The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
77
|
structure length |
77
|
Chain Sequence |
SYQSTIVPVELHSFEDAQVIGGAFRDGDAVVFDMSLLSREEARRIVDFAAGLCFALHGKMQKIDSVTFAVVPELSNI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the BCR protein from Corynebacterium glutamicum. Northeast Structural Genomics Consortium Target CgR8.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Corynebacterium glutamicum
|
molecule keywords |
Uncharacterized BCR
|
total genus |
17
|
structure length |
77
|
sequence length |
77
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-09-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04472 | SepF | Cell division protein SepF |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Translation Initiation Factor IF3 |
#chains in the Genus database with same CATH superfamily 3ZII A; 3P04 A; 3ZIE A; 3ZIG A; 3ZIH A; #chains in the Genus database with same CATH topology 4K86 A; 3ZIE A; 3TTF A; 1JDQ A; 2LN3 A; 3DSC A; 3T1I A; 3ZIG A; 4YKE A; 4EO0 A; 1NH9 A; 1TIG A; 4TWA A; 1VM0 A; 4NZR M; 3WBM A; 1LN4 A; 2EH1 A; 3TTD A; 3QKB A; 3IAL A; 3ZII A; 2L8Y A; 3TSQ A; 1NFJ A; 2P9B A; 3LVJ C; 4K88 A; 2M71 A; 4Q15 A; 2GTC A; 3VTH A; 4FBK A; 3LVK B; 1H0X A; 1Y2I A; 3ZIH A; 3P04 A; 1NJ2 A; 4YDQ A; 1NJ5 A; 2A2Y A; 4OLF A; 3TOE A; 3IAB A; 2Q3V A; 4FBQ A; 1H4S A; 4HD0 A; 1NJ8 A; 2IFE A; 1JE3 A; 2LXR A; 1Y9X A; 4NZT M; 1S8E A; 1PAV A; 1RQ8 A; 4WI1 A; 1H4T A; 4Z9E A; 1UDV A; 4FCX A; 3DSD A; 4HVC A; 1HC7 A; 4HVZ A; 3HZ7 A; 3TSU A; 2EK0 A; 1XEZ A; 1VR4 A; 2CRQ A; 4K87 A; 1DCJ A; 2Y1B A; 2Z7C A; 3TSP A; 1H4Q A; 3VTI A; 1NFH A; 1JO0 A; 1NJ1 A; 3TTC A; 1H0Y A; 4NCX A; 2BKY X; 1NJ6 A; 2H9U A; 3IAB B; 3U6Y A; 4FBW A; 1II7 A; #chains in the Genus database with same CATH homology 3ZII A; 3TSQ A; 3ZIE A; 2P9B A; 3TTF A; 2LN3 A; 3T1I A; 3ZIG A; 4YKE A; 4NZT M; 4EO0 A; 3VTH A; 4FBK A; 3TSP A; 3VTI A; 3ZIH A; 3P04 A; 4FCX A; 3TTC A; 4NZR M; 4HVZ A; 3TSU A; 1XEZ A; 3TTD A; 4FBW A; 4FBQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...