1AIQA

Crystal structure of thymidylate synthase r126e mutant
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSERIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a marginally active thymidylate synthase mutant, Arg 126-->Glu.
pubmed rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Escherichia coli
total genus 86
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1997-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1aiqA00
2TSCA 3H9KA 3HBBA 4ISKA 4FOXA 3UWLB 1THYA 3EHIX 3UWLA 1JUJA 3IK0A 5J7WA 1FFLA 1BKPA 1TVWA 1TSVA 5HS3A 3BNZA 1BP6A 1VZDA 1KZJA 4ISWA 4KY4A 4DPDA 1BO7A 3IRMA 4FOGA 1HW3A 4E5OA 4DPHA 1NJBA 3EBUA 4EB4A 1EV8A 4DQ1A 3QG2A 1F4EA 3B9HA 2G89A 3OB7A 4GEVA 4KNZA 3C06A 3IX6A 1B5DA 1TSNA 1TSMA 4H0RA 1TLSA 4H0UA 1TVVA 1B49A 4Q0DA 1F28A 4O1XA 1I00A 2A9WA 1NCEA 2VETA 3IHIA 2G86A 4UP1A 1TVUA 3CLBA 1TSWA 4XSEA 4JEFA 1BQ1A 1LCAA 1BSPA 2TDDA 3BHRA 3DGAC 1YPVA 3EJLA 3GG5A 5FCTA 3IJZA 1VZAA 1AOBA 1BSFA 1JMHA 4EINA 3KJRA 1FWMA 1TJSA 3INVA 4TMSA 3QGTA 3KGBA 1KZIA 1VZBA 3BZ0A 1BO8A 1F4FA 3HJ3A 3TMSA 3DG8C 3BYXA 4XSDA 1BIDA 3HB8A 4ECKA 1F4DA 1TYSA 4Q0EA 4KYAA 1JMIA 3N5EB 3N5EA 3EGYX 5H39A 2G8DA 3QJ7A 3CL9A 3I3RA 4EZ8A 3NRRA 1JTQA 2RD8A 3EDWX 1B02A 3KJSA 3ED7A 4PSGA 4F2VA 1TDAA 2G8XA 2RDAA 1JUTA 3B5BA 4KPWA 4FGTA 1ZPRA 4LRRA 3BHLA 1SYNA 1F4GA 3UM8A 3BFIA 1AN5A 1BQ2A 1NJCA 1JU6A 1TDCA 1EVFA 3EF9A 1JMGA 1JMFA 4IQQA 5H3AA 1BKOA 4IQBA 1BJGA 1F4CA 1TISA 2AAZA 2BBQA 1VZCA 1LCEA 2ONBA 2VF0A 1AIQA 3EAWX 3N5GA 1EV5A 2KCEA 1F4BA 4FOAA 4O7UA 3GH0A 1TSLA 1TDBA 1TSYA 1LCBA 1B5EA 1DNAA 3K2HA 4EILA 2FTNA 4IRRA 4FQSA 4E28A 4GD7A 1EVGA 1TSXA 5H38A 1TLCA 3DL5A 1AXWA 3IRNA 1HW4A 1VZEA 1NJAA 4XSCA 4O1XD 1AJMA 4H1IA 1JTUA 2H2QA 3DL6A 1TSDA 4G2OX 3JSUA 1QZFA 3UM6A 1QQQA 3IK1A 4O1UA 4GYHA 1RTSA 4G6WX 1SEJA 5BY6A 3UM5A 1BDUA 1BPJA 3IROA 4DP3A 2TDMA 3V8HA 1HZWA 1BP0A 1CI7A 3GH2X 2FTOX 1J3KC 2TSRA 2G8AA 1TSZA 1J3IC 1HVYA 1J3JC 1KCEA 2FTQA 1NJDA 1JG0A 1TDUA 1NJEA 5WRNA 4KY8A 3C0AA 1TRGA 2RD8B 2OIPA 1DDUA 3BGXA
chains in the Genus database with same CATH superfamily
2TSCA 3H9KA 3HBBA 4ISKA 4FOXA 3UWLB 1THYA 3EHIX 3UWLA 1JUJA 3IK0A 5J7WA 1FFLA 1BKPA 1TVWA 1TSVA 5HS3A 3BNZA 1BP6A 1VZDA 1KZJA 4ISWA 4KY4A 4DPDA 1BO7A 3IRMA 4FOGA 1HW3A 4E5OA 4DPHA 1NJBA 3EBUA 4EB4A 1EV8A 4DQ1A 3QG2A 1F4EA 3B9HA 2G89A 3OB7A 4GEVA 4KNZA 3C06A 3IX6A 1B5DA 1TSNA 1TSMA 4H0RA 1TLSA 4H0UA 1TVVA 1B49A 4Q0DA 1F28A 4O1XA 1I00A 2A9WA 1NCEA 2VETA 3IHIA 2G86A 4UP1A 1TVUA 3CLBA 1TSWA 4XSEA 4JEFA 1BQ1A 1LCAA 1BSPA 2TDDA 3BHRA 3DGAC 1YPVA 3EJLA 3GG5A 5FCTA 3IJZA 1VZAA 1AOBA 1BSFA 1JMHA 4EINA 3KJRA 1FWMA 1TJSA 3INVA 4TMSA 3QGTA 3KGBA 1KZIA 1VZBA 3BZ0A 1BO8A 1F4FA 3HJ3A 3TMSA 3DG8C 3BYXA 4XSDA 1BIDA 3HB8A 4ECKA 1F4DA 1TYSA 4Q0EA 4KYAA 1JMIA 3N5EB 3N5EA 3EGYX 5H39A 2G8DA 3QJ7A 3CL9A 3I3RA 4EZ8A 3NRRA 1JTQA 2RD8A 3EDWX 1B02A 3KJSA 3ED7A 4PSGA 4F2VA 1TDAA 2G8XA 2RDAA 1JUTA 3B5BA 4KPWA 4FGTA 1ZPRA 4LRRA 3BHLA 1SYNA 1F4GA 3UM8A 3BFIA 1AN5A 1BQ2A 1NJCA 1JU6A 1TDCA 1EVFA 3EF9A 1JMGA 1JMFA 4IQQA 5H3AA 1BKOA 4IQBA 1BJGA 1F4CA 1TISA 2AAZA 2BBQA 1VZCA 1LCEA 2ONBA 2VF0A 1AIQA 3EAWX 3N5GA 1EV5A 2KCEA 1F4BA 4FOAA 4O7UA 3GH0A 1TSLA 1TDBA 1TSYA 1LCBA 1B5EA 1DNAA 3K2HA 4EILA 2FTNA 4IRRA 4FQSA 4E28A 4GD7A 1EVGA 1TSXA 5H38A 1TLCA 3DL5A 1AXWA 3IRNA 1HW4A 1VZEA 1NJAA 4XSCA 4O1XD 1AJMA 4H1IA 1JTUA 2H2QA 3DL6A 1TSDA 4G2OX 3JSUA 1QZFA 3UM6A 1QQQA 3IK1A 4O1UA 4GYHA 1RTSA 4G6WX 1SEJA 5BY6A 3UM5A 1BDUA 1BPJA 3IROA 4DP3A 2TDMA 3V8HA 1HZWA 1BP0A 1CI7A 3GH2X 2FTOX 1J3KC 2TSRA 2G8AA 1TSZA 1J3IC 1HVYA 1J3JC 1KCEA 2FTQA 1NJDA 1JG0A 1TDUA 1NJEA 5WRNA 4KY8A 3C0AA 1TRGA 2RD8B 2OIPA 1DDUA 3BGXA
chains in the Genus database with same CATH topology
2TSCA 3H9KA 3HBBA 4ISKA 4FOXA 3UWLB 1THYA 3EHIX 3UWLA 1JUJA 3IK0A 5J7WA 1FFLA 1BKPA 1TVWA 1TSVA 5HS3A 3BNZA 1BP6A 1VZDA 1KZJA 4ISWA 4KY4A 4DPDA 1BO7A 3IRMA 4FOGA 1HW3A 4E5OA 4DPHA 1NJBA 3EBUA 4EB4A 1EV8A 4DQ1A 3QG2A 1F4EA 3B9HA 2G89A 3OB7A 4GEVA 4KNZA 3C06A 3IX6A 1B5DA 1TSNA 1TSMA 4H0RA 1TLSA 4H0UA 1TVVA 1B49A 4Q0DA 1F28A 4O1XA 1I00A 2A9WA 1NCEA 2VETA 3IHIA 2G86A 4UP1A 1TVUA 3CLBA 1TSWA 4XSEA 4JEFA 1BQ1A 1LCAA 1BSPA 2TDDA 3BHRA 3DGAC 1YPVA 3EJLA 3GG5A 5FCTA 3IJZA 1VZAA 1AOBA 1BSFA 1JMHA 4EINA 3KJRA 1FWMA 1TJSA 3INVA 4TMSA 3QGTA 3KGBA 1KZIA 1VZBA 3BZ0A 1BO8A 1F4FA 3HJ3A 3TMSA 3DG8C 3BYXA 4XSDA 1BIDA 3HB8A 4ECKA 1F4DA 1TYSA 4Q0EA 4KYAA 1JMIA 3N5EB 3N5EA 3EGYX 5H39A 2G8DA 3QJ7A 3CL9A 3I3RA 4EZ8A 3NRRA 1JTQA 2RD8A 3EDWX 1B02A 3KJSA 3ED7A 4PSGA 4F2VA 1TDAA 2G8XA 2RDAA 1JUTA 3B5BA 4KPWA 4FGTA 1ZPRA 4LRRA 3BHLA 1SYNA 1F4GA 3UM8A 3BFIA 1AN5A 1BQ2A 1NJCA 1JU6A 1TDCA 1EVFA 3EF9A 1JMGA 1JMFA 4IQQA 5H3AA 1BKOA 4IQBA 1BJGA 1F4CA 1TISA 2AAZA 2BBQA 1VZCA 1LCEA 2ONBA 2VF0A 1AIQA 3EAWX 3N5GA 1EV5A 2KCEA 1F4BA 4FOAA 4O7UA 3GH0A 1TSLA 1TDBA 1TSYA 1LCBA 1B5EA 1DNAA 3K2HA 4EILA 2FTNA 4IRRA 4FQSA 4E28A 4GD7A 1EVGA 1TSXA 5H38A 1TLCA 3DL5A 1AXWA 3IRNA 1HW4A 1VZEA 1NJAA 4XSCA 4O1XD 1AJMA 4H1IA 1JTUA 2H2QA 3DL6A 1TSDA 4G2OX 3JSUA 1QZFA 3UM6A 1QQQA 3IK1A 4O1UA 4GYHA 1RTSA 4G6WX 1SEJA 5BY6A 3UM5A 1BDUA 1BPJA 3IROA 4DP3A 2TDMA 3V8HA 1HZWA 1BP0A 1CI7A 3GH2X 2FTOX 1J3KC 2TSRA 2G8AA 1TSZA 1J3IC 1HVYA 1J3JC 1KCEA 2FTQA 1NJDA 1JG0A 1TDUA 1NJEA 5WRNA 4KY8A 3C0AA 1TRGA 2RD8B 2OIPA 1DDUA 3BGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TSC A;  3H9K A;  3HBB A;  4ISK A;  4FOX A;  3UWL B;  1THY A;  3EHI X;  3UWL A;  1JUJ A;  3IK0 A;  5J7W A;  1FFL A;  1BKP A;  1TVW A;  1TSV A;  5HS3 A;  3BNZ A;  1BP6 A;  1VZD A;  1KZJ A;  4ISW A;  4KY4 A;  4DPD A;  1BO7 A;  3IRM A;  4FOG A;  1HW3 A;  4E5O A;  4DPH A;  1NJB A;  3EBU A;  4EB4 A;  1EV8 A;  4DQ1 A;  3QG2 A;  1F4E A;  3B9H A;  2G89 A;  3OB7 A;  4GEV A;  4KNZ A;  3C06 A;  3IX6 A;  1B5D A;  1TSN A;  1TSM A;  4H0R A;  1TLS A;  4H0U A;  1TVV A;  1B49 A;  4Q0D A;  1F28 A;  4O1X A;  1I00 A;  2A9W A;  1NCE A;  2VET A;  3IHI A;  2G86 A;  4UP1 A;  1TVU A;  3CLB A;  1TSW A;  4XSE A;  4JEF A;  1BQ1 A;  1LCA A;  1BSP A;  2TDD A;  3BHR A;  3DGA C;  1YPV A;  3EJL A;  3GG5 A;  5FCT A;  3IJZ A;  1VZA A;  1AOB A;  1BSF A;  1JMH A;  4EIN A;  3KJR A;  1FWM A;  1TJS A;  3INV A;  4TMS A;  3QGT A;  3KGB A;  1KZI A;  1VZB A;  3BZ0 A;  1BO8 A;  1F4F A;  3HJ3 A;  3TMS A;  3DG8 C;  3BYX A;  4XSD A;  1BID A;  3HB8 A;  4ECK A;  1F4D A;  1TYS A;  4Q0E A;  4KYA A;  1JMI A;  3N5E B;  3N5E A;  3EGY X;  5H39 A;  2G8D A;  3QJ7 A;  3CL9 A;  3I3R A;  4EZ8 A;  3NRR A;  1JTQ A;  2RD8 A;  3EDW X;  1B02 A;  3KJS A;  3ED7 A;  4PSG A;  4F2V A;  1TDA A;  2G8X A;  2RDA A;  1JUT A;  3B5B A;  4KPW A;  4FGT A;  1ZPR A;  4LRR A;  3BHL A;  1SYN A;  1F4G A;  3UM8 A;  3BFI A;  1AN5 A;  1BQ2 A;  1NJC A;  1JU6 A;  1TDC A;  1EVF A;  3EF9 A;  1JMG A;  1JMF A;  4IQQ A;  5H3A A;  1BKO A;  4IQB A;  1BJG A;  1F4C A;  1TIS A;  2AAZ A;  2BBQ A;  1VZC A;  1LCE A;  2ONB A;  2VF0 A;  1AIQ A;  3EAW X;  3N5G A;  1EV5 A;  2KCE A;  1F4B A;  4FOA A;  4O7U A;  3GH0 A;  1TSL A;  1TDB A;  1TSY A;  1LCB A;  1B5E A;  1DNA A;  3K2H A;  4EIL A;  2FTN A;  4IRR A;  4FQS A;  4E28 A;  4GD7 A;  1EVG A;  1TSX A;  5H38 A;  1TLC A;  3DL5 A;  1AXW A;  3IRN A;  1HW4 A;  1VZE A;  1NJA A;  4XSC A;  4O1X D;  1AJM A;  4H1I A;  1JTU A;  2H2Q A;  3DL6 A;  1TSD A;  4G2O X;  3JSU A;  1QZF A;  3UM6 A;  1QQQ A;  3IK1 A;  4O1U A;  4GYH A;  1RTS A;  4G6W X;  1SEJ A;  5BY6 A;  3UM5 A;  1BDU A;  1BPJ A;  3IRO A;  4DP3 A;  2TDM A;  3V8H A;  1HZW A;  1BP0 A;  1CI7 A;  3GH2 X;  2FTO X;  1J3K C;  2TSR A;  2G8A A;  1TSZ A;  1J3I C;  1HVY A;  1J3J C;  1KCE A;  2FTQ A;  1NJD A;  1JG0 A;  1TDU A;  1NJE A;  5WRN A;  4KY8 A;  3C0A A;  1TRG A;  2RD8 B;  2OIP A;  1DDU A;  3BGX A; 
#chains in the Genus database with same CATH topology
 2TSC A;  3H9K A;  3HBB A;  4ISK A;  4FOX A;  3UWL B;  1THY A;  3EHI X;  3UWL A;  1JUJ A;  3IK0 A;  5J7W A;  1FFL A;  1BKP A;  1TVW A;  1TSV A;  5HS3 A;  3BNZ A;  1BP6 A;  1VZD A;  1KZJ A;  4ISW A;  4KY4 A;  4DPD A;  1BO7 A;  3IRM A;  4FOG A;  1HW3 A;  4E5O A;  4DPH A;  1NJB A;  3EBU A;  4EB4 A;  1EV8 A;  4DQ1 A;  3QG2 A;  1F4E A;  3B9H A;  2G89 A;  3OB7 A;  4GEV A;  4KNZ A;  3C06 A;  3IX6 A;  1B5D A;  1TSN A;  1TSM A;  4H0R A;  1TLS A;  4H0U A;  1TVV A;  1B49 A;  4Q0D A;  1F28 A;  4O1X A;  1I00 A;  2A9W A;  1NCE A;  2VET A;  3IHI A;  2G86 A;  4UP1 A;  1TVU A;  3CLB A;  1TSW A;  4XSE A;  4JEF A;  1BQ1 A;  1LCA A;  1BSP A;  2TDD A;  3BHR A;  3DGA C;  1YPV A;  3EJL A;  3GG5 A;  5FCT A;  3IJZ A;  1VZA A;  1AOB A;  1BSF A;  1JMH A;  4EIN A;  3KJR A;  1FWM A;  1TJS A;  3INV A;  4TMS A;  3QGT A;  3KGB A;  1KZI A;  1VZB A;  3BZ0 A;  1BO8 A;  1F4F A;  3HJ3 A;  3TMS A;  3DG8 C;  3BYX A;  4XSD A;  1BID A;  3HB8 A;  4ECK A;  1F4D A;  1TYS A;  4Q0E A;  4KYA A;  1JMI A;  3N5E B;  3N5E A;  3EGY X;  5H39 A;  2G8D A;  3QJ7 A;  3CL9 A;  3I3R A;  4EZ8 A;  3NRR A;  1JTQ A;  2RD8 A;  3EDW X;  1B02 A;  3KJS A;  3ED7 A;  4PSG A;  4F2V A;  1TDA A;  2G8X A;  2RDA A;  1JUT A;  3B5B A;  4KPW A;  4FGT A;  1ZPR A;  4LRR A;  3BHL A;  1SYN A;  1F4G A;  3UM8 A;  3BFI A;  1AN5 A;  1BQ2 A;  1NJC A;  1JU6 A;  1TDC A;  1EVF A;  3EF9 A;  1JMG A;  1JMF A;  4IQQ A;  5H3A A;  1BKO A;  4IQB A;  1BJG A;  1F4C A;  1TIS A;  2AAZ A;  2BBQ A;  1VZC A;  1LCE A;  2ONB A;  2VF0 A;  1AIQ A;  3EAW X;  3N5G A;  1EV5 A;  2KCE A;  1F4B A;  4FOA A;  4O7U A;  3GH0 A;  1TSL A;  1TDB A;  1TSY A;  1LCB A;  1B5E A;  1DNA A;  3K2H A;  4EIL A;  2FTN A;  4IRR A;  4FQS A;  4E28 A;  4GD7 A;  1EVG A;  1TSX A;  5H38 A;  1TLC A;  3DL5 A;  1AXW A;  3IRN A;  1HW4 A;  1VZE A;  1NJA A;  4XSC A;  4O1X D;  1AJM A;  4H1I A;  1JTU A;  2H2Q A;  3DL6 A;  1TSD A;  4G2O X;  3JSU A;  1QZF A;  3UM6 A;  1QQQ A;  3IK1 A;  4O1U A;  4GYH A;  1RTS A;  4G6W X;  1SEJ A;  5BY6 A;  3UM5 A;  1BDU A;  1BPJ A;  3IRO A;  4DP3 A;  2TDM A;  3V8H A;  1HZW A;  1BP0 A;  1CI7 A;  3GH2 X;  2FTO X;  1J3K C;  2TSR A;  2G8A A;  1TSZ A;  1J3I C;  1HVY A;  1J3J C;  1KCE A;  2FTQ A;  1NJD A;  1JG0 A;  1TDU A;  1NJE A;  5WRN A;  4KY8 A;  3C0A A;  1TRG A;  2RD8 B;  2OIP A;  1DDU A;  3BGX A; 
#chains in the Genus database with same CATH homology
 2TSC A;  3H9K A;  3HBB A;  4ISK A;  4FOX A;  3UWL B;  1THY A;  3EHI X;  3UWL A;  1JUJ A;  3IK0 A;  5J7W A;  1FFL A;  1BKP A;  1TVW A;  1TSV A;  5HS3 A;  3BNZ A;  1BP6 A;  1VZD A;  1KZJ A;  4ISW A;  4KY4 A;  4DPD A;  1BO7 A;  3IRM A;  4FOG A;  1HW3 A;  4E5O A;  4DPH A;  1NJB A;  3EBU A;  4EB4 A;  1EV8 A;  4DQ1 A;  3QG2 A;  1F4E A;  3B9H A;  2G89 A;  3OB7 A;  4GEV A;  4KNZ A;  3C06 A;  3IX6 A;  1B5D A;  1TSN A;  1TSM A;  4H0R A;  1TLS A;  4H0U A;  1TVV A;  1B49 A;  4Q0D A;  1F28 A;  4O1X A;  1I00 A;  2A9W A;  1NCE A;  2VET A;  3IHI A;  2G86 A;  4UP1 A;  1TVU A;  3CLB A;  1TSW A;  4XSE A;  4JEF A;  1BQ1 A;  1LCA A;  1BSP A;  2TDD A;  3BHR A;  3DGA C;  1YPV A;  3EJL A;  3GG5 A;  5FCT A;  3IJZ A;  1VZA A;  1AOB A;  1BSF A;  1JMH A;  4EIN A;  3KJR A;  1FWM A;  1TJS A;  3INV A;  4TMS A;  3QGT A;  3KGB A;  1KZI A;  1VZB A;  3BZ0 A;  1BO8 A;  1F4F A;  3HJ3 A;  3TMS A;  3DG8 C;  3BYX A;  4XSD A;  1BID A;  3HB8 A;  4ECK A;  1F4D A;  1TYS A;  4Q0E A;  4KYA A;  1JMI A;  3N5E B;  3N5E A;  3EGY X;  5H39 A;  2G8D A;  3QJ7 A;  3CL9 A;  3I3R A;  4EZ8 A;  3NRR A;  1JTQ A;  2RD8 A;  3EDW X;  1B02 A;  3KJS A;  3ED7 A;  4PSG A;  4F2V A;  1TDA A;  2G8X A;  2RDA A;  1JUT A;  3B5B A;  4KPW A;  4FGT A;  1ZPR A;  4LRR A;  3BHL A;  1SYN A;  1F4G A;  3UM8 A;  3BFI A;  1AN5 A;  1BQ2 A;  1NJC A;  1JU6 A;  1TDC A;  1EVF A;  3EF9 A;  1JMG A;  1JMF A;  4IQQ A;  5H3A A;  1BKO A;  4IQB A;  1BJG A;  1F4C A;  1TIS A;  2AAZ A;  2BBQ A;  1VZC A;  1LCE A;  2ONB A;  2VF0 A;  1AIQ A;  3EAW X;  3N5G A;  1EV5 A;  2KCE A;  1F4B A;  4FOA A;  4O7U A;  3GH0 A;  1TSL A;  1TDB A;  1TSY A;  1LCB A;  1B5E A;  1DNA A;  3K2H A;  4EIL A;  2FTN A;  4IRR A;  4FQS A;  4E28 A;  4GD7 A;  1EVG A;  1TSX A;  5H38 A;  1TLC A;  3DL5 A;  1AXW A;  3IRN A;  1HW4 A;  1VZE A;  1NJA A;  4XSC A;  4O1X D;  1AJM A;  4H1I A;  1JTU A;  2H2Q A;  3DL6 A;  1TSD A;  4G2O X;  3JSU A;  1QZF A;  3UM6 A;  1QQQ A;  3IK1 A;  4O1U A;  4GYH A;  1RTS A;  4G6W X;  1SEJ A;  5BY6 A;  3UM5 A;  1BDU A;  1BPJ A;  3IRO A;  4DP3 A;  2TDM A;  3V8H A;  1HZW A;  1BP0 A;  1CI7 A;  3GH2 X;  2FTO X;  1J3K C;  2TSR A;  2G8A A;  1TSZ A;  1J3I C;  1HVY A;  1J3J C;  1KCE A;  2FTQ A;  1NJD A;  1JG0 A;  1TDU A;  1NJE A;  5WRN A;  4KY8 A;  3C0A A;  1TRG A;  2RD8 B;  2OIP A;  1DDU A;  3BGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...