The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
86
|
structure length |
86
|
Chain Sequence |
TPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNIT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Outer Membrane Protein Rcsf, a New Substrate for the Periplasmic Protein- Disulfide Isomerase Dsbc.
pubmed doi rcsb |
molecule tags |
Membrane protein
|
source organism |
Escherichia coli
|
molecule keywords |
PUTATIVE OUTER MEMBRANE PROTEIN, SIGNAL
|
total genus |
24
|
structure length |
86
|
sequence length |
86
|
ec nomenclature | |
pdb deposition date | 2010-12-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF16358 | RcsF | RcsF lipoprotein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Hypothetical protein apc22750. Chain B |
#chains in the Genus database with same CATH superfamily 1Y2I A; 1VR4 A; 2GTC A; 3QKB A; 2Y1B A; 2L8Y A; #chains in the Genus database with same CATH topology 1H4Q A; 3ZIE A; 4EO0 A; 1VM0 A; 2CRQ A; 2GTC A; 3QKB A; 3WBM A; 4K87 A; 4FBQ A; 3ZIH A; 4FBW A; 4NCX A; 4YKE A; 3TOE A; 1NJ5 A; 1II7 A; 1H0Y A; 2IFE A; 1JO0 A; 3TTD A; 1Y9X A; 4TWA A; 4FCX A; 1HC7 A; 1NJ8 A; 4HVC A; 3TTC A; 1NJ2 A; 3IAL A; 4OLF A; 2M71 A; 4K88 A; 4HVZ A; 4Q15 A; 4WI1 A; 4NZR M; 1LN4 A; 2EK0 A; 4FBK A; 1NJ6 A; 2A2Y A; 3P04 A; 2LN3 A; 2Z7C A; 3TSQ A; 3TTF A; 3IAB A; 2EH1 A; 3LVJ C; 3TSU A; 2L8Y A; 2P9B A; 1RQ8 A; 1TIG A; 3ZII A; 1Y2I A; 1DCJ A; 1VR4 A; 1H4S A; 3ZIG A; 1S8E A; 2Q3V A; 2Y1B A; 3DSC A; 3DSD A; 1PAV A; 1NFJ A; 1JE3 A; 1JDQ A; 2H9U A; 4K86 A; 3TSP A; 4Z9E A; 1XEZ A; 3T1I A; 4NZT M; 3U6Y A; 1UDV A; 1NJ1 A; 1NH9 A; 1H4T A; 3VTI A; 1NFH A; 2BKY X; 4HD0 A; 3VTH A; 3HZ7 A; 3IAB B; 4YDQ A; 2LXR A; 3LVK B; 1H0X A; #chains in the Genus database with same CATH homology 1Y2I A; 1VR4 A; 2GTC A; 3QKB A; 2Y1B A; 2L8Y A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...