The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
76
|
structure length |
76
|
Chain Sequence |
LFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLPYRYLIRK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions.
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Escherichia coli
|
molecule keywords |
Cysteine desulfurase
|
total genus |
21
|
structure length |
76
|
sequence length |
76
|
ec nomenclature | |
pdb deposition date | 2010-02-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF01206 | TusA | Sulfurtransferase TusA |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | TusA-like domain |
#chains in the Genus database with same CATH superfamily 1JDQ A; 1PAV A; 1DCJ A; 2LXR A; 1JE3 A; 3HZ7 A; 3LVK B; 3LVJ C; #chains in the Genus database with same CATH topology 2EK0 A; 4K86 A; 2A2Y A; 3DSD A; 4HVZ A; 1II7 A; 1H0X A; 4Q15 A; 3TSQ A; 1H0Y A; 3DSC A; 1DCJ A; 3TSP A; 1HC7 A; 1NJ8 A; 2IFE A; 2CRQ A; 3HZ7 A; 3TTD A; 3LVK B; 3P04 A; 1PAV A; 4NCX A; 3TTC A; 4WI1 A; 3VTI A; 1TIG A; 3IAB B; 1JE3 A; 1NFH A; 4TWA A; 2LXR A; 1RQ8 A; 1NJ6 A; 4EO0 A; 4FCX A; 4FBW A; 1VR4 A; 1UDV A; 2L8Y A; 4NZT M; 1JO0 A; 4K87 A; 3TSU A; 3LVJ C; 3U6Y A; 2Q3V A; 3WBM A; 2P9B A; 1NJ5 A; 3ZIE A; 1H4T A; 1NJ1 A; 3IAL A; 4HD0 A; 4NZR M; 2LN3 A; 3IAB A; 4FBQ A; 4YDQ A; 4HVC A; 1NFJ A; 2H9U A; 3ZII A; 1H4Q A; 4K88 A; 3VTH A; 1Y9X A; 2M71 A; 4Z9E A; 1LN4 A; 1VM0 A; 2EH1 A; 3ZIH A; 1NJ2 A; 3ZIG A; 1Y2I A; 1H4S A; 3QKB A; 1JDQ A; 2Y1B A; 1XEZ A; 4FBK A; 2Z7C A; 1S8E A; 3TTF A; 1NH9 A; 2BKY X; 4YKE A; 4OLF A; 3TOE A; 2GTC A; 3T1I A; #chains in the Genus database with same CATH homology 1JDQ A; 1PAV A; 1DCJ A; 2LXR A; 1JE3 A; 3HZ7 A; 3LVK B; 3LVJ C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...