KSRA 2K24A 4PK4A 1FECA 5JRCA 4PJNA 3ZT6A 4EMIA 1RUC4 3ZKRA 1PBBA 3F8PA 2QGSA 4H4UA 5FS9A 2CRBA 2W61A 3NBXX 5AQHB 2N9DA 4JI7T 5JCMA 3H37A 3B57A 1TDNA 3AE5A 2PYXA 2VURA 4ASKA 3LJCA 2YEVC 3UTHA 1EZ3A 5JCNA 2R044 1GNDA 1MNDA 3UU8A 3PE0A 2GR2A 3AXBA 2NPXA 4FK1A 1E6EA 1WYBA 1CC6A 2VB6A 1ZOVA 2I0MA 1GV4A 1HRI4 3ZMSB 3RPUA 3DA1A 1KF6A 3N9QA 4CQIA 5ABFB 2WOWA 3HKDE 1PHHA 2BC1A 2W0GA 3BHFA 4GB34 1QO8A 1XNQT 3I3LA 4CNKA 3LBXA 4UVBB 4WBOA 3PUQA 5LB7B 3UULA 3RIUA 4WBNE 4U3CA 1GETA 1H86A 3CX8B 1H8TD 3V3NA 2CPTA 4NZHA 2YR5A 1MMNA 2QA2A 2WP5A 3AB1A 2Q9QC 2FJBA 3QB5A 4CXWA 3SZCA 1UX4A 1FIOA 4L9IA 3I6DA 4NUVA 2C5IT 4H2NA 4G6HA 2BZBA 4JNQA 3S61A 4U8NA 3CNTA 4JN9A 2VQBA 4P0AA 2GR3A 3DGHA 4CRTA 4ZI7E 3BQIA 2F4VT 5U25A 2P9BA 2GMHA 3CX6B 2CXFA 4X65T 3FZFB 4CI3B 2IC9A 4HE8A 5AQLB 5FMHA 3EAOA 4J31A 3D8XA 2C5KT 5HXIA 1OWAA 2W0HA 4EQRA 1ZMDA 2MOZA 2EHOA 2KMFA 3SXIA 3HL6A 1EBDA 2W00A 1NHRA 4TV8E 3SWHA 2WQYA 1H84A 3DK8A 4GDPA 4Y4MA 2R4JA 3NG7X 1UKVG 2WU2A 2A3DA 4M52A 4HWDA 2VQET 2XQAA 2ARDA 3PV0F 4GK5E 5KMRA 1M64A 2XAQB 4XAXB 1CJCA 4YSXA 5KNLA 2X50A 1OEDC 3DJDA 4LA1A 3GMCA 2PYLA 3ALMA 5EOWA 4IVMB 4X9NA 5JDGA 4G9KA 1B8SA 4ILBA 1HS7A 1XWMA 3HA4A 2A72A 4LF6T 1EV14 1EL9A 5FY0A 1F8SA 4H63H 3UUNA 3C4XA 1CC2A 5HAXA 3LG7A 2NVKX 2V26A 3PUAA 4GOUA 4UIGA 2B9WA 3AYIA 3H8IA 4OCGA 5LMNT 3KV9A 4F6RC 2X8HA 2VVLA 2J62A 3Q5WA 3NTDA 4Z44A 4C3YA 1YQ3A 2E2AA 3VR9A 3DJGX 5HEGA 2AQJA 2FBWA 4LF9T 3G06A 5L3CB 1BGNA 3RIAA 5IQ1A 4PABA 2V5DA 5L3BB 1JRZA 3HYWA 1VBE4 5J1GA 5J60A 3ONJA 3UUXB 5IPYA 2YKSA 1DOCA 2W66A 5IYZE 4U8MA 3F31A 1OJAA 5BRTA 4O4LE 4DV0T 1CC4A 2WWVA 4U74A 2V6YB 3FZHB 3ZT5A 1PJ6A 1OEDB 2C70A 3V76A 4K8DA 4AT0A 1NG4A 1CBOA 5AFUL 1H7CA 3CGBA 1L9EA 3SZWA 4FI5A 5HEHA 2RMU4 2BKNA 2LOPA 2LOSA 3E1TA 4YHHT 1BGJA 2YLTA 5FVLA 3UQ7A 4HWIB 3N5LA 3AVSA 3AVRA 4MBQA 2H3RA 1HCIA 4IE0A 5LOVE 2NTXA 1AR64 1J5WA 4DR3T 3NKZA 3D0TA 3T14A 1MIYA 3PUSA 4DBRA 5LG3A 2UUAT 1GREA 1VBB4 2BVMA 2QYWA 5IUXA 2C67A 1E1LA 2YG4A 2JQQA 4AOSA 4DMVA 2ZM6T 3AEEA 4A56A 1ASJ4 1KEYA 1PBFA 4OPGA 4CY8A 5FL0A 4JNAA 2RP4A 4H9OC 2WS3A 5LHHB 3KVBA 4V1Av 1W0AA 4UDPA 5BULA 2D5UA 2QAEA 1KNPA 1D0ZA 2JQ9A 3N9OA 2WOIA 3NK0X 1YD8G 1IUVA 4AISA 2BS2A 3F2EA 4JI8T 1AL24 1N1PA 3CNSA 3I9YA 2Y8DA 2RGHA 2WEUA 1L9CA 3Q9TA 5EB4A 4ZCCA 4FJOA 1IZNB 3U78A 3IWAA 4H9PC 2I59A 5LCYA 5EB5A 1NA1D 4ISTA 4N78D 4ZOLE 4NXMT 3QUJA 2YQUA 1HX8A 3ZPOA 3ONXA 2YG3A 2LRLA 5F5WA 2JRKA 3QSMA 5L4EA 3N2KE 2CVJA 4UR9A 5EK3A 2ZZ0A 2CXLA 2YAUA 3WAKA 5L3DB 4RHV4 2CBIA 2N2NA 1PXCA 2PJQA 3NVOA 1YXRA 2LHNA 2OLTA 1HR0T 3FXEB 3AEDA 2CFYA 3QB5K 1NHQA 3SX6A 3PUWF 5DJQC 4BJYA 2A2FX 4O2AE 2IDOB 3MK7C 3MKDA 3RRCA 3AD9B 2CWOA 5JDHA 3FMWA 3VU7H 4E0VA 1IBMT 1V59A 3UP4A 4X1KE 4JI2T 1WRDA 4LU6A 1ZEEA 2WSSV 3ZYMA 4X1YE 4GAVA 2R7FA 4UF0B 1LVLA 4TUYE 2RGOA 3X1DA 4UXNB 4Z2UA 3RLFF 4ERRA 5HY5A 2NW9A 4JQ9A 3KBTA 4ADWA 2AAQA 5LBMA 4CN6A 4ISSA 4AKLA 2V7MA 5IQ4A 5KOWA 4DVDA 1CJ2A 2KNDA 4EGWA 3PUGA 3REDA 3CGDA 3LZWA 3RHWA 3IC9A 1R8IA 2UUBT 2LJLA 1IUTA 5BUKA 1D7YA 3RQUA 1Z0PA 5ABFA 3BI2A 1RUG4 3I0OA 4BV6A 4H4VA 2HPLA 2BK3A 3G5QA 5J0ZA 5ABGA 5J7XA 5ABEA 2B7SA 4C90A 4CNJA 3BQKA 2R0GA 1YKHB 3Q5DA 4HA6A 5FP3A 3BK9A 4DGKA 3ESLA 1PJ7A 3SM8A 4TV9E 4GCMA 1XI1A 4K7ZA 4K5SA 3GYIA 3VHLA 2DHRA 1LKXA 2VVMA 2BXRA 4DMWA 1RUD4 3JC6D 4EZ4A 1GERA 1PO14 3AEGA 3B5MA 1TDOA 2ZM2A 3WAJA 3GSIA 3DTOA 1GALA 4GUVA 4ZZCA 3OTOT 4H4YA 1Z7S4 2X51A 2VVLG 3AAAB 1AR94 1UK5A 1J5ET 2VKHA 4K0KT 2UU9T 2RS34 3J8F4 3RC8A 3C4WA 1UX5A 2LFCA 3MJXA 1X31B 4ILCA 3PUXF 4U72A 2XQ8A 2VKOA 3ALJA 2YINA 3EPTA 4H4QA 3GN5B 4AQGA 2BS4A 5TR3A 4DNAA 1SE7A 4KHZF 3FZMB 4WZXA 4J34A 1OEDE 2M67A 3GYXA 5LV9A 3QJ4A 5JQGE 5LP6E 1KNZA 1W9RA 2DCFA 4C3XA 5KVIA 3L8RA 4O4HE 1BEV4 3F8DA 2IC6A 2Q9QA 3FBZA 3N9PA 1RUE4 3M3ZB 3J9X1 4JEUB 4CI2B 3EDVA 4ZXLA 1ZKEA 1D5TA 1GXFA 1ZKQA 3VRBA 2L3LA 4ZEYA 3SFDA 1B7TA 4U33A 2PTFA 2XVHA 2RR14 3ZEFB 4IDZA 4PK5A 4B63A 3V5UA 2YVGA 2XSBA 5TAOA 1N36T 3IA3A 2IIDA 2XJ7A 1QUUA 1Q1RA 3VKGA 3L09A 2BG9C 5IWAT 4YSZA 1COYA 1HTJF 2R0CA 1R084 1MO9A 3DJBA 1WR6A 2LT3A 5FYMA 2ZMAA 1LJ1A 4QXBB 3A5XA 1UCUA 1O5WA 1YQZA 3AEAA 4H7UA 3ZMUB 4YJ2E 5AQNB 2YWLA 4HTEA 3MA9A 2GRTA 4J33A 4KX6A 5LGTB 4EQSA 2E9XC 2XFNA 3TLUA 2Y6XA 4L0RA 4QX8B 3ZC1A 2XTLA 1OJTA 2WMNA 3T37A 5FXXA 1NWMX 3L39A 4YHJA 3P1WA 3AE1A 2VL8A 3RP8A 1KFYA 4DSHA 3UTFA 2LHRA 1OEDA 3S4UA 4QH5A 1PN0A 2H7OA 5FNVE 1MIVA 2AR8A 3BI5A 5CA1E 4BK3A 1MMDA 2C0SA 3Q5XA 2XAGB 4QWNB 4J2CA 2DLRA 3RQWA 1RP0A 1S3EA 1J1JA 2LM9A 2A87A 4GAPA 4EV6A 3NN6X 2XAFB 4L5GA 2BG9B 2JMKA 4EYYR 3AA0B 3SS1A 4J56A 4C91A 1WFDA 2DWKA 5KVHA 1PXAA 1Z8UA 2BBJA 5LJNA 3ZLIA 4IT4A 3QVRA 4M1PA 4DV7T 1AOGA 5AQVB 4H9RC 5AQJB 4NEVA 1NAAA 3ALLA 4Y4NA 4OPCA 2XVJA 4CN4A 4LF5T 2WDRA 3CQXC 5J2UE 1GRAA 4C5OA 4OPDA 4HWFA 4N9XA 1O95A 3LJPA 5FS7A 4YJ3E 1IBLT 3KVEA 2RS54 3AD8B 3H3MA 4ZZBA 1T72A 4ILAA 4HFDA 1MMAA 1YQ4A 4MFRA 2AE9A 4LF8T 2ODUA 1RYIA 4AKGA 5GONE 4AP1A 2XSAA 2WP6A 4UP3A 4MALA 5KDMC 4U2LA 1WR0A 4JI1T 2VK9A 3PURA 3KLJA 4IA6A 1E2AA 3B13A 5FXWA 5LXTE 1W4XA 2GH5A 5LMUT 3RP6A 3N2GE 4FX9A 1BWCA 1IUUA 5HEUA 3UKHA 2PZSA 2VVSA 4LFCT 4CCRA 4H9SE 3OPCA 4PJMA 2HWC4 3NK1X 4O5QA 5HWXA 2Q0KA 1EAH4 4IL9A 2CBJA 5KOXA 2WY2A 3D1CA 3QOFA 4NTEA 4EEBA 4DUZT 3AEBA 5L47A 3E0ZA 4U2ZA 3K30A 3EHZA 4Z2RA 1PVC4 1XNRT 4P9SA 5L3EB 4HFCA 2YDRA 1SA0E 5LG4A 5LJMA 3J7Yq 3M0OA 3SFEA 3ABVA 4LF4T 3NZPA 5ABHA 5AQMB 1Y64B 3P4WA 4OPLA 1MQTD 2MBGA 3CK6A 2QA7A 1T8BA 3KDSE 3E08A 3UT5E 2B76A 3UU6A 3CIRA 5KMGP 4IE5A 4OPIA 3LB8A 5KMPA 2UXCT 4X66T 3P4QA 3QFBA 4OPUA 3URHA 1TDFA 2CMRA 4J36A 4ZI2D 3I1AA 2BRYA 1Y01A 4QXCB 4C74A 3PUVF 2RPAA 4AI6A 4UF0A 5LBQB 4ZHQE 4B65A 2HPJA 3SGLA 1T98A 3ONLC 3RI5A 3MZKB 3PJAJ 3RYCE 1GRGA 1IAPA 2J4GA 3KV5A 2WOVA 4HFVA 1BZLA 3CPZA 3LK42 3NH3X 1SHZC 2Q7VA 1P2EA 2ZM0A 5HYAA 4APNA 5LHIB 3UOYA 3K1SA 2GAGB 2GV8A 2CDUA 5JCKA 3NYFA 2KINB 4Q4V4 4DV3T 2R064 3K7QX 3NWIA 3ZCIA 2VRMA 4YWOA 4UDQA 4ANJA 2BA9A 2MAWA 3NT6A 4Z43A 5M0ZA 2Z5YA 3RIFA 2V3BA 2NR4A 3MACA 2K5BB 1N4WA 1IJHA 3FZLB 1HYUA 3EVYA 1UUSA 2EQ6A 4ZN0A 2BRAA 2XUEA 2DNXA 4Z25A 2D9DA 2E5LT 2EX3A 1KSUA 1FMWA 1IUWA 2J1DG 3GMIA 3KKJA 2HN1A 2E8IA 5F8PA 2YU2A 4X20E 4Z8XA 2XDOA 2R46A 2PBIA 2FJDA 5GSNA 3HYXA 3G5SA 4JI0T 1IJ5A 2EHOD 1IJ6A 4K5RA 2W2UA 1TDKA 3GN5A 1HNXT 3O4XE 2QRXA 3VR8A 1E39A 2WCAA 2OLNA 1D4CA 1LRZA 3O1JA 2JQKA 4UVAB 4A7AA 4IGUA 2R074 3ZYLA 2X68A 2XLPA 4OFZA 2WP9A 2C72A 1DU2A 3N2OA 4NPPA 3ZYXA 2X9WA 4H9QC 4U8KA 1AJ3A 2VQ7A 2L8KA 2J47A 3AE8A 3PJAA 4K22A 2EQ8A 2ACXA 2I0ZA 1OJDA 1D7LA 4BURA 4X62T 3GRSA 5CFBA 1VQWA 4H50A 1I94T 4ILUA 2JK6A 3ZJ1A 5JDFA 1NG3A 3GDPA 3AEFA 3JBG4 2RM24 2APGA 3UKQA 1TYPA 3WI3A 4DR6T 2XQ3A 3CN8A 4E7ZA 2K48A 2X67A 5JTGA 4XWRA 1AR84 3IF8B 1PJ5A 1LPFA 4Y4LA 1XMOT 2TMDA 4HWHA 4WCTA 2XFOA 1PO24 2ACZA 3BNMA 2BABA 2JQHA 3H3AA 1DXLA 4DV4T 3C96A 1VRQB 1ZOYA 1HXS4 3GA8A 4JDRA 2XFPA 2JB3A 4MHCA 4QXHB 3T2YA 1RVF4 4MJWA 4HB9A 3EAMA 1PBDA 3O1IA 1NPXA 2NP9A 5CA0E 5DQWA 4IE6A 3ZSTA 3UTGA 1OJCA 5CQFA 1HG5A 3HKCE 2XFUA 3IHMA 2YOEA 5AQUB 2QA1A 2WPCA 3JAFA 1PXBA 4U8JA 2X3NA 5CKUA 4D03A 3UTKA 2KWHA 2BG9A 1CHUA 2XM2A 4B64A 2XQ5A 4PJLA 5FS6A 2VL0A 5E0OA 4YTNA 3C4AA 3UKKA 3AXJB 1CF3A 5ER0A 2DWGA 4EXTA 2KZ7B 5BR8T 1H6VA 1JNZA 3ICSA 4A97A 4X5TA 4EAHA 4EB6E 2R45A 1IUXA 3O0HA 3ANWB 2HH7A 1VRH4 2X9XA 1E1MA 3CPHG 4GIWA 2CE7A 5KMQA 4II3A 2BK4A 2JB1A 4GRTA 2E9XA 4EM4A 2XVEA 4A65A 2DKHA 4TWDA 2ZM8A 4WW0A 5C8YE 3ZN0B 5HCJA 3N9MA 4GK0E 5JCLA 3GD4A 3OYXA 4PJJA 1GEUA 4PFOA 1N4UA 4KPRA 4G63A 2JKCA 2V5CA 2LSKA 1VBD4 4YFSA 3M13A 2JJ9A 1FEAA 3SZ0A 2JPFA 1DJQA 4BJZA 4AKRB 2V7KA 2HHHT 1O94A 1LQUA 2NW7A 2WBLA 2YG6A 2YVFA 3CPIG 3P50A 3F8RA 3EF6A 3ISHA 4IREA 2GVCA 1GRTA 2JBVA 3HR0A 5JDNA 1US7B 3AA6B 2H89A 1F6MA 3CVRA 5JDQA 2UXDT 2C3CA 4LMKA 2YR6A 1ONFA 5HXHA 1ZP0A 1D1CA 2XLRA 3BHKA 4ZS2A 2RABA 4XWZA 3AE6A 4ZCDA 3JD74 2HQMA 1DJNA 4NXNT 4IDQA 1MXTA 5FS8A 4YTMA 2W62A 4QH1A 5FXZA 4PNIA 2K9AA 5F3JA 2IUBA 4YSYA 3B3RA 2YLZA 3LDQB 2XZEA 4LFBT 2WESA 2FJAA 1Y56B 3HYVA 4RSLA 4H4RA 2YG5A 2YR4A 4XXGA 2UXXB 1GPEA 5HXRA 2R0PA 2V60A 3EUHA 2W4XA 2YU1A 2X8CA 2V61A 3TLTA 2OALA 2XM1A 5JR9C 3LOVA 4J57A 4G2AA 3A8YC 3AE7A 3KPFA 3GQHA 1XDIA 4DNDA 3AE9A 4H4WA 1U5PA 4B3TT 2XQ4A 3O9XA 3NKSA 4U8PA 2BBHA 3OJAA 1H82A 4H4XA 2VRLA 4BK2A 4KP3C 3GD3A 2ES0A 4CXXA 2VWAA 2VOUA 1HF8A 4GKJT 1K5MD 4CN1A 4EIWA 3Q5EA 4JLEA 4EM3A 4PK6A 2XLTA 4A98A 3RP7A 2VASA 4TX5A 4KBMB 4Z24A 5FKYA 4ZI3D 3EANA 2UXNB 3T1YT 4X9MA 3ZT7A 2NWBA 4B69A 2C66A 1G8XA 1BR1A 3QNUA 4QH4A 2WMOA 5FMNA 4IL4A 4BJMA 3CWZB 3JCFA 5DABA 1XPQA 1W09A 5LYJE 4PAGA 1KNRA 3AWIA 4WYVA 5C2TA 3LK3B 4U7YA 5HXCA 5GRTA 2MPKA 2XPKA 4AKIA 2RS14 4YKGA 1V9DA 2B7RA 4BA9A 3NRYA 3C4NA 3CMMA 5JR9B 2C65A 2BDEA 3E22E 4O2BE 4LFAT 4BJNA 4Q25A 3LZXA 2LRKA 4U2YA 1QSDA 2CHOA 2WDQA 2FUPA 4COFA 4DR1T 1S2QA 4B68A 4Z2TA 3T2ZA 3DH9A 3CGCA 1CUNA 5H6QB 4G6GA 3NRNA 3VQRA 1ZX9A 2XHEB 1D4M4 2LM2A 3SRZA 4IE7A 1XDPA 5KMSA 1BF3A 4K0UA 2WZHA 4IDNA 4O8SA 1WLXA 1CJ4A 2XLUA 2PY5A 2BC0A 2C3DA 3RKOA 3IEEA 3DGZA 2J3NA 1B37A 4GR1A 3CMLA 3PU8A 1X79A 3AB3B 1Q9IA 3NIXA 3KV4A 3QSEA 1GTEA 3VKHA 3OKQA 1T7SA 2BXSA 1NHSA 3C64A 3ZC0A 3DJJA 1D4DA 3DJEA 5FY1A 1BKWA 1D0YA 4QX7B 4LMJA 3L1RA 3K8PC 1MNEA 3ICTA 1XHCA 3KV6A 4P0BA 1OOPD 3NNEA 3ZSSA 3FIMB 1LVFA 3PDYA 2XY8B 1WCRA 2Q9QD 2V8SV 2WDVA 3QSSA 1FL2A 3UKPA 1VCSA 5FXVA 2WPFA 2KLQA 1RUF4 2B9YA 4IVOB 3H4KA 3FI7A 2B1EA 1VG0A 3T31A 3OYZA 2CLYB 4JI3T 2FJEA 2OAMA 4B6XA 2V6YA 3UUMA 3V5SA 4JI6T 5AQSB 4B66A 4KUMB 5EZYE 4XZCA 5BVAA 3UKAA 3R6NA 3UU3A 4K2XA 2UXBT 2UZZA 5L4HA 1Q1WA 2C5JA 2WETA 1PBEA 4LIIA 4EYUA 1VBC4 1KK7A 1FOHA 2X8GA 2BCGG 4O4JE 2E5VA 1U4QA 1LTXR 1DNCA 2Q6UA 3TLVA 4CXYA 5AQQB 2D0TA 4H9NC 5KRQA 1GTHA 5IHYA 3KVAA 1VG9A 2LEHA 3C51A 2VKJA 4HFEA 3O1HA 4EEDA 4GF7A 3FHNA 3SOLA 4JY3A 2I6HA 4HFBA 1XZYA 3CNPA 4H2RA 4HWCA 2V7IA 1EL5A 4H4ZA 2A9UA 3L8KA 2WHDA 4YY3T 3PU3A 4I0UA 5CGMA 3AXJA 4X64T 1DODA
chains in the Genus database with same CATH topology
1E1NA 3RNMA 3OZ2A 1Z6LA 4Z25A 3IWAA 3IHGA 1KSUA 4USRA 5EB5A 1IUWA 4OVIA 3KKJA 4OPTA 2YQUA 4H2QA 2YG3A 2XDOA 4H2PA 3UKLA 4A9WA 4YKFA 3ITJA 3K7MX 3QSMA 2R46A 1NENA 2CVJA 2FJDA 5GSNA 3HYXA 3G5SA 5HHFA 5U1OA 2ZZ0A 5JCIA 4J2WA 2YLWA 2C4CA 2C76A 2GB0A 1GRHA 4K5RA 1TDKA 5L46A 2YAUA 1E39A 3VR8A 2B9XA 2C7GA 3GDNA 3NYCA 2OLNA 3PS9A 1D4CA 1PXCA 1GOSA 1B4VA 3HZLA 4A7AA 3ATRA 4YXDA 3NLCA 2Q0LA 2YG7A 4B67A 3AEDA 2GR0A 2CFYA 1M6IA 1TYTA 3PO7A 1NHQA 2XLPA 3SX6A 4EQWA 2WP9A 4YT0A 2C72A 4RG4A 4BJYA 3NYEA 3ZYXA 3AD9B 4AOXA 4U8KA 5HYMA 3CNDA 2VQ7A 3FMWA 4E0VA 1FCDA 3AE8A 1L9DA 1V59A 3UP4A 4K22A 2A89A 1GRFA 1K0IA 2EQ8A 3P4RA 4LU6A 1JRXA 2I0ZA 1OJDA 4GAVA 1QJDA 3ADAB 4UDRA 1D7LA 2JAEA 1LVLA 2RGOA 4BURA 3GRSA 4H50A 1VQWA 4Z2UA 2A8XA 2JK6A 5HY5A 2C75A 4A99A 4JQ9A 1NG3A 1FEBA 3GDPA 3AEFA 3GMBA 1P2HA 3NGCX 2AAQA 4ADWA 1SEZA 2APGA 2WBAA 3UKQA 3M12A 4YTPA 4CY6A 1TYPA 2F5ZA 5EB4A 3KD9A 5IQ4A 5KOWA 3CN8A 4ZCCA 1CJ2A 2ZZBA 4XWRA 3ICRA 1PJ5A 3CGDA 3LZWA 1E1KA 3REDA 3IC9A 5BUKA 1LPFA 1IUTA 4Y4LA 1D7YA 2GF3A 2TMDA 1Y56A 4WCTA 2XFOA 3BI2A 2ACZA 2H88A 2BABA 3BNMA 1DXLA 4BV6A 2GEWA 2BK3A 3G5QA 4H4VA 3C96A 1VRQB 5J7XA 1ZOYA 1F8WA 2B7SA 1LV0A 4JDRA 4CNJA 1L0VA 2DKIA 3SYIA 2XFPA 2R0GA 1GSNA 1JRYA 2JB3A 4AP3A 3AYLA 4HA6A 3T2YA 2TPRA 4EQXA 4A6NA 3AE3A 2O9ZA 4MJWA 3P4SA 4DGKA 4HB9A 2X99A 1VDCA 3UP5A 1PJ7A 1PBDA 3SM8A 4U2TA 4GCMA 1NPXA 4TM4A 1CL0A 4K7ZA 1Y0PA 3UTGA 4K5SA 4II2A 1OJCA 3GYIA 3Q6JA 5CQFA 2XFUA 3IHMA 2QA1A 1TDEA 2VVMA 2WPCA 2BXRA 3JSKA 3OC4A 3QVPA 1PXBA 1GERA 3KU9A 2X3NA 4U8JA 3AEGA 5CKUA 4D03A 1CHUA 1TDOA 4B64A 1DOBA 3LADA 1K0JA 4U8OA 4EMWA 3GSIA 1GALA 5FS6A 4GUVA 3NK2X 1S3BA 4YTNA 3C4AA 3R9UA 3UKKA 1H7XA 1CF3A 1YKJA 2C64A 2R4EA 4H4YA 5ER0A 2WPEA 3IF9A 3B6DA 2V6OA 4I59A 3ATQA 2VVLG 4O5UA 3COXA 1H6VA 1JNZA 3ICSA 1TRBA 2XVFA 2XVIA 1GT8A 3II4A 4FDCB 2R45A 1IUXA 3O0HA 4H4PA 1H7WA 2BACA 4BK1A 1E1MA 4IV9A 5M10A 3GQKA 1LQTA 3CPHG 3ZDNA 2JB2A 2V3AA 5KMQA 4II3A 2BK4A 2LFCA 2JB1A 4GRTA 1X31B 4EM4A 4REKA 2XVEA 3KPKA 4A65A 2DKHA 2ZZCA 4Z26A 3ALJA 3AE2A 4CBQA 2QCUA 2R9ZA 3EPTA 2GQFA 2BYBA 4H4QA 3CPJG 4TLXA 1JNRA 5KWFA 2BS4A 1YY5A 5TR3A 4X4JA 4DNAA 3RHAA 5JCLA 4YSHA 3VRAA 3GD4A 4NWZA 4J34A 3GYXA 5LV9A 1N4VA 3QJ4A 1GEUA 4C3XA 1N4UA 5KVIA 4KPRA 2E1MA 2JKCA 3DMEA 3F8DA 2GAHB 3M13A 5KNLA 1FECA 1FEAA 4EMIA 1D5TA 1GXFA 1ZKQA 3SZ0A 3VRBA 1DJQA 3GYJA 3WE0A 4BJZA 1PBBA 3F8PA 3SFDA 2XVHA 1O94A 4H4UA 4TM1A 1LQUA 5FS9A 2PHHA 1PS9A 2YVFA 2YG6A 3P9UA 3CPIG 4NTCA 2YVGA 1ZY8A 4B63A 3F8RA 4WX1A 3EF6A 2IIDA 3ISHA 5JCMA 1K0LA 1Q1RA 4USQA 1TDNA 4B1BA 3AE5A 3SQPA 2GVCA 3P4PA 1GRTA 2JBVA 1DOEA 2PYXA 4I58A 4YSZA 3UTHA 1COYA 2H89A 1F6MA 2C3CA 5JCNA 2YR6A 1ONFA 2R0CA 1MO9A 2YM2A 1GNDA 1ZP0A 2GR2A 2XLRA 1LJ1A 2RABA 3BHKA 3AE6A 4XWZA 2XYOA 3AXBA 2NPXA 4ZCDA 2HQMA 1DJNA 3G5RA 4FK1A 4TLZA 3V3OA 3VRDB 1E6EA 1O5WA 4EIQA 3BI4A 1KSSA 1CC6A 1YQZA 4H4SA 3AEAA 1MXTA 4YTMA 4H7UA 5FS8A 4DSGA 2YWLA 1ZOVA 1D4EA 3UTEA 4ECHA 1GV4A 4YSYA 3B3RA 2YLZA 2WESA 2GRTA 4J33A 3DA1A 2FJAA 4KX6A 4EQSA 1KF6A 1Y56B 3HYVA 4RSLA 4H4RA 2YG5A 2YR4A 2XFNA 2WOWA 4XXGA 1GPEA 1PHHA 4A79A 2BC1A 2R0PA 3BHFA 2V60A 1QO8A 1OJTA 3I3LA 4CNKA 3T37A 2X8CA 2V61A 3BNUA 4EMJA 3SUCA 2OALA 3LOVA 3P1WA 4J57A 1GETA 3KPFA 3AE7A 3AE1A 1KDGA 3RP8A 1KFYA 4DSHA 3UTFA 3GQHA 1H86A 1E7PA 3UOXA 1XDIA 3UOVA 4A6NB 3V3NA 5U63A 3AYJA 3FBSA 1PN0A 3AE9A 4H4WA 3S5WA 3UKFA 2AR8A 3BI5A 4NZHA 2WEUA 3NKSA 4U8PA 4BK3A 2YR5A 1H82A 2QA2A 2WP5A 3AB1A 4H4XA 1H83A 2FJBA 2VRLA 4BK2A 3PVCA 3GD3A 3SZCA 3UCLA 3AD7B 1RP0A 3DK4A 2VOUA 1S3EA 3I6DA 2A87A 2Z5XA 4GAPA 4U8IA 1IUSA 4H2NA 4EM3A 2XLTA 4G6HA 3NN6X 3RP7A 4JNQA 3S61A 4U8NA 1PDHA 3CNTA 4JN9A 2VQBA 2GR3A 3DGHA 4IA5A 1K4QA 4Z24A 2IVDA 4NTDA 4CRTA 3EANA 1EL8A 2Y6RA 2IVEA 5U25A 5KXJA 2GMHA 4X9MA 4B69A 3NN0X 2C66A 2OA1A 4J56A 3NTAA 4PAAA 5KVHA 1PXAA 2V5ZA 3LXDA 3QVRA 3GRTA 2XLSA 1AOGA 1NHPA 1XPQA 4FK1C 4NEVA 1NAAA 5FMHA 1KNRA 3ALLA 3AWIA 3EAOA 4J31A 3D8XA 4Y4NA 4OPCA 2XVJA 5HXIA 2W0HA 4EQRA 5C2TA 1ZMDA 5GRTA 2WDRA 3AECA 5KMPA 1GRAA 4NNJA 4C5OA 4G73A 2EQ7A 4AT2A 4OPDA 4GDEA 4N9XA 3SXIA 1O95A 3LJPA 5FS7A 1EBDA 2B7RA 4YKGA 1NHRA 1ZMCA 3KA7A 3KVEA 2WQYA 1H84A 2BK5A 3AD8B 3C4NA 3DK8A 1MOKA 2R4JA 3CMMA 4GDPA 4Y4MA 2BCPA 2C65A 5EBKA 3NG7X 1UKVG 2WU2A 4M52A 2GMJA 3LZXA 1YQ4A 1RYIA 2ARDA 1JOAA 4AP1A 5KMRA 1M64A 2WP6A 2WDQA 4UP3A 4H4TA 1CJCA 1S2QA 4YSXA 4B68A 2X50A 2VZ2A 3T2ZA 3DH9A 4U2LA 4Z2TA 1NDAA 3CGCA 3DJDA 4LA1A 3GMCA 3ALMA 4G6GA 5EOWA 1GESA 3KLJA 3NRNA 4IA6A 1ZX9A 4IVMB 3VQRA 2GH5A 4X9NA 1W4XA 4G9KA 1B8SA 1GRBA 5C3JA 3RP6A 5KMSA 1BF3A 4TM3A 4FX9A 1BWCA 4RG3A 4D04A 1IUUA 3UKHA 1CJ4A 2XLUA 4CCRA 2BC0A 1EL9A 2C3DA 1F8SA 1NEKA 1H81A 1CC2A 1ELIA 2J3NA 3DGZA 3NK1X 4O5QA 4U2SA 2E4GA 4U8LA 3SY4A 1RSGA 1B37A 2NVKX 2Q0KA 4GR1A 5KOXA 3AYIA 2B9WA 3H8IA 1Q9IA 3D1CA 3NIXA 4OCGA 3QSEA 4NTEA 1GTEA 2BXSA 2X8HA 2RGJA 1NHSA 3AEBA 1JEHA 3DJJA 1D4DA 2VVLA 3GWDA 3DJEA 4G74A 4Z44A 3NTDA 2CULA 3K30A 1BKWA 4C3YA 1YQ3A 4C77A 3VR9A 2WU5A 3K7TA 4P9SA 3DJGX 4Z2RA 2AQJA 3L1RA 1EL7A 2FBWA 4EIPA 1BGNA 1XHCA 3ICTA 1JU2A 5IQ1A 3NNEA 2ZBWA 2XCGA 4PABA 3M0OA 3SFEA 2EQ9A 3ABVA 1JRZA 3HYWA 4OPLA 5J60A 3FIMB 1PBCA 5IPYA 3T2KA 2B76A 3CIRA 4OPIA 2WDVA 1B5QA 1DOCA 1FL2A 1REOA 3LB8A 1ZK7A 3QSSA 4U8MA 3UKPA 1OJAA 5BRTA 2WPFA 3P4QA 3QFBA 4OPUA 1CC4A 3URHA 1TDFA 2B9YA 4IVOB 3H8LA 2GR1A 3H4KA 4J36A 1F8RA 1PJ6A 2YLSA 1VG0A 3T31A 2C70A 3V76A 2BRYA 4K8DA 4AT0A 4C74A 2FJEA 1NG4A 1CJ3A 1S2YA 2OAMA 4CCQA 4B65A 1CBOA 2YLXA 3CGBA 4B66A 1L9EA 3CGEA 3CTYA 3SGLA 3SZWA 5BVAA 3AE4A 3UKAA 3SZFA 1GRGA 3E1TA 1BGJA 2YLTA 3GWFA 3FPZA 2WOVA 4TM0A 4K2XA 1BZLA 2YVJA 2UZZA 2WETA 1Q1WA 3NH3X 1PBEA 4LIIA 3UOZA 2Q7VA 1P2EA 3T14A 1FOHA 1QLBA 4APNA 5DBJA 2X8GA 2BCGG 4JY2A 2E5VA 3UOYA 1GREA 1LTXR 2GAGB 2GV8A 1DNCA 2Q6UA 1F3PA 2CDUA 3Q9TA 5JCKA 2C67A 3CNJA 3NYFA 1E1LA 3DK9A 2YG4A 3FG2P 3NHOX 4A5LA 4AOSA 5KRQA 1GTHA 2Y6QA 1VG9A 1XANA 3AEEA 3K7QX 2XFQA 2C73A 1PBFA 4NEWA 4OPGA 2VRMA 4YWOA 4CY8A 4JNAA 4GF7A 3T0KA 2YM1A 4UDQA 2BA9A 4JY3A 1ZDLA 2YLRA 2BS3A 3CNPA 3NT6A 4H2RA 4Z43A 2WS3A 4H4ZA 5M0ZA 1EL5A 4UDPA 2OLOA 2Z5YA 5BULA 2QAEA 2V3BA 1KNPA 3NK0X 3L8KA 1N4WA 2WOIA 1IJHA 1IUVA 1HYUA 2EQ6A 2BS2A 3QFAA 2WHDA 1OJ9A 1N1PA 2BRAA 2GQWA 3CNSA 4ICYA 4ZN0A 2RGHA 1L9CA 1DODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1N A;  3RNM A;  3OZ2 A;  1Z6L A;  4Z25 A;  3IWA A;  3IHG A;  1KSU A;  4USR A;  5EB5 A;  1IUW A;  4OVI A;  3KKJ A;  4OPT A;  2YQU A;  4H2Q A;  2YG3 A;  2XDO A;  4H2P A;  3UKL A;  4A9W A;  4YKF A;  3ITJ A;  3K7M X;  3QSM A;  2R46 A;  1NEN A;  2CVJ A;  2FJD A;  5GSN A;  3G5S A;  5HHF A;  5U1O A;  2ZZ0 A;  5JCI A;  4J2W A;  2YLW A;  2GB0 A;  2C76 A;  4K5R A;  1GRH A;  5L46 A;  1TDK A;  2YAU A;  1E39 A;  3VR8 A;  2B9X A;  2C7G A;  3GDN A;  3NYC A;  2OLN A;  3PS9 A;  1D4C A;  1PXC A;  1GOS A;  1B4V A;  3HZL A;  4A7A A;  3ATR A;  4YXD A;  3NLC A;  2Q0L A;  2YG7 A;  4B67 A;  3AED A;  2GR0 A;  2CFY A;  1M6I A;  1TYT A;  3PO7 A;  1NHQ A;  2XLP A;  4EQW A;  2WP9 A;  4YT0 A;  2C72 A;  4RG4 A;  4BJY A;  3NYE A;  3ZYX A;  3AD9 B;  4AOX A;  4U8K A;  5HYM A;  3CND A;  2VQ7 A;  3FMW A;  4E0V A;  1FCD A;  3AE8 A;  1L9D A;  1V59 A;  3UP4 A;  4K22 A;  2A89 A;  1GRF A;  1K0I A;  2EQ8 A;  3P4R A;  4LU6 A;  1JRX A;  2I0Z A;  1OJD A;  1QJD A;  3ADA B;  4UDR A;  1D7L A;  2JAE A;  1LVL A;  2RGO A;  4BUR A;  3GRS A;  4H50 A;  1VQW A;  4Z2U A;  2A8X A;  2JK6 A;  5HY5 A;  2C75 A;  4A99 A;  4JQ9 A;  1NG3 A;  1FEB A;  3GDP A;  3AEF A;  3GMB A;  1P2H A;  3NGC X;  2AAQ A;  4ADW A;  1SEZ A;  2APG A;  2WBA A;  3UKQ A;  3M12 A;  4YTP A;  4CY6 A;  1TYP A;  2F5Z A;  5EB4 A;  3KD9 A;  5IQ4 A;  5KOW A;  3CN8 A;  4ZCC A;  1CJ2 A;  2ZZB A;  4XWR A;  3ICR A;  1PJ5 A;  3CGD A;  3LZW A;  1E1K A;  3RED A;  3IC9 A;  5BUK A;  1LPF A;  1IUT A;  4Y4L A;  1D7Y A;  2GF3 A;  2TMD A;  1Y56 A;  4WCT A;  2XFO A;  3BI2 A;  2ACZ A;  2H88 A;  2BAB A;  3BNM A;  1DXL A;  4BV6 A;  2GEW A;  2BK3 A;  3G5Q A;  4H4V A;  3C96 A;  1VRQ B;  5J7X A;  1ZOY A;  1F8W A;  2B7S A;  1LV0 A;  4JDR A;  4CNJ A;  1L0V A;  2DKI A;  2XFP A;  2R0G A;  1GSN A;  1JRY A;  2JB3 A;  4AP3 A;  3AYL A;  4HA6 A;  4EQX A;  2TPR A;  4A6N A;  3AE3 A;  2O9Z A;  4MJW A;  3P4S A;  4DGK A;  4HB9 A;  2X99 A;  1VDC A;  3UP5 A;  1PJ7 A;  1PBD A;  3SM8 A;  4U2T A;  4GCM A;  1NPX A;  4TM4 A;  1CL0 A;  4K7Z A;  1Y0P A;  3UTG A;  4K5S A;  1OJC A;  3GYI A;  3Q6J A;  5CQF A;  2XFU A;  3IHM A;  2QA1 A;  1TDE A;  2VVM A;  2WPC A;  2BXR A;  3JSK A;  3OC4 A;  3QVP A;  1PXB A;  1GER A;  3KU9 A;  2X3N A;  4U8J A;  3AEG A;  5CKU A;  4D03 A;  1CHU A;  1TDO A;  4B64 A;  1DOB A;  3LAD A;  1K0J A;  4U8O A;  4EMW A;  3GSI A;  1GAL A;  5FS6 A;  4GUV A;  3NK2 X;  1S3B A;  4YTN A;  3C4A A;  3R9U A;  3UKK A;  1H7X A;  1CF3 A;  1YKJ A;  2C64 A;  2R4E A;  4H4Y A;  5ER0 A;  2WPE A;  3IF9 A;  3B6D A;  2V6O A;  4I59 A;  3ATQ A;  2VVL G;  4O5U A;  3COX A;  1H6V A;  1JNZ A;  3ICS A;  1TRB A;  2XVF A;  2XVI A;  1GT8 A;  3II4 A;  4FDC B;  2R45 A;  1IUX A;  3O0H A;  4H4P A;  1H7W A;  2BAC A;  4BK1 A;  1E1M A;  4IV9 A;  5M10 A;  3GQK A;  1LQT A;  3CPH G;  3ZDN A;  2JB2 A;  2V3A A;  2BK4 A;  2LFC A;  2JB1 A;  4GRT A;  1X31 B;  4EM4 A;  4REK A;  2XVE A;  4A65 A;  2DKH A;  2ZZC A;  4Z26 A;  3ALJ A;  3AE2 A;  4CBQ A;  2QCU A;  2R9Z A;  3EPT A;  2GQF A;  2BYB A;  4H4Q A;  3CPJ G;  4TLX A;  1JNR A;  5KWF A;  2BS4 A;  1YY5 A;  5TR3 A;  4X4J A;  4DNA A;  3RHA A;  5JCL A;  4YSH A;  3VRA A;  3GD4 A;  4J34 A;  3GYX A;  5LV9 A;  1N4V A;  3QJ4 A;  1GEU A;  4C3X A;  1N4U A;  5KVI A;  4KPR A;  2E1M A;  2JKC A;  3DME A;  3F8D A;  2GAH B;  3M13 A;  1FEC A;  1FEA A;  4EMI A;  1D5T A;  1GXF A;  1ZKQ A;  3VRB A;  1DJQ A;  3GYJ A;  3WE0 A;  4BJZ A;  1PBB A;  3F8P A;  3SFD A;  2XVH A;  1O94 A;  4H4U A;  4TM1 A;  1LQU A;  5FS9 A;  2PHH A;  1PS9 A;  2YVF A;  2YG6 A;  3P9U A;  3CPI G;  4NTC A;  2YVG A;  1ZY8 A;  4B63 A;  3F8R A;  4WX1 A;  3EF6 A;  2IID A;  3ISH A;  5JCM A;  1K0L A;  1Q1R A;  4USQ A;  1TDN A;  4B1B A;  3AE5 A;  3SQP A;  2GVC A;  3P4P A;  1GRT A;  2JBV A;  1DOE A;  2PYX A;  4I58 A;  4YSZ A;  3UTH A;  1COY A;  2H89 A;  1F6M A;  2C3C A;  5JCN A;  2YR6 A;  1ONF A;  2R0C A;  1MO9 A;  2YM2 A;  1GND A;  1ZP0 A;  2GR2 A;  2XLR A;  1LJ1 A;  2RAB A;  3BHK A;  3AE6 A;  4XWZ A;  2XYO A;  3AXB A;  2NPX A;  4ZCD A;  2HQM A;  1DJN A;  3G5R A;  4FK1 A;  4TLZ A;  3V3O A;  3VRD B;  1E6E A;  1O5W A;  4EIQ A;  3BI4 A;  1KSS A;  1CC6 A;  1YQZ A;  4H4S A;  3AEA A;  1MXT A;  4YTM A;  4H7U A;  5FS8 A;  4DSG A;  2YWL A;  1ZOV A;  1D4E A;  3UTE A;  4ECH A;  1GV4 A;  4YSY A;  3B3R A;  2YLZ A;  2WES A;  2GRT A;  4J33 A;  3DA1 A;  2FJA A;  4KX6 A;  4EQS A;  1KF6 A;  1Y56 B;  4RSL A;  4H4R A;  2YG5 A;  2YR4 A;  2XFN A;  2WOW A;  4XXG A;  1GPE A;  1PHH A;  4A79 A;  2BC1 A;  2R0P A;  3BHF A;  2V60 A;  1QO8 A;  1OJT A;  3I3L A;  4CNK A;  3T37 A;  2X8C A;  2V61 A;  3BNU A;  4EMJ A;  3SUC A;  2OAL A;  3LOV A;  3P1W A;  4J57 A;  1GET A;  3KPF A;  3AE7 A;  3AE1 A;  1KDG A;  3RP8 A;  1KFY A;  4DSH A;  3UTF A;  3GQH A;  1H86 A;  1E7P A;  3UOX A;  1XDI A;  3UOV A;  4A6N B;  3V3N A;  5U63 A;  3AYJ A;  3FBS A;  1PN0 A;  3AE9 A;  4H4W A;  3S5W A;  3UKF A;  2AR8 A;  3BI5 A;  4NZH A;  2WEU A;  3NKS A;  4U8P A;  4BK3 A;  2YR5 A;  1H82 A;  2QA2 A;  2WP5 A;  3AB1 A;  4H4X A;  1H83 A;  2FJB A;  2VRL A;  4BK2 A;  3PVC A;  3GD3 A;  3UCL A;  3AD7 B;  1RP0 A;  3DK4 A;  2VOU A;  1S3E A;  3I6D A;  2A87 A;  2Z5X A;  4U8I A;  1IUS A;  4H2N A;  4EM3 A;  2XLT A;  3NN6 X;  3RP7 A;  4JNQ A;  3S61 A;  4U8N A;  1PDH A;  3CNT A;  4JN9 A;  2VQB A;  2GR3 A;  3DGH A;  4IA5 A;  1K4Q A;  4Z24 A;  2IVD A;  4NTD A;  4CRT A;  3EAN A;  1EL8 A;  2Y6R A;  2IVE A;  5U25 A;  5KXJ A;  2GMH A;  4X9M A;  4B69 A;  3NN0 X;  2C66 A;  2OA1 A;  4J56 A;  3NTA A;  4PAA A;  5KVH A;  1PXA A;  2V5Z A;  3LXD A;  3QVR A;  3GRT A;  2XLS A;  1AOG A;  1NHP A;  1XPQ A;  4FK1 C;  4NEV A;  1NAA A;  5FMH A;  1KNR A;  3ALL A;  3AWI A;  3EAO A;  4J31 A;  3D8X A;  4Y4N A;  4OPC A;  2XVJ A;  5HXI A;  2W0H A;  4EQR A;  5C2T A;  1ZMD A;  5GRT A;  2WDR A;  3AEC A;  1GRA A;  4C5O A;  2EQ7 A;  4AT2 A;  4OPD A;  4GDE A;  4N9X A;  1O95 A;  3LJP A;  5FS7 A;  1EBD A;  2B7R A;  4YKG A;  1NHR A;  1ZMC A;  3KA7 A;  3KVE A;  2WQY A;  1H84 A;  2BK5 A;  3AD8 B;  3C4N A;  3DK8 A;  1MOK A;  2R4J A;  4GDP A;  4Y4M A;  5EBK A;  2BCP A;  2C65 A;  3NG7 X;  1UKV G;  2WU2 A;  4M52 A;  2GMJ A;  3LZX A;  1YQ4 A;  1RYI A;  2ARD A;  1JOA A;  4AP1 A;  1M64 A;  2WP6 A;  2WDQ A;  4UP3 A;  4H4T A;  1CJC A;  1S2Q A;  4YSX A;  4B68 A;  2X50 A;  2VZ2 A;  4Z2T A;  3DH9 A;  4U2L A;  1NDA A;  3CGC A;  3DJD A;  4LA1 A;  3GMC A;  3ALM A;  5EOW A;  1GES A;  3KLJ A;  3NRN A;  4IA6 A;  1ZX9 A;  4IVM B;  3VQR A;  2GH5 A;  4X9N A;  1W4X A;  1B8S A;  1GRB A;  5C3J A;  3RP6 A;  1BF3 A;  4TM3 A;  4FX9 A;  1BWC A;  4RG3 A;  4D04 A;  1IUU A;  3UKH A;  1CJ4 A;  2XLU A;  4CCR A;  2BC0 A;  1EL9 A;  2C3D A;  1F8S A;  1NEK A;  1H81 A;  1CC2 A;  1ELI A;  2J3N A;  3DGZ A;  3NK1 X;  4O5Q A;  4U2S A;  2E4G A;  4U8L A;  1RSG A;  1B37 A;  2NVK X;  2Q0K A;  4GR1 A;  5KOX A;  3AYI A;  2B9W A;  3H8I A;  1Q9I A;  3D1C A;  3NIX A;  4OCG A;  3QSE A;  4NTE A;  1GTE A;  2BXS A;  2X8H A;  2RGJ A;  1NHS A;  3AEB A;  1JEH A;  3DJJ A;  1D4D A;  2VVL A;  3GWD A;  3DJE A;  4Z44 A;  3NTD A;  2CUL A;  3K30 A;  1BKW A;  4C3Y A;  1YQ3 A;  4C77 A;  3VR9 A;  2WU5 A;  3K7T A;  4P9S A;  3DJG X;  4Z2R A;  2AQJ A;  3L1R A;  1EL7 A;  2FBW A;  4EIP A;  1BGN A;  1XHC A;  3ICT A;  1JU2 A;  5IQ1 A;  3NNE A;  2ZBW A;  2XCG A;  4PAB A;  3M0O A;  3SFE A;  2EQ9 A;  3ABV A;  1JRZ A;  4OPL A;  5J60 A;  3FIM B;  1PBC A;  5IPY A;  2B76 A;  3CIR A;  4OPI A;  2WDV A;  1B5Q A;  1DOC A;  1FL2 A;  1REO A;  3LB8 A;  1ZK7 A;  3QSS A;  4U8M A;  3UKP A;  1OJA A;  5BRT A;  2WPF A;  3P4Q A;  3QFB A;  4OPU A;  1CC4 A;  3URH A;  1TDF A;  2B9Y A;  4IVO B;  3H8L A;  2GR1 A;  3H4K A;  4J36 A;  1F8R A;  1PJ6 A;  2YLS A;  1VG0 A;  2C70 A;  3V76 A;  4K8D A;  4AT0 A;  4C74 A;  2FJE A;  1NG4 A;  1CJ3 A;  1S2Y A;  2OAM A;  4CCQ A;  4B65 A;  1CBO A;  2YLX A;  3CGB A;  4B66 A;  1L9E A;  3CGE A;  3CTY A;  3SGL A;  5BVA A;  3AE4 A;  3UKA A;  1GRG A;  3E1T A;  1BGJ A;  2YLT A;  3GWF A;  3FPZ A;  2WOV A;  4TM0 A;  4K2X A;  1BZL A;  2YVJ A;  2UZZ A;  2WET A;  1Q1W A;  3NH3 X;  1PBE A;  4LII A;  3UOZ A;  2Q7V A;  1P2E A;  1FOH A;  1QLB A;  4APN A;  5DBJ A;  2X8G A;  2BCG G;  4JY2 A;  2E5V A;  3UOY A;  1GRE A;  1LTX R;  2GAG B;  2GV8 A;  1DNC A;  2Q6U A;  1F3P A;  2CDU A;  3Q9T A;  5JCK A;  2C67 A;  3CNJ A;  3NYF A;  1E1L A;  3DK9 A;  2YG4 A;  3FG2 P;  3NHO X;  4A5L A;  4AOS A;  5KRQ A;  1GTH A;  2Y6Q A;  1VG9 A;  1XAN A;  3AEE A;  3K7Q X;  2XFQ A;  2C73 A;  1PBF A;  4NEW A;  4OPG A;  2VRM A;  4YWO A;  4CY8 A;  4JNA A;  4GF7 A;  2YM1 A;  4UDQ A;  2BA9 A;  4JY3 A;  1ZDL A;  2YLR A;  2BS3 A;  3CNP A;  3NT6 A;  4H2R A;  4Z43 A;  2WS3 A;  4H4Z A;  5M0Z A;  1EL5 A;  4UDP A;  2OLO A;  2Z5Y A;  5BUL A;  2QAE A;  2V3B A;  1KNP A;  3NK0 X;  3L8K A;  1N4W A;  2WOI A;  1IJH A;  1IUV A;  1HYU A;  2EQ6 A;  2BS2 A;  3QFA A;  2WHD A;  1OJ9 A;  1N1P A;  2GQW A;  3CNS A;  4ICY A;  4ZN0 A;  2RGH A;  1L9C A;  1DOD A; 
#chains in the Genus database with same CATH topology
 3CQC B;  3RNM A;  1Z6L A;  2X9Y A;  3UU5 A;  3K3Q C;  3IHG A;  4USR A;  4YLH A;  3PUZ F;  1VOM A;  3JC6 C;  1VBA 4;  4OVI A;  1I6Z A;  4CI1 B;  3ANW A;  4OPT A;  2H7V C;  4H2Q A;  4H2P A;  3UKL A;  4YKF A;  3P8C D;  3K7M X;  1NEN A;  5JVD E;  4X1I E;  5M4Y A;  3RGL A;  5HHF A;  5U1O A;  5JCI A;  2YLW A;  5AQG B;  2C4C A;  2C76 A;  5L46 A;  2G0U A;  3T1H T;  2B9X A;  2C7G A;  2NTY A;  4ADZ A;  3NYC A;  3Q2M A;  1B4V A;  2K3W A;  3HZL A;  1ZHC A;  4MLK A;  3ZCJ A;  3NLC A;  1BR0 A;  2YG7 A;  1RHI 4;  2PW9 A;  3FBL A;  5BMV E;  1M6I A;  1TYT A;  2V7J A;  4Z90 A;  2LKH A;  3NYE A;  1POV 0;  5HXS A;  4DR7 T;  3NZQ A;  3CND A;  2A89 A;  1K0I A;  3EI0 A;  3ZJ2 A;  5A1L A;  4OX9 T;  3P4R A;  5ADX L;  1JRX A;  1VCT A;  4UDR A;  2JAE A;  4Q4X 4;  2XAJ B;  4A99 A;  1FEB A;  3EDU A;  2WBA A;  3KD9 A;  4F8H A;  5HWY A;  2SPC A;  4Z91 A;  1NAF A;  5CB4 E;  5L2L A;  2CA5 A;  1HG2 A;  3QC9 A;  5JRE A;  4JYA T;  1Y56 A;  2VKD A;  4UVC B;  4DR4 T;  4JUY A;  2IAK A;  3UU4 A;  1AR7 4;  3OVU A;  2X0Y A;  2DKI A;  2LSG A;  4AP3 A;  4U31 A;  3AYL A;  5AQF B;  2O9Z A;  3A7M A;  4U2T A;  1MMG A;  1LVK A;  4TM4 A;  1CL0 A;  1Y0P A;  4II2 A;  3AA7 B;  3RYH E;  4PW8 A;  4OYJ A;  3JSK A;  1RMU 4;  2XQ9 A;  1DOB A;  3LAD A;  1K0J A;  3NK2 X;  1N33 T;  1YKJ A;  2C64 A;  2R4E A;  4NIQ A;  3B6D A;  2V6O A;  4TNW A;  4AXP A;  3COX A;  5FY7 A;  1TRB A;  2XVF A;  4DV6 T;  2LSJ A;  2OA5 A;  4H4P A;  5M10 A;  3ZDN A;  3N9N A;  3CX7 B;  2D2S A;  4REK A;  3KPK A;  3CQG B;  5L3G B;  3ZMT B;  4I43 B;  2WWU A;  4CBQ A;  5AQR B;  4Q4W 4;  4BAY B;  4XBF B;  2GQF A;  2IIU A;  3CPJ G;  2CHN A;  2UUC T;  3FB2 A;  5JR9 A;  3RHA A;  3VRA A;  1E1H B;  2Q9Q B;  1N4V A;  1WYC A;  2X0L B;  2ZLY A;  3DME A;  2GAH B;  4LML A;  4AQF C;  5AQK B;  2VVN A;  2XQ7 A;  3GYJ A;  4JV5 T;  3WE0 A;  1R09 4;  4TM1 A;  2PHH A;  1PS9 A;  3P9U A;  4NTC A;  1ZY8 A;  4WX1 A;  1UUR A;  2BG9 E;  3MXZ A;  1K0L A;  4USQ A;  4B1B A;  3SQP A;  3I9W A;  3P4P A;  1DOE A;  4I58 A;  4UV9 B;  2QVA A;  3ZMZ B;  2YM2 A;  4HN9 A;  2XYO A;  4KI0 F;  3G5R A;  4TLZ A;  3VRD B;  3V3O A;  2NOX A;  1RUI 4;  4EIQ A;  3BI4 A;  1KSS A;  4H4S A;  4DSG A;  1VRB A;  1D4E A;  4TNV A;  3UTE A;  4ECH A;  3C50 A;  5ETW A;  5LNK A;  2CXD A;  1D0X A;  2RA1 A;  3HKB E;  3KIN B;  4A79 A;  4TWF A;  1XMQ T;  4DR5 T;  5HEJ A;  3BNU A;  3SUC A;  4EMJ A;  3TKL B;  2HN2 A;  2ODV A;  1KDG A;  1E7P A;  2WM9 A;  3UOX A;  3UOV A;  4A6N B;  5U63 A;  3AYJ A;  3FBS A;  3S5W A;  3UKF A;  2KT9 A;  1ZV4 X;  1H83 A;  3PVC A;  3UCL A;  3AD7 B;  3DK4 A;  5LGU B;  2Z5X A;  4U8I A;  1IUS A;  1FJG T;  4ZI2 C;  5FVK A;  5H6R B;  1PDH A;  2IVD A;  4IA5 A;  1K4Q A;  1M62 A;  4NTD A;  4IDP A;  4E7S A;  1EL8 A;  2Y6R A;  2IVE A;  5KXJ A;  3IHR A;  4TZ4 C;  3NN0 X;  5L3F B;  2OA1 A;  3TLW A;  3NTA A;  4PAA A;  1YW0 A;  1IBK T;  2V5Z A;  3LXD A;  3GRT A;  2XLS A;  4PFP A;  2BVL A;  1NHP A;  4FK1 C;  2V7L A;  4HFH A;  4DBQ A;  3R84 B;  2X66 A;  3AEC A;  1BR2 A;  4NNJ A;  4G73 A;  2EQ7 A;  3CKD A;  4AT2 A;  4B3R T;  4GDE A;  2DI4 A;  4TN7 B;  5J2T E;  1ZMC A;  3KA7 A;  4KMC A;  2BK5 A;  5EBK A;  1MOK A;  2BCP A;  4WNK A;  4IIJ E;  3K3N A;  2GMJ A;  2M6B A;  1JOA A;  3JAD A;  3RIU C;  4OK0 A;  2CWY A;  4DR2 T;  2LKG A;  3RYF E;  4IHJ E;  3QK6 A;  4H4T A;  4AQY T;  5JRC B;  3RRW A;  2VZ2 A;  1NDA A;  5AQI B;  1OXZ A;  1X9B A;  4CZZ B;  1GES A;  2X9H A;  1GRB A;  5C3J A;  5HXE A;  4TM3 A;  4D04 A;  4RG3 A;  5HCM A;  2IML A;  2JIW A;  3C4Z A;  4DV2 T;  3I0Q A;  1COV 4;  1NEK A;  1H81 A;  1ELI A;  4U8L A;  4UEL A;  3SY4 A;  4U2S A;  2E4G A;  1RSG A;  3IBP A;  3LK2 B;  2NW8 A;  2E9X D;  1BR4 A;  2RGJ A;  3BQL A;  1JEH A;  2IHR 1;  3GWD A;  4G74 A;  2CUL A;  4GYR A;  4C77 A;  2WU5 A;  3K7T A;  2WAU A;  2WZI A;  3UFG A;  1EL7 A;  2X5I D;  4EIP A;  4AIU A;  1JU2 A;  2WB5 A;  4LF7 T;  2ZBW A;  2XCG A;  2EQ9 A;  2XQ6 A;  5JDM A;  2Z6E A;  2EHO C;  1PBC A;  3FZK B;  3T2K A;  2YK0 A;  5CJ5 A;  2MTQ A;  2LSY A;  1B5Q A;  1REO A;  4TWH A;  1ZK7 A;  3LBX B;  4HEA A;  4I55 E;  4I4T E;  2VQF T;  4JI5 T;  3AAE B;  3H8L A;  2GR1 A;  3N9L A;  3DP7 A;  1F8R A;  2YLS A;  2YN6 A;  4U7I A;  2OV9 A;  4H63 V;  4OHF A;  5LA6 E;  1CJ3 A;  1S2Y A;  4CCQ A;  2YLX A;  3RYI E;  3CGE A;  3CTY A;  1M7K A;  3RKG A;  3AE4 A;  3SZF A;  3UUB A;  2KXP B;  3GWF A;  2CEA A;  3FPZ A;  4TM0 A;  2V6X A;  4JI4 T;  1HRV 4;  1GQE A;  2YVJ A;  5AQO B;  3M65 A;  3UOZ A;  1QLB A;  5DBJ A;  3C98 B;  4P09 A;  4JY2 A;  4UEM A;  1D1B A;  1F3P A;  1D1A A;  3CNJ A;  3K3O A;  4PDW D;  4EOZ B;  2DL1 A;  3DK9 A;  3FG2 P;  3NHO X;  4A5L A;  3RX6 A;  4Q4Y 4;  2EHO B;  2Y6Q A;  2BKP A;  1RUJ 4;  5AQP B;  3W15 B;  1XAN A;  3KBU A;  2XFQ A;  2C73 A;  2W67 A;  4NEW A;  1W0B A;  3T0K A;  2YM1 A;  2D0U A;  3UQ4 A;  1ZDL A;  3GWH A;  2YLR A;  2BS3 A;  3RC3 A;  2OLO A;  1RUH 4;  4QHO A;  2JMH A;  4JEH B;  3ETU A;  3QFA A;  1NCQ D;  3PUY F;  1OJ9 A;  2GQW A;  4ICY A;  3ADA B;  3RF1 A;  1E1N A;  3OZ2 A;  2XAH B;  1N32 T;  2CLY C;  3EAB A;  3TLS A;  3ZN1 B;  3ETV A;  2V1D B;  3AA1 B;  1UGO A;  4A9W A;  5EK2 A;  3ITJ A;  1FMV A;  4HFI A;  1PIV 4;  1S35 A;  2HWB 4;  1MIW A;  4J2W A;  2GB0 A;  3F57 A;  4IDO A;  1GRH A;  4KHP T;  1SUM B;  3GDN A;  3PS9 A;  1XHZ A;  4A5X A;  4AKH A;  1GOS A;  3ATR A;  4YXD A;  2Q0L A;  4B67 A;  1S94 A;  2GR0 A;  3ZYK A;  5LHG B;  2AXD S;  3PO7 A;  1FEW A;  4EQW A;  4YT0 A;  1HFA A;  4RG4 A;  2PFV A;  4AOX A;  5HYM A;  3P7I A;  3L3P A;  2IW5 B;  1HX1 B;  1HNZ T;  1N34 T;  2X0H A;  1HNW T;  1FCD A;  1L9D A;  4B3S T;  1GRF A;  2LLY A;  3HKE E;  4HKA A;  3HI2 A;  1QJD A;  4DV5 T;  2PG8 A;  2A8X A;  4I50 E;  2PLV 4;  2C75 A;  3PTR B;  3GMB A;  3NGC X;  1P2H A;  2CM0 A;  1SEZ A;  2PYJ A;  2LE8 A;  3M12 A;  4YTP A;  4CY6 A;  2F5Z A;  3U3I A;  2XAS B;  2Y48 B;  4P1N A;  2ZZB A;  4HGA A;  2CCQ A;  3ICR A;  4DID B;  1E1K A;  5DQV A;  2GF3 A;  1G73 A;  3AAI A;  2LSI A;  2H88 A;  2GEW A;  2YDS A;  3LFM A;  5KX5 E;  1F8W A;  4QKN A;  1LV0 A;  1L0V A;  3SYI A;  1XHX A;  1GSN A;  1JRY A;  2MYS A;  4EQX A;  2TPR A;  3T8O A;  4A6N A;  3AE3 A;  4AQF A;  3P4S A;  2YDQ A;  2X99 A;  1VDC A;  3UP5 A;  4ZS3 A;  5EK4 A;  4DUY T;  5HEO A;  3RH3 A;  3Q6J A;  2M6I A;  1YKE B;  1TDE A;  1O3X A;  2BKO A;  5JDL A;  3OC4 A;  3QVP A;  2L9Q A;  3NRX A;  1XDO A;  3KU9 A;  4OYK A;  3ZMV B;  4U8O A;  4EMW A;  1S3B A;  3R9U A;  4GYS A;  5LGN B;  1H7X A;  4EZH A;  3Q9D A;  2WPE A;  3IF9 A;  4I59 A;  4O4I E;  3ATQ A;  4O5U A;  2XQY A;  2XVI A;  5AQT B;  1GT8 A;  3II4 A;  4FDC B;  2E9X B;  1H7W A;  2BAC A;  3OBV E;  4BK1 A;  4IV9 A;  3GQK A;  1LQT A;  4ZI3 C;  2JB2 A;  4B3M T;  2V3A A;  2KWI B;  4DV1 T;  2ZZC A;  4NUU A;  4Z26 A;  3AE2 A;  3LSV A;  2QCU A;  2N1G A;  2R9Z A;  2BYB A;  4TLX A;  1JNR A;  5KWF A;  4GKK T;  1YY5 A;  4X4J A;  4YSH A;  3JAE A;  4NWZ A;  4DO0 A;  5JH7 E;  4JBW F;  2R6G F;  3UFE A;  4IE4 A;  5FL1 A;  2E1M A;  2GK9 A;  3KFW X;  4UV8 B;  3FXD B;  2W63 A;  2KSR A;  2K24 A;  4PK4 A;  1FEC A;  5JRC A;  4PJN A;  3ZT6 A;  4EMI A;  1RUC 4;  3ZKR A;  1PBB A;  3F8P A;  2QGS A;  4H4U A;  5FS9 A;  2CRB A;  2W61 A;  3NBX X;  5AQH B;  2N9D A;  4JI7 T;  5JCM A;  3H37 A;  3B57 A;  1TDN A;  3AE5 A;  2PYX A;  2VUR A;  4ASK A;  3LJC A;  2YEV C;  3UTH A;  1EZ3 A;  5JCN A;  2R04 4;  1GND A;  1MND A;  3UU8 A;  3PE0 A;  2GR2 A;  3AXB A;  2NPX A;  4FK1 A;  1E6E A;  1WYB A;  1CC6 A;  2VB6 A;  1ZOV A;  2I0M A;  1GV4 A;  1HRI 4;  3ZMS B;  3RPU A;  3DA1 A;  1KF6 A;  3N9Q A;  4CQI A;  5ABF B;  2WOW A;  3HKD E;  1PHH A;  2BC1 A;  2W0G A;  3BHF A;  4GB3 4;  1QO8 A;  1XNQ T;  3I3L A;  4CNK A;  3LBX A;  4UVB B;  4WBO A;  3PUQ A;  5LB7 B;  3UUL A;  3RIU A;  4WBN E;  4U3C A;  1GET A;  1H86 A;  3CX8 B;  1H8T D;  3V3N A;  2CPT A;  4NZH A;  2YR5 A;  1MMN A;  2QA2 A;  2WP5 A;  3AB1 A;  2Q9Q C;  2FJB A;  3QB5 A;  4CXW A;  3SZC A;  1UX4 A;  1FIO A;  4L9I A;  3I6D A;  4NUV A;  2C5I T;  4H2N A;  4G6H A;  2BZB A;  4JNQ A;  3S61 A;  4U8N A;  3CNT A;  4JN9 A;  2VQB A;  4P0A A;  2GR3 A;  3DGH A;  4CRT A;  4ZI7 E;  3BQI A;  2F4V T;  5U25 A;  2P9B A;  2GMH A;  3CX6 B;  2CXF A;  4X65 T;  3FZF B;  4CI3 B;  2IC9 A;  4HE8 A;  5AQL B;  5FMH A;  3EAO A;  4J31 A;  3D8X A;  2C5K T;  5HXI A;  1OWA A;  2W0H A;  4EQR A;  1ZMD A;  2MOZ A;  2EHO A;  2KMF A;  3SXI A;  3HL6 A;  1EBD A;  2W00 A;  1NHR A;  4TV8 E;  3SWH A;  2WQY A;  1H84 A;  3DK8 A;  4GDP A;  4Y4M A;  2R4J A;  3NG7 X;  1UKV G;  2WU2 A;  2A3D A;  4M52 A;  4HWD A;  2VQE T;  2XQA A;  2ARD A;  3PV0 F;  4GK5 E;  5KMR A;  1M64 A;  2XAQ B;  4XAX B;  1CJC A;  4YSX A;  5KNL A;  2X50 A;  1OED C;  3DJD A;  4LA1 A;  3GMC A;  2PYL A;  3ALM A;  5EOW A;  4IVM B;  4X9N A;  5JDG A;  4G9K A;  1B8S A;  4ILB A;  1HS7 A;  1XWM A;  3HA4 A;  2A72 A;  4LF6 T;  1EV1 4;  1EL9 A;  5FY0 A;  1F8S A;  4H63 H;  3UUN A;  3C4X A;  1CC2 A;  5HAX A;  3LG7 A;  2NVK X;  2V26 A;  3PUA A;  4GOU A;  4UIG A;  2B9W A;  3AYI A;  3H8I A;  4OCG A;  5LMN T;  3KV9 A;  4F6R C;  2X8H A;  2VVL A;  2J62 A;  3Q5W A;  3NTD A;  4Z44 A;  4C3Y A;  1YQ3 A;  2E2A A;  3VR9 A;  3DJG X;  5HEG A;  2AQJ A;  2FBW A;  4LF9 T;  3G06 A;  5L3C B;  1BGN A;  3RIA A;  5IQ1 A;  4PAB A;  2V5D A;  5L3B B;  1JRZ A;  3HYW A;  1VBE 4;  5J1G A;  5J60 A;  3ONJ A;  3UUX B;  5IPY A;  2YKS A;  1DOC A;  2W66 A;  5IYZ E;  4U8M A;  3F31 A;  1OJA A;  5BRT A;  4O4L E;  4DV0 T;  1CC4 A;  2WWV A;  4U74 A;  2V6Y B;  3FZH B;  3ZT5 A;  1PJ6 A;  1OED B;  2C70 A;  3V76 A;  4K8D A;  4AT0 A;  1NG4 A;  1CBO A;  5AFU L;  1H7C A;  3CGB A;  1L9E A;  3SZW A;  4FI5 A;  5HEH A;  2RMU 4;  2BKN A;  2LOP A;  2LOS A;  3E1T A;  4YHH T;  1BGJ A;  2YLT A;  5FVL A;  3UQ7 A;  4HWI B;  3N5L A;  3AVS A;  3AVR A;  4MBQ A;  2H3R A;  1HCI A;  4IE0 A;  5LOV E;  2NTX A;  1AR6 4;  1J5W A;  4DR3 T;  3NKZ A;  3D0T A;  3T14 A;  1MIY A;  3PUS A;  4DBR A;  5LG3 A;  2UUA T;  1GRE A;  1VBB 4;  2BVM A;  2QYW A;  5IUX A;  2C67 A;  1E1L A;  2YG4 A;  2JQQ A;  4AOS A;  4DMV A;  2ZM6 T;  3AEE A;  4A56 A;  1ASJ 4;  1KEY A;  1PBF A;  4OPG A;  4CY8 A;  5FL0 A;  4JNA A;  2RP4 A;  4H9O C;  2WS3 A;  5LHH B;  3KVB A;  4V1A v;  1W0A A;  4UDP A;  5BUL A;  2D5U A;  2QAE A;  1KNP A;  1D0Z A;  2JQ9 A;  3N9O A;  2WOI A;  3NK0 X;  1YD8 G;  1IUV A;  4AIS A;  2BS2 A;  3F2E A;  4JI8 T;  1AL2 4;  1N1P A;  3CNS A;  3I9Y A;  2Y8D A;  2RGH A;  2WEU A;  1L9C A;  3Q9T A;  5EB4 A;  4ZCC A;  4FJO A;  1IZN B;  3U78 A;  3IWA A;  4H9P C;  2I59 A;  5LCY A;  5EB5 A;  1NA1 D;  4IST A;  4N78 D;  4ZOL E;  4NXM T;  3QUJ A;  2YQU A;  1HX8 A;  3ZPO A;  3ONX A;  2YG3 A;  2LRL A;  5F5W A;  2JRK A;  3QSM A;  5L4E A;  3N2K E;  2CVJ A;  4UR9 A;  5EK3 A;  2ZZ0 A;  2CXL A;  2YAU A;  3WAK A;  5L3D B;  4RHV 4;  2CBI A;  2N2N A;  1PXC A;  2PJQ A;  3NVO A;  1YXR A;  2LHN A;  2OLT A;  1HR0 T;  3FXE B;  3AED A;  2CFY A;  3QB5 K;  1NHQ A;  3SX6 A;  3PUW F;  5DJQ C;  4BJY A;  2A2F X;  4O2A E;  2IDO B;  3MK7 C;  3MKD A;  3RRC A;  3AD9 B;  2CWO A;  5JDH A;  3FMW A;  3VU7 H;  4E0V A;  1IBM T;  1V59 A;  3UP4 A;  4X1K E;  4JI2 T;  1WRD A;  4LU6 A;  1ZEE A;  2WSS V;  3ZYM A;  4X1Y E;  4GAV A;  2R7F A;  4UF0 B;  1LVL A;  4TUY E;  2RGO A;  3X1D A;  4UXN B;  4Z2U A;  3RLF F;  4ERR A;  5HY5 A;  2NW9 A;  4JQ9 A;  3KBT A;  4ADW A;  2AAQ A;  5LBM A;  4CN6 A;  4ISS A;  4AKL A;  2V7M A;  5IQ4 A;  5KOW A;  4DVD A;  1CJ2 A;  2KND A;  4EGW A;  3PUG A;  3RED A;  3CGD A;  3LZW A;  3RHW A;  3IC9 A;  1R8I A;  2UUB T;  2LJL A;  1IUT A;  5BUK A;  1D7Y A;  3RQU A;  1Z0P A;  5ABF A;  3BI2 A;  1RUG 4;  3I0O A;  4BV6 A;  4H4V A;  2HPL A;  2BK3 A;  3G5Q A;  5J0Z A;  5ABG A;  5J7X A;  5ABE A;  2B7S A;  4C90 A;  4CNJ A;  3BQK A;  2R0G A;  1YKH B;  3Q5D A;  4HA6 A;  5FP3 A;  3BK9 A;  4DGK A;  3ESL A;  1PJ7 A;  3SM8 A;  4TV9 E;  4GCM A;  1XI1 A;  4K7Z A;  4K5S A;  3GYI A;  3VHL A;  2DHR A;  1LKX A;  2VVM A;  2BXR A;  4DMW A;  1RUD 4;  3JC6 D;  4EZ4 A;  1GER A;  1PO1 4;  3AEG A;  3B5M A;  1TDO A;  2ZM2 A;  3WAJ A;  3GSI A;  3DTO A;  1GAL A;  4GUV A;  4ZZC A;  3OTO T;  4H4Y A;  1Z7S 4;  2X51 A;  2VVL G;  3AAA B;  1AR9 4;  1UK5 A;  1J5E T;  2VKH A;  4K0K T;  2UU9 T;  2RS3 4;  3J8F 4;  3RC8 A;  3C4W A;  1UX5 A;  2LFC A;  3MJX A;  1X31 B;  4ILC A;  3PUX F;  4U72 A;  2XQ8 A;  2VKO A;  3ALJ A;  2YIN A;  3EPT A;  4H4Q A;  3GN5 B;  4AQG A;  2BS4 A;  5TR3 A;  4DNA A;  1SE7 A;  4KHZ F;  3FZM B;  4WZX A;  4J34 A;  1OED E;  2M67 A;  3GYX A;  5LV9 A;  3QJ4 A;  5JQG E;  5LP6 E;  1KNZ A;  1W9R A;  2DCF A;  4C3X A;  5KVI A;  3L8R A;  4O4H E;  1BEV 4;  3F8D A;  2IC6 A;  2Q9Q A;  3FBZ A;  3N9P A;  1RUE 4;  3M3Z B;  3J9X 1;  4JEU B;  4CI2 B;  3EDV A;  4ZXL A;  1ZKE A;  1D5T A;  1GXF A;  1ZKQ A;  3VRB A;  2L3L A;  4ZEY A;  3SFD A;  1B7T A;  4U33 A;  2PTF A;  2XVH A;  2RR1 4;  3ZEF B;  4IDZ A;  4PK5 A;  4B63 A;  3V5U A;  2YVG A;  2XSB A;  5TAO A;  1N36 T;  3IA3 A;  2IID A;  2XJ7 A;  1QUU A;  1Q1R A;  3VKG A;  3L09 A;  2BG9 C;  5IWA T;  4YSZ A;  1COY A;  1HTJ F;  2R0C A;  1R08 4;  1MO9 A;  3DJB A;  1WR6 A;  2LT3 A;  5FYM A;  2ZMA A;  1LJ1 A;  4QXB B;  3A5X A;  1UCU A;  1O5W A;  1YQZ A;  3AEA A;  4H7U A;  3ZMU B;  4YJ2 E;  5AQN B;  2YWL A;  4HTE A;  3MA9 A;  2GRT A;  4J33 A;  4KX6 A;  5LGT B;  4EQS A;  2E9X C;  2XFN A;  3TLU A;  2Y6X A;  4L0R A;  4QX8 B;  3ZC1 A;  2XTL A;  1OJT A;  2WMN A;  3T37 A;  5FXX A;  1NWM X;  3L39 A;  4YHJ A;  3P1W A;  3AE1 A;  2VL8 A;  3RP8 A;  1KFY A;  4DSH A;  3UTF A;  2LHR A;  1OED A;  3S4U A;  4QH5 A;  1PN0 A;  2H7O A;  5FNV E;  1MIV A;  2AR8 A;  3BI5 A;  5CA1 E;  4BK3 A;  1MMD A;  2C0S A;  3Q5X A;  2XAG B;  4QWN B;  4J2C A;  2DLR A;  3RQW A;  1RP0 A;  1S3E A;  1J1J A;  2LM9 A;  2A87 A;  4GAP A;  4EV6 A;  3NN6 X;  2XAF B;  4L5G A;  2BG9 B;  2JMK A;  4EYY R;  3AA0 B;  3SS1 A;  4J56 A;  4C91 A;  1WFD A;  2DWK A;  5KVH A;  1PXA A;  1Z8U A;  2BBJ A;  5LJN A;  3ZLI A;  4IT4 A;  3QVR A;  4M1P A;  4DV7 T;  1AOG A;  5AQV B;  4H9R C;  5AQJ B;  4NEV A;  1NAA A;  3ALL A;  4Y4N A;  4OPC A;  2XVJ A;  4CN4 A;  4LF5 T;  2WDR A;  3CQX C;  5J2U E;  1GRA A;  4C5O A;  4OPD A;  4HWF A;  4N9X A;  1O95 A;  3LJP A;  5FS7 A;  4YJ3 E;  1IBL T;  3KVE A;  2RS5 4;  3AD8 B;  3H3M A;  4ZZB A;  1T72 A;  4ILA A;  4HFD A;  1MMA A;  1YQ4 A;  4MFR A;  2AE9 A;  4LF8 T;  2ODU A;  1RYI A;  4AKG A;  5GON E;  4AP1 A;  2XSA A;  2WP6 A;  4UP3 A;  4MAL A;  5KDM C;  4U2L A;  1WR0 A;  4JI1 T;  2VK9 A;  3PUR A;  3KLJ A;  4IA6 A;  1E2A A;  3B13 A;  5FXW A;  5LXT E;  1W4X A;  2GH5 A;  5LMU T;  3RP6 A;  3N2G E;  4FX9 A;  1BWC A;  1IUU A;  5HEU A;  3UKH A;  2PZS A;  2VVS A;  4LFC T;  4CCR A;  4H9S E;  3OPC A;  4PJM A;  2HWC 4;  3NK1 X;  4O5Q A;  5HWX A;  2Q0K A;  1EAH 4;  4IL9 A;  2CBJ A;  5KOX A;  2WY2 A;  3D1C A;  3QOF A;  4NTE A;  4EEB A;  4DUZ T;  3AEB A;  5L47 A;  3E0Z A;  4U2Z A;  3K30 A;  3EHZ A;  4Z2R A;  1PVC 4;  1XNR T;  4P9S A;  5L3E B;  4HFC A;  2YDR A;  1SA0 E;  5LG4 A;  5LJM A;  3J7Y q;  3M0O A;  3SFE A;  3ABV A;  4LF4 T;  3NZP A;  5ABH A;  5AQM B;  1Y64 B;  3P4W A;  4OPL A;  1MQT D;  2MBG A;  3CK6 A;  2QA7 A;  1T8B A;  3KDS E;  3E08 A;  3UT5 E;  2B76 A;  3UU6 A;  3CIR A;  5KMG P;  4IE5 A;  4OPI A;  3LB8 A;  5KMP A;  2UXC T;  4X66 T;  3P4Q A;  3QFB A;  4OPU A;  3URH A;  1TDF A;  2CMR A;  4J36 A;  4ZI2 D;  3I1A A;  2BRY A;  1Y01 A;  4QXC B;  4C74 A;  3PUV F;  2RPA A;  4AI6 A;  4UF0 A;  5LBQ B;  4ZHQ E;  4B65 A;  2HPJ A;  3SGL A;  1T98 A;  3ONL C;  3RI5 A;  3MZK B;  3PJA J;  3RYC E;  1GRG A;  1IAP A;  2J4G A;  3KV5 A;  2WOV A;  4HFV A;  1BZL A;  3CPZ A;  3LK4 2;  3NH3 X;  1SHZ C;  2Q7V A;  1P2E A;  2ZM0 A;  5HYA A;  4APN A;  5LHI B;  3UOY A;  3K1S A;  2GAG B;  2GV8 A;  2CDU A;  5JCK A;  3NYF A;  2KIN B;  4Q4V 4;  4DV3 T;  2R06 4;  3K7Q X;  3NWI A;  3ZCI A;  2VRM A;  4YWO A;  4UDQ A;  4ANJ A;  2BA9 A;  2MAW A;  3NT6 A;  4Z43 A;  5M0Z A;  2Z5Y A;  3RIF A;  2V3B A;  2NR4 A;  3MAC A;  2K5B B;  1N4W A;  1IJH A;  3FZL B;  1HYU A;  3EVY A;  1UUS A;  2EQ6 A;  4ZN0 A;  2BRA A;  2XUE A;  2DNX A;  4Z25 A;  2D9D A;  2E5L T;  2EX3 A;  1KSU A;  1FMW A;  1IUW A;  2J1D G;  3GMI A;  3KKJ A;  2HN1 A;  2E8I A;  5F8P A;  2YU2 A;  4X20 E;  4Z8X A;  2XDO A;  2R46 A;  2PBI A;  2FJD A;  5GSN A;  3HYX A;  3G5S A;  4JI0 T;  1IJ5 A;  2EHO D;  1IJ6 A;  4K5R A;  2W2U A;  1TDK A;  3GN5 A;  1HNX T;  3O4X E;  2QRX A;  3VR8 A;  1E39 A;  2WCA A;  2OLN A;  1D4C A;  1LRZ A;  3O1J A;  2JQK A;  4UVA B;  4A7A A;  4IGU A;  2R07 4;  3ZYL A;  2X68 A;  2XLP A;  4OFZ A;  2WP9 A;  2C72 A;  1DU2 A;  3N2O A;  4NPP A;  3ZYX A;  2X9W A;  4H9Q C;  4U8K A;  1AJ3 A;  2VQ7 A;  2L8K A;  2J47 A;  3AE8 A;  3PJA A;  4K22 A;  2EQ8 A;  2ACX A;  2I0Z A;  1OJD A;  1D7L A;  4BUR A;  4X62 T;  3GRS A;  5CFB A;  1VQW A;  4H50 A;  1I94 T;  4ILU A;  2JK6 A;  3ZJ1 A;  5JDF A;  1NG3 A;  3GDP A;  3AEF A;  3JBG 4;  2RM2 4;  2APG A;  3UKQ A;  1TYP A;  3WI3 A;  4DR6 T;  2XQ3 A;  3CN8 A;  4E7Z A;  2K48 A;  2X67 A;  5JTG A;  4XWR A;  1AR8 4;  3IF8 B;  1PJ5 A;  1LPF A;  4Y4L A;  1XMO T;  2TMD A;  4HWH A;  4WCT A;  2XFO A;  1PO2 4;  2ACZ A;  3BNM A;  2BAB A;  2JQH A;  3H3A A;  1DXL A;  4DV4 T;  3C96 A;  1VRQ B;  1ZOY A;  1HXS 4;  3GA8 A;  4JDR A;  2XFP A;  2JB3 A;  4MHC A;  4QXH B;  3T2Y A;  1RVF 4;  4MJW A;  4HB9 A;  3EAM A;  1PBD A;  3O1I A;  1NPX A;  2NP9 A;  5CA0 E;  5DQW A;  4IE6 A;  3ZST A;  3UTG A;  1OJC A;  5CQF A;  1HG5 A;  3HKC E;  2XFU A;  3IHM A;  2YOE A;  5AQU B;  2QA1 A;  2WPC A;  3JAF A;  1PXB A;  4U8J A;  2X3N A;  5CKU A;  4D03 A;  3UTK A;  2KWH A;  2BG9 A;  1CHU A;  2XM2 A;  4B64 A;  2XQ5 A;  4PJL A;  5FS6 A;  2VL0 A;  5E0O A;  4YTN A;  3C4A A;  3UKK A;  3AXJ B;  1CF3 A;  5ER0 A;  2DWG A;  4EXT A;  2KZ7 B;  5BR8 T;  1H6V A;  1JNZ A;  3ICS A;  4A97 A;  4X5T A;  4EAH A;  4EB6 E;  2R45 A;  1IUX A;  3O0H A;  3ANW B;  2HH7 A;  1VRH 4;  2X9X A;  1E1M A;  3CPH G;  4GIW A;  2CE7 A;  5KMQ A;  4II3 A;  2BK4 A;  2JB1 A;  4GRT A;  2E9X A;  4EM4 A;  2XVE A;  4A65 A;  2DKH A;  4TWD A;  2ZM8 A;  4WW0 A;  5C8Y E;  3ZN0 B;  5HCJ A;  3N9M A;  4GK0 E;  5JCL A;  3GD4 A;  3OYX A;  4PJJ A;  1GEU A;  4PFO A;  1N4U A;  4KPR A;  4G63 A;  2JKC A;  2V5C A;  2LSK A;  1VBD 4;  4YFS A;  3M13 A;  2JJ9 A;  1FEA A;  3SZ0 A;  2JPF A;  1DJQ A;  4BJZ A;  4AKR B;  2V7K A;  2HHH T;  1O94 A;  1LQU A;  2NW7 A;  2WBL A;  2YG6 A;  2YVF A;  3CPI G;  3P50 A;  3F8R A;  3EF6 A;  3ISH A;  4IRE A;  2GVC A;  1GRT A;  2JBV A;  3HR0 A;  5JDN A;  1US7 B;  3AA6 B;  2H89 A;  1F6M A;  3CVR A;  5JDQ A;  2UXD T;  2C3C A;  4LMK A;  2YR6 A;  1ONF A;  5HXH A;  1ZP0 A;  1D1C A;  2XLR A;  3BHK A;  4ZS2 A;  2RAB A;  4XWZ A;  3AE6 A;  4ZCD A;  3JD7 4;  2HQM A;  1DJN A;  4NXN T;  4IDQ A;  1MXT A;  5FS8 A;  4YTM A;  2W62 A;  4QH1 A;  5FXZ A;  4PNI A;  2K9A A;  5F3J A;  2IUB A;  4YSY A;  3B3R A;  2YLZ A;  3LDQ B;  2XZE A;  4LFB T;  2WES A;  2FJA A;  1Y56 B;  3HYV A;  4RSL A;  4H4R A;  2YG5 A;  2YR4 A;  4XXG A;  2UXX B;  1GPE A;  5HXR A;  2R0P A;  2V60 A;  3EUH A;  2W4X A;  2YU1 A;  2X8C A;  2V61 A;  3TLT A;  2OAL A;  2XM1 A;  5JR9 C;  3LOV A;  4J57 A;  4G2A A;  3A8Y C;  3AE7 A;  3KPF A;  3GQH A;  1XDI A;  4DND A;  3AE9 A;  4H4W A;  1U5P A;  4B3T T;  2XQ4 A;  3O9X A;  3NKS A;  4U8P A;  2BBH A;  3OJA A;  1H82 A;  4H4X A;  2VRL A;  4BK2 A;  4KP3 C;  3GD3 A;  2ES0 A;  4CXX A;  2VWA A;  2VOU A;  1HF8 A;  4GKJ T;  1K5M D;  4CN1 A;  4EIW A;  3Q5E A;  4JLE A;  4EM3 A;  4PK6 A;  2XLT A;  4A98 A;  3RP7 A;  2VAS A;  4TX5 A;  4KBM B;  4Z24 A;  5FKY A;  4ZI3 D;  3EAN A;  2UXN B;  3T1Y T;  4X9M A;  3ZT7 A;  2NWB A;  4B69 A;  2C66 A;  1G8X A;  1BR1 A;  3QNU A;  4QH4 A;  2WMO A;  5FMN A;  4IL4 A;  4BJM A;  3CWZ B;  3JCF A;  5DAB A;  1XPQ A;  1W09 A;  5LYJ E;  4PAG A;  1KNR A;  3AWI A;  4WYV A;  5C2T A;  3LK3 B;  4U7Y A;  5HXC A;  5GRT A;  2MPK A;  2XPK A;  4AKI A;  2RS1 4;  4YKG A;  1V9D A;  2B7R A;  4BA9 A;  3NRY A;  3C4N A;  3CMM A;  5JR9 B;  2C65 A;  2BDE A;  3E22 E;  4O2B E;  4LFA T;  4BJN A;  4Q25 A;  3LZX A;  2LRK A;  4U2Y A;  1QSD A;  2CHO A;  2WDQ A;  2FUP A;  4COF A;  4DR1 T;  1S2Q A;  4B68 A;  4Z2T A;  3T2Z A;  3DH9 A;  3CGC A;  1CUN A;  5H6Q B;  4G6G A;  3NRN A;  3VQR A;  1ZX9 A;  2XHE B;  1D4M 4;  2LM2 A;  3SRZ A;  4IE7 A;  1XDP A;  5KMS A;  1BF3 A;  4K0U A;  2WZH A;  4IDN A;  4O8S A;  1WLX A;  1CJ4 A;  2XLU A;  2PY5 A;  2BC0 A;  2C3D A;  3RKO A;  3IEE A;  3DGZ A;  2J3N A;  1B37 A;  4GR1 A;  3CML A;  3PU8 A;  1X79 A;  3AB3 B;  1Q9I A;  3NIX A;  3KV4 A;  3QSE A;  1GTE A;  3VKH A;  3OKQ A;  1T7S A;  2BXS A;  1NHS A;  3C64 A;  3ZC0 A;  3DJJ A;  1D4D A;  3DJE A;  5FY1 A;  1BKW A;  1D0Y A;  4QX7 B;  4LMJ A;  3L1R A;  3K8P C;  1MNE A;  3ICT A;  1XHC A;  3KV6 A;  4P0B A;  1OOP D;  3NNE A;  3ZSS A;  3FIM B;  1LVF A;  3PDY A;  2XY8 B;  1WCR A;  2Q9Q D;  2V8S V;  2WDV A;  3QSS A;  1FL2 A;  3UKP A;  1VCS A;  5FXV A;  2WPF A;  2KLQ A;  1RUF 4;  2B9Y A;  4IVO B;  3H4K A;  3FI7 A;  2B1E A;  1VG0 A;  3T31 A;  3OYZ A;  2CLY B;  4JI3 T;  2FJE A;  2OAM A;  4B6X A;  2V6Y A;  3UUM A;  3V5S A;  4JI6 T;  5AQS B;  4B66 A;  4KUM B;  5EZY E;  4XZC A;  5BVA A;  3UKA A;  3R6N A;  3UU3 A;  4K2X A;  2UXB T;  2UZZ A;  5L4H A;  1Q1W A;  2C5J A;  2WET A;  1PBE A;  4LII A;  4EYU A;  1VBC 4;  1KK7 A;  1FOH A;  2X8G A;  2BCG G;  4O4J E;  2E5V A;  1U4Q A;  1LTX R;  1DNC A;  2Q6U A;  3TLV A;  4CXY A;  5AQQ B;  2D0T A;  4H9N C;  5KRQ A;  1GTH A;  5IHY A;  3KVA A;  1VG9 A;  2LEH A;  3C51 A;  2VKJ A;  4HFE A;  3O1H A;  4EED A;  4GF7 A;  3FHN A;  3SOL A;  4JY3 A;  2I6H A;  4HFB A;  1XZY A;  3CNP A;  4H2R A;  4HWC A;  2V7I A;  1EL5 A;  4H4Z A;  2A9U A;  3L8K A;  2WHD A;  4YY3 T;  3PU3 A;  4I0U A;  5CGM A;  3AXJ A;  4X64 T;  1DOD A; 
#chains in the Genus database with same CATH homology
 1E1N A;  3RNM A;  3OZ2 A;  1Z6L A;  4Z25 A;  3IWA A;  3IHG A;  1KSU A;  4USR A;  5EB5 A;  1IUW A;  4OVI A;  3KKJ A;  4OPT A;  2YQU A;  4H2Q A;  2YG3 A;  2XDO A;  4H2P A;  3UKL A;  4A9W A;  4YKF A;  3ITJ A;  3K7M X;  3QSM A;  2R46 A;  1NEN A;  2CVJ A;  2FJD A;  5GSN A;  3HYX A;  3G5S A;  5HHF A;  5U1O A;  2ZZ0 A;  5JCI A;  4J2W A;  2YLW A;  2C4C A;  2C76 A;  2GB0 A;  1GRH A;  4K5R A;  1TDK A;  5L46 A;  2YAU A;  1E39 A;  3VR8 A;  2B9X A;  2C7G A;  3GDN A;  3NYC A;  2OLN A;  3PS9 A;  1D4C A;  1PXC A;  1GOS A;  1B4V A;  3HZL A;  4A7A A;  3ATR A;  4YXD A;  3NLC A;  2Q0L A;  2YG7 A;  4B67 A;  3AED A;  2GR0 A;  2CFY A;  1M6I A;  1TYT A;  3PO7 A;  1NHQ A;  2XLP A;  3SX6 A;  4EQW A;  2WP9 A;  4YT0 A;  2C72 A;  4RG4 A;  4BJY A;  3NYE A;  3ZYX A;  3AD9 B;  4AOX A;  4U8K A;  5HYM A;  3CND A;  2VQ7 A;  3FMW A;  4E0V A;  1FCD A;  3AE8 A;  1L9D A;  1V59 A;  3UP4 A;  4K22 A;  2A89 A;  1GRF A;  1K0I A;  2EQ8 A;  3P4R A;  4LU6 A;  1JRX A;  2I0Z A;  1OJD A;  4GAV A;  1QJD A;  3ADA B;  4UDR A;  1D7L A;  2JAE A;  1LVL A;  2RGO A;  4BUR A;  3GRS A;  4H50 A;  1VQW A;  4Z2U A;  2A8X A;  2JK6 A;  5HY5 A;  2C75 A;  4A99 A;  4JQ9 A;  1NG3 A;  1FEB A;  3GDP A;  3AEF A;  3GMB A;  1P2H A;  3NGC X;  2AAQ A;  4ADW A;  1SEZ A;  2APG A;  2WBA A;  3UKQ A;  3M12 A;  4YTP A;  4CY6 A;  1TYP A;  2F5Z A;  5EB4 A;  3KD9 A;  5IQ4 A;  5KOW A;  3CN8 A;  4ZCC A;  1CJ2 A;  2ZZB A;  4XWR A;  3ICR A;  1PJ5 A;  3CGD A;  3LZW A;  1E1K A;  3RED A;  3IC9 A;  5BUK A;  1LPF A;  1IUT A;  4Y4L A;  1D7Y A;  2GF3 A;  2TMD A;  1Y56 A;  4WCT A;  2XFO A;  3BI2 A;  2ACZ A;  2H88 A;  2BAB A;  3BNM A;  1DXL A;  4BV6 A;  2GEW A;  2BK3 A;  3G5Q A;  4H4V A;  3C96 A;  1VRQ B;  5J7X A;  1ZOY A;  1F8W A;  2B7S A;  1LV0 A;  4JDR A;  4CNJ A;  1L0V A;  2DKI A;  3SYI A;  2XFP A;  2R0G A;  1GSN A;  1JRY A;  2JB3 A;  4AP3 A;  3AYL A;  4HA6 A;  3T2Y A;  2TPR A;  4EQX A;  4A6N A;  3AE3 A;  2O9Z A;  4MJW A;  3P4S A;  4DGK A;  4HB9 A;  2X99 A;  1VDC A;  3UP5 A;  1PJ7 A;  1PBD A;  3SM8 A;  4U2T A;  4GCM A;  1NPX A;  4TM4 A;  1CL0 A;  4K7Z A;  1Y0P A;  3UTG A;  4K5S A;  4II2 A;  1OJC A;  3GYI A;  3Q6J A;  5CQF A;  2XFU A;  3IHM A;  2QA1 A;  1TDE A;  2VVM A;  2WPC A;  2BXR A;  3JSK A;  3OC4 A;  3QVP A;  1PXB A;  1GER A;  3KU9 A;  2X3N A;  4U8J A;  3AEG A;  5CKU A;  4D03 A;  1CHU A;  1TDO A;  4B64 A;  1DOB A;  3LAD A;  1K0J A;  4U8O A;  4EMW A;  3GSI A;  1GAL A;  5FS6 A;  4GUV A;  3NK2 X;  1S3B A;  4YTN A;  3C4A A;  3R9U A;  3UKK A;  1H7X A;  1CF3 A;  1YKJ A;  2C64 A;  2R4E A;  4H4Y A;  5ER0 A;  2WPE A;  3IF9 A;  3B6D A;  2V6O A;  4I59 A;  3ATQ A;  2VVL G;  4O5U A;  3COX A;  1H6V A;  1JNZ A;  3ICS A;  1TRB A;  2XVF A;  2XVI A;  1GT8 A;  3II4 A;  4FDC B;  2R45 A;  1IUX A;  3O0H A;  4H4P A;  1H7W A;  2BAC A;  4BK1 A;  1E1M A;  4IV9 A;  5M10 A;  3GQK A;  1LQT A;  3CPH G;  3ZDN A;  2JB2 A;  2V3A A;  5KMQ A;  4II3 A;  2BK4 A;  2LFC A;  2JB1 A;  4GRT A;  1X31 B;  4EM4 A;  4REK A;  2XVE A;  3KPK A;  4A65 A;  2DKH A;  2ZZC A;  4Z26 A;  3ALJ A;  3AE2 A;  4CBQ A;  2QCU A;  2R9Z A;  3EPT A;  2GQF A;  2BYB A;  4H4Q A;  3CPJ G;  4TLX A;  1JNR A;  5KWF A;  2BS4 A;  1YY5 A;  5TR3 A;  4X4J A;  4DNA A;  3RHA A;  5JCL A;  4YSH A;  3VRA A;  3GD4 A;  4NWZ A;  4J34 A;  3GYX A;  5LV9 A;  1N4V A;  3QJ4 A;  1GEU A;  4C3X A;  1N4U A;  5KVI A;  4KPR A;  2E1M A;  2JKC A;  3DME A;  3F8D A;  2GAH B;  3M13 A;  5KNL A;  1FEC A;  1FEA A;  4EMI A;  1D5T A;  1GXF A;  1ZKQ A;  3SZ0 A;  3VRB A;  1DJQ A;  3GYJ A;  3WE0 A;  4BJZ A;  1PBB A;  3F8P A;  3SFD A;  2XVH A;  1O94 A;  4H4U A;  4TM1 A;  1LQU A;  5FS9 A;  2PHH A;  1PS9 A;  2YVF A;  2YG6 A;  3P9U A;  3CPI G;  4NTC A;  2YVG A;  1ZY8 A;  4B63 A;  3F8R A;  4WX1 A;  3EF6 A;  2IID A;  3ISH A;  5JCM A;  1K0L A;  1Q1R A;  4USQ A;  1TDN A;  4B1B A;  3AE5 A;  3SQP A;  2GVC A;  3P4P A;  1GRT A;  2JBV A;  1DOE A;  2PYX A;  4I58 A;  4YSZ A;  3UTH A;  1COY A;  2H89 A;  1F6M A;  2C3C A;  5JCN A;  2YR6 A;  1ONF A;  2R0C A;  1MO9 A;  2YM2 A;  1GND A;  1ZP0 A;  2GR2 A;  2XLR A;  1LJ1 A;  2RAB A;  3BHK A;  3AE6 A;  4XWZ A;  2XYO A;  3AXB A;  2NPX A;  4ZCD A;  2HQM A;  1DJN A;  3G5R A;  4FK1 A;  4TLZ A;  3V3O A;  3VRD B;  1E6E A;  1O5W A;  4EIQ A;  3BI4 A;  1KSS A;  1CC6 A;  1YQZ A;  4H4S A;  3AEA A;  1MXT A;  4YTM A;  4H7U A;  5FS8 A;  4DSG A;  2YWL A;  1ZOV A;  1D4E A;  3UTE A;  4ECH A;  1GV4 A;  4YSY A;  3B3R A;  2YLZ A;  2WES A;  2GRT A;  4J33 A;  3DA1 A;  2FJA A;  4KX6 A;  4EQS A;  1KF6 A;  1Y56 B;  3HYV A;  4RSL A;  4H4R A;  2YG5 A;  2YR4 A;  2XFN A;  2WOW A;  4XXG A;  1GPE A;  1PHH A;  4A79 A;  2BC1 A;  2R0P A;  3BHF A;  2V60 A;  1QO8 A;  1OJT A;  3I3L A;  4CNK A;  3T37 A;  2X8C A;  2V61 A;  3BNU A;  4EMJ A;  3SUC A;  2OAL A;  3LOV A;  3P1W A;  4J57 A;  1GET A;  3KPF A;  3AE7 A;  3AE1 A;  1KDG A;  3RP8 A;  1KFY A;  4DSH A;  3UTF A;  3GQH A;  1H86 A;  1E7P A;  3UOX A;  1XDI A;  3UOV A;  4A6N B;  3V3N A;  5U63 A;  3AYJ A;  3FBS A;  1PN0 A;  3AE9 A;  4H4W A;  3S5W A;  3UKF A;  2AR8 A;  3BI5 A;  4NZH A;  2WEU A;  3NKS A;  4U8P A;  4BK3 A;  2YR5 A;  1H82 A;  2QA2 A;  2WP5 A;  3AB1 A;  4H4X A;  1H83 A;  2FJB A;  2VRL A;  4BK2 A;  3PVC A;  3GD3 A;  3SZC A;  3UCL A;  3AD7 B;  1RP0 A;  3DK4 A;  2VOU A;  1S3E A;  3I6D A;  2A87 A;  2Z5X A;  4GAP A;  4U8I A;  1IUS A;  4H2N A;  4EM3 A;  2XLT A;  4G6H A;  3NN6 X;  3RP7 A;  4JNQ A;  3S61 A;  4U8N A;  1PDH A;  3CNT A;  4JN9 A;  2VQB A;  2GR3 A;  3DGH A;  4IA5 A;  1K4Q A;  4Z24 A;  2IVD A;  4NTD A;  4CRT A;  3EAN A;  1EL8 A;  2Y6R A;  2IVE A;  5U25 A;  5KXJ A;  2GMH A;  4X9M A;  4B69 A;  3NN0 X;  2C66 A;  2OA1 A;  4J56 A;  3NTA A;  4PAA A;  5KVH A;  1PXA A;  2V5Z A;  3LXD A;  3QVR A;  3GRT A;  2XLS A;  1AOG A;  1NHP A;  1XPQ A;  4FK1 C;  4NEV A;  1NAA A;  5FMH A;  1KNR A;  3ALL A;  3AWI A;  3EAO A;  4J31 A;  3D8X A;  4Y4N A;  4OPC A;  2XVJ A;  5HXI A;  2W0H A;  4EQR A;  5C2T A;  1ZMD A;  5GRT A;  2WDR A;  3AEC A;  5KMP A;  1GRA A;  4NNJ A;  4C5O A;  4G73 A;  2EQ7 A;  4AT2 A;  4OPD A;  4GDE A;  4N9X A;  3SXI A;  1O95 A;  3LJP A;  5FS7 A;  1EBD A;  2B7R A;  4YKG A;  1NHR A;  1ZMC A;  3KA7 A;  3KVE A;  2WQY A;  1H84 A;  2BK5 A;  3AD8 B;  3C4N A;  3DK8 A;  1MOK A;  2R4J A;  3CMM A;  4GDP A;  4Y4M A;  2BCP A;  2C65 A;  5EBK A;  3NG7 X;  1UKV G;  2WU2 A;  4M52 A;  2GMJ A;  3LZX A;  1YQ4 A;  1RYI A;  2ARD A;  1JOA A;  4AP1 A;  5KMR A;  1M64 A;  2WP6 A;  2WDQ A;  4UP3 A;  4H4T A;  1CJC A;  1S2Q A;  4YSX A;  4B68 A;  2X50 A;  2VZ2 A;  3T2Z A;  3DH9 A;  4U2L A;  4Z2T A;  1NDA A;  3CGC A;  3DJD A;  4LA1 A;  3GMC A;  3ALM A;  4G6G A;  5EOW A;  1GES A;  3KLJ A;  3NRN A;  4IA6 A;  1ZX9 A;  4IVM B;  3VQR A;  2GH5 A;  4X9N A;  1W4X A;  4G9K A;  1B8S A;  1GRB A;  5C3J A;  3RP6 A;  5KMS A;  1BF3 A;  4TM3 A;  4FX9 A;  1BWC A;  4RG3 A;  4D04 A;  1IUU A;  3UKH A;  1CJ4 A;  2XLU A;  4CCR A;  2BC0 A;  1EL9 A;  2C3D A;  1F8S A;  1NEK A;  1H81 A;  1CC2 A;  1ELI A;  2J3N A;  3DGZ A;  3NK1 X;  4O5Q A;  4U2S A;  2E4G A;  4U8L A;  3SY4 A;  1RSG A;  1B37 A;  2NVK X;  2Q0K A;  4GR1 A;  5KOX A;  3AYI A;  2B9W A;  3H8I A;  1Q9I A;  3D1C A;  3NIX A;  4OCG A;  3QSE A;  4NTE A;  1GTE A;  2BXS A;  2X8H A;  2RGJ A;  1NHS A;  3AEB A;  1JEH A;  3DJJ A;  1D4D A;  2VVL A;  3GWD A;  3DJE A;  4G74 A;  4Z44 A;  3NTD A;  2CUL A;  3K30 A;  1BKW A;  4C3Y A;  1YQ3 A;  4C77 A;  3VR9 A;  2WU5 A;  3K7T A;  4P9S A;  3DJG X;  4Z2R A;  2AQJ A;  3L1R A;  1EL7 A;  2FBW A;  4EIP A;  1BGN A;  1XHC A;  3ICT A;  1JU2 A;  5IQ1 A;  3NNE A;  2ZBW A;  2XCG A;  4PAB A;  3M0O A;  3SFE A;  2EQ9 A;  3ABV A;  1JRZ A;  3HYW A;  4OPL A;  5J60 A;  3FIM B;  1PBC A;  5IPY A;  3T2K A;  2B76 A;  3CIR A;  4OPI A;  2WDV A;  1B5Q A;  1DOC A;  1FL2 A;  1REO A;  3LB8 A;  1ZK7 A;  3QSS A;  4U8M A;  3UKP A;  1OJA A;  5BRT A;  2WPF A;  3P4Q A;  3QFB A;  4OPU A;  1CC4 A;  3URH A;  1TDF A;  2B9Y A;  4IVO B;  3H8L A;  2GR1 A;  3H4K A;  4J36 A;  1F8R A;  1PJ6 A;  2YLS A;  1VG0 A;  3T31 A;  2C70 A;  3V76 A;  2BRY A;  4K8D A;  4AT0 A;  4C74 A;  2FJE A;  1NG4 A;  1CJ3 A;  1S2Y A;  2OAM A;  4CCQ A;  4B65 A;  1CBO A;  2YLX A;  3CGB A;  4B66 A;  1L9E A;  3CGE A;  3CTY A;  3SGL A;  3SZW A;  5BVA A;  3AE4 A;  3UKA A;  3SZF A;  1GRG A;  3E1T A;  1BGJ A;  2YLT A;  3GWF A;  3FPZ A;  2WOV A;  4TM0 A;  4K2X A;  1BZL A;  2YVJ A;  2UZZ A;  2WET A;  1Q1W A;  3NH3 X;  1PBE A;  4LII A;  3UOZ A;  2Q7V A;  1P2E A;  3T14 A;  1FOH A;  1QLB A;  4APN A;  5DBJ A;  2X8G A;  2BCG G;  4JY2 A;  2E5V A;  3UOY A;  1GRE A;  1LTX R;  2GAG B;  2GV8 A;  1DNC A;  2Q6U A;  1F3P A;  2CDU A;  3Q9T A;  5JCK A;  2C67 A;  3CNJ A;  3NYF A;  1E1L A;  3DK9 A;  2YG4 A;  3FG2 P;  3NHO X;  4A5L A;  4AOS A;  5KRQ A;  1GTH A;  2Y6Q A;  1VG9 A;  1XAN A;  3AEE A;  3K7Q X;  2XFQ A;  2C73 A;  1PBF A;  4NEW A;  4OPG A;  2VRM A;  4YWO A;  4CY8 A;  4JNA A;  4GF7 A;  3T0K A;  2YM1 A;  4UDQ A;  2BA9 A;  4JY3 A;  1ZDL A;  2YLR A;  2BS3 A;  3CNP A;  3NT6 A;  4H2R A;  4Z43 A;  2WS3 A;  4H4Z A;  5M0Z A;  1EL5 A;  4UDP A;  2OLO A;  2Z5Y A;  5BUL A;  2QAE A;  2V3B A;  1KNP A;  3NK0 X;  3L8K A;  1N4W A;  2WOI A;  1IJH A;  1IUV A;  1HYU A;  2EQ6 A;  2BS2 A;  3QFA A;  2WHD A;  1OJ9 A;  1N1P A;  2BRA A;  2GQW A;  3CNS A;  4ICY A;  4ZN0 A;  2RGH A;  1L9C A;  1DOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...