4YSYA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[(2,4-dichlorophenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 213
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ysyA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ysyA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ysyA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ysyA04
4YSXA 2X3NA 2WPFA 4J56A 4H2QA 1MOKA 5KVIA 3E1TA 4GRTA 4H4UA 2V6OA 4J31A 1PXBA 3DGHA 2YQUA 4TM0A 4A65A 1XANA 2YWLA 1IUVA 2GR3A 3VR8A 1ELIA 5EOWA 4K8DA 4FX9A 3EANA 3H8IA 1D7YA 3UKKA 4EMIA 1O95A 2BK3A 2OLNA 2VZ2A 2YLRA 1O5WA 4AP1A 3NK2X 1FL2A 1JRZA 3CNTA 2C67A 2X8CA 4ZCCA 3RHAA 1H7XA 3EPTA 1F3PA 2Y6QA 3OZ2A 4YWOA 1PJ5A 2VQBA 1ZP0A 3AE8A 2C3DA 3P4PA 3KLJA 1H83A 2WP9A 2BC0A 3AE9A 1TDNA 4B65A 2HQMA 2J3NA 4DGKA 5LV9A 1IUTA 1F8RA 3DGZA 4CY6A 4EMJA 1NG4A 2YG7A 1RP0A 4TM3A 4OCGA 1BWCA 1PN0A 3CNPA 3CGDA 4Y4NA 2DKHA 4IA5A 2BC1A 2CFYA 2WQYA 3GWDA 4AP3A 2BCPA 2C65A 3SFDA 2XCGA 3LOVA 1B37A 4TLZA 1EL7A 5CQFA 3GRSA 2JB3A 3CNJA 4BURA 5KWFA 4OVIA 4N9XA 1ONFA 4H4YA 2APGA 3VRBA 5IQ1A 2YAUA 1GREA 1S2YA 1S2QA 2BACA 3R9UA 4B1BA 3S61A 1DODA 4YTMA 3JSKA 3AE7A 2GRTA 4CCRA 1OJDA 1CJCA 3COXA 5J7XA 2WESA 3K30A 2JKCA 4H4VA 4DSHA 1FOHA 4UDQA 2VVMA 3NK1X 1CL0A 1GPEA 4U2LA 5U25A 2GMJA 1VQWA 2CVJA 4ZCDA 3OC4A 4EMWA 2YR4A 4AT0A 3P4SA 1N4VA 3P9UA 2WU2A 2XLTA 2BXRA 1CBOA 2C70A 1GTHA 2QAEA 4I59A 2IIDA 2JB1A 4EQRA 3AE5A 1GT8A 4JQ9A 2X8GA 3AE3A 4U2SA 4J57A 3NLCA 2C64A 2YLXA 2DKIA 2WEUA 3RNMA 1NHQA 1Z6LA 2JK6A 3AYIA 1NEKA 4EQXA 2GR0A 3WE0A 1P2EA 4HB9A 3AEDA 3UP5A 1QLBA 2TMDA 4X4JA 5J60A 2GR2A 2XFNA 1Y56A 3LJPA 1TDFA 1IUXA 3FG2P 3G5QA 1Q1WA 1TYPA 2IVEA 4J2WA 4U8OA 4H4XA 3DMEA 1OJ9A 1D4DA 2WDVA 2X8HA 4GDEA 3AEBA 2YG6A 4IA6A 4CCQA 3DK4A 2XVFA 3GYJA 3BNUA 5CKUA 4J33A 3GQHA 2A8XA 1PS9A 2C7GA 1OJCA 4NEWA 5KOXA 2B7RA 3UOZA 4BJYA 4APNA 5ER0A 3LZXA 3NN6X 1SEZA 4JDRA 4CNKA 2ACZA 1KSSA 2GVCA 1CJ3A 2WOIA 4H7UA 1EL8A 4IVOB 3CIRA 3UKHA 1OJAA 2GAGB 3NYCA 2X99A 2E5VA 2ZZCA 1IJHA 4XWRA 2Q0LA 4EIPA 4NEVA 3QFBA 1PBDA 2YLTA 3AEGA 3DJGX 2BA9A 1E1NA 1FECA 3AE4A 1GRHA 3D1CA 1VRQB 2OLOA 2XFUA 4GR1A 2VVLA 4YTPA 1PJ7A 5JCKA 3UKLA 4CY8A 3G5RA 5HXIA 3UOXA 3I6DA 3QFAA 2GMHA 4NTCA 3ZDNA 1MO9A 2YR5A 4J36A 5C3JA 1YKJA 3EF6A 1H7WA 4RG4A 5FS6A 4YSYA 2X50A 3HZLA 4OPCA 1NAAA 4K5SA 3ALMA 4C74A 2GB0A 3CPHG 1D4EA 1Q9IA 5GSNA 4GUVA 3PVCA 3LB8A 2AAQA 2E4GA 1BKWA 1DJQA 2R0PA 1DOCA 1OJTA 3L1RA 3L8KA 4NTDA 3H4KA 1GNDA 1TRBA 2WPCA 4OPUA 4X9MA 3PS9A 1JEHA 3M13A 3GSIA 2NPXA 3AWIA 3NK0X 4X9NA 2YM2A 4CBQA 4EIQA 4H50A 4H2RA 4ECHA 4IV9A 5EB4A 5BRTA 1EBDA 1N4WA 4PABA 3RP6A 3M12A 5FMHA 4B64A 4Z2RA 1DJNA 2VRMA 2WOVA 2ZBWA 3BI2A 1L9CA 2C75A 5JCLA 3UKQA 2BCGG 3M0OA 4UDPA 3C4AA 3NTDA 3AYLA 2R9ZA 4BJZA 3FMWA 3LADA 5EB5A 4BK3A 3ABVA 1CJ4A 1DXLA 1NG3A 4K7ZA 3SQPA 2YM1A 3F8DA 4Z44A 1ZKQA 3NH3X 1ZK7A 2GR1A 1B8SA 2YVGA 3UOYA 3DJJA 2BS3A 3FBSA 3UP4A 1K4QA 4JNAA 4TM1A 4YSHA 1JOAA 1TDKA 1JRXA 1PXCA 1ZMDA 4B69A 4Z26A 1M6IA 1Y56B 4O5UA 2B76A 1FEAA 2ARDA 2XLRA 2Q6UA 4REKA 3FIMB 1L0VA 1IUWA 1K0JA 2Z5YA 3DJDA 1VG9A 4EM4A 2PHHA 3C96A 1XDIA 1TDEA 3ADAB 2GQWA 3PO7A 1LQTA 1N4UA 3KD9A 3NTAA 1PBBA 5U1OA 1K0LA 4USRA 5BULA 1COYA 2LFCA 1H84A 5JCIA 3ITJA 5U63A 3AE1A 3UTHA 3NT6A 5FS8A 1NHRA 3NRNA 1GV4A 4FK1A 3S5WA 4KX6A 3ICRA 4RSLA 3QJ4A 2VOUA 1JNRA 2WHDA 3BI5A 3UCLA 1CJ2A 1KFYA 4C77A 3B6DA 1NHPA 5FS9A 2WPEA 4XWZA 3NHOX 3DK8A 3LZWA 3UKAA 1O94A 2EQ6A 4YKGA 3CGBA 1GRAA 4H2PA 4TM4A 3GWFA 4U8JA 1AOGA 1B5QA 4H4PA 4ICYA 3DH9A 1TDOA 2FJDA 4U8LA 3DK9A 4A6NA 1IUSA 4U8PA 1CC4A 3O0HA 2V3AA 4U8KA 1GXFA 2YG4A 3P1WA 2R0CA 1KSUA 2XFOA 1JNZA 1L9EA 2CULA 4PAAA 4C3YA 2Q7VA 3VRAA 2AR8A 2C66A 3T37A 1LQUA 1NPXA 2R4EA 2YLSA 1E1KA 4H4RA 2I0ZA 2XVEA 1H81A 1HYUA 2YLZA 2V61A 3BNMA 1BGNA 3IWAA 1YY5A 4GF7A 2B9WA 1CC2A 2YR6A 3AD8B 4EM3A 3ICSA 2GF3A 3GDPA 4MJWA 1GALA 3DA1A 5M10A 1ZDLA 5IQ4A 2EQ9A 4H2NA 3RP7A 1LVLA 2B9YA 1W4XA 3F8PA 3VQRA 3BHFA 2EQ7A 3GDNA 4U8MA 2WDRA 2YVFA 4B68A 1EL5A 2UZZA 2YG3A 4D03A 4EQWA 1YQ3A 2XVIA 4DNAA 1PJ6A 4H4TA 2YLWA 4A5LA 3AEAA 3VR9A 3AECA 2H88A 4LIIA 1JU2A 3G5SA 1VG0A 2C76A 2JAEA 2VRLA 1PBFA 2R46A 4J34A 1RSGA 4A7AA 2YVJA 4JY3A 1CF3A 2JB2A 4KPRA 5IPYA 2W0HA 1QO8A 4OPIA 2VQ7A 3AE6A 3KVEA 4D04A 4WX1A 5JCMA 1NHSA 1ZY8A 1M64A 3EAOA 3V76A 5HYMA 1BF3A 2WU5A 5BUKA 2GAHB 3D8XA 3ICTA 2XDOA 3I3LA 3K7QX 4O5QA 4B66A 2V5ZA 4P9SA 2YG5A 4HA6A 4U8NA 3ZYXA 3II4A 1GESA 3BI4A 3F8RA 3AD9B 4BK1A 2RGOA 4LU6A 4JN9A 4NZHA 4A99A 1K0IA 4Z24A 3UKPA 1F8SA 3KA7A 1YQZA 3QVPA 4YSZA 3QSEA 4K5RA 3B3RA 2Y6RA 1H82A 3LXDA 2CDUA 1KNRA 3GRTA 5BVAA 3AEFA 2OAMA 4DSGA 3DJEA 4YTNA 4LA1A 2RGHA 4OPDA 2WETA 1P2HA 4JNQA 5JCNA 1E39A 3KU9A 4EQSA 4FDCB 4OPGA 5KRQA 2XYOA 1ZOVA 4YT0A 3P4RA 1E1MA 2VVLG 2GH5A 4OPLA 3CTYA 3CPJG 3Q6JA 2TPRA 3NN0X 1KDGA 3CGCA 2BS4A 4A6NB 3Q9TA 2C73A 2NVKX 1BZLA 1XPQA 4CNJA 2C72A 2GV8A 1B4VA 1PBCA 4FK1C 3AEEA 1D7LA 2OA1A 4UP3A 1KNPA 2A89A 1E6EA 2R0GA 1F8WA 1H86A 2ZZBA 2BABA 3SFEA 2Z5XA 1YQ4A 1FCDA 1X31B 2QA1A 2WP6A 1VDCA 3V3NA 1NDAA 2WOWA 1E1LA 4GDPA 4H4QA 3H8LA 4BK2A 1V59A 2Q0KA 3GD4A 5TR3A 2FJEA 2RABA 5L46A 2E1MA 3IF9A 1GERA 2FJAA 3GQKA 4K2XA 1LPFA 2AQJA 2XVJA 3ALJA 3NYEA 1TYTA 1F6MA 2XLSA 3AB1A 2WS3A 4I58A 1EL9A 4Y4MA 3GMCA 1N1PA 3NG7X 4C3XA 1DOEA 1GETA 4B67A 5DBJA 2BK5A 2XFPA 2BXSA 4IVMB 1PHHA 3CNDA 3FPZA 3NGCX 5GRTA 1GSNA 1QJDA 3UTFA 1GOSA 2C3CA 3UTEA 2BYBA 4C5OA 3GD3A 1CHUA 3CNSA 1KF6A 5HY5A 2GQFA 5C2TA 3UTGA 4A9WA 3CN8A 3K7MX 1Y0PA 4B63A 1MXTA 1S3EA 2QCUA 2O9ZA 2FBWA 2WDQA 3BHKA 2B9XA 4JY2A 3QSSA 4RG3A 3GMBA 2JBVA 4Z25A 3GYIA 3UOVA 3K7TA 4Z2UA 3AE2A 1L9DA 3IC9A 4XXGA 2V60A 4WCTA 1IUUA 1BGJA 4YKFA 4USQA 2WP5A 4Y4LA 3NYFA 4E0VA 1Q1RA 3SGLA 5KXJA 1RYIA 3ISHA 3AXBA 3SM8A 4ADWA 1GRGA 5KVHA 2BS2A 2FJBA 5KOWA 4YXDA 2WBAA 4NTEA 1GRFA 3ATQA 1GRBA 1XHCA 1LTXR 4H4ZA 3URHA 4H4WA 3CGEA 2ZZ0A 4K22A 4Z2TA 1GTEA 1FEBA 1GRTA 3VRDB 1H6VA 1NENA 1D5TA 3NKSA 3REDA 1E7PA 4AOSA 3ALLA 3QSMA 2OALA 3ATRA 2XLUA 5M0ZA 1CC6A 4AOXA 3AD7B 1REOA 2H89A 3IHGA 4GCMA 3UKFA 1DNCA 1LJ1A 2B7SA 1DOBA 1ZMCA 3CPIG 2XLPA 1D4CA 4A79A 2PYXA 4U2TA 1GEUA 2IVDA 5FS7A 4AT2A 4U8IA 2R45A 4BV6A 2QA2A 2EQ8A 3P4QA 1S3BA 3NIXA 4Z43A 2GEWA 4ZN0A 3KPFA 2R4JA 1LV0A 3AYJA 2V3BA 3GYXA 1PDHA 2RGJA 5HHFA 1UKVG 3KKJA 1ZOYA 1PXAA 3QVRA 4H4SA 3IHMA 3C4NA 2BK4A 3SUCA 4TLXA 2XVHA 4M52A 1ZX9A 2A87A 4UDRA 5EBKA 2XFQA 1JRYA 3NNEA 3RP8A 4CRTA 1PBEA 4OPTA 3V3OA 2F5ZA
chains in the Genus database with same CATH superfamily
4YSXA 2WPFA 3I1AA 1OEDB 4J56A 4GK0E 4GRTA 4J31A 4ILUA 4A65A 3CX8B 2YWLA 2OV9A 2GR3A 1ELIA 2LRKA 5JDGA 3RH3A 3EANA 4G6GA 2PG8A 3RKGA 4HFIA 3L39A 1VCTA 4KI0F 2BK3A 2OLNA 2YLRA 4AP1A 4GYSA 2C67A 4QH1A 4J2CA 1H7XA 3EPTA 2Y6QA 1PJ5A 4CXYA 4H9NC 2C3DA 4YHJA 3KLJA 4HTEA 5KMQA 2RS34 5M4YA 3KV5A 4X66T 4JI2T 4DGKA 5LV9A 4EMJA 2MTQA 2NW7A 5LB7B 1Z7S4 1BWCA 1PN0A 3OKQA 2CMRA 4CZZB 3QB5K 5F5WA 2DCFA 2XY8B 1S94A 4AP3A 1EAH4 4AKLA 3LOVA 1B37A 4TLZA 1EL7A 5CQFA 3T2ZA 2VURA 4DR2T 3C4WA 4H4YA 2VVSA 5ETWA 2APGA 1XDPA 5IQ1A 4HWDA 1GREA 3SXIA 1S2QA 4DUYT 4JI7T 3R9UA 3S61A 2V1DB 3JSKA 4HKAA 3U78A 3W15B 2NOXA 4Z8XA 5EK3A 5J7XA 4U3CA 4C90A 2V5CA 1QSDA 1W0BA 4H9PC 1CL0A 3OC4A 2YR4A 4HFEA 3P4SA 1N4VA 3RRCA 5L3FB 2XLTA 2BXRA 3MACA 2C70A 1GTHA 2JB1A 1MNDA 4EQRA 1YKEB 1GT8A 4ZHQE 4U2SA 2UXCT 3EVYA 1WYBA 3LBXA 3T1YT 2C64A 2YLXA 2YEVC 3NLCA 4QWNB 3RIFA 2ODVA 3AYIA 1NEKA 2GR0A 3WE0A 4HB9A 3UP5A 1D1AA 4YY3T 2GR2A 4B1BA 1TDFA 3FG2P 1Q1WA 2YDRA 2IVEA 4H4XA 3RC8A 2YG6A 3EDUA 3CKDA 2ZM0A 5CKUA 1UCUA 4IE5A 2A8XA 4ZI3C 2XHEB 4NEWA 2XAHB 4APNA 5ER0A 4JDRA 1SEZA 4L5GA 2PYLA 4U2ZA 5HEJA 4IREA 4JUYA 5HXRA 2CM0A 1LVKA 3ZMTB 1PBDA 2YLTA 3QFBA 3FZLB 5CA1E 4G63A 4WNKA 1E1NA 3D1CA 2VVLA 2C0SA 2BBJA 4HWFA 3G5RA 1NCQD 4X64T 4NTCA 2J1DG 1MNEA 5JDQA 1H7WA 4YSYA 3HZLA 3ALMA 1D4EA 3UULA 4UIGA 3AVSA 2E4GA 3HL6A 1XZYA 1BKWA 2R0PA 4NTDA 4B68A 4GYRA 1TRBA 4X9MA 5AQPB 2NPXA 4ZI7E 3SS1A 3AWIA 3GSIA 1XNQT 4CBQA 3NZPA 4IE7A 5BRTA 3MJXA 3M12A 1DJNA 2WOVA 2ZBWA 2BG9C 4IL4A 4ZI3D 4HFHA 3UKQA 2BCGG 3M0OA 3C4AA 4XBFB 3ABVA 4DV4T 4H9RC 1NG3A 4K7ZA 3SQPA 3NH3X 4AKRB 1B8SA 3N9NA 3UOYA 2KXPB 4JNAA 2YU2A 4YSHA 1TDKA 4B69A 1M6IA 5AQOB 4O5UA 4H9OC 5DABA 3P7IA 4HFVA 1IUWA 2EHOB 4EM4A 3NRYA 4PFPA 2GQWA 4KHZF 4WZXA 4LF8T 1W09A 3ZJ2A 1K0LA 1COYA 3ITJA 5AQVB 3AE1A 3NT6A 5L3CB 3EAMA 4FJOA 3QJ4A 2VOUA 3PJAJ 2J62A 2LSKA 2EX3A 4C77A 4I0UA 3ONXA 1NHPA 5FS9A 3UU6A 4EYYR 2LT3A 2XQ9A 2OLTA 3UKAA 3DTOA 3SY4A 4WYVA 1RVF4 2W61A 2EQ6A 3CGBA 5LCYA 4H2PA 3EDVA 5HXEA 4TM4A 4U8JA 2CWOA 3KV9A 4G2AA 2FJDA 1TDOA 3CMMA 4A6NA 3O0HA 3CMLA 3SZ0A 1XMQT 1GXFA 1UX5A 3P1WA 2R0CA 3UQ7A 4JI6T 1KSUA 1L9EA 5LG4A 2XQ6A 3T37A 1ZV4X 5LMUT 3CWZB 4GK5E 2XVEA 4UVAB 5DJQC 5EZYE 3RIUC 2YLZA 1LKXA 1YY5A 4GF7A 3T2KA 1XHXA 3ICSA 1D0YA 2GF3A 3GDPA 4QKNA 2IDOB 1GALA 3DA1A 5M10A 2PW9A 2B9YA 5IYZE 4H9QC 3FI7A 2YVFA 5C8YE 4PDWD 2YG3A 5E0OA 5LBMA 4DNAA 4A5LA 2YLWA 4H63H 3AEAA 2RS14 2WBLA 2WWVA 1SE7A 4LIIA 4GAPA 1BR2A 1VG0A 5JREA 4LF6T 4DR6T 3KVEA 2QVAA 1HG2A 2C5IT 2XSAA 3JC6C 3BQLA 4HWIB 1ZY8A 1WYCA 4DV5T 3EAOA 4OFZA 3IF8B 2XDOA 4B66A 2JQQA 2V5ZA 2YG5A 1NAFA 5HYAA 4GIWA 5ABFA 4KBMB 3II4A 1GESA 4F8HA 3BI4A 3F8RA 3AD9B 4LU6A 4A99A 4H63V 3KA7A 3QVPA 5JR9C 2HWC4 1H82A 3LXDA 2CDUA 3ANWB 1KNRA 1XDOA 3AEFA 4YTNA 4LA1A 4OPDA 5JCNA 5HXHA 4UVCB 1PO24 2X0HA 3KU9A 4QXBB 1M62A 5JDFA 3P4RA 2VVLG 1FIOA 2BRAA 2HN1A 3CPJG 1X79A 2W2UA 5FY0A 2XAFB 5HEUA 2BS4A 2C73A 3AVRA 2VKDA 3ZCJA 4Q25A 2NVKX 1BZLA 1WCRA 2OA1A 4UP3A 1KNPA 3NBXX 3T31A 4EIWA 2ZZBA 1H86A 4U7YA 1VBA4 3SFEA 4NUUA 5AQUB 1FCDA 2WP6A 4DR1T 2WOWA 5KMPA 4GDPA 3H8LA 1V59A 2V7IA 5TR3A 2FJEA 4HWCA 2RABA 2E1MA 3IF9A 1LPFA 3PU3A 2PYJA 3B13A 4TZ4C 2XVJA 3JC6D 4FI5A 1F6MA 5L3GB 4Y4MA 3GMCA 1UK5A 2MYSA 3N9QA 4C3XA 1GETA 4B67A 2JQKA 2BK5A 3UTFA 3CNDA 4M1PA 1XMOT 2KNDA 1GSNA 3NGCX 5GRTA 5LHHB 5AQQB 3GD3A 5C2TA 2QCUA 2FBWA 4IDZA 4RG3A 2WY2A 2JBVA 3UOVA 2IUBA 4Z2UA 1L9DA 4XXGA 4WCTA 3QK6A 4JLEA 3I9YA 4YKFA 2WP5A 3NYFA 4PAGA 3VHLA 3E08A 5KXJA 3ISHA 4ADWA 4YJ2E 3ZMUB 2FJBA 1LTXR 3URHA 3CGEA 3UU4A 4K22A 3FBZA 1FEBA 3UUMA 4QXCB 1B7TA 4AQFC 1D4M4 2OALA 3LDQB 1AJ3A 3AD7B 3ZSTA 2H89A 2B7SA 1ZMCA 4LF5T 1D4CA 2E8IA 4A97A 1GEUA 3Q5WA 4AT2A 4IGUA 2A9UA 3MA9A 2WWUA 1G73A 1MMNA 4BV6A 1S3BA 4ZN0A 2VKOA 5JQGE 3PTRB 3N9PA 2E9XC 4OYKA 1ZOYA 3UQ4A 3WAKA 2YN6A 1EZ3A 2BK4A 1ZX9A 4UDRA 2DNXA 1JRYA 1GRAA 2LOPA 1PBEA 3UT5E 4H2QA 1KK7A 5KVIA 2X68A 5J60A 3DGHA 4P1NA 1XANA 2VKHA 1IUVA 1LVFA 5EOWA 4K8DA 4GKKT 3HKBE 4EMIA 1D1BA 2KSRA 3K3NA 3N9LA 3NK2X 4DVDA 1FL2A 1JRZA 1Z8UA 2LLYA 5H6RB 4UV8B 5L4HA 2Q9QA 1IAPA 1TDNA 2CLYB 3PUSA 3PUXF 1OEDC 1RP0A 3KINB 4QXHB 2DKHA 3ZCIA 2WQYA 3P8CD 4DV0T 1N36T 2BG9A 3GRSA 3CNJA 4BURA 4N9XA 3FZHB 4EZ4A 4P09A 3ZT5A 2XM2A 2BACA 5LG3A 4YTMA 5CA0E 1PVC4 2D0TA 3AA0B 3TLTA 4CCRA 4AQGA 2ZLYA 3K30A 4Q4Y4 2X66A 3T2YA 1FOHA 3Q5EA 5DQVA 3WAJA 4U2LA 2E9XD 3WI3A 2I6HA 2D5UA 4EMWA 4RHV4 4AT0A 3VKHA 1CBOA 2LKGA 3OJAA 2IIDA 1Y01A 4DUZT 3L09A 4GKJT 2X8GA 4DIDB 3AAIA 5ABGA 1NHQA 3NKZA 2JK6A 1VBE4 4PW8A 3RGLA 1HNZT 4EQXA 1P2EA 5F3JA 4X4JA 3I9WA 1Y56A 4YLHA 3LK2B 4U8OA 3DMEA 1OJ9A 2UU9T 1WR6A 2K48A 4GDEA 4II2A 2WAUA 4CCQA 2JJ9A 4YJ3E 4IE6A 3DK4A 3ZLIA 3BNUA 3GQHA 2XAGB 3IEEA 1HF8A 4AKIA 2C7GA 3T8OA 3T0KA 1OJCA 5KOXA 2B7RA 3ZN1B 3PURA 4CNKA 4CQIA 1AR74 2ACZA 1KSSA 2WOIA 4TWHA 2GK9A 4TX5A 4BA9A 1KEYA 2X99A 2ZZCA 1IJHA 2Q0LA 4EIPA 5IHYA 4O4IE 2ZM8A 4DMVA 3RIUA 3DJGX 3AEGA 1HXS4 4EV6A 2BA9A 3B57A 1FECA 3ONJA 2DHRA 2K5BB 3AE4A 1GRHA 1VBD4 4MBQA 1VRQB 4GR1A 5LXTE 5JCKA 5FVLA 4UF0B 2IHR1 5HXIA 3UOXA 3I6DA 3QFAA 2RS54 3ZDNA 1MO9A 5C3JA 2DWGA 3JAFA 4O2AE 4RG4A 1Q9IA 5GSNA 1VBC4 1GNDA 2WPCA 4GOUA 4YHHT 3PS9A 3LK3B 4JI1T 4DV2T 4IE4A 3RPUA 4JI5T 4H50A 5F8PA 4H2RA 4B64A 3OYXA 3AXJA 2VRMA 3BI2A 5JCLA 3G06A 3NTDA 2CE7A 2R9ZA 3AAAB 3FMWA 3LADA 4DV6T 5JR9A 1RHI4 5J2UE 2YM1A 3F8DA 4WBNE 2V7MA 4O2BE 2BZBA 2GR1A 1COV4 3H3MA 2FUPA 4PK4A 4LFBT 1JOAA 4WW0A 1JRXA 1ZMDA 4DV3T 3PUYF 3D0TA 4PJJA 4I55E 2Q6UA 3FB2A 2BKNA 2PHHA 1XDIA 5AQTB 3PO7A 1LQTA 3KD9A 5U1OA 1FMVA 2XM1A 4EXTA 5U63A 4X1IE 3UTHA 3ZYMA 4X5TA 1R084 1POV0 4RSLA 4UVBB 1FEWA 4ZEYA 1JNRA 2WHDA 4EB6E 5HCMA 1CJ2A 2UUCT 3IBPA 3TLVA 2EHOC 4HGAA 2WPEA 1RUG4 3NHOX 2QYWA 2JIWA 1AR64 3E22E 1LRZA 2KMFA 1IUSA 4U8PA 3ZKRA 3N2GE 1XWMA 2YG4A 4K0KT 3VU7H 1JNZA 4C3YA 2D2SA 2Q7VA 5HWYA 2AR8A 2R4EA 4H4RA 3Q5DA 2I0ZA 1VCSA 1H81A 2V61A 1BGNA 3U3IA 4ASKA 5BMVE 2B9WA 3ONLC 5LNKA 2VQFT 2M6BA 5IWAT 5CB4E 5KMSA 2WMOA 1ZDLA 5IQ4A 2IC9A 1LVLA 1W4XA 2D0UA 2EQ7A 4D03A 4LF4T 2XVIA 3VR9A 3AECA 2H88A 2AXDS 3G5SA 1T98A 4X65T 3UU5A 3QNUA 3RF1A 2C76A 1PBFA 1HCIA 4AQFA 5FMNA 3Q5XA 2R46A 2VRLA 1RSGA 3OVUA 4J34A 2YVJA 4A7AA 3CQXC 2CHOA 3V5SA 1CF3A 4JY3A 2W0HA 2DL1A 4OPIA 3LG7A 3AE6A 4D04A 2H7OA 4WX1A 2IC6A 3UFGA 5HYMA 2Q9QC 2EHOD 3ICTA 4O5QA 2R074 3KVBA 4IT4A 2LOSA 2V7JA 4PFOA 3E0ZA 4BK1A 2BVMA 2E9XA 4Z24A 3UKPA 3RIAA 5KNLA 1YQZA 4YSZA 4UV9B 3K1SA 2NP9A 3GRTA 1D0ZA 3KDSE 2OAMA 2J47A 1P2HA 1E39A 2NW9A 5JDHA 4FDCB 3PUWF 3JADA 2XYOA 3H37A 5AQNB 5LA6E 1ZOVA 1BEV4 2JPFA 3RI5A 3NN0X 1KDGA 4AI6A 4XZCA 2XQ4A 1XPQA 5KMRA 1NWMX 2D9DA 1OEDA 4FK1C 2R7FA 2A89A 2R0GA 2ZM6T 4PK6A 2BABA 2Z5XA 1YW0A 2XUEA 1VDCA 3V3NA 1E1LA 4H4QA 4BK2A 3GD4A 2PLV4 3SYIA 5L46A 2RPAA 2FJAA 3ESLA 3ALJA 1WLXA 4TNWA 4KP3C 2KLQA 2Q9QD 1EL9A 5FY7A 3ZEFB 2Y8DA 2MAWA 1HFAA 2IIUA 2BXSA 1PHHA 3UTEA 3HKDE 1GOSA 1CHUA 5HY5A 3FZKB 3T14A 4A9WA 4NWZA 2O9ZA 4X1KE 3PUZF 2WDQA 3SX6A 2B9XA 3K7TA 2BKPA 3AE2A 1ZEEA 4TUYE 2V60A 3HYVA 1BGJA 4USQA 4E0VA 1Q1RA 3RX6A 4CXWA 1RYIA 1S35A 2L8KA 3AXBA 4CI3B 2BS2A 1YXRA 4JV5T 3ATQA 4NTEA 2X9YA 4H4WA 2ZZ0A 4Z2TA 4ILBA 2H7VC 5A1LA 2K9AA 3VRDB 4Z91A 2VB6A 1NENA 1D5TA 4B3ST 3ALLA 5LHGB 2XLUA 5M0ZA 2JRKA 2MPKA 4CI1B 1VRH4 3CPIG 3NZQA 1T7SA 4IIJE 1X9BA 2XLPA 1AR84 4BJMA 4B3MT 4U2TA 5CFBA 4CI2B 2BG9E 4IL9A 2NW8A 2QA2A 2CBIA 4Z43A 4ZZCA 2UXBT 4O4JE 1J5ET 5LOVE 2HH7A 3GYXA 5LP6E 2VL8A 3MK7C 1PXAA 2X67A 4HFCA 3IHMA 1D0XA 5HXCA 2XVHA 2A87A 5EBKA 2XFQA 3NNEA 2W0GA 1W0AA 5AQHB 3N9OA 2F5ZA 3O1JA 3PE0A 1MOKA 3E1TA 4TM0A 4H4UA 2V6OA 1PXBA 4FX9A 4DBQA 1D7YA 2W63A 3UKKA 1O95A 1O5WA 4ZCCA 4YFSA 3OZ2A 1KNZA 3AE8A 1US7B 3P4PA 4NIQA 5KDMC 1H83A 2WP9A 1YKHB 2HQMA 1IUTA 1F8RA 1NG4A 1IBKT 2YG7A 4E7ZA 5HEGA 2BC1A 2CFYA 1YD8G 2BCPA 3SFDA 2XCGA 3UUXB 4MFRA 2JB3A 4OX9T 1ONFA 3VRBA 2YAUA 3J7Yq 2G0UA 4AQYT 1MIYA 3PDYA 3AE7A 3HKEE 2LRLA 2GRTA 2CLYC 2N9DA 1CJCA 1OJDA 3COXA 4DSHA 2VWAA 2VVMA 4UDQA 1QUUA 3NK1X 4IDOA 5U25A 2GMJA 2CVJA 1HRV4 4B6XA 4NXNT 2QAEA 2I0MA 4I59A 2XPKA 4TWDA 4JQ9A 3AE3A 4HFDA 4TN7B 3CQCB 3N5LA 2V8SV 2DKIA 3I0OA 5AQJB 5HEHA 4EAHA 2M67A 3AEDA 3CX6B 1QLBA 2XFNA 2LHRA 1IUXA 4DV1T 1SA0E 4NXMT 3G5QA 1ZHCA 1N34T 2EHOA 2V7KA 2WDVA 5DQWA 2X8HA 3DP7A 3KBUA 4IA6A 3HYXA 2WB5A 2XVFA 5FY1A 5TAOA 1H7CA 2C4CA 5JRCB 5AQSB 1O3XA 5JDLA 1U4QA 2LEHA 4BJYA 4Q4W4 3NN6X 3F2EA 4ADZA 5L4EA 1EL8A 3CIRA 5FKYA 3UKHA 2GAGB 4KMCA 4COFA 1VBB4 5HCJA 1J5WA 2BDEA 3PUAA 4XWRA 2BRYA 2X9XA 3JD74 3UFEA 3RYHE 4ILCA 2XASB 2K3WA 2ACXA 2QRXA 2LSYA 1IJ6A 2W00A 2XQ7A 4N78D 2W66A 4B3TT 3HA4A 3N2KE 4NNJA 2YR5A 4J36A 2LM9A 2V5DA 1YKJA 2KT9A 1ZKEA 1RMU4 2RA1A 5FS6A 2X50A 2A72A 1NAAA 3ZN0B 2UXNB 2YDQA 4GUVA 2CXLA 3LB8A 1OXZA 4ZI2C 1DOCA 1OJTA 3PJAA 2V26A 3NK0X 4X9NA 2YM2A 3NRXA 4EZHA 3RYIE 4ECHA 4JYAT 1N4WA 4PABA 5FMHA 5JDNA 1L9CA 2YK0A 3RQUA 4AKHA 4B3RT 4UDPA 3AYLA 4BJZA 5L47A 5EB5A 4BK3A 3QOFA 1IZNB 1DXLA 3MKDA 3LK42 3FZMB 3DJJA 2BS3A 3UP4A 4TM1A 4PK5A 1HS7A 2B76A 2XLRA 4REKA 1K0JA 2C5KT 2Z5YA 1VG9A 3DJDA 3C96A 3C51A 2KWHA 3ADAB 1N4UA 1PBBA 4CN6A 2LFCA 1H84A 5FXXA 5JCIA 2R044 2A2FX 2OA5A 3ANWA 5FS8A 3KFWX 1NHRA 2VKJA 3F31A 3ZJ1A 3NRNA 4FK1A 3S5WA 4KX6A 3ICRA 3UCLA 5GONE 3FXEB 1KFYA 2ES0A 3K8PC 3HI2A 2HPJA 1DU2A 4ZI2D 4XWZA 4JI8T 3C4ZA 3DK8A 5AQGB 3L3PA 1O94A 4YKGA 4L9IA 5FVKA 3GWFA 1AOGA 3CX7B 1UUSA 1B5QA 4O8SA 4H4PA 4ICYA 2CEAA 4LF9T 3DH9A 1RUI4 4EEDA 3DK9A 2JQHA 1BR0A 1CC4A 2WZIA 2V3AA 4U8KA 4I43B 2XFOA 4DBRA 2PBIA 2CULA 2LSIA 4PAAA 3VRAA 1LQUA 1E1KA 5AQKB 2XAQB 1HYUA 1CC2A 3AD8B 4EM3A 4EEBA 3AA6B 4MJWA 4H2NA 3RP7A 2HPLA 5JDMA 2Z6EA 5FXZA 4TNVA 3VQRA 4HE8A 3BHFA 3LFMA 4U8MA 2WDRA 1EL5A 2R6GF 2W62A 4EQWA 1HX1B 4BJNA 1PJ6A 4HN9A 3TLSA 3ZYKA 2JAEA 3GA8A 2VASA 5IPYA 4KPRA 1QO8A 1OEDE 2XQYA 4XAXB 4GB34 1NHSA 5AQLB 4JEUB 1M64A 2N2NA 1V9DA 1E1HB 2WU5A 5ABHA 1OWAA 3VKGA 2GAHB 3D8XA 3I3LA 3K7QX 1RUJ4 4HA6A 3O4XE 1MIWA 3ZYXA 1RUH4 5BR8T 4JN9A 4LFAT 1F8SA 4ERRA 5J2TE 5CJ5A 1MIVA 2Y6RA 3Q9DA 4ZS2A 5BVAA 1H8TD 4DSGA 3KV4A 4P0AA 2RGHA 5IUXA 2PZSA 2NTYA 4U33A 2KWIB 4OPGA 5KRQA 1J1JA 4YT0A 4OPLA 4CN1A 2R064 2X0YA 3Q6JA 1HNWT 2CBJA 3HYWA 4A6NB 2C72A 2PJQA 4O4LE 1PBCA 4U74A 2J4GA 4ISSA 1D7LA 4JBWF 1F8WA 2IAKA 2YKSA 3J8F4 3F57A 3NWIA 3FZFB 2QA1A 2L9QA 2W4XA 2Q0KA 3ZT7A 2X9HA 1GERA 1T8BA 5LYJE 4IDQA 3NYEA 1FMWA 2XLSA 3AB1A 3RQWA 3C64A 3GMIA 3NG7X 4EYUA 4LF7T 3PV0F 3PUVF 5DBJA 1IBLT 1QJDA 3ZMZB 2BYBA 4C5OA 3CNSA 1I6ZA 3UTGA 4B63A 4ISTA 3CN8A 3AA1B 1Y0PA 3K7MX 3BHKA 4JY2A 3BQKA 3GMBA 1CUNA 4Z90A 5LGUB 2MOZA 4Y4LA 2V6YB 1E2AA 4DR3T 1HRI4 4QH4A 3R84B 3SGLA 5KVHA 1GRGA 2YU1A 3J9X1 2WBAA 3EHZA 5LMNT 1GRBA 4P0BA 5ABFB 4H4ZA 3HR0A 2WCAA 2F4VT 3TLUA 1H6VA 3REDA 5HAXA 3ATRA 1CC6A 1REOA 3SWHA 4Q4X4 3K3OA 1BR4A 4QX7B 4GCMA 3UKFA 1DNCA 1LJ1A 3I0QA 4MLKA 3IA3A 3N9MA 4U8IA 4X1YE 2UXDT 3AA7B 2LSGA 2V6XA 1U5PA 2EQ8A 2ZMAA 3NIXA 2GEWA 4ZXLA 2R4JA 3FBLA 2M6IA 4H9SE 1PDHA 5HHFA 1G8XA 1UKVG 4ZOLE 1IJ5A 5FXVA 4H4SA 2X5ID 2E2AA 5L2LA 3RP8A 1R094 4K5SA 4OPTA 3V3OA 4JI0T 2X3NA 4A5XA 1WR0A 3A7MA 2YQUA 1Z0PA 3VR8A 1HX8A 3DJBA 1M7KA 2KZ7B 5LGTB 3CQGB 3H8IA 3H3AA 2VZ2A 3RC3A 3CNTA 2X8CA 3RHAA 4YWOA 4TV8E 1F3PA 2JMKA 3K3QC 3FXDB 1ZP0A 2VQBA 1W9RA 1FJGT 5LJMA 3TKLB 2BC0A 3AE9A 4B65A 2CHNA 2J3NA 4U2YA 3UUBA 3HKCE 3DGZA 4CY6A 1T72A 4UF0A 2HWB4 4TM3A 2I59A 5HWXA 3ETUA 4OCGA 3CNPA 3CGDA 4Y4NA 4IA5A 1HNXT 3SZCA 4I50E 3GWDA 2C65A 1MMGA 4EGWA 2MBGA 2PY5A 5KWFA 4II3A 4OVIA 4JI4T 5J1GA 1S2YA 3QB5A 1DODA 3O9XA 4OYJA 2IW5B 3ZYLA 4BAYB 2WESA 2JKCA 4H4VA 3A5XA 3OYZA 5H6QB 4I4TE 4UEMA 1GPEA 1VQWA 4L0RA 2N1GA 4NPPA 2HHHT 4ZCDA 5FYMA 4AIUA 3P9UA 2WU2A 4PJMA 1SUMB 2H3RA 5JH7E 2VQET 2XQ8A 3KPKA 3AE5A 4J57A 2VVNA 1HTJF 2WEUA 3RNMA 1Z6LA 1NA1D 2X0LB 2WSSV 2XSBA 4X62T 4DR5T 2TMDA 3LJPA 3B5MA 3O1IA 4J2WA 3LSVA 4QX8B 1TYPA 1MQTD 3ZT6A 4IDPA 1D4DA 3UU3A 3AEBA 4OHFA 2Y48B 4PJLA 4WBOA 3CVRA 3GYJA 4J33A 4ANJA 4LFCT 1PS9A 3R6NA 1WRDA 3UOZA 3LZXA 2GVCA 1CJ3A 5EK2A 4H7UA 2XAJB 4IVOB 2C5JA 4QH5A 3KV6A 1OJAA 4KUMB 3NYCA 2E5VA 4V1Av 2X51A 2XQ5A 5FNVE 4NEVA 1GQEA 3UUNA 2Q9QB 4TV9E 3C4XA 2K24A 2OLOA 2XFUA 3M65A 1UGOA 3RYCE 4YTPA 1PJ7A 5FL1A 3UKLA 3AB3B 4CY8A 2ODUA 1IBMT 3QC9A 2QGSA 2GMHA 2VK9A 3Q2MA 3KVAA 3EF6A 2BG9B 2E5LT 3OBVE 4OPCA 2VL0A 4C74A 2GB0A 5AFUL 3CPHG 2RMU4 3RLFF 3PVCA 5JTGA 2V6YA 2V7LA 2AAQA 3L8KA 1DJQA 3L1RA 3H4KA 4OPUA 1JEHA 3M13A 3RKOA 4U7IA 4EIQA 2JMHA 2JQ9A 4IV9A 5EB4A 1EBDA 3RP6A 3BK9A 3MXZA 3GN5B 3SZWA 4Z2RA 3ZSSA 5AQIB 2A3DA 4A56A 2C75A 4TWFA 4NUVA 4LMKA 2NTXA 3PUGA 1CJ4A 3P4WA 4AKGA 4Z44A 3QUJA 3ETVA 1ZKQA 2DI4A 1ZK7A 1XI1A 2YVGA 3FBSA 1N32T 3EABA 3NVOA 1K4QA 1PXCA 4Z26A 2RR14 2AE9A 1VOMA 3ZPOA 3ZMVB 1Y56B 3PU8A 1FEAA 4PJNA 2ARDA 3FIMB 1L0VA 3CK6A 1TDEA 2WZHA 2W67A 2LJLA 3MZKB 3NTAA 3LJCA 2WM9A 4HWHA 2IMLA 4USRA 5BULA 4UELA 4A98A 1RUE4 4O4HE 1PO14 1UURA 1GV4A 1K5MD 3BI5A 4JI3T 3B6DA 3BQIA 2YDSA 2KINB 3LZWA 2UUBT 4CN4A 2X9WA 2XTLA 2PTFA 4UXNB 1BR1A 4U8LA 1D1CA 2XQ3A 4C91A 3OPCA 2C66A 3M3ZB 1XNRT 1NPXA 4DNDA 2YLSA 2XQAA 3BNMA 3IHRA 3IWAA 2YR6A 1UX4A 4QHOA 2PFVA 2L3LA 2EQ9A 4K0UA 3F8PA 2BBHA 3CPZA 3GDNA 2YOEA 3EI0A 3PUQA 2DWKA 2NR4A 2UZZA 4G73A 3AXJB 2LE8A 1YQ3A 4H4TA 3C98B 5J0ZA 3A8YC 1JU2A 5KMGP 3RRWA 4IE0A 4MHCA 4AISA 5JR9B 2LSJA 2JB2A 5LGNB 2CCQA 4U31A 2VQ7A 4PNIA 5JCMA 2YINA 3V76A 4AXPA 1BF3A 5BUKA 4P9SA 2XJ7A 4U8NA 2XZEA 1EV14 4ZZBA 1RUD4 1VRBA 4OK0A 4ZS3A 2RP4A 2RGOA 4NZHA 5L3EB 1K0IA 5L3DB 2Y6XA 5FXWA 2HN2A 3QSEA 4K5RA 3B3RA 2RM24 1ASJ4 3T1HT 3DJEA 4G9KA 2WETA 4JNQA 5LHIB 3LBXB 2ZM2A 5L3BB 4EQSA 3UU8A 3EUHA 2BKOA 1E1MA 1XHZA 3KBTA 2GH5A 3CTYA 4E7SA 1OOPD 4DR4T 2TPRA 3SOLA 5HXSA 2LHNA 4UR9A 4G74A 2B1EA 2LKHA 3CGCA 4LMLA 3Q9TA 4Q4V4 5AQFB 5LJNA 2NWBA 4CNJA 4KHPT 2GV8A 1B4VA 3AEEA 4HFBA 1E6EA 2CWYA 3O1HA 1YQ4A 4DR7T 5CGMA 5KX5E 1X31B 3JCFA 1NDAA 3OTOT 3SRZA 2UXXB 3GQKA 4K2XA 3P50A 2AQJA 1TYTA 2WS3A 4I58A 4MALA 1N1PA 2LM2A 1DOEA 4HEAA 4U72A 2SPCA 3GN5A 4EOZB 1RUC4 3TLWA 2XFPA 2DLRA 4IVMB 3FPZA 4ILAA 1I94T 2C3CA 1KF6A 2GQFA 4DMWA 2UUAT 1MXTA 1S3EA 1AL24 3V5UA 5LBQB 4X20E 3QSSA 5FP3A 5FL0A 2CA5A 4Z25A 3L8RA 3GYIA 4DV7T 4DO0A 3IC9A 2CXDA 3S4UA 1IUUA 3SZFA 3JBG4 3RYFE 1MMDA 3SM8A 5AQMB 1R8IA 5KOWA 4YXDA 3X1DA 1GRFA 1XHCA 4CXXA 1MMAA 1SHZC 1GRTA 1GTEA 5JVDE 2E9XB 3AAEB 3NKSA 1E7PA 5EK4A 4AOSA 4IDNA 5ABEA 3C50A 3QSMA 5AQRB 4GAVA 4AOXA 1PIV4 2CRBA 2CXFA 5ADXL 4LMJA 3IHGA 4G6HA 3JAEA 1DOBA 2CPTA 3ZC1A 1RUF4 4A79A 2PYXA 1HG5A 2IVDA 5FS7A 4F6RC 2R45A 5HEOA 3P4QA 3ZMSB 2P9BA 3GWHA 4JEHB 1HR0T 1LV0A 3KPFA 2WMNA 2V3BA 3AYJA 1AR94 1WFDA 2RGJA 4IHJE 1Y64B 3UTKA 3KKJA 3QVRA 3FHNA 3C4NA 2BVLA 1N33T 3SUCA 4TLXA 4M52A 2QA7A 3ZC0A 4CRTA 3RHWA 3N2OA 5JRCA
chains in the Genus database with same CATH topology
4YSXA 2X3NA 2WPFA 4J56A 4H2QA 1MOKA 5KVIA 3E1TA 4GRTA 4H4UA 2V6OA 4J31A 1PXBA 3DGHA 2YQUA 4TM0A 4A65A 1XANA 2YWLA 1IUVA 2GR3A 3VR8A 1ELIA 5EOWA 4K8DA 4FX9A 3EANA 4G6GA 3H8IA 1D7YA 3UKKA 4EMIA 1O95A 2BK3A 2OLNA 2VZ2A 2YLRA 1O5WA 4AP1A 3NK2X 1FL2A 1JRZA 3CNTA 2C67A 2X8CA 4ZCCA 3RHAA 1H7XA 3EPTA 1F3PA 2Y6QA 3OZ2A 4YWOA 1PJ5A 2VQBA 1ZP0A 3AE8A 2C3DA 3P4PA 3KLJA 1H83A 2WP9A 2BC0A 3AE9A 1TDNA 4B65A 4A9WA 2HQMA 5KMQA 2J3NA 4DGKA 5LV9A 1IUTA 1F8RA 3DGZA 4CY6A 4EMJA 1NG4A 2YG7A 1RP0A 4TM3A 4OCGA 1BWCA 1PN0A 3CNPA 3CGDA 4Y4NA 2DKHA 4IA5A 2BC1A 2CFYA 3SZCA 2WQYA 3GWDA 4AP3A 2BCPA 2C65A 3SFDA 2XCGA 3LOVA 1B37A 4TLZA 1EL7A 5CQFA 3T2ZA 3GRSA 2JB3A 3CNJA 4BURA 5KWFA 4II3A 4N9XA 4OVIA 1ONFA 4H4YA 2APGA 3VRBA 5IQ1A 3SXIA 2YAUA 1GREA 1S2YA 1S2QA 2BACA 3R9UA 4B1BA 3S61A 1DODA 4YTMA 3JSKA 3AE7A 2GRTA 4CCRA 1OJDA 1CJCA 3COXA 5J7XA 2WESA 3K30A 2JKCA 4H4VA 3T2YA 4DSHA 1FOHA 4UDQA 2VVMA 3NK1X 1CL0A 1GPEA 4U2LA 5U25A 2GMJA 1VQWA 2CVJA 4ZCDA 3OC4A 4EMWA 2YR4A 4AT0A 3P4SA 1N4VA 3P9UA 2WU2A 2XLTA 2BXRA 1CBOA 2C70A 1GTHA 2QAEA 4I59A 2IIDA 2JB1A 3KPKA 4EQRA 3AE5A 1GT8A 4JQ9A 2X8GA 3AE3A 4U2SA 4J57A 3NLCA 2C64A 2YLXA 2DKIA 2WEUA 3RNMA 1NHQA 1Z6LA 2JK6A 3AYIA 1NEKA 4EQXA 2GR0A 3WE0A 1P2EA 4HB9A 3AEDA 3UP5A 1QLBA 2TMDA 4X4JA 5J60A 2GR2A 2XFNA 1Y56A 3LJPA 1TDFA 1IUXA 3FG2P 3G5QA 1Q1WA 1TYPA 2IVEA 4J2WA 4U8OA 4H4XA 3DMEA 1OJ9A 1D4DA 2WDVA 2X8HA 4GDEA 3AEBA 2YG6A 4IA6A 4II2A 3HYXA 4CCQA 3DK4A 2XVFA 3GYJA 3BNUA 5CKUA 4J33A 3GQHA 2A8XA 2C4CA 1PS9A 2C7GA 3T0KA 1OJCA 4NEWA 5KOXA 2B7RA 3UOZA 4BJYA 4APNA 5ER0A 3LZXA 3NN6X 1SEZA 4JDRA 4CNKA 2ACZA 1KSSA 2GVCA 1CJ3A 2WOIA 4H7UA 1EL8A 4IVOB 3CIRA 3UKHA 1OJAA 2GAGB 3NYCA 2X99A 2E5VA 2ZZCA 1IJHA 4XWRA 2Q0LA 2BRYA 4EIPA 4NEVA 3QFBA 1PBDA 2YLTA 3AEGA 3DJGX 2BA9A 1E1NA 1FECA 3AE4A 1GRHA 3D1CA 1VRQB 2OLOA 2XFUA 4GR1A 2VVLA 4YTPA 1PJ7A 5JCKA 3UKLA 4CY8A 3G5RA 5HXIA 3UOXA 3I6DA 3QFAA 2GMHA 4NNJA 4NTCA 3ZDNA 1MO9A 2YR5A 4J36A 5C3JA 1YKJA 3EF6A 1H7WA 4RG4A 5FS6A 4YSYA 2X50A 3HZLA 4OPCA 1NAAA 4K5SA 3ALMA 4C74A 2GB0A 3CPHG 1D4EA 1Q9IA 5GSNA 4GUVA 3PVCA 3LB8A 2AAQA 2E4GA 1BKWA 1DJQA 2R0PA 1DOCA 1OJTA 3L1RA 3L8KA 4NTDA 3H4KA 1GNDA 1TRBA 2WPCA 4OPUA 4X9MA 3PS9A 1JEHA 3M13A 3GSIA 2NPXA 3AWIA 3NK0X 4X9NA 2YM2A 4CBQA 4EIQA 4H50A 4H2RA 4ECHA 4IV9A 5EB4A 5BRTA 1EBDA 1N4WA 4PABA 3RP6A 3M12A 5FMHA 4B64A 3SZWA 1DJNA 2VRMA 4Z2RA 2WOVA 2ZBWA 3BI2A 1L9CA 2C75A 5JCLA 3UKQA 2BCGG 3M0OA 4UDPA 3C4AA 3NTDA 3AYLA 2R9ZA 4BJZA 3FMWA 3LADA 5EB5A 4BK3A 3ABVA 1CJ4A 1DXLA 1NG3A 4K7ZA 3SQPA 2YM1A 3F8DA 4Z44A 1ZKQA 3NH3X 1ZK7A 2GR1A 1B8SA 2YVGA 3UOYA 3DJJA 2BS3A 3FBSA 3UP4A 1K4QA 4JNAA 4TM1A 4YSHA 1JOAA 1TDKA 1JRXA 1PXCA 1ZMDA 4B69A 4Z26A 1M6IA 1Y56B 4O5UA 2B76A 1FEAA 2ARDA 2XLRA 2Q6UA 4REKA 3FIMB 1L0VA 1IUWA 1K0JA 2Z5YA 3DJDA 1VG9A 4EM4A 2PHHA 3C96A 1XDIA 1TDEA 3ADAB 2GQWA 3PO7A 1LQTA 1N4UA 3KD9A 3NTAA 1PBBA 5U1OA 1K0LA 4USRA 5BULA 1COYA 2LFCA 1H84A 5JCIA 3ITJA 5U63A 3AE1A 3UTHA 3NT6A 5FS8A 1NHRA 3NRNA 1GV4A 4FK1A 3S5WA 4KX6A 3ICRA 4RSLA 3QJ4A 2VOUA 1JNRA 2WHDA 3BI5A 3UCLA 1CJ2A 1KFYA 4C77A 3B6DA 1NHPA 5FS9A 2WPEA 4XWZA 3NHOX 3DK8A 3LZWA 3UKAA 3SY4A 1O94A 2EQ6A 4YKGA 3CGBA 1GRAA 4H2PA 4TM4A 3GWFA 4U8JA 1AOGA 1B5QA 4H4PA 4ICYA 3DH9A 1TDOA 2FJDA 3CMMA 3DK9A 4U8LA 1IUSA 4A6NA 4U8PA 1CC4A 3O0HA 2V3AA 4U8KA 3SZ0A 1GXFA 2YG4A 3P1WA 2R0CA 1KSUA 2XFOA 1JNZA 1L9EA 2CULA 4PAAA 4C3YA 2Q7VA 3VRAA 2AR8A 2C66A 3T37A 1LQUA 1NPXA 2R4EA 2YLSA 1E1KA 4H4RA 2I0ZA 2XVEA 1H81A 1HYUA 2YLZA 2V61A 3BNMA 1BGNA 3IWAA 1YY5A 4GF7A 2B9WA 1CC2A 2YR6A 3AD8B 3T2KA 4EM3A 3ICSA 2GF3A 3GDPA 4MJWA 1GALA 3DA1A 5KMSA 5M10A 1ZDLA 5IQ4A 2EQ9A 4H2NA 3RP7A 1LVLA 2B9YA 1W4XA 3F8PA 3VQRA 3BHFA 2EQ7A 3GDNA 4U8MA 2WDRA 2YVFA 4B68A 4G73A 1EL5A 2UZZA 2YG3A 4D03A 4EQWA 1YQ3A 2XVIA 4DNAA 1PJ6A 4H4TA 2YLWA 4A5LA 3AEAA 3VR9A 3AECA 2H88A 4LIIA 1JU2A 3G5SA 4GAPA 1VG0A 2C76A 2JAEA 2VRLA 1PBFA 2R46A 4J34A 1RSGA 4A7AA 2YVJA 4JY3A 1CF3A 2JB2A 4KPRA 5IPYA 2W0HA 1QO8A 4OPIA 2VQ7A 3AE6A 3KVEA 4D04A 4WX1A 5JCMA 1NHSA 1ZY8A 1M64A 3EAOA 3V76A 5HYMA 1BF3A 2WU5A 5BUKA 2GAHB 3D8XA 3ICTA 2XDOA 3I3LA 3K7QX 4O5QA 4B66A 2V5ZA 4P9SA 2YG5A 4HA6A 4U8NA 3ZYXA 3II4A 1GESA 3BI4A 3F8RA 3AD9B 4BK1A 2RGOA 4LU6A 4JN9A 4NZHA 4A99A 1K0IA 4Z24A 3UKPA 1F8SA 3KA7A 5KNLA 1YQZA 3QVPA 4YSZA 3QSEA 4K5RA 3B3RA 2Y6RA 1H82A 3LXDA 2CDUA 1KNRA 3GRTA 5BVAA 3AEFA 2OAMA 4DSGA 3DJEA 4YTNA 4G9KA 4LA1A 2RGHA 4OPDA 2WETA 1P2HA 4JNQA 5JCNA 1E39A 3KU9A 4EQSA 4FDCB 4OPGA 5KRQA 2XYOA 1ZOVA 4YT0A 3P4RA 1E1MA 2VVLG 2BRAA 2GH5A 4OPLA 3CTYA 3CPJG 3Q6JA 2TPRA 4G74A 3NN0X 1KDGA 3CGCA 3HYWA 2BS4A 4A6NB 3Q9TA 2C73A 2NVKX 1BZLA 1XPQA 4CNJA 2C72A 2GV8A 1B4VA 5KMRA 1PBCA 4FK1C 3AEEA 1D7LA 2OA1A 4UP3A 1KNPA 3T31A 2A89A 1E6EA 2R0GA 1F8WA 1H86A 2ZZBA 2BABA 3SFEA 2Z5XA 1YQ4A 1FCDA 1X31B 2QA1A 2WP6A 1VDCA 3V3NA 1NDAA 2WOWA 1E1LA 4GDPA 4H4QA 5KMPA 3H8LA 4BK2A 1V59A 2Q0KA 3GD4A 5TR3A 2FJEA 3SYIA 2RABA 5L46A 2E1MA 3IF9A 1GERA 2FJAA 3GQKA 4K2XA 1LPFA 2AQJA 2XVJA 3ALJA 3NYEA 1TYTA 1F6MA 2XLSA 3AB1A 2WS3A 4I58A 1EL9A 4Y4MA 3GMCA 1N1PA 3NG7X 4C3XA 1DOEA 1GETA 4B67A 5DBJA 2BK5A 2XFPA 2BXSA 4IVMB 1PHHA 3CNDA 3FPZA 3NGCX 5GRTA 1GSNA 1QJDA 3UTFA 1GOSA 2C3CA 3UTEA 2BYBA 4C5OA 3GD3A 1CHUA 3CNSA 1KF6A 5HY5A 2GQFA 5C2TA 3T14A 3UTGA 3CN8A 3K7MX 1Y0PA 4NWZA 1MXTA 1S3EA 2QCUA 4B63A 2O9ZA 2FBWA 2WDQA 3BHKA 2B9XA 4JY2A 3QSSA 3SX6A 4RG3A 3GMBA 2JBVA 4Z25A 3GYIA 3UOVA 3K7TA 4Z2UA 3AE2A 1L9DA 3IC9A 4XXGA 2V60A 4WCTA 1IUUA 3HYVA 1BGJA 4YKFA 4USQA 2WP5A 4Y4LA 3NYFA 3SZFA 4E0VA 1Q1RA 3SGLA 5KXJA 1RYIA 3ISHA 3AXBA 3SM8A 4ADWA 1GRGA 5KVHA 2BS2A 2FJBA 5KOWA 4YXDA 2WBAA 4NTEA 1GRFA 3ATQA 1GRBA 1XHCA 1LTXR 4H4ZA 3URHA 4H4WA 3CGEA 2ZZ0A 4K22A 4Z2TA 1GTEA 1FEBA 1GRTA 3VRDB 1H6VA 1NENA 1D5TA 3NKSA 3REDA 1E7PA 4AOSA 3ALLA 3QSMA 2OALA 4GAVA 3ATRA 2XLUA 5M0ZA 1CC6A 4AOXA 3AD7B 1REOA 2H89A 3IHGA 4G6HA 4GCMA 3UKFA 1DNCA 1LJ1A 2B7SA 1DOBA 1ZMCA 3CPIG 2XLPA 1D4CA 4A79A 2PYXA 4U2TA 1GEUA 2IVDA 5FS7A 4AT2A 4U8IA 2R45A 4BV6A 2QA2A 2EQ8A 3P4QA 1S3BA 3NIXA 4Z43A 2GEWA 4ZN0A 3KPFA 2R4JA 1LV0A 3AYJA 2V3BA 3GYXA 1PDHA 2RGJA 5HHFA 1UKVG 3KKJA 1ZOYA 1PXAA 3QVRA 4H4SA 3IHMA 3C4NA 2BK4A 3SUCA 4TLXA 2XVHA 4M52A 1ZX9A 2A87A 4UDRA 5EBKA 2XFQA 1JRYA 3NNEA 3RP8A 4CRTA 1PBEA 4OPTA 3V3OA 2F5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSX A;  2X3N A;  2WPF A;  4J56 A;  4H2Q A;  1MOK A;  5KVI A;  3E1T A;  4GRT A;  4H4U A;  2V6O A;  4J31 A;  1PXB A;  3DGH A;  2YQU A;  4TM0 A;  4A65 A;  1XAN A;  2YWL A;  1IUV A;  2GR3 A;  3VR8 A;  1ELI A;  5EOW A;  4K8D A;  4FX9 A;  3EAN A;  3H8I A;  1D7Y A;  3UKK A;  4EMI A;  1O95 A;  2BK3 A;  2OLN A;  2VZ2 A;  2YLR A;  1O5W A;  4AP1 A;  3NK2 X;  1FL2 A;  1JRZ A;  3CNT A;  2C67 A;  2X8C A;  4ZCC A;  3RHA A;  1H7X A;  3EPT A;  1F3P A;  2Y6Q A;  3OZ2 A;  4YWO A;  1PJ5 A;  2VQB A;  1ZP0 A;  3AE8 A;  2C3D A;  3P4P A;  3KLJ A;  1H83 A;  2WP9 A;  2BC0 A;  3AE9 A;  1TDN A;  4B65 A;  2HQM A;  2J3N A;  4DGK A;  5LV9 A;  1IUT A;  1F8R A;  3DGZ A;  4CY6 A;  4EMJ A;  1NG4 A;  2YG7 A;  1RP0 A;  4TM3 A;  4OCG A;  1BWC A;  1PN0 A;  3CNP A;  3CGD A;  4Y4N A;  2DKH A;  4IA5 A;  2BC1 A;  2CFY A;  2WQY A;  3GWD A;  4AP3 A;  2BCP A;  2C65 A;  3SFD A;  2XCG A;  3LOV A;  1B37 A;  4TLZ A;  1EL7 A;  5CQF A;  3GRS A;  2JB3 A;  3CNJ A;  4BUR A;  5KWF A;  4OVI A;  4N9X A;  1ONF A;  4H4Y A;  2APG A;  3VRB A;  5IQ1 A;  2YAU A;  1GRE A;  1S2Y A;  1S2Q A;  2BAC A;  3R9U A;  4B1B A;  3S61 A;  1DOD A;  4YTM A;  3JSK A;  3AE7 A;  2GRT A;  4CCR A;  1OJD A;  1CJC A;  3COX A;  5J7X A;  2WES A;  3K30 A;  2JKC A;  4H4V A;  4DSH A;  1FOH A;  4UDQ A;  2VVM A;  3NK1 X;  1CL0 A;  1GPE A;  4U2L A;  5U25 A;  2GMJ A;  1VQW A;  2CVJ A;  4ZCD A;  3OC4 A;  4EMW A;  2YR4 A;  4AT0 A;  3P4S A;  1N4V A;  3P9U A;  2WU2 A;  2XLT A;  2BXR A;  1CBO A;  2C70 A;  1GTH A;  2QAE A;  4I59 A;  2IID A;  2JB1 A;  4EQR A;  3AE5 A;  1GT8 A;  4JQ9 A;  2X8G A;  3AE3 A;  4U2S A;  4J57 A;  3NLC A;  2C64 A;  2YLX A;  2DKI A;  2WEU A;  3RNM A;  1NHQ A;  1Z6L A;  2JK6 A;  3AYI A;  1NEK A;  4EQX A;  2GR0 A;  3WE0 A;  1P2E A;  4HB9 A;  3AED A;  3UP5 A;  1QLB A;  2TMD A;  4X4J A;  5J60 A;  2GR2 A;  2XFN A;  1Y56 A;  3LJP A;  1TDF A;  1IUX A;  3FG2 P;  3G5Q A;  1Q1W A;  1TYP A;  2IVE A;  4J2W A;  4U8O A;  4H4X A;  3DME A;  1OJ9 A;  1D4D A;  2WDV A;  2X8H A;  4GDE A;  3AEB A;  2YG6 A;  4IA6 A;  4CCQ A;  3DK4 A;  2XVF A;  3GYJ A;  3BNU A;  5CKU A;  4J33 A;  3GQH A;  2A8X A;  1PS9 A;  2C7G A;  1OJC A;  4NEW A;  5KOX A;  2B7R A;  3UOZ A;  4BJY A;  4APN A;  5ER0 A;  3LZX A;  3NN6 X;  1SEZ A;  4JDR A;  4CNK A;  2ACZ A;  1KSS A;  2GVC A;  1CJ3 A;  2WOI A;  4H7U A;  1EL8 A;  4IVO B;  3CIR A;  3UKH A;  1OJA A;  2GAG B;  3NYC A;  2X99 A;  2E5V A;  2ZZC A;  1IJH A;  4XWR A;  2Q0L A;  4EIP A;  4NEV A;  3QFB A;  1PBD A;  2YLT A;  3AEG A;  3DJG X;  2BA9 A;  1E1N A;  1FEC A;  3AE4 A;  1GRH A;  3D1C A;  1VRQ B;  2OLO A;  2XFU A;  4GR1 A;  2VVL A;  4YTP A;  1PJ7 A;  5JCK A;  3UKL A;  4CY8 A;  3G5R A;  5HXI A;  3UOX A;  3I6D A;  3QFA A;  2GMH A;  4NTC A;  3ZDN A;  1MO9 A;  2YR5 A;  4J36 A;  5C3J A;  1YKJ A;  3EF6 A;  1H7W A;  4RG4 A;  5FS6 A;  4YSY A;  2X50 A;  3HZL A;  4OPC A;  1NAA A;  4K5S A;  3ALM A;  4C74 A;  2GB0 A;  3CPH G;  1D4E A;  1Q9I A;  5GSN A;  4GUV A;  3PVC A;  3LB8 A;  2AAQ A;  2E4G A;  1BKW A;  1DJQ A;  2R0P A;  1DOC A;  1OJT A;  3L1R A;  3L8K A;  4NTD A;  3H4K A;  1GND A;  1TRB A;  2WPC A;  4OPU A;  4X9M A;  3PS9 A;  1JEH A;  3M13 A;  3GSI A;  2NPX A;  3AWI A;  3NK0 X;  4X9N A;  2YM2 A;  4CBQ A;  4EIQ A;  4H50 A;  4H2R A;  4ECH A;  4IV9 A;  5EB4 A;  5BRT A;  1EBD A;  1N4W A;  4PAB A;  3RP6 A;  3M12 A;  5FMH A;  4B64 A;  4Z2R A;  1DJN A;  2VRM A;  2WOV A;  2ZBW A;  3BI2 A;  1L9C A;  2C75 A;  5JCL A;  3UKQ A;  2BCG G;  3M0O A;  4UDP A;  3C4A A;  3NTD A;  3AYL A;  2R9Z A;  4BJZ A;  3FMW A;  3LAD A;  5EB5 A;  4BK3 A;  3ABV A;  1CJ4 A;  1DXL A;  1NG3 A;  4K7Z A;  3SQP A;  2YM1 A;  3F8D A;  4Z44 A;  1ZKQ A;  3NH3 X;  1ZK7 A;  2GR1 A;  1B8S A;  2YVG A;  3UOY A;  3DJJ A;  2BS3 A;  3FBS A;  3UP4 A;  1K4Q A;  4JNA A;  4TM1 A;  4YSH A;  1JOA A;  1TDK A;  1JRX A;  1PXC A;  1ZMD A;  4B69 A;  4Z26 A;  1M6I A;  1Y56 B;  4O5U A;  2B76 A;  1FEA A;  2ARD A;  2XLR A;  2Q6U A;  4REK A;  3FIM B;  1L0V A;  1IUW A;  1K0J A;  2Z5Y A;  3DJD A;  1VG9 A;  4EM4 A;  2PHH A;  3C96 A;  1XDI A;  1TDE A;  3ADA B;  2GQW A;  3PO7 A;  1LQT A;  1N4U A;  3KD9 A;  3NTA A;  1PBB A;  5U1O A;  1K0L A;  4USR A;  5BUL A;  1COY A;  2LFC A;  1H84 A;  5JCI A;  3ITJ A;  5U63 A;  3AE1 A;  3UTH A;  3NT6 A;  5FS8 A;  1NHR A;  3NRN A;  1GV4 A;  4FK1 A;  3S5W A;  4KX6 A;  3ICR A;  4RSL A;  3QJ4 A;  2VOU A;  1JNR A;  2WHD A;  3BI5 A;  3UCL A;  1CJ2 A;  1KFY A;  4C77 A;  3B6D A;  1NHP A;  5FS9 A;  2WPE A;  4XWZ A;  3NHO X;  3DK8 A;  3LZW A;  3UKA A;  1O94 A;  2EQ6 A;  4YKG A;  3CGB A;  1GRA A;  4H2P A;  4TM4 A;  3GWF A;  4U8J A;  1AOG A;  1B5Q A;  4H4P A;  4ICY A;  3DH9 A;  1TDO A;  2FJD A;  4U8L A;  3DK9 A;  4A6N A;  1IUS A;  4U8P A;  1CC4 A;  3O0H A;  2V3A A;  4U8K A;  1GXF A;  2YG4 A;  3P1W A;  2R0C A;  1KSU A;  2XFO A;  1JNZ A;  1L9E A;  2CUL A;  4PAA A;  4C3Y A;  2Q7V A;  3VRA A;  2AR8 A;  2C66 A;  3T37 A;  1LQU A;  1NPX A;  2R4E A;  2YLS A;  1E1K A;  4H4R A;  2I0Z A;  2XVE A;  1H81 A;  1HYU A;  2YLZ A;  2V61 A;  3BNM A;  1BGN A;  3IWA A;  1YY5 A;  4GF7 A;  2B9W A;  1CC2 A;  2YR6 A;  3AD8 B;  4EM3 A;  3ICS A;  2GF3 A;  3GDP A;  4MJW A;  1GAL A;  3DA1 A;  5M10 A;  1ZDL A;  5IQ4 A;  2EQ9 A;  4H2N A;  3RP7 A;  1LVL A;  2B9Y A;  1W4X A;  3F8P A;  3VQR A;  3BHF A;  2EQ7 A;  3GDN A;  4U8M A;  2WDR A;  2YVF A;  4B68 A;  1EL5 A;  2UZZ A;  2YG3 A;  4D03 A;  4EQW A;  1YQ3 A;  2XVI A;  4DNA A;  1PJ6 A;  4H4T A;  2YLW A;  4A5L A;  3AEA A;  3VR9 A;  3AEC A;  2H88 A;  4LII A;  1JU2 A;  3G5S A;  1VG0 A;  2C76 A;  2JAE A;  2VRL A;  1PBF A;  2R46 A;  4J34 A;  1RSG A;  4A7A A;  2YVJ A;  4JY3 A;  1CF3 A;  2JB2 A;  4KPR A;  5IPY A;  2W0H A;  1QO8 A;  4OPI A;  2VQ7 A;  3AE6 A;  3KVE A;  4D04 A;  4WX1 A;  5JCM A;  1NHS A;  1ZY8 A;  1M64 A;  3EAO A;  3V76 A;  5HYM A;  1BF3 A;  2WU5 A;  5BUK A;  2GAH B;  3D8X A;  3ICT A;  2XDO A;  3I3L A;  3K7Q X;  4O5Q A;  4B66 A;  2V5Z A;  4P9S A;  2YG5 A;  4HA6 A;  4U8N A;  3ZYX A;  3II4 A;  1GES A;  3BI4 A;  3F8R A;  3AD9 B;  4BK1 A;  2RGO A;  4LU6 A;  4JN9 A;  4NZH A;  4A99 A;  1K0I A;  4Z24 A;  3UKP A;  1F8S A;  3KA7 A;  1YQZ A;  3QVP A;  4YSZ A;  3QSE A;  4K5R A;  3B3R A;  2Y6R A;  1H82 A;  3LXD A;  2CDU A;  1KNR A;  3GRT A;  5BVA A;  3AEF A;  2OAM A;  4DSG A;  3DJE A;  4YTN A;  4LA1 A;  2RGH A;  4OPD A;  2WET A;  1P2H A;  4JNQ A;  5JCN A;  1E39 A;  3KU9 A;  4EQS A;  4FDC B;  4OPG A;  5KRQ A;  2XYO A;  1ZOV A;  4YT0 A;  3P4R A;  1E1M A;  2VVL G;  2GH5 A;  4OPL A;  3CTY A;  3CPJ G;  3Q6J A;  2TPR A;  3NN0 X;  1KDG A;  3CGC A;  2BS4 A;  4A6N B;  3Q9T A;  2C73 A;  2NVK X;  1BZL A;  1XPQ A;  4CNJ A;  2C72 A;  2GV8 A;  1B4V A;  1PBC A;  4FK1 C;  3AEE A;  1D7L A;  2OA1 A;  4UP3 A;  1KNP A;  2A89 A;  1E6E A;  2R0G A;  1F8W A;  1H86 A;  2ZZB A;  2BAB A;  3SFE A;  2Z5X A;  1YQ4 A;  1FCD A;  1X31 B;  2QA1 A;  2WP6 A;  1VDC A;  3V3N A;  1NDA A;  2WOW A;  1E1L A;  4GDP A;  4H4Q A;  3H8L A;  4BK2 A;  1V59 A;  2Q0K A;  3GD4 A;  5TR3 A;  2FJE A;  2RAB A;  5L46 A;  2E1M A;  3IF9 A;  1GER A;  2FJA A;  3GQK A;  4K2X A;  1LPF A;  2AQJ A;  2XVJ A;  3ALJ A;  3NYE A;  1TYT A;  1F6M A;  2XLS A;  3AB1 A;  2WS3 A;  4I58 A;  1EL9 A;  4Y4M A;  3GMC A;  1N1P A;  3NG7 X;  4C3X A;  1DOE A;  1GET A;  4B67 A;  5DBJ A;  2BK5 A;  2XFP A;  2BXS A;  4IVM B;  1PHH A;  3CND A;  3FPZ A;  3NGC X;  5GRT A;  1GSN A;  1QJD A;  3UTF A;  1GOS A;  2C3C A;  3UTE A;  2BYB A;  4C5O A;  3GD3 A;  1CHU A;  3CNS A;  1KF6 A;  5HY5 A;  2GQF A;  5C2T A;  3UTG A;  4A9W A;  3CN8 A;  3K7M X;  1Y0P A;  4B63 A;  1MXT A;  1S3E A;  2QCU A;  2O9Z A;  2FBW A;  2WDQ A;  3BHK A;  2B9X A;  4JY2 A;  3QSS A;  4RG3 A;  3GMB A;  2JBV A;  4Z25 A;  3GYI A;  3UOV A;  3K7T A;  4Z2U A;  3AE2 A;  1L9D A;  3IC9 A;  4XXG A;  2V60 A;  4WCT A;  1IUU A;  1BGJ A;  4YKF A;  4USQ A;  2WP5 A;  4Y4L A;  3NYF A;  4E0V A;  1Q1R A;  3SGL A;  5KXJ A;  1RYI A;  3ISH A;  3AXB A;  3SM8 A;  4ADW A;  1GRG A;  5KVH A;  2BS2 A;  2FJB A;  5KOW A;  4YXD A;  2WBA A;  4NTE A;  1GRF A;  3ATQ A;  1GRB A;  1XHC A;  1LTX R;  4H4Z A;  3URH A;  4H4W A;  3CGE A;  2ZZ0 A;  4K22 A;  4Z2T A;  1GTE A;  1FEB A;  1GRT A;  3VRD B;  1H6V A;  1NEN A;  1D5T A;  3NKS A;  3RED A;  1E7P A;  4AOS A;  3ALL A;  3QSM A;  2OAL A;  3ATR A;  2XLU A;  5M0Z A;  1CC6 A;  4AOX A;  3AD7 B;  1REO A;  2H89 A;  3IHG A;  4GCM A;  3UKF A;  1DNC A;  1LJ1 A;  2B7S A;  1DOB A;  1ZMC A;  3CPI G;  2XLP A;  1D4C A;  4A79 A;  2PYX A;  4U2T A;  1GEU A;  2IVD A;  5FS7 A;  4AT2 A;  4U8I A;  2R45 A;  4BV6 A;  2QA2 A;  2EQ8 A;  3P4Q A;  1S3B A;  3NIX A;  4Z43 A;  2GEW A;  4ZN0 A;  3KPF A;  2R4J A;  1LV0 A;  3AYJ A;  2V3B A;  3GYX A;  1PDH A;  2RGJ A;  5HHF A;  1UKV G;  3KKJ A;  1ZOY A;  1PXA A;  3QVR A;  4H4S A;  3IHM A;  3C4N A;  2BK4 A;  3SUC A;  4TLX A;  2XVH A;  4M52 A;  1ZX9 A;  2A87 A;  4UDR A;  5EBK A;  2XFQ A;  1JRY A;  3NNE A;  3RP8 A;  4CRT A;  1PBE A;  4OPT A;  3V3O A;  2F5Z A; 
#chains in the Genus database with same CATH topology
 4YSX A;  2WPF A;  3I1A A;  1OED B;  4J56 A;  4GK0 E;  4GRT A;  4J31 A;  4ILU A;  4A65 A;  3CX8 B;  2YWL A;  2OV9 A;  2GR3 A;  1ELI A;  2LRK A;  5JDG A;  3RH3 A;  3EAN A;  4G6G A;  2PG8 A;  3RKG A;  4HFI A;  3L39 A;  1VCT A;  4KI0 F;  2BK3 A;  2OLN A;  2YLR A;  4AP1 A;  4GYS A;  2C67 A;  4QH1 A;  4J2C A;  1H7X A;  3EPT A;  2Y6Q A;  1PJ5 A;  4CXY A;  4H9N C;  2C3D A;  4YHJ A;  3KLJ A;  4HTE A;  5KMQ A;  2RS3 4;  5M4Y A;  3KV5 A;  4X66 T;  4JI2 T;  4DGK A;  5LV9 A;  4EMJ A;  2MTQ A;  2NW7 A;  5LB7 B;  1Z7S 4;  1BWC A;  1PN0 A;  3OKQ A;  2CMR A;  4CZZ B;  3QB5 K;  5F5W A;  2DCF A;  2XY8 B;  1S94 A;  4AP3 A;  1EAH 4;  4AKL A;  3LOV A;  1B37 A;  4TLZ A;  1EL7 A;  5CQF A;  3T2Z A;  2VUR A;  4DR2 T;  3C4W A;  4H4Y A;  2VVS A;  5ETW A;  2APG A;  1XDP A;  5IQ1 A;  4HWD A;  1GRE A;  3SXI A;  1S2Q A;  4DUY T;  4JI7 T;  3R9U A;  3S61 A;  2V1D B;  3JSK A;  4HKA A;  3U78 A;  3W15 B;  2NOX A;  4Z8X A;  5EK3 A;  5J7X A;  4U3C A;  4C90 A;  2V5C A;  1QSD A;  1W0B A;  4H9P C;  1CL0 A;  3OC4 A;  2YR4 A;  4HFE A;  3P4S A;  1N4V A;  3RRC A;  5L3F B;  2XLT A;  2BXR A;  3MAC A;  2C70 A;  1GTH A;  2JB1 A;  1MND A;  4EQR A;  1YKE B;  1GT8 A;  4ZHQ E;  4U2S A;  2UXC T;  3EVY A;  1WYB A;  3LBX A;  3T1Y T;  2C64 A;  2YLX A;  2YEV C;  3NLC A;  4QWN B;  3RIF A;  2ODV A;  3AYI A;  1NEK A;  2GR0 A;  3WE0 A;  4HB9 A;  3UP5 A;  1D1A A;  4YY3 T;  2GR2 A;  4B1B A;  1TDF A;  3FG2 P;  1Q1W A;  2YDR A;  2IVE A;  4H4X A;  3RC8 A;  2YG6 A;  3EDU A;  3CKD A;  2ZM0 A;  5CKU A;  1UCU A;  4IE5 A;  2A8X A;  4ZI3 C;  2XHE B;  4NEW A;  2XAH B;  4APN A;  5ER0 A;  4JDR A;  1SEZ A;  4L5G A;  2PYL A;  4U2Z A;  5HEJ A;  4IRE A;  4JUY A;  5HXR A;  2CM0 A;  1LVK A;  3ZMT B;  1PBD A;  2YLT A;  3QFB A;  3FZL B;  5CA1 E;  4G63 A;  4WNK A;  1E1N A;  3D1C A;  2VVL A;  2C0S A;  2BBJ A;  4HWF A;  3G5R A;  1NCQ D;  4X64 T;  4NTC A;  2J1D G;  1MNE A;  5JDQ A;  1H7W A;  4YSY A;  3HZL A;  3ALM A;  1D4E A;  3UUL A;  4UIG A;  3AVS A;  2E4G A;  3HL6 A;  1XZY A;  1BKW A;  2R0P A;  4NTD A;  4B68 A;  4GYR A;  1TRB A;  4X9M A;  5AQP B;  2NPX A;  4ZI7 E;  3SS1 A;  3AWI A;  3GSI A;  1XNQ T;  4CBQ A;  3NZP A;  4IE7 A;  5BRT A;  3MJX A;  3M12 A;  1DJN A;  2WOV A;  2ZBW A;  2BG9 C;  4IL4 A;  4ZI3 D;  4HFH A;  3UKQ A;  2BCG G;  3M0O A;  3C4A A;  4XBF B;  3ABV A;  4DV4 T;  4H9R C;  1NG3 A;  4K7Z A;  3SQP A;  3NH3 X;  4AKR B;  1B8S A;  3N9N A;  3UOY A;  2KXP B;  4JNA A;  2YU2 A;  4YSH A;  1TDK A;  4B69 A;  1M6I A;  5AQO B;  4O5U A;  4H9O C;  5DAB A;  3P7I A;  4HFV A;  1IUW A;  2EHO B;  4EM4 A;  3NRY A;  4PFP A;  2GQW A;  4KHZ F;  4WZX A;  4LF8 T;  1W09 A;  3ZJ2 A;  1K0L A;  1COY A;  3ITJ A;  5AQV B;  3AE1 A;  3NT6 A;  5L3C B;  3EAM A;  4FJO A;  3QJ4 A;  2VOU A;  3PJA J;  2J62 A;  2LSK A;  2EX3 A;  4C77 A;  4I0U A;  3ONX A;  1NHP A;  5FS9 A;  3UU6 A;  4EYY R;  2LT3 A;  2XQ9 A;  2OLT A;  3UKA A;  3DTO A;  3SY4 A;  4WYV A;  1RVF 4;  2W61 A;  2EQ6 A;  3CGB A;  5LCY A;  4H2P A;  3EDV A;  5HXE A;  4TM4 A;  4U8J A;  2CWO A;  3KV9 A;  4G2A A;  2FJD A;  1TDO A;  3CMM A;  4A6N A;  3O0H A;  3CML A;  3SZ0 A;  1XMQ T;  1GXF A;  1UX5 A;  3P1W A;  2R0C A;  3UQ7 A;  4JI6 T;  1KSU A;  1L9E A;  5LG4 A;  2XQ6 A;  3T37 A;  1ZV4 X;  5LMU T;  3CWZ B;  4GK5 E;  2XVE A;  4UVA B;  5DJQ C;  5EZY E;  3RIU C;  2YLZ A;  1LKX A;  1YY5 A;  4GF7 A;  3T2K A;  1XHX A;  3ICS A;  1D0Y A;  2GF3 A;  3GDP A;  4QKN A;  2IDO B;  1GAL A;  3DA1 A;  5M10 A;  2PW9 A;  2B9Y A;  5IYZ E;  4H9Q C;  3FI7 A;  2YVF A;  5C8Y E;  4PDW D;  2YG3 A;  5E0O A;  5LBM A;  4DNA A;  4A5L A;  2YLW A;  4H63 H;  3AEA A;  2RS1 4;  2WBL A;  2WWV A;  1SE7 A;  4LII A;  4GAP A;  1BR2 A;  1VG0 A;  5JRE A;  4LF6 T;  4DR6 T;  3KVE A;  2QVA A;  1HG2 A;  2C5I T;  2XSA A;  3JC6 C;  3BQL A;  4HWI B;  1ZY8 A;  1WYC A;  4DV5 T;  3EAO A;  4OFZ A;  3IF8 B;  2XDO A;  4B66 A;  2JQQ A;  2V5Z A;  2YG5 A;  1NAF A;  5HYA A;  4GIW A;  5ABF A;  4KBM B;  3II4 A;  1GES A;  4F8H A;  3BI4 A;  3F8R A;  3AD9 B;  4LU6 A;  4A99 A;  4H63 V;  3KA7 A;  3QVP A;  5JR9 C;  2HWC 4;  1H82 A;  3LXD A;  2CDU A;  3ANW B;  1KNR A;  1XDO A;  3AEF A;  4YTN A;  4LA1 A;  4OPD A;  5JCN A;  5HXH A;  4UVC B;  1PO2 4;  2X0H A;  3KU9 A;  4QXB B;  1M62 A;  5JDF A;  3P4R A;  2VVL G;  1FIO A;  2BRA A;  2HN1 A;  3CPJ G;  1X79 A;  2W2U A;  5FY0 A;  2XAF B;  5HEU A;  2BS4 A;  2C73 A;  3AVR A;  2VKD A;  3ZCJ A;  4Q25 A;  2NVK X;  1BZL A;  1WCR A;  2OA1 A;  4UP3 A;  1KNP A;  3NBX X;  3T31 A;  4EIW A;  2ZZB A;  1H86 A;  4U7Y A;  1VBA 4;  3SFE A;  4NUU A;  5AQU B;  1FCD A;  2WP6 A;  4DR1 T;  2WOW A;  5KMP A;  4GDP A;  3H8L A;  1V59 A;  2V7I A;  5TR3 A;  2FJE A;  4HWC A;  2RAB A;  2E1M A;  3IF9 A;  1LPF A;  3PU3 A;  2PYJ A;  3B13 A;  4TZ4 C;  2XVJ A;  3JC6 D;  4FI5 A;  1F6M A;  5L3G B;  4Y4M A;  3GMC A;  1UK5 A;  2MYS A;  3N9Q A;  4C3X A;  1GET A;  4B67 A;  2JQK A;  2BK5 A;  3UTF A;  3CND A;  4M1P A;  1XMO T;  2KND A;  1GSN A;  3NGC X;  5GRT A;  5LHH B;  5AQQ B;  3GD3 A;  5C2T A;  2QCU A;  2FBW A;  4IDZ A;  4RG3 A;  2WY2 A;  2JBV A;  3UOV A;  2IUB A;  4Z2U A;  1L9D A;  4XXG A;  4WCT A;  3QK6 A;  4JLE A;  3I9Y A;  4YKF A;  2WP5 A;  3NYF A;  4PAG A;  3VHL A;  3E08 A;  5KXJ A;  3ISH A;  4ADW A;  4YJ2 E;  3ZMU B;  2FJB A;  1LTX R;  3URH A;  3CGE A;  3UU4 A;  4K22 A;  3FBZ A;  1FEB A;  3UUM A;  4QXC B;  1B7T A;  4AQF C;  1D4M 4;  2OAL A;  3LDQ B;  1AJ3 A;  3AD7 B;  3ZST A;  2H89 A;  2B7S A;  1ZMC A;  4LF5 T;  1D4C A;  2E8I A;  4A97 A;  1GEU A;  3Q5W A;  4AT2 A;  4IGU A;  2A9U A;  3MA9 A;  2WWU A;  1G73 A;  1MMN A;  4BV6 A;  1S3B A;  4ZN0 A;  2VKO A;  5JQG E;  3PTR B;  3N9P A;  2E9X C;  4OYK A;  1ZOY A;  3UQ4 A;  3WAK A;  2YN6 A;  1EZ3 A;  2BK4 A;  1ZX9 A;  4UDR A;  2DNX A;  1JRY A;  1GRA A;  2LOP A;  1PBE A;  3UT5 E;  4H2Q A;  1KK7 A;  5KVI A;  2X68 A;  5J60 A;  3DGH A;  4P1N A;  1XAN A;  2VKH A;  1IUV A;  1LVF A;  5EOW A;  4K8D A;  4GKK T;  3HKB E;  4EMI A;  1D1B A;  2KSR A;  3K3N A;  3N9L A;  3NK2 X;  4DVD A;  1FL2 A;  1JRZ A;  1Z8U A;  2LLY A;  5H6R B;  4UV8 B;  5L4H A;  2Q9Q A;  1IAP A;  1TDN A;  2CLY B;  3PUS A;  3PUX F;  1OED C;  1RP0 A;  3KIN B;  4QXH B;  2DKH A;  3ZCI A;  2WQY A;  3P8C D;  4DV0 T;  1N36 T;  2BG9 A;  3GRS A;  3CNJ A;  4BUR A;  4N9X A;  3FZH B;  4EZ4 A;  4P09 A;  3ZT5 A;  2XM2 A;  2BAC A;  5LG3 A;  4YTM A;  5CA0 E;  1PVC 4;  2D0T A;  3AA0 B;  3TLT A;  4CCR A;  4AQG A;  2ZLY A;  3K30 A;  4Q4Y 4;  2X66 A;  3T2Y A;  1FOH A;  3Q5E A;  5DQV A;  3WAJ A;  4U2L A;  2E9X D;  3WI3 A;  2I6H A;  2D5U A;  4EMW A;  4RHV 4;  4AT0 A;  3VKH A;  1CBO A;  2LKG A;  3OJA A;  2IID A;  1Y01 A;  4DUZ T;  3L09 A;  4GKJ T;  2X8G A;  4DID B;  3AAI A;  5ABG A;  1NHQ A;  3NKZ A;  2JK6 A;  1VBE 4;  4PW8 A;  3RGL A;  1HNZ T;  4EQX A;  1P2E A;  5F3J A;  4X4J A;  3I9W A;  1Y56 A;  4YLH A;  3LK2 B;  4U8O A;  3DME A;  1OJ9 A;  2UU9 T;  1WR6 A;  2K48 A;  4GDE A;  4II2 A;  2WAU A;  4CCQ A;  2JJ9 A;  4YJ3 E;  4IE6 A;  3DK4 A;  3ZLI A;  3BNU A;  3GQH A;  2XAG B;  3IEE A;  1HF8 A;  4AKI A;  2C7G A;  3T8O A;  3T0K A;  1OJC A;  5KOX A;  2B7R A;  3ZN1 B;  3PUR A;  4CNK A;  4CQI A;  1AR7 4;  2ACZ A;  1KSS A;  2WOI A;  4TWH A;  2GK9 A;  4TX5 A;  4BA9 A;  1KEY A;  2X99 A;  2ZZC A;  1IJH A;  2Q0L A;  4EIP A;  5IHY A;  4O4I E;  2ZM8 A;  4DMV A;  3RIU A;  3DJG X;  3AEG A;  1HXS 4;  4EV6 A;  2BA9 A;  3B57 A;  1FEC A;  3ONJ A;  2DHR A;  2K5B B;  3AE4 A;  1GRH A;  1VBD 4;  4MBQ A;  1VRQ B;  4GR1 A;  5LXT E;  5JCK A;  5FVL A;  4UF0 B;  2IHR 1;  5HXI A;  3UOX A;  3I6D A;  3QFA A;  2RS5 4;  3ZDN A;  1MO9 A;  5C3J A;  2DWG A;  3JAF A;  4O2A E;  4RG4 A;  1Q9I A;  5GSN A;  1VBC 4;  1GND A;  2WPC A;  4GOU A;  4YHH T;  3PS9 A;  3LK3 B;  4JI1 T;  4DV2 T;  4IE4 A;  3RPU A;  4JI5 T;  4H50 A;  5F8P A;  4H2R A;  4B64 A;  3OYX A;  3AXJ A;  2VRM A;  3BI2 A;  5JCL A;  3G06 A;  3NTD A;  2CE7 A;  2R9Z A;  3AAA B;  3FMW A;  3LAD A;  4DV6 T;  5JR9 A;  1RHI 4;  5J2U E;  2YM1 A;  3F8D A;  4WBN E;  2V7M A;  4O2B E;  2BZB A;  2GR1 A;  1COV 4;  3H3M A;  2FUP A;  4PK4 A;  4LFB T;  1JOA A;  4WW0 A;  1JRX A;  1ZMD A;  4DV3 T;  3PUY F;  3D0T A;  4PJJ A;  4I55 E;  2Q6U A;  3FB2 A;  2BKN A;  2PHH A;  1XDI A;  5AQT B;  3PO7 A;  1LQT A;  3KD9 A;  5U1O A;  1FMV A;  2XM1 A;  4EXT A;  5U63 A;  4X1I E;  3UTH A;  3ZYM A;  4X5T A;  1R08 4;  1POV 0;  4RSL A;  4UVB B;  1FEW A;  4ZEY A;  1JNR A;  2WHD A;  4EB6 E;  5HCM A;  1CJ2 A;  2UUC T;  3IBP A;  3TLV A;  2EHO C;  4HGA A;  2WPE A;  1RUG 4;  3NHO X;  2QYW A;  2JIW A;  1AR6 4;  3E22 E;  1LRZ A;  2KMF A;  1IUS A;  4U8P A;  3ZKR A;  3N2G E;  1XWM A;  2YG4 A;  4K0K T;  3VU7 H;  1JNZ A;  4C3Y A;  2D2S A;  2Q7V A;  5HWY A;  2AR8 A;  2R4E A;  4H4R A;  3Q5D A;  2I0Z A;  1VCS A;  1H81 A;  2V61 A;  1BGN A;  3U3I A;  4ASK A;  5BMV E;  2B9W A;  3ONL C;  5LNK A;  2VQF T;  2M6B A;  5IWA T;  5CB4 E;  5KMS A;  2WMO A;  1ZDL A;  5IQ4 A;  2IC9 A;  1LVL A;  1W4X A;  2D0U A;  2EQ7 A;  4D03 A;  4LF4 T;  2XVI A;  3VR9 A;  3AEC A;  2H88 A;  2AXD S;  3G5S A;  1T98 A;  4X65 T;  3UU5 A;  3QNU A;  3RF1 A;  2C76 A;  1PBF A;  1HCI A;  4AQF A;  5FMN A;  3Q5X A;  2R46 A;  2VRL A;  1RSG A;  3OVU A;  4J34 A;  2YVJ A;  4A7A A;  3CQX C;  2CHO A;  3V5S A;  1CF3 A;  4JY3 A;  2W0H A;  2DL1 A;  4OPI A;  3LG7 A;  3AE6 A;  4D04 A;  2H7O A;  4WX1 A;  2IC6 A;  3UFG A;  5HYM A;  2Q9Q C;  2EHO D;  3ICT A;  4O5Q A;  2R07 4;  3KVB A;  4IT4 A;  2LOS A;  2V7J A;  4PFO A;  3E0Z A;  4BK1 A;  2BVM A;  2E9X A;  4Z24 A;  3UKP A;  3RIA A;  5KNL A;  1YQZ A;  4YSZ A;  4UV9 B;  3K1S A;  2NP9 A;  3GRT A;  1D0Z A;  3KDS E;  2OAM A;  2J47 A;  1P2H A;  1E39 A;  2NW9 A;  5JDH A;  4FDC B;  3PUW F;  3JAD A;  2XYO A;  3H37 A;  5AQN B;  5LA6 E;  1ZOV A;  1BEV 4;  2JPF A;  3RI5 A;  3NN0 X;  1KDG A;  4AI6 A;  4XZC A;  2XQ4 A;  1XPQ A;  5KMR A;  1NWM X;  2D9D A;  1OED A;  4FK1 C;  2R7F A;  2A89 A;  2R0G A;  2ZM6 T;  4PK6 A;  2BAB A;  2Z5X A;  1YW0 A;  2XUE A;  1VDC A;  3V3N A;  1E1L A;  4H4Q A;  4BK2 A;  3GD4 A;  2PLV 4;  3SYI A;  5L46 A;  2RPA A;  2FJA A;  3ESL A;  3ALJ A;  1WLX A;  4TNW A;  4KP3 C;  2KLQ A;  2Q9Q D;  1EL9 A;  5FY7 A;  3ZEF B;  2Y8D A;  2MAW A;  1HFA A;  2IIU A;  2BXS A;  1PHH A;  3UTE A;  3HKD E;  1GOS A;  1CHU A;  5HY5 A;  3FZK B;  3T14 A;  4A9W A;  4NWZ A;  2O9Z A;  4X1K E;  3PUZ F;  2WDQ A;  3SX6 A;  2B9X A;  3K7T A;  2BKP A;  3AE2 A;  1ZEE A;  4TUY E;  2V60 A;  3HYV A;  1BGJ A;  4USQ A;  4E0V A;  1Q1R A;  3RX6 A;  4CXW A;  1RYI A;  1S35 A;  2L8K A;  3AXB A;  4CI3 B;  2BS2 A;  1YXR A;  4JV5 T;  3ATQ A;  4NTE A;  2X9Y A;  4H4W A;  2ZZ0 A;  4Z2T A;  4ILB A;  2H7V C;  5A1L A;  2K9A A;  3VRD B;  4Z91 A;  2VB6 A;  1NEN A;  1D5T A;  4B3S T;  3ALL A;  5LHG B;  2XLU A;  5M0Z A;  2JRK A;  2MPK A;  4CI1 B;  1VRH 4;  3CPI G;  3NZQ A;  1T7S A;  4IIJ E;  1X9B A;  2XLP A;  1AR8 4;  4BJM A;  4B3M T;  4U2T A;  5CFB A;  4CI2 B;  2BG9 E;  4IL9 A;  2NW8 A;  2QA2 A;  2CBI A;  4Z43 A;  4ZZC A;  2UXB T;  4O4J E;  1J5E T;  5LOV E;  2HH7 A;  3GYX A;  5LP6 E;  2VL8 A;  3MK7 C;  1PXA A;  2X67 A;  4HFC A;  3IHM A;  1D0X A;  5HXC A;  2XVH A;  2A87 A;  5EBK A;  2XFQ A;  3NNE A;  2W0G A;  1W0A A;  5AQH B;  3N9O A;  2F5Z A;  3O1J A;  3PE0 A;  1MOK A;  3E1T A;  4TM0 A;  4H4U A;  2V6O A;  1PXB A;  4FX9 A;  4DBQ A;  1D7Y A;  2W63 A;  3UKK A;  1O95 A;  1O5W A;  4ZCC A;  4YFS A;  3OZ2 A;  1KNZ A;  3AE8 A;  1US7 B;  3P4P A;  4NIQ A;  5KDM C;  1H83 A;  2WP9 A;  1YKH B;  2HQM A;  1IUT A;  1F8R A;  1NG4 A;  1IBK T;  2YG7 A;  4E7Z A;  5HEG A;  2BC1 A;  2CFY A;  1YD8 G;  2BCP A;  3SFD A;  2XCG A;  3UUX B;  4MFR A;  2JB3 A;  4OX9 T;  1ONF A;  3VRB A;  2YAU A;  3J7Y q;  2G0U A;  4AQY T;  1MIY A;  3PDY A;  3AE7 A;  3HKE E;  2LRL A;  2GRT A;  2CLY C;  2N9D A;  1CJC A;  1OJD A;  3COX A;  4DSH A;  2VWA A;  2VVM A;  4UDQ A;  1QUU A;  3NK1 X;  4IDO A;  5U25 A;  2GMJ A;  2CVJ A;  1HRV 4;  4B6X A;  4NXN T;  2QAE A;  2I0M A;  4I59 A;  2XPK A;  4TWD A;  4JQ9 A;  3AE3 A;  4HFD A;  4TN7 B;  3CQC B;  3N5L A;  2V8S V;  2DKI A;  3I0O A;  5AQJ B;  5HEH A;  4EAH A;  2M67 A;  3AED A;  3CX6 B;  1QLB A;  2XFN A;  2LHR A;  1IUX A;  4DV1 T;  1SA0 E;  4NXM T;  3G5Q A;  1ZHC A;  1N34 T;  2EHO A;  2V7K A;  2WDV A;  5DQW A;  2X8H A;  3DP7 A;  3KBU A;  4IA6 A;  3HYX A;  2WB5 A;  2XVF A;  5FY1 A;  5TAO A;  1H7C A;  2C4C A;  5JRC B;  5AQS B;  1O3X A;  5JDL A;  1U4Q A;  2LEH A;  4BJY A;  4Q4W 4;  3NN6 X;  3F2E A;  4ADZ A;  5L4E A;  1EL8 A;  3CIR A;  5FKY A;  3UKH A;  2GAG B;  4KMC A;  4COF A;  1VBB 4;  5HCJ A;  1J5W A;  2BDE A;  3PUA A;  4XWR A;  2BRY A;  2X9X A;  3JD7 4;  3UFE A;  3RYH E;  4ILC A;  2XAS B;  2K3W A;  2ACX A;  2QRX A;  2LSY A;  1IJ6 A;  2W00 A;  2XQ7 A;  4N78 D;  2W66 A;  4B3T T;  3HA4 A;  3N2K E;  4NNJ A;  2YR5 A;  4J36 A;  2LM9 A;  2V5D A;  1YKJ A;  2KT9 A;  1ZKE A;  1RMU 4;  2RA1 A;  5FS6 A;  2X50 A;  2A72 A;  1NAA A;  3ZN0 B;  2UXN B;  2YDQ A;  4GUV A;  2CXL A;  3LB8 A;  1OXZ A;  4ZI2 C;  1DOC A;  1OJT A;  3PJA A;  2V26 A;  3NK0 X;  4X9N A;  2YM2 A;  3NRX A;  4EZH A;  3RYI E;  4ECH A;  4JYA T;  1N4W A;  4PAB A;  5FMH A;  5JDN A;  1L9C A;  2YK0 A;  3RQU A;  4AKH A;  4B3R T;  4UDP A;  3AYL A;  4BJZ A;  5L47 A;  5EB5 A;  4BK3 A;  3QOF A;  1IZN B;  1DXL A;  3MKD A;  3LK4 2;  3FZM B;  3DJJ A;  2BS3 A;  3UP4 A;  4TM1 A;  4PK5 A;  1HS7 A;  2B76 A;  2XLR A;  4REK A;  1K0J A;  2C5K T;  2Z5Y A;  1VG9 A;  3DJD A;  3C96 A;  3C51 A;  2KWH A;  3ADA B;  1N4U A;  1PBB A;  4CN6 A;  2LFC A;  1H84 A;  5FXX A;  5JCI A;  2R04 4;  2A2F X;  2OA5 A;  3ANW A;  5FS8 A;  3KFW X;  1NHR A;  2VKJ A;  3F31 A;  3ZJ1 A;  3NRN A;  4FK1 A;  3S5W A;  4KX6 A;  3ICR A;  3UCL A;  5GON E;  3FXE B;  1KFY A;  2ES0 A;  3K8P C;  3HI2 A;  2HPJ A;  1DU2 A;  4ZI2 D;  4XWZ A;  4JI8 T;  3C4Z A;  3DK8 A;  5AQG B;  3L3P A;  1O94 A;  4YKG A;  4L9I A;  5FVK A;  3GWF A;  1AOG A;  3CX7 B;  1UUS A;  1B5Q A;  4O8S A;  4H4P A;  4ICY A;  2CEA A;  4LF9 T;  3DH9 A;  1RUI 4;  4EED A;  3DK9 A;  2JQH A;  1BR0 A;  1CC4 A;  2WZI A;  2V3A A;  4U8K A;  4I43 B;  2XFO A;  4DBR A;  2PBI A;  2CUL A;  2LSI A;  4PAA A;  3VRA A;  1LQU A;  1E1K A;  5AQK B;  2XAQ B;  1HYU A;  1CC2 A;  3AD8 B;  4EM3 A;  4EEB A;  3AA6 B;  4MJW A;  4H2N A;  3RP7 A;  2HPL A;  5JDM A;  2Z6E A;  5FXZ A;  4TNV A;  3VQR A;  4HE8 A;  3BHF A;  3LFM A;  4U8M A;  2WDR A;  1EL5 A;  2R6G F;  2W62 A;  4EQW A;  1HX1 B;  4BJN A;  1PJ6 A;  4HN9 A;  3TLS A;  3ZYK A;  2JAE A;  3GA8 A;  2VAS A;  5IPY A;  4KPR A;  1QO8 A;  1OED E;  2XQY A;  4XAX B;  4GB3 4;  1NHS A;  5AQL B;  4JEU B;  1M64 A;  2N2N A;  1V9D A;  1E1H B;  2WU5 A;  5ABH A;  1OWA A;  3VKG A;  2GAH B;  3D8X A;  3I3L A;  3K7Q X;  1RUJ 4;  4HA6 A;  3O4X E;  1MIW A;  3ZYX A;  1RUH 4;  5BR8 T;  4JN9 A;  4LFA T;  1F8S A;  4ERR A;  5J2T E;  5CJ5 A;  1MIV A;  2Y6R A;  3Q9D A;  4ZS2 A;  5BVA A;  1H8T D;  4DSG A;  3KV4 A;  4P0A A;  2RGH A;  5IUX A;  2PZS A;  2NTY A;  4U33 A;  2KWI B;  4OPG A;  5KRQ A;  1J1J A;  4YT0 A;  4OPL A;  4CN1 A;  2R06 4;  2X0Y A;  3Q6J A;  1HNW T;  2CBJ A;  3HYW A;  4A6N B;  2C72 A;  2PJQ A;  4O4L E;  1PBC A;  4U74 A;  2J4G A;  4ISS A;  1D7L A;  4JBW F;  1F8W A;  2IAK A;  2YKS A;  3J8F 4;  3F57 A;  3NWI A;  3FZF B;  2QA1 A;  2L9Q A;  2W4X A;  2Q0K A;  3ZT7 A;  2X9H A;  1GER A;  1T8B A;  5LYJ E;  4IDQ A;  3NYE A;  1FMW A;  2XLS A;  3AB1 A;  3RQW A;  3C64 A;  3GMI A;  3NG7 X;  4EYU A;  4LF7 T;  3PV0 F;  3PUV F;  5DBJ A;  1IBL T;  1QJD A;  3ZMZ B;  2BYB A;  4C5O A;  3CNS A;  1I6Z A;  3UTG A;  4B63 A;  4IST A;  3CN8 A;  3AA1 B;  1Y0P A;  3K7M X;  3BHK A;  4JY2 A;  3BQK A;  3GMB A;  1CUN A;  4Z90 A;  5LGU B;  2MOZ A;  4Y4L A;  2V6Y B;  1E2A A;  4DR3 T;  1HRI 4;  4QH4 A;  3R84 B;  3SGL A;  5KVH A;  1GRG A;  2YU1 A;  3J9X 1;  2WBA A;  3EHZ A;  5LMN T;  1GRB A;  4P0B A;  5ABF B;  4H4Z A;  3HR0 A;  2WCA A;  2F4V T;  3TLU A;  1H6V A;  3RED A;  5HAX A;  3ATR A;  1CC6 A;  1REO A;  3SWH A;  4Q4X 4;  3K3O A;  1BR4 A;  4QX7 B;  4GCM A;  3UKF A;  1DNC A;  1LJ1 A;  3I0Q A;  4MLK A;  3IA3 A;  3N9M A;  4U8I A;  4X1Y E;  2UXD T;  3AA7 B;  2LSG A;  2V6X A;  1U5P A;  2EQ8 A;  2ZMA A;  3NIX A;  2GEW A;  4ZXL A;  2R4J A;  3FBL A;  2M6I A;  4H9S E;  1PDH A;  5HHF A;  1G8X A;  1UKV G;  4ZOL E;  1IJ5 A;  5FXV A;  4H4S A;  2X5I D;  2E2A A;  5L2L A;  3RP8 A;  1R09 4;  4K5S A;  4OPT A;  3V3O A;  4JI0 T;  2X3N A;  4A5X A;  1WR0 A;  3A7M A;  2YQU A;  1Z0P A;  3VR8 A;  1HX8 A;  3DJB A;  1M7K A;  2KZ7 B;  5LGT B;  3CQG B;  3H8I A;  3H3A A;  2VZ2 A;  3RC3 A;  3CNT A;  2X8C A;  3RHA A;  4YWO A;  4TV8 E;  1F3P A;  2JMK A;  3K3Q C;  3FXD B;  1ZP0 A;  2VQB A;  1W9R A;  1FJG T;  5LJM A;  3TKL B;  2BC0 A;  3AE9 A;  4B65 A;  2CHN A;  2J3N A;  4U2Y A;  3UUB A;  3HKC E;  3DGZ A;  4CY6 A;  1T72 A;  4UF0 A;  2HWB 4;  4TM3 A;  2I59 A;  5HWX A;  3ETU A;  4OCG A;  3CNP A;  3CGD A;  4Y4N A;  4IA5 A;  1HNX T;  3SZC A;  4I50 E;  3GWD A;  2C65 A;  1MMG A;  4EGW A;  2MBG A;  2PY5 A;  5KWF A;  4II3 A;  4OVI A;  4JI4 T;  5J1G A;  1S2Y A;  3QB5 A;  1DOD A;  3O9X A;  4OYJ A;  2IW5 B;  3ZYL A;  4BAY B;  2WES A;  2JKC A;  4H4V A;  3A5X A;  3OYZ A;  5H6Q B;  4I4T E;  4UEM A;  1GPE A;  1VQW A;  4L0R A;  2N1G A;  4NPP A;  2HHH T;  4ZCD A;  5FYM A;  4AIU A;  3P9U A;  2WU2 A;  4PJM A;  1SUM B;  2H3R A;  5JH7 E;  2VQE T;  2XQ8 A;  3KPK A;  3AE5 A;  4J57 A;  2VVN A;  1HTJ F;  2WEU A;  3RNM A;  1Z6L A;  1NA1 D;  2X0L B;  2WSS V;  2XSB A;  4X62 T;  4DR5 T;  2TMD A;  3LJP A;  3B5M A;  3O1I A;  4J2W A;  3LSV A;  4QX8 B;  1TYP A;  1MQT D;  3ZT6 A;  4IDP A;  1D4D A;  3UU3 A;  3AEB A;  4OHF A;  2Y48 B;  4PJL A;  4WBO A;  3CVR A;  3GYJ A;  4J33 A;  4ANJ A;  4LFC T;  1PS9 A;  3R6N A;  1WRD A;  3UOZ A;  3LZX A;  2GVC A;  1CJ3 A;  5EK2 A;  4H7U A;  2XAJ B;  4IVO B;  2C5J A;  4QH5 A;  3KV6 A;  1OJA A;  4KUM B;  3NYC A;  2E5V A;  4V1A v;  2X51 A;  2XQ5 A;  5FNV E;  4NEV A;  1GQE A;  3UUN A;  2Q9Q B;  4TV9 E;  3C4X A;  2K24 A;  2OLO A;  2XFU A;  3M65 A;  1UGO A;  3RYC E;  4YTP A;  1PJ7 A;  5FL1 A;  3UKL A;  3AB3 B;  4CY8 A;  2ODU A;  1IBM T;  3QC9 A;  2QGS A;  2GMH A;  2VK9 A;  3Q2M A;  3KVA A;  3EF6 A;  2BG9 B;  2E5L T;  3OBV E;  4OPC A;  2VL0 A;  4C74 A;  2GB0 A;  5AFU L;  3CPH G;  2RMU 4;  3RLF F;  3PVC A;  5JTG A;  2V6Y A;  2V7L A;  2AAQ A;  3L8K A;  1DJQ A;  3L1R A;  3H4K A;  4OPU A;  1JEH A;  3M13 A;  3RKO A;  4U7I A;  4EIQ A;  2JMH A;  2JQ9 A;  4IV9 A;  5EB4 A;  1EBD A;  3RP6 A;  3BK9 A;  3MXZ A;  3GN5 B;  3SZW A;  4Z2R A;  3ZSS A;  5AQI B;  2A3D A;  4A56 A;  2C75 A;  4TWF A;  4NUV A;  4LMK A;  2NTX A;  3PUG A;  1CJ4 A;  3P4W A;  4AKG A;  4Z44 A;  3QUJ A;  3ETV A;  1ZKQ A;  2DI4 A;  1ZK7 A;  1XI1 A;  2YVG A;  3FBS A;  1N32 T;  3EAB A;  3NVO A;  1K4Q A;  1PXC A;  4Z26 A;  2RR1 4;  2AE9 A;  1VOM A;  3ZPO A;  3ZMV B;  1Y56 B;  3PU8 A;  1FEA A;  4PJN A;  2ARD A;  3FIM B;  1L0V A;  3CK6 A;  1TDE A;  2WZH A;  2W67 A;  2LJL A;  3MZK B;  3NTA A;  3LJC A;  2WM9 A;  4HWH A;  2IML A;  4USR A;  5BUL A;  4UEL A;  4A98 A;  1RUE 4;  4O4H E;  1PO1 4;  1UUR A;  1GV4 A;  1K5M D;  3BI5 A;  4JI3 T;  3B6D A;  3BQI A;  2YDS A;  2KIN B;  3LZW A;  2UUB T;  4CN4 A;  2X9W A;  2XTL A;  2PTF A;  4UXN B;  1BR1 A;  4U8L A;  1D1C A;  2XQ3 A;  4C91 A;  3OPC A;  2C66 A;  3M3Z B;  1XNR T;  1NPX A;  4DND A;  2YLS A;  2XQA A;  3BNM A;  3IHR A;  3IWA A;  2YR6 A;  1UX4 A;  4QHO A;  2PFV A;  2L3L A;  2EQ9 A;  4K0U A;  3F8P A;  2BBH A;  3CPZ A;  3GDN A;  2YOE A;  3EI0 A;  3PUQ A;  2DWK A;  2NR4 A;  2UZZ A;  4G73 A;  3AXJ B;  2LE8 A;  1YQ3 A;  4H4T A;  3C98 B;  5J0Z A;  3A8Y C;  1JU2 A;  5KMG P;  3RRW A;  4IE0 A;  4MHC A;  4AIS A;  5JR9 B;  2LSJ A;  2JB2 A;  5LGN B;  2CCQ A;  4U31 A;  2VQ7 A;  4PNI A;  5JCM A;  2YIN A;  3V76 A;  4AXP A;  1BF3 A;  5BUK A;  4P9S A;  2XJ7 A;  4U8N A;  2XZE A;  1EV1 4;  4ZZB A;  1RUD 4;  1VRB A;  4OK0 A;  4ZS3 A;  2RP4 A;  2RGO A;  4NZH A;  5L3E B;  1K0I A;  5L3D B;  2Y6X A;  5FXW A;  2HN2 A;  3QSE A;  4K5R A;  3B3R A;  2RM2 4;  1ASJ 4;  3T1H T;  3DJE A;  4G9K A;  2WET A;  4JNQ A;  5LHI B;  3LBX B;  2ZM2 A;  5L3B B;  4EQS A;  3UU8 A;  3EUH A;  2BKO A;  1E1M A;  1XHZ A;  3KBT A;  2GH5 A;  3CTY A;  4E7S A;  1OOP D;  4DR4 T;  2TPR A;  3SOL A;  5HXS A;  2LHN A;  4UR9 A;  4G74 A;  2B1E A;  2LKH A;  3CGC A;  4LML A;  3Q9T A;  4Q4V 4;  5AQF B;  5LJN A;  2NWB A;  4CNJ A;  4KHP T;  2GV8 A;  1B4V A;  3AEE A;  4HFB A;  1E6E A;  2CWY A;  3O1H A;  1YQ4 A;  4DR7 T;  5CGM A;  5KX5 E;  1X31 B;  3JCF A;  1NDA A;  3OTO T;  3SRZ A;  2UXX B;  3GQK A;  4K2X A;  3P50 A;  2AQJ A;  1TYT A;  2WS3 A;  4I58 A;  4MAL A;  1N1P A;  2LM2 A;  1DOE A;  4HEA A;  4U72 A;  2SPC A;  3GN5 A;  4EOZ B;  1RUC 4;  3TLW A;  2XFP A;  2DLR A;  4IVM B;  3FPZ A;  4ILA A;  1I94 T;  2C3C A;  1KF6 A;  2GQF A;  4DMW A;  2UUA T;  1MXT A;  1S3E A;  1AL2 4;  3V5U A;  5LBQ B;  4X20 E;  3QSS A;  5FP3 A;  5FL0 A;  2CA5 A;  4Z25 A;  3L8R A;  3GYI A;  4DV7 T;  4DO0 A;  3IC9 A;  2CXD A;  3S4U A;  1IUU A;  3SZF A;  3JBG 4;  3RYF E;  1MMD A;  3SM8 A;  5AQM B;  1R8I A;  5KOW A;  4YXD A;  3X1D A;  1GRF A;  1XHC A;  4CXX A;  1MMA A;  1SHZ C;  1GRT A;  1GTE A;  5JVD E;  2E9X B;  3AAE B;  3NKS A;  1E7P A;  5EK4 A;  4AOS A;  4IDN A;  5ABE A;  3C50 A;  3QSM A;  5AQR B;  4GAV A;  4AOX A;  1PIV 4;  2CRB A;  2CXF A;  5ADX L;  4LMJ A;  3IHG A;  4G6H A;  3JAE A;  1DOB A;  2CPT A;  3ZC1 A;  1RUF 4;  4A79 A;  2PYX A;  1HG5 A;  2IVD A;  5FS7 A;  4F6R C;  2R45 A;  5HEO A;  3P4Q A;  3ZMS B;  2P9B A;  3GWH A;  4JEH B;  1HR0 T;  1LV0 A;  3KPF A;  2WMN A;  2V3B A;  3AYJ A;  1AR9 4;  1WFD A;  2RGJ A;  4IHJ E;  1Y64 B;  3UTK A;  3KKJ A;  3QVR A;  3FHN A;  3C4N A;  2BVL A;  1N33 T;  3SUC A;  4TLX A;  4M52 A;  2QA7 A;  3ZC0 A;  4CRT A;  3RHW A;  3N2O A;  5JRC A; 
#chains in the Genus database with same CATH homology
 4YSX A;  2X3N A;  2WPF A;  4J56 A;  4H2Q A;  1MOK A;  5KVI A;  3E1T A;  4GRT A;  4H4U A;  2V6O A;  4J31 A;  1PXB A;  3DGH A;  2YQU A;  4TM0 A;  4A65 A;  1XAN A;  2YWL A;  1IUV A;  2GR3 A;  3VR8 A;  1ELI A;  5EOW A;  4K8D A;  4FX9 A;  3EAN A;  4G6G A;  3H8I A;  1D7Y A;  3UKK A;  4EMI A;  1O95 A;  2BK3 A;  2OLN A;  2VZ2 A;  2YLR A;  1O5W A;  4AP1 A;  3NK2 X;  1FL2 A;  1JRZ A;  3CNT A;  2C67 A;  2X8C A;  4ZCC A;  3RHA A;  1H7X A;  3EPT A;  1F3P A;  2Y6Q A;  3OZ2 A;  4YWO A;  1PJ5 A;  2VQB A;  1ZP0 A;  3AE8 A;  2C3D A;  3P4P A;  3KLJ A;  1H83 A;  2WP9 A;  2BC0 A;  3AE9 A;  1TDN A;  4B65 A;  4A9W A;  2HQM A;  5KMQ A;  2J3N A;  4DGK A;  5LV9 A;  1IUT A;  1F8R A;  3DGZ A;  4CY6 A;  4EMJ A;  1NG4 A;  2YG7 A;  1RP0 A;  4TM3 A;  4OCG A;  1BWC A;  1PN0 A;  3CNP A;  3CGD A;  4Y4N A;  2DKH A;  4IA5 A;  2BC1 A;  2CFY A;  3SZC A;  2WQY A;  3GWD A;  4AP3 A;  2BCP A;  2C65 A;  3SFD A;  2XCG A;  3LOV A;  1B37 A;  4TLZ A;  1EL7 A;  5CQF A;  3T2Z A;  3GRS A;  2JB3 A;  3CNJ A;  4BUR A;  5KWF A;  4II3 A;  4N9X A;  4OVI A;  1ONF A;  4H4Y A;  2APG A;  3VRB A;  5IQ1 A;  3SXI A;  2YAU A;  1GRE A;  1S2Y A;  1S2Q A;  2BAC A;  3R9U A;  4B1B A;  3S61 A;  1DOD A;  4YTM A;  3JSK A;  3AE7 A;  2GRT A;  4CCR A;  1OJD A;  1CJC A;  3COX A;  5J7X A;  2WES A;  3K30 A;  2JKC A;  4H4V A;  3T2Y A;  4DSH A;  1FOH A;  4UDQ A;  2VVM A;  3NK1 X;  1CL0 A;  1GPE A;  4U2L A;  5U25 A;  2GMJ A;  1VQW A;  2CVJ A;  4ZCD A;  3OC4 A;  4EMW A;  2YR4 A;  4AT0 A;  3P4S A;  1N4V A;  3P9U A;  2WU2 A;  2XLT A;  2BXR A;  1CBO A;  2C70 A;  1GTH A;  2QAE A;  4I59 A;  2IID A;  2JB1 A;  3KPK A;  4EQR A;  3AE5 A;  1GT8 A;  4JQ9 A;  2X8G A;  3AE3 A;  4U2S A;  4J57 A;  3NLC A;  2C64 A;  2YLX A;  2DKI A;  2WEU A;  3RNM A;  1NHQ A;  1Z6L A;  2JK6 A;  3AYI A;  1NEK A;  4EQX A;  2GR0 A;  3WE0 A;  1P2E A;  4HB9 A;  3AED A;  3UP5 A;  1QLB A;  2TMD A;  4X4J A;  5J60 A;  2GR2 A;  2XFN A;  1Y56 A;  3LJP A;  1TDF A;  1IUX A;  3FG2 P;  3G5Q A;  1Q1W A;  1TYP A;  2IVE A;  4J2W A;  4U8O A;  4H4X A;  3DME A;  1OJ9 A;  1D4D A;  2WDV A;  2X8H A;  4GDE A;  3AEB A;  2YG6 A;  4IA6 A;  4II2 A;  3HYX A;  4CCQ A;  3DK4 A;  2XVF A;  3GYJ A;  3BNU A;  5CKU A;  4J33 A;  3GQH A;  2A8X A;  2C4C A;  1PS9 A;  2C7G A;  3T0K A;  1OJC A;  4NEW A;  5KOX A;  2B7R A;  3UOZ A;  4BJY A;  4APN A;  5ER0 A;  3LZX A;  3NN6 X;  1SEZ A;  4JDR A;  4CNK A;  2ACZ A;  1KSS A;  2GVC A;  1CJ3 A;  2WOI A;  4H7U A;  1EL8 A;  4IVO B;  3CIR A;  3UKH A;  1OJA A;  2GAG B;  3NYC A;  2X99 A;  2E5V A;  2ZZC A;  1IJH A;  4XWR A;  2Q0L A;  2BRY A;  4EIP A;  4NEV A;  3QFB A;  1PBD A;  2YLT A;  3AEG A;  3DJG X;  2BA9 A;  1E1N A;  1FEC A;  3AE4 A;  1GRH A;  3D1C A;  1VRQ B;  2OLO A;  2XFU A;  4GR1 A;  2VVL A;  4YTP A;  1PJ7 A;  5JCK A;  3UKL A;  4CY8 A;  3G5R A;  5HXI A;  3UOX A;  3I6D A;  3QFA A;  2GMH A;  4NNJ A;  4NTC A;  3ZDN A;  1MO9 A;  2YR5 A;  4J36 A;  5C3J A;  1YKJ A;  3EF6 A;  1H7W A;  4RG4 A;  5FS6 A;  4YSY A;  2X50 A;  3HZL A;  4OPC A;  1NAA A;  4K5S A;  3ALM A;  4C74 A;  2GB0 A;  3CPH G;  1D4E A;  1Q9I A;  5GSN A;  4GUV A;  3PVC A;  3LB8 A;  2AAQ A;  2E4G A;  1BKW A;  1DJQ A;  2R0P A;  1DOC A;  1OJT A;  3L1R A;  3L8K A;  4NTD A;  3H4K A;  1GND A;  1TRB A;  2WPC A;  4OPU A;  4X9M A;  3PS9 A;  1JEH A;  3M13 A;  3GSI A;  2NPX A;  3AWI A;  3NK0 X;  4X9N A;  2YM2 A;  4CBQ A;  4EIQ A;  4H50 A;  4H2R A;  4ECH A;  4IV9 A;  5EB4 A;  5BRT A;  1EBD A;  1N4W A;  4PAB A;  3RP6 A;  3M12 A;  5FMH A;  4B64 A;  3SZW A;  1DJN A;  2VRM A;  4Z2R A;  2WOV A;  2ZBW A;  3BI2 A;  1L9C A;  2C75 A;  5JCL A;  3UKQ A;  2BCG G;  3M0O A;  4UDP A;  3C4A A;  3NTD A;  3AYL A;  2R9Z A;  4BJZ A;  3FMW A;  3LAD A;  5EB5 A;  4BK3 A;  3ABV A;  1CJ4 A;  1DXL A;  1NG3 A;  4K7Z A;  3SQP A;  2YM1 A;  3F8D A;  4Z44 A;  1ZKQ A;  3NH3 X;  1ZK7 A;  2GR1 A;  1B8S A;  2YVG A;  3UOY A;  3DJJ A;  2BS3 A;  3FBS A;  3UP4 A;  1K4Q A;  4JNA A;  4TM1 A;  4YSH A;  1JOA A;  1TDK A;  1JRX A;  1PXC A;  1ZMD A;  4B69 A;  4Z26 A;  1M6I A;  1Y56 B;  4O5U A;  2B76 A;  1FEA A;  2ARD A;  2XLR A;  2Q6U A;  4REK A;  3FIM B;  1L0V A;  1IUW A;  1K0J A;  2Z5Y A;  3DJD A;  1VG9 A;  4EM4 A;  2PHH A;  3C96 A;  1XDI A;  1TDE A;  3ADA B;  2GQW A;  3PO7 A;  1LQT A;  1N4U A;  3KD9 A;  3NTA A;  1PBB A;  5U1O A;  1K0L A;  4USR A;  5BUL A;  1COY A;  2LFC A;  1H84 A;  5JCI A;  3ITJ A;  5U63 A;  3AE1 A;  3UTH A;  3NT6 A;  5FS8 A;  1NHR A;  3NRN A;  1GV4 A;  4FK1 A;  3S5W A;  4KX6 A;  3ICR A;  4RSL A;  3QJ4 A;  2VOU A;  1JNR A;  2WHD A;  3BI5 A;  3UCL A;  1CJ2 A;  1KFY A;  4C77 A;  3B6D A;  1NHP A;  5FS9 A;  2WPE A;  4XWZ A;  3NHO X;  3DK8 A;  3LZW A;  3UKA A;  3SY4 A;  1O94 A;  2EQ6 A;  4YKG A;  3CGB A;  1GRA A;  4H2P A;  4TM4 A;  3GWF A;  4U8J A;  1AOG A;  1B5Q A;  4H4P A;  4ICY A;  3DH9 A;  1TDO A;  2FJD A;  3CMM A;  3DK9 A;  4U8L A;  1IUS A;  4A6N A;  4U8P A;  1CC4 A;  3O0H A;  2V3A A;  4U8K A;  3SZ0 A;  1GXF A;  2YG4 A;  3P1W A;  2R0C A;  1KSU A;  2XFO A;  1JNZ A;  1L9E A;  2CUL A;  4PAA A;  4C3Y A;  2Q7V A;  3VRA A;  2AR8 A;  2C66 A;  3T37 A;  1LQU A;  1NPX A;  2R4E A;  2YLS A;  1E1K A;  4H4R A;  2I0Z A;  2XVE A;  1H81 A;  1HYU A;  2YLZ A;  2V61 A;  3BNM A;  1BGN A;  3IWA A;  1YY5 A;  4GF7 A;  2B9W A;  1CC2 A;  2YR6 A;  3AD8 B;  3T2K A;  4EM3 A;  3ICS A;  2GF3 A;  3GDP A;  4MJW A;  1GAL A;  3DA1 A;  5KMS A;  5M10 A;  1ZDL A;  5IQ4 A;  2EQ9 A;  4H2N A;  3RP7 A;  1LVL A;  2B9Y A;  1W4X A;  3F8P A;  3VQR A;  3BHF A;  2EQ7 A;  3GDN A;  4U8M A;  2WDR A;  2YVF A;  4B68 A;  4G73 A;  1EL5 A;  2UZZ A;  2YG3 A;  4D03 A;  4EQW A;  1YQ3 A;  2XVI A;  4DNA A;  1PJ6 A;  4H4T A;  2YLW A;  4A5L A;  3AEA A;  3VR9 A;  3AEC A;  2H88 A;  4LII A;  1JU2 A;  3G5S A;  4GAP A;  1VG0 A;  2C76 A;  2JAE A;  2VRL A;  1PBF A;  2R46 A;  4J34 A;  1RSG A;  4A7A A;  2YVJ A;  4JY3 A;  1CF3 A;  2JB2 A;  4KPR A;  5IPY A;  2W0H A;  1QO8 A;  4OPI A;  2VQ7 A;  3AE6 A;  3KVE A;  4D04 A;  4WX1 A;  5JCM A;  1NHS A;  1ZY8 A;  1M64 A;  3EAO A;  3V76 A;  5HYM A;  1BF3 A;  2WU5 A;  5BUK A;  2GAH B;  3D8X A;  3ICT A;  2XDO A;  3I3L A;  3K7Q X;  4O5Q A;  4B66 A;  2V5Z A;  4P9S A;  2YG5 A;  4HA6 A;  4U8N A;  3ZYX A;  3II4 A;  1GES A;  3BI4 A;  3F8R A;  3AD9 B;  4BK1 A;  2RGO A;  4LU6 A;  4JN9 A;  4NZH A;  4A99 A;  1K0I A;  4Z24 A;  3UKP A;  1F8S A;  3KA7 A;  5KNL A;  1YQZ A;  3QVP A;  4YSZ A;  3QSE A;  4K5R A;  3B3R A;  2Y6R A;  1H82 A;  3LXD A;  2CDU A;  1KNR A;  3GRT A;  5BVA A;  3AEF A;  2OAM A;  4DSG A;  3DJE A;  4YTN A;  4G9K A;  4LA1 A;  2RGH A;  4OPD A;  2WET A;  1P2H A;  4JNQ A;  5JCN A;  1E39 A;  3KU9 A;  4EQS A;  4FDC B;  4OPG A;  5KRQ A;  2XYO A;  1ZOV A;  4YT0 A;  3P4R A;  1E1M A;  2VVL G;  2BRA A;  2GH5 A;  4OPL A;  3CTY A;  3CPJ G;  3Q6J A;  2TPR A;  4G74 A;  3NN0 X;  1KDG A;  3CGC A;  3HYW A;  2BS4 A;  4A6N B;  3Q9T A;  2C73 A;  2NVK X;  1BZL A;  1XPQ A;  4CNJ A;  2C72 A;  2GV8 A;  1B4V A;  5KMR A;  1PBC A;  4FK1 C;  3AEE A;  1D7L A;  2OA1 A;  4UP3 A;  1KNP A;  3T31 A;  2A89 A;  1E6E A;  2R0G A;  1F8W A;  1H86 A;  2ZZB A;  2BAB A;  3SFE A;  2Z5X A;  1YQ4 A;  1FCD A;  1X31 B;  2QA1 A;  2WP6 A;  1VDC A;  3V3N A;  1NDA A;  2WOW A;  1E1L A;  4GDP A;  4H4Q A;  5KMP A;  3H8L A;  4BK2 A;  1V59 A;  2Q0K A;  3GD4 A;  5TR3 A;  2FJE A;  3SYI A;  2RAB A;  5L46 A;  2E1M A;  3IF9 A;  1GER A;  2FJA A;  3GQK A;  4K2X A;  1LPF A;  2AQJ A;  2XVJ A;  3ALJ A;  3NYE A;  1TYT A;  1F6M A;  2XLS A;  3AB1 A;  2WS3 A;  4I58 A;  1EL9 A;  4Y4M A;  3GMC A;  1N1P A;  3NG7 X;  4C3X A;  1DOE A;  1GET A;  4B67 A;  5DBJ A;  2BK5 A;  2XFP A;  2BXS A;  4IVM B;  1PHH A;  3CND A;  3FPZ A;  3NGC X;  5GRT A;  1GSN A;  1QJD A;  3UTF A;  1GOS A;  2C3C A;  3UTE A;  2BYB A;  4C5O A;  3GD3 A;  1CHU A;  3CNS A;  1KF6 A;  5HY5 A;  2GQF A;  5C2T A;  3T14 A;  3UTG A;  3CN8 A;  3K7M X;  1Y0P A;  4NWZ A;  1MXT A;  1S3E A;  2QCU A;  4B63 A;  2O9Z A;  2FBW A;  2WDQ A;  3BHK A;  2B9X A;  4JY2 A;  3QSS A;  3SX6 A;  4RG3 A;  3GMB A;  2JBV A;  4Z25 A;  3GYI A;  3UOV A;  3K7T A;  4Z2U A;  3AE2 A;  1L9D A;  3IC9 A;  4XXG A;  2V60 A;  4WCT A;  1IUU A;  3HYV A;  1BGJ A;  4YKF A;  4USQ A;  2WP5 A;  4Y4L A;  3NYF A;  3SZF A;  4E0V A;  1Q1R A;  3SGL A;  5KXJ A;  1RYI A;  3ISH A;  3AXB A;  3SM8 A;  4ADW A;  1GRG A;  5KVH A;  2BS2 A;  2FJB A;  5KOW A;  4YXD A;  2WBA A;  4NTE A;  1GRF A;  3ATQ A;  1GRB A;  1XHC A;  1LTX R;  4H4Z A;  3URH A;  4H4W A;  3CGE A;  2ZZ0 A;  4K22 A;  4Z2T A;  1GTE A;  1FEB A;  1GRT A;  3VRD B;  1H6V A;  1NEN A;  1D5T A;  3NKS A;  3RED A;  1E7P A;  4AOS A;  3ALL A;  3QSM A;  2OAL A;  4GAV A;  3ATR A;  2XLU A;  5M0Z A;  1CC6 A;  4AOX A;  3AD7 B;  1REO A;  2H89 A;  3IHG A;  4G6H A;  4GCM A;  3UKF A;  1DNC A;  1LJ1 A;  2B7S A;  1DOB A;  1ZMC A;  3CPI G;  2XLP A;  1D4C A;  4A79 A;  2PYX A;  4U2T A;  1GEU A;  2IVD A;  5FS7 A;  4AT2 A;  4U8I A;  2R45 A;  4BV6 A;  2QA2 A;  2EQ8 A;  3P4Q A;  1S3B A;  3NIX A;  4Z43 A;  2GEW A;  4ZN0 A;  3KPF A;  2R4J A;  1LV0 A;  3AYJ A;  2V3B A;  3GYX A;  1PDH A;  2RGJ A;  5HHF A;  1UKV G;  3KKJ A;  1ZOY A;  1PXA A;  3QVR A;  4H4S A;  3IHM A;  3C4N A;  2BK4 A;  3SUC A;  4TLX A;  2XVH A;  4M52 A;  1ZX9 A;  2A87 A;  4UDR A;  5EBK A;  2XFQ A;  1JRY A;  3NNE A;  3RP8 A;  4CRT A;  1PBE A;  4OPT A;  3V3O A;  2F5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...