1FFLA

Crystal structure of the apo-thymidylate synthase r166q mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQQSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of thymidylate synthase mutant R166Q: Structural basis for the nearly complete loss of catalytic activity.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Escherichia coli
total genus 83
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1fflA00
1BJGA 3OB7A 3IHIA 1AIQA 1JMHA 2BBQA 3QJ7A 3KJRA 3DL5A 1VZDA 1TSWA 3UM6A 4DPHA 4O1XD 5HS3A 4EZ8A 1QQQA 1NJEA 3EDWX 3HJ3A 3IROA 4EINA 1BO7A 4FQSA 1TLCA 4Q0EA 1BP0A 1FFLA 1BKPA 2FTOX 3BNZA 3INVA 3TMSA 1EV8A 1TVVA 1BDUA 1JUJA 1TSYA 4EILA 2FTQA 3QGTA 1AJMA 2TDMA 1B02A 1NJCA 4FOGA 5H39A 1TSVA 3IX6A 1J3KC 3IRNA 3V8HA 4FOAA 1TDBA 1J3IC 3BYXA 4KY8A 1BO8A 4KPWA 1B5DA 3UWLB 1B5EA 1HW4A 1JU6A 1TLSA 1F4BA 1RTSA 3ED7A 1JUTA 1F4FA 5FCTA 1F28A 1YPVA 4GYHA 3EJLA 1DNAA 1BQ2A 2TSRA 4TMSA 3GG5A 4DPDA 1EVFA 3IJZA 4IQBA 1TSZA 1TISA 4ISWA 1I00A 3EGYX 3N5GA 1VZCA 2KCEA 1TSDA 1AOBA 2AAZA 1AXWA 2G8DA 1VZAA 3UWLA 1TJSA 4O7UA 1JMFA 1TVUA 3EBUA 1KZJA 1TVWA 4FOXA 4LRRA 3C0AA 4XSEA 3EAWX 4G2OX 1HVYA 2G8AA 4ISKA 4O1UA 4UP1A 2RD8B 3BFIA 4H0RA 1EV5A 4DQ1A 1NJDA 3BHRA 3BZ0A 1F4GA 4EB4A 3DL6A 1KZIA 1LCEA 3C06A 4Q0DA 4XSDA 1CI7A 2G89A 1KCEA 1BSFA 1TDAA 1F4DA 5H3AA 1LCAA 1TSMA 3KGBA 1TSLA 1VZEA 3N5EB 1TRGA 1TSNA 4H1IA 2RD8A 5H38A 3EF9A 1BIDA 4IRRA 3UM8A 4GEVA 2RDAA 4KNZA 1BKOA 4DP3A 3I3RA 3GH2X 3BHLA 1JG0A 2TDDA 2ONBA 1BQ1A 2TSCA 1F4EA 3B9HA 2A9WA 4G6WX 1TSXA 1TDCA 5J7WA 2VF0A 1THYA 1NJAA 4F2VA 1BPJA 3N5EA 1SYNA 2VETA 3H9KA 1EVGA 3IK0A 4E28A 1J3JC 1TDUA 3QG2A 1AN5A 2G8XA 4JEFA 1NJBA 3NRRA 4H0UA 3IK1A 3UM5A 3BGXA 1LCBA 1JTQA 3EHIX 1SEJA 5WRNA 1BSPA 4KYAA 3GH0A 4PSGA 4XSCA 1HZWA 3JSUA 4KY4A 1JMGA 3IRMA 4ECKA 3KJSA 1BP6A 1JTUA 1JMIA 1TYSA 3DG8C 2H2QA 4E5OA 2FTNA 3B5BA 3CLBA 1FWMA 2G86A 3DGAC 1QZFA 3HB8A 3HBBA 3K2HA 1ZPRA 4O1XA 5BY6A 1B49A 1DDUA 1VZBA 1NCEA 3CL9A 4FGTA 4GD7A 4IQQA 1HW3A 2OIPA 1F4CA
chains in the Genus database with same CATH superfamily
1BJGA 3OB7A 3IHIA 1AIQA 1JMHA 2BBQA 3QJ7A 3KJRA 3DL5A 1VZDA 1TSWA 3UM6A 4DPHA 4O1XD 5HS3A 4EZ8A 1QQQA 1NJEA 3EDWX 3HJ3A 3IROA 4EINA 1BO7A 4FQSA 1TLCA 4Q0EA 1BP0A 1FFLA 1BKPA 2FTOX 3BNZA 3INVA 3TMSA 1EV8A 1TVVA 1BDUA 1JUJA 1TSYA 4EILA 2FTQA 3QGTA 1AJMA 2TDMA 1B02A 1NJCA 4FOGA 5H39A 1TSVA 3IX6A 1J3KC 3IRNA 3V8HA 4FOAA 1TDBA 1J3IC 3BYXA 4KY8A 1BO8A 4KPWA 1B5DA 3UWLB 1B5EA 1HW4A 1JU6A 1TLSA 1F4BA 1RTSA 3ED7A 1JUTA 1F4FA 5FCTA 1F28A 1YPVA 4GYHA 3EJLA 1DNAA 1BQ2A 2TSRA 4TMSA 3GG5A 4DPDA 1EVFA 3IJZA 4IQBA 1TSZA 1TISA 4ISWA 1I00A 3EGYX 3N5GA 1VZCA 2KCEA 1TSDA 1AOBA 2AAZA 1AXWA 2G8DA 1VZAA 3UWLA 1TJSA 4O7UA 1JMFA 1TVUA 3EBUA 1KZJA 1TVWA 4FOXA 4LRRA 3C0AA 4XSEA 3EAWX 4G2OX 1HVYA 2G8AA 4ISKA 4O1UA 4UP1A 2RD8B 3BFIA 4H0RA 1EV5A 4DQ1A 1NJDA 3BHRA 3BZ0A 1F4GA 4EB4A 3DL6A 1KZIA 1LCEA 3C06A 4Q0DA 4XSDA 1CI7A 2G89A 1KCEA 1BSFA 1TDAA 1F4DA 5H3AA 1LCAA 1TSMA 3KGBA 1TSLA 1VZEA 3N5EB 1TRGA 1TSNA 4H1IA 2RD8A 5H38A 3EF9A 1BIDA 4IRRA 3UM8A 4GEVA 2RDAA 4KNZA 1BKOA 4DP3A 3I3RA 3GH2X 3BHLA 1JG0A 2TDDA 2ONBA 1BQ1A 2TSCA 1F4EA 3B9HA 2A9WA 4G6WX 1TSXA 1TDCA 5J7WA 2VF0A 1THYA 1NJAA 4F2VA 1BPJA 3N5EA 1SYNA 2VETA 3H9KA 1EVGA 3IK0A 4E28A 1J3JC 1TDUA 3QG2A 1AN5A 2G8XA 4JEFA 1NJBA 3NRRA 4H0UA 3IK1A 3UM5A 3BGXA 1LCBA 1JTQA 3EHIX 1SEJA 5WRNA 1BSPA 4KYAA 3GH0A 4PSGA 4XSCA 1HZWA 3JSUA 4KY4A 1JMGA 3IRMA 4ECKA 3KJSA 1BP6A 1JTUA 1JMIA 1TYSA 3DG8C 2H2QA 4E5OA 2FTNA 3B5BA 3CLBA 1FWMA 2G86A 3DGAC 1QZFA 3HB8A 3HBBA 3K2HA 1ZPRA 4O1XA 5BY6A 1B49A 1DDUA 1VZBA 1NCEA 3CL9A 4FGTA 4GD7A 4IQQA 1HW3A 2OIPA 1F4CA
chains in the Genus database with same CATH topology
1BJGA 3OB7A 3IHIA 1AIQA 1JMHA 2BBQA 3QJ7A 3KJRA 3DL5A 1VZDA 1TSWA 3UM6A 4DPHA 4O1XD 5HS3A 4EZ8A 1QQQA 1NJEA 3EDWX 3HJ3A 3IROA 4EINA 1BO7A 4FQSA 1TLCA 4Q0EA 1BP0A 1FFLA 1BKPA 2FTOX 3BNZA 3INVA 3TMSA 1EV8A 1TVVA 1BDUA 1JUJA 1TSYA 4EILA 2FTQA 3QGTA 1AJMA 2TDMA 1B02A 1NJCA 4FOGA 5H39A 1TSVA 3IX6A 1J3KC 3IRNA 3V8HA 4FOAA 1TDBA 1J3IC 3BYXA 4KY8A 1BO8A 4KPWA 1B5DA 3UWLB 1B5EA 1HW4A 1JU6A 1TLSA 1F4BA 1RTSA 3ED7A 1JUTA 1F4FA 5FCTA 1F28A 1YPVA 4GYHA 3EJLA 1DNAA 1BQ2A 2TSRA 4TMSA 3GG5A 4DPDA 1EVFA 3IJZA 4IQBA 1TSZA 1TISA 4ISWA 1I00A 3EGYX 3N5GA 1VZCA 2KCEA 1TSDA 1AOBA 2AAZA 1AXWA 2G8DA 1VZAA 3UWLA 1TJSA 4O7UA 1JMFA 1TVUA 3EBUA 1KZJA 1TVWA 4FOXA 4LRRA 3C0AA 4XSEA 3EAWX 4G2OX 1HVYA 2G8AA 4ISKA 4O1UA 4UP1A 2RD8B 3BFIA 4H0RA 1EV5A 4DQ1A 1NJDA 3BHRA 3BZ0A 1F4GA 4EB4A 3DL6A 1KZIA 1LCEA 3C06A 4Q0DA 4XSDA 1CI7A 2G89A 1KCEA 1BSFA 1TDAA 1F4DA 5H3AA 1LCAA 1TSMA 3KGBA 1TSLA 1VZEA 3N5EB 1TRGA 1TSNA 4H1IA 2RD8A 5H38A 3EF9A 1BIDA 4IRRA 3UM8A 4GEVA 2RDAA 4KNZA 1BKOA 4DP3A 3I3RA 3GH2X 3BHLA 1JG0A 2TDDA 2ONBA 1BQ1A 2TSCA 1F4EA 3B9HA 2A9WA 4G6WX 1TSXA 1TDCA 5J7WA 2VF0A 1THYA 1NJAA 4F2VA 1BPJA 3N5EA 1SYNA 2VETA 3H9KA 1EVGA 3IK0A 4E28A 1J3JC 1TDUA 3QG2A 1AN5A 2G8XA 4JEFA 1NJBA 3NRRA 4H0UA 3IK1A 3UM5A 3BGXA 1LCBA 1JTQA 3EHIX 1SEJA 5WRNA 1BSPA 4KYAA 3GH0A 4PSGA 4XSCA 1HZWA 3JSUA 4KY4A 1JMGA 3IRMA 4ECKA 3KJSA 1BP6A 1JTUA 1JMIA 1TYSA 3DG8C 2H2QA 4E5OA 2FTNA 3B5BA 3CLBA 1FWMA 2G86A 3DGAC 1QZFA 3HB8A 3HBBA 3K2HA 1ZPRA 4O1XA 5BY6A 1B49A 1DDUA 1VZBA 1NCEA 3CL9A 4FGTA 4GD7A 4IQQA 1HW3A 2OIPA 1F4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJG A;  3OB7 A;  3IHI A;  1AIQ A;  1JMH A;  2BBQ A;  3QJ7 A;  3KJR A;  3DL5 A;  1VZD A;  1TSW A;  3UM6 A;  4DPH A;  4O1X D;  5HS3 A;  4EZ8 A;  1QQQ A;  1NJE A;  3EDW X;  3HJ3 A;  3IRO A;  4EIN A;  1BO7 A;  4FQS A;  1TLC A;  4Q0E A;  1BP0 A;  1FFL A;  1BKP A;  2FTO X;  3BNZ A;  3INV A;  3TMS A;  1EV8 A;  1TVV A;  1BDU A;  1JUJ A;  1TSY A;  4EIL A;  2FTQ A;  3QGT A;  1AJM A;  2TDM A;  1B02 A;  1NJC A;  4FOG A;  5H39 A;  1TSV A;  3IX6 A;  1J3K C;  3IRN A;  3V8H A;  4FOA A;  1TDB A;  1J3I C;  3BYX A;  4KY8 A;  1BO8 A;  4KPW A;  1B5D A;  3UWL B;  1B5E A;  1HW4 A;  1JU6 A;  1TLS A;  1F4B A;  1RTS A;  3ED7 A;  1JUT A;  1F4F A;  5FCT A;  1F28 A;  1YPV A;  4GYH A;  3EJL A;  1DNA A;  1BQ2 A;  2TSR A;  4TMS A;  3GG5 A;  4DPD A;  1EVF A;  3IJZ A;  4IQB A;  1TSZ A;  1TIS A;  4ISW A;  1I00 A;  3EGY X;  3N5G A;  1VZC A;  2KCE A;  1TSD A;  1AOB A;  2AAZ A;  1AXW A;  2G8D A;  1VZA A;  3UWL A;  1TJS A;  4O7U A;  1JMF A;  1TVU A;  3EBU A;  1KZJ A;  1TVW A;  4FOX A;  4LRR A;  3C0A A;  4XSE A;  3EAW X;  4G2O X;  1HVY A;  2G8A A;  4ISK A;  4O1U A;  4UP1 A;  2RD8 B;  3BFI A;  4H0R A;  1EV5 A;  4DQ1 A;  1NJD A;  3BHR A;  3BZ0 A;  1F4G A;  4EB4 A;  3DL6 A;  1KZI A;  1LCE A;  3C06 A;  4Q0D A;  4XSD A;  1CI7 A;  2G89 A;  1KCE A;  1BSF A;  1TDA A;  1F4D A;  5H3A A;  1LCA A;  1TSM A;  3KGB A;  1TSL A;  1VZE A;  3N5E B;  1TRG A;  1TSN A;  4H1I A;  2RD8 A;  5H38 A;  3EF9 A;  1BID A;  4IRR A;  3UM8 A;  4GEV A;  2RDA A;  4KNZ A;  1BKO A;  4DP3 A;  3I3R A;  3GH2 X;  3BHL A;  1JG0 A;  2TDD A;  2ONB A;  1BQ1 A;  2TSC A;  1F4E A;  3B9H A;  2A9W A;  4G6W X;  1TSX A;  1TDC A;  5J7W A;  2VF0 A;  1THY A;  1NJA A;  4F2V A;  1BPJ A;  3N5E A;  1SYN A;  2VET A;  3H9K A;  1EVG A;  3IK0 A;  4E28 A;  1J3J C;  1TDU A;  3QG2 A;  1AN5 A;  2G8X A;  4JEF A;  1NJB A;  3NRR A;  4H0U A;  3IK1 A;  3UM5 A;  3BGX A;  1LCB A;  1JTQ A;  3EHI X;  1SEJ A;  5WRN A;  1BSP A;  4KYA A;  3GH0 A;  4PSG A;  4XSC A;  1HZW A;  3JSU A;  4KY4 A;  1JMG A;  3IRM A;  4ECK A;  3KJS A;  1BP6 A;  1JTU A;  1JMI A;  1TYS A;  3DG8 C;  2H2Q A;  4E5O A;  2FTN A;  3B5B A;  3CLB A;  1FWM A;  2G86 A;  3DGA C;  1QZF A;  3HB8 A;  3HBB A;  3K2H A;  1ZPR A;  4O1X A;  5BY6 A;  1B49 A;  1DDU A;  1VZB A;  1NCE A;  3CL9 A;  4FGT A;  4GD7 A;  4IQQ A;  1HW3 A;  2OIP A;  1F4C A; 
#chains in the Genus database with same CATH topology
 1BJG A;  3OB7 A;  3IHI A;  1AIQ A;  1JMH A;  2BBQ A;  3QJ7 A;  3KJR A;  3DL5 A;  1VZD A;  1TSW A;  3UM6 A;  4DPH A;  4O1X D;  5HS3 A;  4EZ8 A;  1QQQ A;  1NJE A;  3EDW X;  3HJ3 A;  3IRO A;  4EIN A;  1BO7 A;  4FQS A;  1TLC A;  4Q0E A;  1BP0 A;  1FFL A;  1BKP A;  2FTO X;  3BNZ A;  3INV A;  3TMS A;  1EV8 A;  1TVV A;  1BDU A;  1JUJ A;  1TSY A;  4EIL A;  2FTQ A;  3QGT A;  1AJM A;  2TDM A;  1B02 A;  1NJC A;  4FOG A;  5H39 A;  1TSV A;  3IX6 A;  1J3K C;  3IRN A;  3V8H A;  4FOA A;  1TDB A;  1J3I C;  3BYX A;  4KY8 A;  1BO8 A;  4KPW A;  1B5D A;  3UWL B;  1B5E A;  1HW4 A;  1JU6 A;  1TLS A;  1F4B A;  1RTS A;  3ED7 A;  1JUT A;  1F4F A;  5FCT A;  1F28 A;  1YPV A;  4GYH A;  3EJL A;  1DNA A;  1BQ2 A;  2TSR A;  4TMS A;  3GG5 A;  4DPD A;  1EVF A;  3IJZ A;  4IQB A;  1TSZ A;  1TIS A;  4ISW A;  1I00 A;  3EGY X;  3N5G A;  1VZC A;  2KCE A;  1TSD A;  1AOB A;  2AAZ A;  1AXW A;  2G8D A;  1VZA A;  3UWL A;  1TJS A;  4O7U A;  1JMF A;  1TVU A;  3EBU A;  1KZJ A;  1TVW A;  4FOX A;  4LRR A;  3C0A A;  4XSE A;  3EAW X;  4G2O X;  1HVY A;  2G8A A;  4ISK A;  4O1U A;  4UP1 A;  2RD8 B;  3BFI A;  4H0R A;  1EV5 A;  4DQ1 A;  1NJD A;  3BHR A;  3BZ0 A;  1F4G A;  4EB4 A;  3DL6 A;  1KZI A;  1LCE A;  3C06 A;  4Q0D A;  4XSD A;  1CI7 A;  2G89 A;  1KCE A;  1BSF A;  1TDA A;  1F4D A;  5H3A A;  1LCA A;  1TSM A;  3KGB A;  1TSL A;  1VZE A;  3N5E B;  1TRG A;  1TSN A;  4H1I A;  2RD8 A;  5H38 A;  3EF9 A;  1BID A;  4IRR A;  3UM8 A;  4GEV A;  2RDA A;  4KNZ A;  1BKO A;  4DP3 A;  3I3R A;  3GH2 X;  3BHL A;  1JG0 A;  2TDD A;  2ONB A;  1BQ1 A;  2TSC A;  1F4E A;  3B9H A;  2A9W A;  4G6W X;  1TSX A;  1TDC A;  5J7W A;  2VF0 A;  1THY A;  1NJA A;  4F2V A;  1BPJ A;  3N5E A;  1SYN A;  2VET A;  3H9K A;  1EVG A;  3IK0 A;  4E28 A;  1J3J C;  1TDU A;  3QG2 A;  1AN5 A;  2G8X A;  4JEF A;  1NJB A;  3NRR A;  4H0U A;  3IK1 A;  3UM5 A;  3BGX A;  1LCB A;  1JTQ A;  3EHI X;  1SEJ A;  5WRN A;  1BSP A;  4KYA A;  3GH0 A;  4PSG A;  4XSC A;  1HZW A;  3JSU A;  4KY4 A;  1JMG A;  3IRM A;  4ECK A;  3KJS A;  1BP6 A;  1JTU A;  1JMI A;  1TYS A;  3DG8 C;  2H2Q A;  4E5O A;  2FTN A;  3B5B A;  3CLB A;  1FWM A;  2G86 A;  3DGA C;  1QZF A;  3HB8 A;  3HBB A;  3K2H A;  1ZPR A;  4O1X A;  5BY6 A;  1B49 A;  1DDU A;  1VZB A;  1NCE A;  3CL9 A;  4FGT A;  4GD7 A;  4IQQ A;  1HW3 A;  2OIP A;  1F4C A; 
#chains in the Genus database with same CATH homology
 1BJG A;  3OB7 A;  3IHI A;  1AIQ A;  1JMH A;  2BBQ A;  3QJ7 A;  3KJR A;  3DL5 A;  1VZD A;  1TSW A;  3UM6 A;  4DPH A;  4O1X D;  5HS3 A;  4EZ8 A;  1QQQ A;  1NJE A;  3EDW X;  3HJ3 A;  3IRO A;  4EIN A;  1BO7 A;  4FQS A;  1TLC A;  4Q0E A;  1BP0 A;  1FFL A;  1BKP A;  2FTO X;  3BNZ A;  3INV A;  3TMS A;  1EV8 A;  1TVV A;  1BDU A;  1JUJ A;  1TSY A;  4EIL A;  2FTQ A;  3QGT A;  1AJM A;  2TDM A;  1B02 A;  1NJC A;  4FOG A;  5H39 A;  1TSV A;  3IX6 A;  1J3K C;  3IRN A;  3V8H A;  4FOA A;  1TDB A;  1J3I C;  3BYX A;  4KY8 A;  1BO8 A;  4KPW A;  1B5D A;  3UWL B;  1B5E A;  1HW4 A;  1JU6 A;  1TLS A;  1F4B A;  1RTS A;  3ED7 A;  1JUT A;  1F4F A;  5FCT A;  1F28 A;  1YPV A;  4GYH A;  3EJL A;  1DNA A;  1BQ2 A;  2TSR A;  4TMS A;  3GG5 A;  4DPD A;  1EVF A;  3IJZ A;  4IQB A;  1TSZ A;  1TIS A;  4ISW A;  1I00 A;  3EGY X;  3N5G A;  1VZC A;  2KCE A;  1TSD A;  1AOB A;  2AAZ A;  1AXW A;  2G8D A;  1VZA A;  3UWL A;  1TJS A;  4O7U A;  1JMF A;  1TVU A;  3EBU A;  1KZJ A;  1TVW A;  4FOX A;  4LRR A;  3C0A A;  4XSE A;  3EAW X;  4G2O X;  1HVY A;  2G8A A;  4ISK A;  4O1U A;  4UP1 A;  2RD8 B;  3BFI A;  4H0R A;  1EV5 A;  4DQ1 A;  1NJD A;  3BHR A;  3BZ0 A;  1F4G A;  4EB4 A;  3DL6 A;  1KZI A;  1LCE A;  3C06 A;  4Q0D A;  4XSD A;  1CI7 A;  2G89 A;  1KCE A;  1BSF A;  1TDA A;  1F4D A;  5H3A A;  1LCA A;  1TSM A;  3KGB A;  1TSL A;  1VZE A;  3N5E B;  1TRG A;  1TSN A;  4H1I A;  2RD8 A;  5H38 A;  3EF9 A;  1BID A;  4IRR A;  3UM8 A;  4GEV A;  2RDA A;  4KNZ A;  1BKO A;  4DP3 A;  3I3R A;  3GH2 X;  3BHL A;  1JG0 A;  2TDD A;  2ONB A;  1BQ1 A;  2TSC A;  1F4E A;  3B9H A;  2A9W A;  4G6W X;  1TSX A;  1TDC A;  5J7W A;  2VF0 A;  1THY A;  1NJA A;  4F2V A;  1BPJ A;  3N5E A;  1SYN A;  2VET A;  3H9K A;  1EVG A;  3IK0 A;  4E28 A;  1J3J C;  1TDU A;  3QG2 A;  1AN5 A;  2G8X A;  4JEF A;  1NJB A;  3NRR A;  4H0U A;  3IK1 A;  3UM5 A;  3BGX A;  1LCB A;  1JTQ A;  3EHI X;  1SEJ A;  5WRN A;  1BSP A;  4KYA A;  3GH0 A;  4PSG A;  4XSC A;  1HZW A;  3JSU A;  4KY4 A;  1JMG A;  3IRM A;  4ECK A;  3KJS A;  1BP6 A;  1JTU A;  1JMI A;  1TYS A;  3DG8 C;  2H2Q A;  4E5O A;  2FTN A;  3B5B A;  3CLB A;  1FWM A;  2G86 A;  3DGA C;  1QZF A;  3HB8 A;  3HBB A;  3K2H A;  1ZPR A;  4O1X A;  5BY6 A;  1B49 A;  1DDU A;  1VZB A;  1NCE A;  3CL9 A;  4FGT A;  4GD7 A;  4IQQ A;  1HW3 A;  2OIP A;  1F4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...