The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
82
|
structure length |
82
|
Chain Sequence |
SSKVVLSEPRVYAEAQEIADHLKNRRAVVVNLQRIQHDQAKRIVDFLSKTVYAIGGDIQRIGSDIFLCTPDNVDVSGTISEL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and Genetic Analyses Reveal the Protein Sepf as a New Membrane Anchor for the Z Ring.
pubmed doi rcsb |
| molecule keywords |
CELL DIVISION PROTEIN SEPF
|
| molecule tags |
Cell cycle
|
| source organism |
Bacillus subtilis
|
| total genus |
19
|
| structure length |
82
|
| sequence length |
82
|
| ec nomenclature | |
| pdb deposition date | 2013-01-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04472 | SepF | Cell division protein SepF |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Translation Initiation Factor IF3 |
#chains in the Genus database with same CATH superfamily 3P04 A; 3ZIG A; 3ZII A; 3ZIH A; 3ZIE A; #chains in the Genus database with same CATH topology 2H9U A; 2LN3 A; 4Q15 A; 3IAB B; 2P9B A; 1LN4 A; 3TSU A; 4WI1 A; 2LXR A; 2Y1B A; 4FBW A; 1XEZ A; 4YKE A; 4EO0 A; 1RQ8 A; 3ZIH A; 3DSC A; 1Y9X A; 4K86 A; 3ZIE A; 1H4S A; 1HC7 A; 3WBM A; 1H0Y A; 1H4T A; 1JE3 A; 1PAV A; 1NJ2 A; 2EH1 A; 4HVC A; 3ZII A; 3TTF A; 4FBQ A; 4FBK A; 1DCJ A; 4TWA A; 2Z7C A; 3ZIG A; 1NFJ A; 1JDQ A; 2EK0 A; 1TIG A; 3LVK B; 1II7 A; 3TSQ A; 2GTC A; 4NZT M; 1H4Q A; 2M71 A; 4HD0 A; 3VTH A; 3VTI A; 3QKB A; 1Y2I A; 1S8E A; 3TSP A; 3HZ7 A; 3IAB A; 1VM0 A; 4YDQ A; 3TOE A; 1NH9 A; 3DSD A; 4HVZ A; 1NJ6 A; 2BKY X; 2CRQ A; 3TTC A; 4OLF A; 1JO0 A; 1NJ5 A; 1NJ8 A; 1VR4 A; 3T1I A; 1H0X A; 2IFE A; 2L8Y A; 3P04 A; 4NZR M; 2A2Y A; 3LVJ C; 3TTD A; 1NFH A; 4FCX A; 4K87 A; 1UDV A; 3IAL A; 4K88 A; 2Q3V A; 4NCX A; 3U6Y A; 1NJ1 A; 4Z9E A; #chains in the Genus database with same CATH homology 3TTC A; 3TSQ A; 4NZT M; 2LN3 A; 3T1I A; 3P04 A; 3VTH A; 3VTI A; 2P9B A; 4NZR M; 3TSP A; 3TSU A; 3TTD A; 3ZII A; 3TTF A; 4FBQ A; 4FBW A; 4FBK A; 1XEZ A; 4FCX A; 4YKE A; 4HVZ A; 3ZIG A; 4EO0 A; 3ZIH A; 3ZIE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...