1HVYA

Human thymidylate synthase complexed with dump and raltitrexed, an antifolate drug, is in the closed conformation
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
288
structure length
287
Chain Sequence
PPHGELQYLGQIQHILRGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human thymidylate synthase is in the closed conformation when complexed with dUMP and raltitrexed, an antifolate drug
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Homo sapiens
total genus 93
structure length 287
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1hvyA00
4ECKA 3V8HA 1BO7A 1F4DA 1BSFA 2ONBA 1JTUA 1JUJA 1TVWA 2VF0A 4G2OX 4JEFA 3HJ3A 1F4CA 1TSZA 1B5EA 4O1XD 1TLCA 3DGAC 3BFIA 1JMGA 1NJAA 4IQBA 4XSDA 1TDCA 1EV8A 3EF9A 4ISKA 2TDMA 4G6WX 4O1XA 1B49A 3I3RA 3QJ7A 3UM8A 4DPDA 1F28A 3GH2X 3B9HA 4KY4A 3UM6A 5H39A 1EVFA 1JU6A 1NJBA 1TRGA 3UM5A 1TVVA 1EVGA 3DL5A 5FCTA 1J3IC 1HW3A 3C0AA 4DPHA 3EJLA 4IQQA 3EGYX 3DG8C 1BP0A 1TDAA 1HVYA 1JTQA 1F4GA 4EILA 1J3JC 2AAZA 1BQ2A 1NJDA 1TVUA 3EDWX 1BDUA 1TSLA 4GD7A 4FOXA 5WRNA 1BKPA 2G86A 2TSRA 1BIDA 3GG5A 4ISWA 3C06A 1AXWA 4PSGA 1TSDA 2FTNA 1BSPA 2H2QA 3IX6A 1BQ1A 1QZFA 4FGTA 1BJGA 3N5EA 3UWLA 3KJSA 1TYSA 4GEVA 3EAWX 1F4FA 1RTSA 3BNZA 4O1UA 3BYXA 1SEJA 1TSNA 1AN5A 1TISA 3B5BA 1JMFA 3IRMA 1KCEA 2RD8B 2RDAA 5HS3A 3IJZA 4FQSA 2KCEA 4IRRA 3TMSA 4H0UA 4KNZA 3BZ0A 3H9KA 3IROA 1NJCA 3OB7A 5H38A 1JMIA 3IRNA 1J3KC 4O7UA 4FOAA 2A9WA 1THYA 1HW4A 1EV5A 3NRRA 4EB4A 1TSYA 3CL9A 3EBUA 3KJRA 4H1IA 1B5DA 2FTQA 4KPWA 5BY6A 1LCBA 1B02A 1BP6A 1JMHA 1F4EA 1VZAA 1FFLA 2G8DA 1TDUA 2TSCA 1LCEA 3BHRA 2VETA 1AIQA 1TJSA 3IHIA 1TSXA 4Q0DA 1ZPRA 1QQQA 2G89A 1TSVA 3IK1A 4EINA 4XSEA 1NCEA 1BPJA 1VZEA 3GH0A 4GYHA 1LCAA 1CI7A 3BGXA 5J7WA 4Q0EA 3QGTA 1VZBA 4FOGA 1JG0A 1JUTA 2BBQA 3QG2A 1TLSA 1TSWA 1BO8A 2TDDA 1DNAA 1TSMA 4E28A 2FTOX 3KGBA 1VZCA 5H3AA 3JSUA 2OIPA 3DL6A 1NJEA 1YPVA 3CLBA 3N5EB 3UWLB 1HZWA 4EZ8A 2G8AA 3IK0A 4KY8A 4DP3A 4F2VA 1TDBA 4TMSA 4KYAA 1I00A 4DQ1A 1DDUA 4H0RA 3ED7A 4E5OA 2G8XA 1KZIA 3K2HA 1VZDA 1BKOA 3HBBA 3EHIX 4LRRA 3N5GA 2RD8A 3INVA 1FWMA 1SYNA 4UP1A 4XSCA 1AJMA 1F4BA 1KZJA 3BHLA 3HB8A 1AOBA
chains in the Genus database with same CATH superfamily
4ECKA 3V8HA 1BO7A 1F4DA 1BSFA 2ONBA 1JTUA 1JUJA 1TVWA 2VF0A 4G2OX 4JEFA 3HJ3A 1F4CA 1TSZA 1B5EA 4O1XD 1TLCA 3DGAC 3BFIA 1JMGA 1NJAA 4IQBA 4XSDA 1TDCA 1EV8A 3EF9A 4ISKA 2TDMA 4G6WX 4O1XA 1B49A 3I3RA 3QJ7A 3UM8A 4DPDA 1F28A 3GH2X 3B9HA 4KY4A 3UM6A 5H39A 1EVFA 1JU6A 1NJBA 1TRGA 3UM5A 1TVVA 1EVGA 3DL5A 5FCTA 1J3IC 1HW3A 3C0AA 4DPHA 3EJLA 4IQQA 3EGYX 3DG8C 1BP0A 1TDAA 1HVYA 1JTQA 1F4GA 4EILA 1J3JC 2AAZA 1BQ2A 1NJDA 1TVUA 3EDWX 1BDUA 1TSLA 4GD7A 4FOXA 5WRNA 1BKPA 2G86A 2TSRA 1BIDA 3GG5A 4ISWA 3C06A 1AXWA 4PSGA 1TSDA 2FTNA 1BSPA 2H2QA 3IX6A 1BQ1A 1QZFA 4FGTA 1BJGA 3N5EA 3UWLA 3KJSA 1TYSA 4GEVA 3EAWX 1F4FA 1RTSA 3BNZA 4O1UA 3BYXA 1SEJA 1TSNA 1AN5A 1TISA 3B5BA 1JMFA 3IRMA 1KCEA 2RD8B 2RDAA 5HS3A 3IJZA 4FQSA 2KCEA 4IRRA 3TMSA 4H0UA 4KNZA 3BZ0A 3H9KA 3IROA 1NJCA 3OB7A 5H38A 1JMIA 3IRNA 1J3KC 4O7UA 4FOAA 2A9WA 1THYA 1HW4A 1EV5A 3NRRA 4EB4A 1TSYA 3CL9A 3EBUA 3KJRA 4H1IA 1B5DA 2FTQA 4KPWA 5BY6A 1LCBA 1B02A 1BP6A 1JMHA 1F4EA 1VZAA 1FFLA 2G8DA 1TDUA 2TSCA 1LCEA 3BHRA 2VETA 1AIQA 1TJSA 3IHIA 1TSXA 4Q0DA 1ZPRA 1QQQA 2G89A 1TSVA 3IK1A 4EINA 4XSEA 1NCEA 1BPJA 1VZEA 3GH0A 4GYHA 1LCAA 1CI7A 3BGXA 5J7WA 4Q0EA 3QGTA 1VZBA 4FOGA 1JG0A 1JUTA 2BBQA 3QG2A 1TLSA 1TSWA 1BO8A 2TDDA 1DNAA 1TSMA 4E28A 2FTOX 3KGBA 1VZCA 5H3AA 3JSUA 2OIPA 3DL6A 1NJEA 1YPVA 3CLBA 3N5EB 3UWLB 1HZWA 4EZ8A 2G8AA 3IK0A 4KY8A 4DP3A 4F2VA 1TDBA 4TMSA 4KYAA 1I00A 4DQ1A 1DDUA 4H0RA 3ED7A 4E5OA 2G8XA 1KZIA 3K2HA 1VZDA 1BKOA 3HBBA 3EHIX 4LRRA 3N5GA 2RD8A 3INVA 1FWMA 1SYNA 4UP1A 4XSCA 1AJMA 1F4BA 1KZJA 3BHLA 3HB8A 1AOBA
chains in the Genus database with same CATH topology
4ECKA 3V8HA 1BO7A 1F4DA 1BSFA 2ONBA 1JTUA 1JUJA 1TVWA 2VF0A 4G2OX 4JEFA 3HJ3A 1F4CA 1TSZA 1B5EA 4O1XD 1TLCA 3DGAC 3BFIA 1JMGA 1NJAA 4IQBA 4XSDA 1TDCA 1EV8A 3EF9A 4ISKA 2TDMA 4G6WX 4O1XA 1B49A 3I3RA 3QJ7A 3UM8A 4DPDA 1F28A 3GH2X 3B9HA 4KY4A 3UM6A 5H39A 1EVFA 1JU6A 1NJBA 1TRGA 3UM5A 1TVVA 1EVGA 3DL5A 5FCTA 1J3IC 1HW3A 3C0AA 4DPHA 3EJLA 4IQQA 3EGYX 3DG8C 1BP0A 1TDAA 1HVYA 1JTQA 1F4GA 4EILA 1J3JC 2AAZA 1BQ2A 1NJDA 1TVUA 3EDWX 1BDUA 1TSLA 4GD7A 4FOXA 5WRNA 1BKPA 2G86A 2TSRA 1BIDA 3GG5A 4ISWA 3C06A 1AXWA 4PSGA 1TSDA 2FTNA 1BSPA 2H2QA 3IX6A 1BQ1A 1QZFA 4FGTA 1BJGA 3N5EA 3UWLA 3KJSA 1TYSA 4GEVA 3EAWX 1F4FA 1RTSA 3BNZA 4O1UA 3BYXA 1SEJA 1TSNA 1AN5A 1TISA 3B5BA 1JMFA 3IRMA 1KCEA 2RD8B 2RDAA 5HS3A 3IJZA 4FQSA 2KCEA 4IRRA 3TMSA 4H0UA 4KNZA 3BZ0A 3H9KA 3IROA 1NJCA 3OB7A 5H38A 1JMIA 3IRNA 1J3KC 4O7UA 4FOAA 2A9WA 1THYA 1HW4A 1EV5A 3NRRA 4EB4A 1TSYA 3CL9A 3EBUA 3KJRA 4H1IA 1B5DA 2FTQA 4KPWA 5BY6A 1LCBA 1B02A 1BP6A 1JMHA 1F4EA 1VZAA 1FFLA 2G8DA 1TDUA 2TSCA 1LCEA 3BHRA 2VETA 1AIQA 1TJSA 3IHIA 1TSXA 4Q0DA 1ZPRA 1QQQA 2G89A 1TSVA 3IK1A 4EINA 4XSEA 1NCEA 1BPJA 1VZEA 3GH0A 4GYHA 1LCAA 1CI7A 3BGXA 5J7WA 4Q0EA 3QGTA 1VZBA 4FOGA 1JG0A 1JUTA 2BBQA 3QG2A 1TLSA 1TSWA 1BO8A 2TDDA 1DNAA 1TSMA 4E28A 2FTOX 3KGBA 1VZCA 5H3AA 3JSUA 2OIPA 3DL6A 1NJEA 1YPVA 3CLBA 3N5EB 3UWLB 1HZWA 4EZ8A 2G8AA 3IK0A 4KY8A 4DP3A 4F2VA 1TDBA 4TMSA 4KYAA 1I00A 4DQ1A 1DDUA 4H0RA 3ED7A 4E5OA 2G8XA 1KZIA 3K2HA 1VZDA 1BKOA 3HBBA 3EHIX 4LRRA 3N5GA 2RD8A 3INVA 1FWMA 1SYNA 4UP1A 4XSCA 1AJMA 1F4BA 1KZJA 3BHLA 3HB8A 1AOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECK A;  3V8H A;  1BO7 A;  1F4D A;  1BSF A;  2ONB A;  1JTU A;  1JUJ A;  1TVW A;  2VF0 A;  4G2O X;  4JEF A;  3HJ3 A;  1F4C A;  1TSZ A;  1B5E A;  4O1X D;  1TLC A;  3DGA C;  3BFI A;  1JMG A;  1NJA A;  4IQB A;  4XSD A;  1TDC A;  1EV8 A;  3EF9 A;  4ISK A;  2TDM A;  4G6W X;  4O1X A;  1B49 A;  3I3R A;  3QJ7 A;  3UM8 A;  4DPD A;  1F28 A;  3GH2 X;  3B9H A;  4KY4 A;  3UM6 A;  5H39 A;  1EVF A;  1JU6 A;  1NJB A;  1TRG A;  3UM5 A;  1TVV A;  1EVG A;  3DL5 A;  5FCT A;  1J3I C;  1HW3 A;  3C0A A;  4DPH A;  3EJL A;  4IQQ A;  3EGY X;  3DG8 C;  1BP0 A;  1TDA A;  1HVY A;  1JTQ A;  1F4G A;  4EIL A;  1J3J C;  2AAZ A;  1BQ2 A;  1NJD A;  1TVU A;  3EDW X;  1BDU A;  1TSL A;  4GD7 A;  4FOX A;  5WRN A;  1BKP A;  2G86 A;  2TSR A;  1BID A;  3GG5 A;  4ISW A;  3C06 A;  1AXW A;  4PSG A;  1TSD A;  2FTN A;  1BSP A;  2H2Q A;  3IX6 A;  1BQ1 A;  1QZF A;  4FGT A;  1BJG A;  3N5E A;  3UWL A;  3KJS A;  1TYS A;  4GEV A;  3EAW X;  1F4F A;  1RTS A;  3BNZ A;  4O1U A;  3BYX A;  1SEJ A;  1TSN A;  1AN5 A;  1TIS A;  3B5B A;  1JMF A;  3IRM A;  1KCE A;  2RD8 B;  2RDA A;  5HS3 A;  3IJZ A;  4FQS A;  2KCE A;  4IRR A;  3TMS A;  4H0U A;  4KNZ A;  3BZ0 A;  3H9K A;  3IRO A;  1NJC A;  3OB7 A;  5H38 A;  1JMI A;  3IRN A;  1J3K C;  4O7U A;  4FOA A;  2A9W A;  1THY A;  1HW4 A;  1EV5 A;  3NRR A;  4EB4 A;  1TSY A;  3CL9 A;  3EBU A;  3KJR A;  4H1I A;  1B5D A;  2FTQ A;  4KPW A;  5BY6 A;  1LCB A;  1B02 A;  1BP6 A;  1JMH A;  1F4E A;  1VZA A;  1FFL A;  2G8D A;  1TDU A;  2TSC A;  1LCE A;  3BHR A;  2VET A;  1AIQ A;  1TJS A;  3IHI A;  1TSX A;  4Q0D A;  1ZPR A;  1QQQ A;  2G89 A;  1TSV A;  3IK1 A;  4EIN A;  4XSE A;  1NCE A;  1BPJ A;  1VZE A;  3GH0 A;  4GYH A;  1LCA A;  1CI7 A;  3BGX A;  5J7W A;  4Q0E A;  3QGT A;  1VZB A;  4FOG A;  1JG0 A;  1JUT A;  2BBQ A;  3QG2 A;  1TLS A;  1TSW A;  1BO8 A;  2TDD A;  1DNA A;  1TSM A;  4E28 A;  2FTO X;  3KGB A;  1VZC A;  5H3A A;  3JSU A;  2OIP A;  3DL6 A;  1NJE A;  1YPV A;  3CLB A;  3N5E B;  3UWL B;  1HZW A;  4EZ8 A;  2G8A A;  3IK0 A;  4KY8 A;  4DP3 A;  4F2V A;  1TDB A;  4TMS A;  4KYA A;  1I00 A;  4DQ1 A;  1DDU A;  4H0R A;  3ED7 A;  4E5O A;  2G8X A;  1KZI A;  3K2H A;  1VZD A;  1BKO A;  3HBB A;  3EHI X;  4LRR A;  3N5G A;  2RD8 A;  3INV A;  1FWM A;  1SYN A;  4UP1 A;  4XSC A;  1AJM A;  1F4B A;  1KZJ A;  3BHL A;  3HB8 A;  1AOB A; 
#chains in the Genus database with same CATH topology
 4ECK A;  3V8H A;  1BO7 A;  1F4D A;  1BSF A;  2ONB A;  1JTU A;  1JUJ A;  1TVW A;  2VF0 A;  4G2O X;  4JEF A;  3HJ3 A;  1F4C A;  1TSZ A;  1B5E A;  4O1X D;  1TLC A;  3DGA C;  3BFI A;  1JMG A;  1NJA A;  4IQB A;  4XSD A;  1TDC A;  1EV8 A;  3EF9 A;  4ISK A;  2TDM A;  4G6W X;  4O1X A;  1B49 A;  3I3R A;  3QJ7 A;  3UM8 A;  4DPD A;  1F28 A;  3GH2 X;  3B9H A;  4KY4 A;  3UM6 A;  5H39 A;  1EVF A;  1JU6 A;  1NJB A;  1TRG A;  3UM5 A;  1TVV A;  1EVG A;  3DL5 A;  5FCT A;  1J3I C;  1HW3 A;  3C0A A;  4DPH A;  3EJL A;  4IQQ A;  3EGY X;  3DG8 C;  1BP0 A;  1TDA A;  1HVY A;  1JTQ A;  1F4G A;  4EIL A;  1J3J C;  2AAZ A;  1BQ2 A;  1NJD A;  1TVU A;  3EDW X;  1BDU A;  1TSL A;  4GD7 A;  4FOX A;  5WRN A;  1BKP A;  2G86 A;  2TSR A;  1BID A;  3GG5 A;  4ISW A;  3C06 A;  1AXW A;  4PSG A;  1TSD A;  2FTN A;  1BSP A;  2H2Q A;  3IX6 A;  1BQ1 A;  1QZF A;  4FGT A;  1BJG A;  3N5E A;  3UWL A;  3KJS A;  1TYS A;  4GEV A;  3EAW X;  1F4F A;  1RTS A;  3BNZ A;  4O1U A;  3BYX A;  1SEJ A;  1TSN A;  1AN5 A;  1TIS A;  3B5B A;  1JMF A;  3IRM A;  1KCE A;  2RD8 B;  2RDA A;  5HS3 A;  3IJZ A;  4FQS A;  2KCE A;  4IRR A;  3TMS A;  4H0U A;  4KNZ A;  3BZ0 A;  3H9K A;  3IRO A;  1NJC A;  3OB7 A;  5H38 A;  1JMI A;  3IRN A;  1J3K C;  4O7U A;  4FOA A;  2A9W A;  1THY A;  1HW4 A;  1EV5 A;  3NRR A;  4EB4 A;  1TSY A;  3CL9 A;  3EBU A;  3KJR A;  4H1I A;  1B5D A;  2FTQ A;  4KPW A;  5BY6 A;  1LCB A;  1B02 A;  1BP6 A;  1JMH A;  1F4E A;  1VZA A;  1FFL A;  2G8D A;  1TDU A;  2TSC A;  1LCE A;  3BHR A;  2VET A;  1AIQ A;  1TJS A;  3IHI A;  1TSX A;  4Q0D A;  1ZPR A;  1QQQ A;  2G89 A;  1TSV A;  3IK1 A;  4EIN A;  4XSE A;  1NCE A;  1BPJ A;  1VZE A;  3GH0 A;  4GYH A;  1LCA A;  1CI7 A;  3BGX A;  5J7W A;  4Q0E A;  3QGT A;  1VZB A;  4FOG A;  1JG0 A;  1JUT A;  2BBQ A;  3QG2 A;  1TLS A;  1TSW A;  1BO8 A;  2TDD A;  1DNA A;  1TSM A;  4E28 A;  2FTO X;  3KGB A;  1VZC A;  5H3A A;  3JSU A;  2OIP A;  3DL6 A;  1NJE A;  1YPV A;  3CLB A;  3N5E B;  3UWL B;  1HZW A;  4EZ8 A;  2G8A A;  3IK0 A;  4KY8 A;  4DP3 A;  4F2V A;  1TDB A;  4TMS A;  4KYA A;  1I00 A;  4DQ1 A;  1DDU A;  4H0R A;  3ED7 A;  4E5O A;  2G8X A;  1KZI A;  3K2H A;  1VZD A;  1BKO A;  3HBB A;  3EHI X;  4LRR A;  3N5G A;  2RD8 A;  3INV A;  1FWM A;  1SYN A;  4UP1 A;  4XSC A;  1AJM A;  1F4B A;  1KZJ A;  3BHL A;  3HB8 A;  1AOB A; 
#chains in the Genus database with same CATH homology
 4ECK A;  3V8H A;  1BO7 A;  1F4D A;  1BSF A;  2ONB A;  1JTU A;  1JUJ A;  1TVW A;  2VF0 A;  4G2O X;  4JEF A;  3HJ3 A;  1F4C A;  1TSZ A;  1B5E A;  4O1X D;  1TLC A;  3DGA C;  3BFI A;  1JMG A;  1NJA A;  4IQB A;  4XSD A;  1TDC A;  1EV8 A;  3EF9 A;  4ISK A;  2TDM A;  4G6W X;  4O1X A;  1B49 A;  3I3R A;  3QJ7 A;  3UM8 A;  4DPD A;  1F28 A;  3GH2 X;  3B9H A;  4KY4 A;  3UM6 A;  5H39 A;  1EVF A;  1JU6 A;  1NJB A;  1TRG A;  3UM5 A;  1TVV A;  1EVG A;  3DL5 A;  5FCT A;  1J3I C;  1HW3 A;  3C0A A;  4DPH A;  3EJL A;  4IQQ A;  3EGY X;  3DG8 C;  1BP0 A;  1TDA A;  1HVY A;  1JTQ A;  1F4G A;  4EIL A;  1J3J C;  2AAZ A;  1BQ2 A;  1NJD A;  1TVU A;  3EDW X;  1BDU A;  1TSL A;  4GD7 A;  4FOX A;  5WRN A;  1BKP A;  2G86 A;  2TSR A;  1BID A;  3GG5 A;  4ISW A;  3C06 A;  1AXW A;  4PSG A;  1TSD A;  2FTN A;  1BSP A;  2H2Q A;  3IX6 A;  1BQ1 A;  1QZF A;  4FGT A;  1BJG A;  3N5E A;  3UWL A;  3KJS A;  1TYS A;  4GEV A;  3EAW X;  1F4F A;  1RTS A;  3BNZ A;  4O1U A;  3BYX A;  1SEJ A;  1TSN A;  1AN5 A;  1TIS A;  3B5B A;  1JMF A;  3IRM A;  1KCE A;  2RD8 B;  2RDA A;  5HS3 A;  3IJZ A;  4FQS A;  2KCE A;  4IRR A;  3TMS A;  4H0U A;  4KNZ A;  3BZ0 A;  3H9K A;  3IRO A;  1NJC A;  3OB7 A;  5H38 A;  1JMI A;  3IRN A;  1J3K C;  4O7U A;  4FOA A;  2A9W A;  1THY A;  1HW4 A;  1EV5 A;  3NRR A;  4EB4 A;  1TSY A;  3CL9 A;  3EBU A;  3KJR A;  4H1I A;  1B5D A;  2FTQ A;  4KPW A;  5BY6 A;  1LCB A;  1B02 A;  1BP6 A;  1JMH A;  1F4E A;  1VZA A;  1FFL A;  2G8D A;  1TDU A;  2TSC A;  1LCE A;  3BHR A;  2VET A;  1AIQ A;  1TJS A;  3IHI A;  1TSX A;  4Q0D A;  1ZPR A;  1QQQ A;  2G89 A;  1TSV A;  3IK1 A;  4EIN A;  4XSE A;  1NCE A;  1BPJ A;  1VZE A;  3GH0 A;  4GYH A;  1LCA A;  1CI7 A;  3BGX A;  5J7W A;  4Q0E A;  3QGT A;  1VZB A;  4FOG A;  1JG0 A;  1JUT A;  2BBQ A;  3QG2 A;  1TLS A;  1TSW A;  1BO8 A;  2TDD A;  1DNA A;  1TSM A;  4E28 A;  2FTO X;  3KGB A;  1VZC A;  5H3A A;  3JSU A;  2OIP A;  3DL6 A;  1NJE A;  1YPV A;  3CLB A;  3N5E B;  3UWL B;  1HZW A;  4EZ8 A;  2G8A A;  3IK0 A;  4KY8 A;  4DP3 A;  4F2V A;  1TDB A;  4TMS A;  4KYA A;  1I00 A;  4DQ1 A;  1DDU A;  4H0R A;  3ED7 A;  4E5O A;  2G8X A;  1KZI A;  3K2H A;  1VZD A;  1BKO A;  3HBB A;  3EHI X;  4LRR A;  3N5G A;  2RD8 A;  3INV A;  1FWM A;  1SYN A;  4UP1 A;  4XSC A;  1AJM A;  1F4B A;  1KZJ A;  3BHL A;  3HB8 A;  1AOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...