1BDUA

E. coli thymidylate synthase complexed with durd
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
264
structure length
264
Chain Sequence
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The additivity of substrate fragments in enzyme-ligand binding.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Methyltransferase
source organism Escherichia coli
total genus 88
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1bduA00
4GD7A 3HBBA 3EGYX 1TVVA 3CLBA 3KJSA 4DPHA 3NRRA 1B49A 1JU6A 2FTNA 2FTOX 2RD8A 1JMFA 2RDAA 3IK1A 5BY6A 3C0AA 1JMIA 3IROA 1ZPRA 4G6WX 3B5BA 4ISWA 3UM8A 3IRMA 1LCEA 4FOAA 4F2VA 1BO8A 1BQ1A 4DP3A 1HZWA 3K2HA 3KGBA 2TSCA 3QG2A 1VZCA 1JUTA 1TRGA 5H39A 1DNAA 2FTQA 3BFIA 1BQ2A 1BSPA 3I3RA 2G8XA 4IRRA 3IHIA 4DQ1A 3OB7A 3INVA 1TSMA 3CL9A 4KY8A 2OIPA 4UP1A 2TSRA 4O7UA 1BP6A 5HS3A 1NJAA 1EV5A 1THYA 4E28A 1NJBA 3QGTA 2ONBA 4O1XD 1AN5A 1TDBA 4KY4A 4KYAA 1TSZA 1NJCA 3DGAC 4FOXA 1SYNA 1EVFA 2A9WA 1JUJA 1KCEA 2AAZA 3UWLA 4XSDA 4ECKA 1F4EA 3EBUA 1F4BA 1BKOA 1TYSA 3HB8A 1KZIA 1YPVA 4GYHA 4IQQA 1JMHA 4O1UA 4DPDA 3ED7A 1B5EA 2VETA 3TMSA 1EVGA 3DG8C 1QQQA 1J3KC 1LCBA 3BHLA 1TLSA 1J3IC 3N5EA 1TJSA 3IX6A 1F4FA 1JTQA 1JMGA 1LCAA 3IRNA 1BIDA 1BO7A 4KNZA 1AIQA 1FWMA 3EDWX 4G2OX 1B02A 1I00A 1TISA 1QZFA 1TSWA 1FFLA 1F4CA 3B9HA 3BNZA 1BKPA 5H38A 4XSEA 2H2QA 3BZ0A 1VZDA 3GH2X 1TSXA 1NCEA 4O1XA 1HW4A 1HW3A 1TSVA 3UM5A 3H9KA 1VZBA 1TSYA 5H3AA 1NJDA 3IJZA 3V8HA 4KPWA 1EV8A 2RD8B 2G89A 4TMSA 1AJMA 3BGXA 2G86A 4H1IA 1F4DA 1TDAA 1J3JC 3DL5A 4FOGA 1AXWA 5J7WA 4LRRA 4H0UA 1B5DA 3DL6A 1F4GA 1F28A 4FQSA 3GH0A 1AOBA 2G8DA 1KZJA 1TDCA 4GEVA 1HVYA 3UM6A 4PSGA 1NJEA 1RTSA 1VZAA 1JTUA 3JSUA 1BSFA 4Q0DA 1CI7A 3EF9A 2KCEA 5WRNA 1TSLA 1VZEA 4H0RA 4XSCA 2TDDA 3BYXA 3GG5A 1TDUA 4EILA 1TVWA 1TVUA 4E5OA 1SEJA 1BP0A 1BPJA 4ISKA 3UWLB 4EB4A 3KJRA 1JG0A 4EZ8A 1TSNA 2VF0A 3EHIX 4JEFA 5FCTA 2TDMA 4FGTA 3HJ3A 3QJ7A 4IQBA 1BDUA 4Q0EA 1BJGA 1DDUA 2BBQA 3IK0A 3N5EB 4EINA 1TLCA 3BHRA 3C06A 2G8AA 3EAWX 3EJLA 1TSDA 3N5GA
chains in the Genus database with same CATH superfamily
4GD7A 3HBBA 3EGYX 1TVVA 3CLBA 3KJSA 4DPHA 3NRRA 1B49A 1JU6A 2FTNA 2FTOX 2RD8A 1JMFA 2RDAA 3IK1A 5BY6A 3C0AA 1JMIA 3IROA 1ZPRA 4G6WX 3B5BA 4ISWA 3UM8A 3IRMA 1LCEA 4FOAA 4F2VA 1BO8A 1BQ1A 4DP3A 1HZWA 3K2HA 3KGBA 2TSCA 3QG2A 1VZCA 1JUTA 1TRGA 5H39A 1DNAA 2FTQA 3BFIA 1BQ2A 1BSPA 3I3RA 2G8XA 4IRRA 3IHIA 4DQ1A 3OB7A 3INVA 1TSMA 3CL9A 4KY8A 2OIPA 4UP1A 2TSRA 4O7UA 1BP6A 5HS3A 1NJAA 1EV5A 1THYA 4E28A 1NJBA 3QGTA 2ONBA 4O1XD 1AN5A 1TDBA 4KY4A 4KYAA 1TSZA 1NJCA 3DGAC 4FOXA 1SYNA 1EVFA 2A9WA 1JUJA 1KCEA 2AAZA 3UWLA 4XSDA 4ECKA 1F4EA 3EBUA 1F4BA 1BKOA 1TYSA 3HB8A 1KZIA 1YPVA 4GYHA 4IQQA 1JMHA 4O1UA 4DPDA 3ED7A 1B5EA 2VETA 3TMSA 1EVGA 3DG8C 1QQQA 1J3KC 1LCBA 3BHLA 1TLSA 1J3IC 3N5EA 1TJSA 3IX6A 1F4FA 1JTQA 1JMGA 1LCAA 3IRNA 1BIDA 1BO7A 4KNZA 1AIQA 1FWMA 3EDWX 4G2OX 1B02A 1I00A 1TISA 1QZFA 1TSWA 1FFLA 1F4CA 3B9HA 3BNZA 1BKPA 5H38A 4XSEA 2H2QA 3BZ0A 1VZDA 3GH2X 1TSXA 1NCEA 4O1XA 1HW4A 1HW3A 1TSVA 3UM5A 3H9KA 1VZBA 1TSYA 5H3AA 1NJDA 3IJZA 3V8HA 4KPWA 1EV8A 2RD8B 2G89A 4TMSA 1AJMA 3BGXA 2G86A 4H1IA 1F4DA 1TDAA 1J3JC 3DL5A 4FOGA 1AXWA 5J7WA 4LRRA 4H0UA 1B5DA 3DL6A 1F4GA 1F28A 4FQSA 3GH0A 1AOBA 2G8DA 1KZJA 1TDCA 4GEVA 1HVYA 3UM6A 4PSGA 1NJEA 1RTSA 1VZAA 1JTUA 3JSUA 1BSFA 4Q0DA 1CI7A 3EF9A 2KCEA 5WRNA 1TSLA 1VZEA 4H0RA 4XSCA 2TDDA 3BYXA 3GG5A 1TDUA 4EILA 1TVWA 1TVUA 4E5OA 1SEJA 1BP0A 1BPJA 4ISKA 3UWLB 4EB4A 3KJRA 1JG0A 4EZ8A 1TSNA 2VF0A 3EHIX 4JEFA 5FCTA 2TDMA 4FGTA 3HJ3A 3QJ7A 4IQBA 1BDUA 4Q0EA 1BJGA 1DDUA 2BBQA 3IK0A 3N5EB 4EINA 1TLCA 3BHRA 3C06A 2G8AA 3EAWX 3EJLA 1TSDA 3N5GA
chains in the Genus database with same CATH topology
4GD7A 3HBBA 3EGYX 1TVVA 3CLBA 3KJSA 4DPHA 3NRRA 1B49A 1JU6A 2FTNA 2FTOX 2RD8A 1JMFA 2RDAA 3IK1A 5BY6A 3C0AA 1JMIA 3IROA 1ZPRA 4G6WX 3B5BA 4ISWA 3UM8A 3IRMA 1LCEA 4FOAA 4F2VA 1BO8A 1BQ1A 4DP3A 1HZWA 3K2HA 3KGBA 2TSCA 3QG2A 1VZCA 1JUTA 1TRGA 5H39A 1DNAA 2FTQA 3BFIA 1BQ2A 1BSPA 3I3RA 2G8XA 4IRRA 3IHIA 4DQ1A 3OB7A 3INVA 1TSMA 3CL9A 4KY8A 2OIPA 4UP1A 2TSRA 4O7UA 1BP6A 5HS3A 1NJAA 1EV5A 1THYA 4E28A 1NJBA 3QGTA 2ONBA 4O1XD 1AN5A 1TDBA 4KY4A 4KYAA 1TSZA 1NJCA 3DGAC 4FOXA 1SYNA 1EVFA 2A9WA 1JUJA 1KCEA 2AAZA 3UWLA 4XSDA 4ECKA 1F4EA 3EBUA 1F4BA 1BKOA 1TYSA 3HB8A 1KZIA 1YPVA 4GYHA 4IQQA 1JMHA 4O1UA 4DPDA 3ED7A 1B5EA 2VETA 3TMSA 1EVGA 3DG8C 1QQQA 1J3KC 1LCBA 3BHLA 1TLSA 1J3IC 3N5EA 1TJSA 3IX6A 1F4FA 1JTQA 1JMGA 1LCAA 3IRNA 1BIDA 1BO7A 4KNZA 1AIQA 1FWMA 3EDWX 4G2OX 1B02A 1I00A 1TISA 1QZFA 1TSWA 1FFLA 1F4CA 3B9HA 3BNZA 1BKPA 5H38A 4XSEA 2H2QA 3BZ0A 1VZDA 3GH2X 1TSXA 1NCEA 4O1XA 1HW4A 1HW3A 1TSVA 3UM5A 3H9KA 1VZBA 1TSYA 5H3AA 1NJDA 3IJZA 3V8HA 4KPWA 1EV8A 2RD8B 2G89A 4TMSA 1AJMA 3BGXA 2G86A 4H1IA 1F4DA 1TDAA 1J3JC 3DL5A 4FOGA 1AXWA 5J7WA 4LRRA 4H0UA 1B5DA 3DL6A 1F4GA 1F28A 4FQSA 3GH0A 1AOBA 2G8DA 1KZJA 1TDCA 4GEVA 1HVYA 3UM6A 4PSGA 1NJEA 1RTSA 1VZAA 1JTUA 3JSUA 1BSFA 4Q0DA 1CI7A 3EF9A 2KCEA 5WRNA 1TSLA 1VZEA 4H0RA 4XSCA 2TDDA 3BYXA 3GG5A 1TDUA 4EILA 1TVWA 1TVUA 4E5OA 1SEJA 1BP0A 1BPJA 4ISKA 3UWLB 4EB4A 3KJRA 1JG0A 4EZ8A 1TSNA 2VF0A 3EHIX 4JEFA 5FCTA 2TDMA 4FGTA 3HJ3A 3QJ7A 4IQBA 1BDUA 4Q0EA 1BJGA 1DDUA 2BBQA 3IK0A 3N5EB 4EINA 1TLCA 3BHRA 3C06A 2G8AA 3EAWX 3EJLA 1TSDA 3N5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GD7 A;  3HBB A;  3EGY X;  1TVV A;  3CLB A;  3KJS A;  4DPH A;  3NRR A;  1B49 A;  1JU6 A;  2FTN A;  2FTO X;  2RD8 A;  1JMF A;  2RDA A;  3IK1 A;  5BY6 A;  3C0A A;  1JMI A;  3IRO A;  1ZPR A;  4G6W X;  3B5B A;  4ISW A;  3UM8 A;  3IRM A;  1LCE A;  4FOA A;  4F2V A;  1BO8 A;  1BQ1 A;  4DP3 A;  1HZW A;  3K2H A;  3KGB A;  2TSC A;  3QG2 A;  1VZC A;  1JUT A;  1TRG A;  5H39 A;  1DNA A;  2FTQ A;  3BFI A;  1BQ2 A;  1BSP A;  3I3R A;  2G8X A;  4IRR A;  3IHI A;  4DQ1 A;  3OB7 A;  3INV A;  1TSM A;  3CL9 A;  4KY8 A;  2OIP A;  4UP1 A;  2TSR A;  4O7U A;  1BP6 A;  5HS3 A;  1NJA A;  1EV5 A;  1THY A;  4E28 A;  1NJB A;  3QGT A;  2ONB A;  4O1X D;  1AN5 A;  1TDB A;  4KY4 A;  4KYA A;  1TSZ A;  1NJC A;  3DGA C;  4FOX A;  1SYN A;  1EVF A;  2A9W A;  1JUJ A;  1KCE A;  2AAZ A;  3UWL A;  4XSD A;  4ECK A;  1F4E A;  3EBU A;  1F4B A;  1BKO A;  1TYS A;  3HB8 A;  1KZI A;  1YPV A;  4GYH A;  4IQQ A;  1JMH A;  4O1U A;  4DPD A;  3ED7 A;  1B5E A;  2VET A;  3TMS A;  1EVG A;  3DG8 C;  1QQQ A;  1J3K C;  1LCB A;  3BHL A;  1TLS A;  1J3I C;  3N5E A;  1TJS A;  3IX6 A;  1F4F A;  1JTQ A;  1JMG A;  1LCA A;  3IRN A;  1BID A;  1BO7 A;  4KNZ A;  1AIQ A;  1FWM A;  3EDW X;  4G2O X;  1B02 A;  1I00 A;  1TIS A;  1QZF A;  1TSW A;  1FFL A;  1F4C A;  3B9H A;  3BNZ A;  1BKP A;  5H38 A;  4XSE A;  2H2Q A;  3BZ0 A;  1VZD A;  3GH2 X;  1TSX A;  1NCE A;  4O1X A;  1HW4 A;  1HW3 A;  1TSV A;  3UM5 A;  3H9K A;  1VZB A;  1TSY A;  5H3A A;  1NJD A;  3IJZ A;  3V8H A;  4KPW A;  1EV8 A;  2RD8 B;  2G89 A;  4TMS A;  1AJM A;  3BGX A;  2G86 A;  4H1I A;  1F4D A;  1TDA A;  1J3J C;  3DL5 A;  4FOG A;  1AXW A;  5J7W A;  4LRR A;  4H0U A;  1B5D A;  3DL6 A;  1F4G A;  1F28 A;  4FQS A;  3GH0 A;  1AOB A;  2G8D A;  1KZJ A;  1TDC A;  4GEV A;  1HVY A;  3UM6 A;  4PSG A;  1NJE A;  1RTS A;  1VZA A;  1JTU A;  3JSU A;  1BSF A;  4Q0D A;  1CI7 A;  3EF9 A;  2KCE A;  5WRN A;  1TSL A;  1VZE A;  4H0R A;  4XSC A;  2TDD A;  3BYX A;  3GG5 A;  1TDU A;  4EIL A;  1TVW A;  1TVU A;  4E5O A;  1SEJ A;  1BP0 A;  1BPJ A;  4ISK A;  3UWL B;  4EB4 A;  3KJR A;  1JG0 A;  4EZ8 A;  1TSN A;  2VF0 A;  3EHI X;  4JEF A;  5FCT A;  2TDM A;  4FGT A;  3HJ3 A;  3QJ7 A;  4IQB A;  1BDU A;  4Q0E A;  1BJG A;  1DDU A;  2BBQ A;  3IK0 A;  3N5E B;  4EIN A;  1TLC A;  3BHR A;  3C06 A;  2G8A A;  3EAW X;  3EJL A;  1TSD A;  3N5G A; 
#chains in the Genus database with same CATH topology
 4GD7 A;  3HBB A;  3EGY X;  1TVV A;  3CLB A;  3KJS A;  4DPH A;  3NRR A;  1B49 A;  1JU6 A;  2FTN A;  2FTO X;  2RD8 A;  1JMF A;  2RDA A;  3IK1 A;  5BY6 A;  3C0A A;  1JMI A;  3IRO A;  1ZPR A;  4G6W X;  3B5B A;  4ISW A;  3UM8 A;  3IRM A;  1LCE A;  4FOA A;  4F2V A;  1BO8 A;  1BQ1 A;  4DP3 A;  1HZW A;  3K2H A;  3KGB A;  2TSC A;  3QG2 A;  1VZC A;  1JUT A;  1TRG A;  5H39 A;  1DNA A;  2FTQ A;  3BFI A;  1BQ2 A;  1BSP A;  3I3R A;  2G8X A;  4IRR A;  3IHI A;  4DQ1 A;  3OB7 A;  3INV A;  1TSM A;  3CL9 A;  4KY8 A;  2OIP A;  4UP1 A;  2TSR A;  4O7U A;  1BP6 A;  5HS3 A;  1NJA A;  1EV5 A;  1THY A;  4E28 A;  1NJB A;  3QGT A;  2ONB A;  4O1X D;  1AN5 A;  1TDB A;  4KY4 A;  4KYA A;  1TSZ A;  1NJC A;  3DGA C;  4FOX A;  1SYN A;  1EVF A;  2A9W A;  1JUJ A;  1KCE A;  2AAZ A;  3UWL A;  4XSD A;  4ECK A;  1F4E A;  3EBU A;  1F4B A;  1BKO A;  1TYS A;  3HB8 A;  1KZI A;  1YPV A;  4GYH A;  4IQQ A;  1JMH A;  4O1U A;  4DPD A;  3ED7 A;  1B5E A;  2VET A;  3TMS A;  1EVG A;  3DG8 C;  1QQQ A;  1J3K C;  1LCB A;  3BHL A;  1TLS A;  1J3I C;  3N5E A;  1TJS A;  3IX6 A;  1F4F A;  1JTQ A;  1JMG A;  1LCA A;  3IRN A;  1BID A;  1BO7 A;  4KNZ A;  1AIQ A;  1FWM A;  3EDW X;  4G2O X;  1B02 A;  1I00 A;  1TIS A;  1QZF A;  1TSW A;  1FFL A;  1F4C A;  3B9H A;  3BNZ A;  1BKP A;  5H38 A;  4XSE A;  2H2Q A;  3BZ0 A;  1VZD A;  3GH2 X;  1TSX A;  1NCE A;  4O1X A;  1HW4 A;  1HW3 A;  1TSV A;  3UM5 A;  3H9K A;  1VZB A;  1TSY A;  5H3A A;  1NJD A;  3IJZ A;  3V8H A;  4KPW A;  1EV8 A;  2RD8 B;  2G89 A;  4TMS A;  1AJM A;  3BGX A;  2G86 A;  4H1I A;  1F4D A;  1TDA A;  1J3J C;  3DL5 A;  4FOG A;  1AXW A;  5J7W A;  4LRR A;  4H0U A;  1B5D A;  3DL6 A;  1F4G A;  1F28 A;  4FQS A;  3GH0 A;  1AOB A;  2G8D A;  1KZJ A;  1TDC A;  4GEV A;  1HVY A;  3UM6 A;  4PSG A;  1NJE A;  1RTS A;  1VZA A;  1JTU A;  3JSU A;  1BSF A;  4Q0D A;  1CI7 A;  3EF9 A;  2KCE A;  5WRN A;  1TSL A;  1VZE A;  4H0R A;  4XSC A;  2TDD A;  3BYX A;  3GG5 A;  1TDU A;  4EIL A;  1TVW A;  1TVU A;  4E5O A;  1SEJ A;  1BP0 A;  1BPJ A;  4ISK A;  3UWL B;  4EB4 A;  3KJR A;  1JG0 A;  4EZ8 A;  1TSN A;  2VF0 A;  3EHI X;  4JEF A;  5FCT A;  2TDM A;  4FGT A;  3HJ3 A;  3QJ7 A;  4IQB A;  1BDU A;  4Q0E A;  1BJG A;  1DDU A;  2BBQ A;  3IK0 A;  3N5E B;  4EIN A;  1TLC A;  3BHR A;  3C06 A;  2G8A A;  3EAW X;  3EJL A;  1TSD A;  3N5G A; 
#chains in the Genus database with same CATH homology
 4GD7 A;  3HBB A;  3EGY X;  1TVV A;  3CLB A;  3KJS A;  4DPH A;  3NRR A;  1B49 A;  1JU6 A;  2FTN A;  2FTO X;  2RD8 A;  1JMF A;  2RDA A;  3IK1 A;  5BY6 A;  3C0A A;  1JMI A;  3IRO A;  1ZPR A;  4G6W X;  3B5B A;  4ISW A;  3UM8 A;  3IRM A;  1LCE A;  4FOA A;  4F2V A;  1BO8 A;  1BQ1 A;  4DP3 A;  1HZW A;  3K2H A;  3KGB A;  2TSC A;  3QG2 A;  1VZC A;  1JUT A;  1TRG A;  5H39 A;  1DNA A;  2FTQ A;  3BFI A;  1BQ2 A;  1BSP A;  3I3R A;  2G8X A;  4IRR A;  3IHI A;  4DQ1 A;  3OB7 A;  3INV A;  1TSM A;  3CL9 A;  4KY8 A;  2OIP A;  4UP1 A;  2TSR A;  4O7U A;  1BP6 A;  5HS3 A;  1NJA A;  1EV5 A;  1THY A;  4E28 A;  1NJB A;  3QGT A;  2ONB A;  4O1X D;  1AN5 A;  1TDB A;  4KY4 A;  4KYA A;  1TSZ A;  1NJC A;  3DGA C;  4FOX A;  1SYN A;  1EVF A;  2A9W A;  1JUJ A;  1KCE A;  2AAZ A;  3UWL A;  4XSD A;  4ECK A;  1F4E A;  3EBU A;  1F4B A;  1BKO A;  1TYS A;  3HB8 A;  1KZI A;  1YPV A;  4GYH A;  4IQQ A;  1JMH A;  4O1U A;  4DPD A;  3ED7 A;  1B5E A;  2VET A;  3TMS A;  1EVG A;  3DG8 C;  1QQQ A;  1J3K C;  1LCB A;  3BHL A;  1TLS A;  1J3I C;  3N5E A;  1TJS A;  3IX6 A;  1F4F A;  1JTQ A;  1JMG A;  1LCA A;  3IRN A;  1BID A;  1BO7 A;  4KNZ A;  1AIQ A;  1FWM A;  3EDW X;  4G2O X;  1B02 A;  1I00 A;  1TIS A;  1QZF A;  1TSW A;  1FFL A;  1F4C A;  3B9H A;  3BNZ A;  1BKP A;  5H38 A;  4XSE A;  2H2Q A;  3BZ0 A;  1VZD A;  3GH2 X;  1TSX A;  1NCE A;  4O1X A;  1HW4 A;  1HW3 A;  1TSV A;  3UM5 A;  3H9K A;  1VZB A;  1TSY A;  5H3A A;  1NJD A;  3IJZ A;  3V8H A;  4KPW A;  1EV8 A;  2RD8 B;  2G89 A;  4TMS A;  1AJM A;  3BGX A;  2G86 A;  4H1I A;  1F4D A;  1TDA A;  1J3J C;  3DL5 A;  4FOG A;  1AXW A;  5J7W A;  4LRR A;  4H0U A;  1B5D A;  3DL6 A;  1F4G A;  1F28 A;  4FQS A;  3GH0 A;  1AOB A;  2G8D A;  1KZJ A;  1TDC A;  4GEV A;  1HVY A;  3UM6 A;  4PSG A;  1NJE A;  1RTS A;  1VZA A;  1JTU A;  3JSU A;  1BSF A;  4Q0D A;  1CI7 A;  3EF9 A;  2KCE A;  5WRN A;  1TSL A;  1VZE A;  4H0R A;  4XSC A;  2TDD A;  3BYX A;  3GG5 A;  1TDU A;  4EIL A;  1TVW A;  1TVU A;  4E5O A;  1SEJ A;  1BP0 A;  1BPJ A;  4ISK A;  3UWL B;  4EB4 A;  3KJR A;  1JG0 A;  4EZ8 A;  1TSN A;  2VF0 A;  3EHI X;  4JEF A;  5FCT A;  2TDM A;  4FGT A;  3HJ3 A;  3QJ7 A;  4IQB A;  1BDU A;  4Q0E A;  1BJG A;  1DDU A;  2BBQ A;  3IK0 A;  3N5E B;  4EIN A;  1TLC A;  3BHR A;  3C06 A;  2G8A A;  3EAW X;  3EJL A;  1TSD A;  3N5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...