1F4FA

Crystal structure of e. coli thymidylate synthase complexed with sp-722
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
261
structure length
261
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-directed ligand discovery.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Escherichia coli
total genus 78
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1f4fA00
3B5BA 1BO7A 4UP1A 1QQQA 2VETA 1F4FA 3CLBA 1F28A 1SEJA 1THYA 1TDCA 3IK1A 4O7UA 3DL6A 1BQ1A 1NJCA 1B5DA 3EBUA 5HS3A 2FTNA 1F4BA 2G8XA 1EVGA 1KZIA 3NRRA 1LCEA 4KPWA 4PSGA 1BPJA 1F4DA 1BP0A 4DP3A 3EGYX 1BO8A 3EDWX 4DPDA 3C0AA 3HB8A 3DL5A 1F4GA 1CI7A 1RTSA 1HW4A 1HZWA 1JTQA 3IHIA 3UWLB 3INVA 1F4EA 4TMSA 4IRRA 1JMGA 3KGBA 3IRNA 1VZDA 1VZCA 4KNZA 3EAWX 1TSMA 4ISKA 3EJLA 1EVFA 1TISA 3GH0A 1LCBA 3BFIA 3BNZA 1ZPRA 2G8DA 4H0UA 1QZFA 5H3AA 4DQ1A 1BP6A 1BQ2A 1J3IC 4GEVA 1B49A 1TYSA 3IK0A 2AAZA 4EB4A 1VZBA 1TLSA 1KZJA 2KCEA 3ED7A 3IROA 3EHIX 4GYHA 4G2OX 4KYAA 4IQQA 4Q0EA 3TMSA 2TDMA 4H1IA 4G6WX 3N5EA 3C06A 1LCAA 1DDUA 1AJMA 2TDDA 2FTQA 1J3KC 1BIDA 1AIQA 1TSZA 2G86A 1TSYA 2TSRA 2RD8A 1FWMA 1BDUA 1TVWA 2RDAA 4GD7A 4EZ8A 5H38A 1JMFA 3IX6A 3BGXA 1B02A 4EILA 1JUJA 1YPVA 3QJ7A 3UM8A 1KCEA 4EINA 1BSFA 1EV5A 1TSLA 1JMIA 1BKPA 1TSVA 1AOBA 3UM5A 3B9HA 1NCEA 1AXWA 1JG0A 1I00A 1VZAA 3EF9A 1TSXA 3OB7A 1TLCA 1HVYA 4H0RA 3V8HA 4JEFA 1JU6A 4LRRA 4FOXA 4IQBA 3DG8C 3BHLA 2TSCA 3BZ0A 1NJAA 1TDAA 3QGTA 4O1XA 3DGAC 3CL9A 1F4CA 3GG5A 3H9KA 5BY6A 3IJZA 2FTOX 4E28A 1JMHA 3KJSA 4O1XD 5FCTA 2VF0A 4E5OA 3N5EB 1TSNA 3GH2X 4XSDA 3HBBA 1TRGA 1NJDA 1VZEA 1B5EA 1TSWA 4Q0DA 1TJSA 2RD8B 3N5GA 4O1UA 1EV8A 1JTUA 1TDUA 2G8AA 1SYNA 3BHRA 4F2VA 3QG2A 4DPHA 2ONBA 4FOGA 5J7WA 4KY8A 2OIPA 1TSDA 3IRMA 1BKOA 3JSUA 5H39A 3K2HA 3UM6A 1JUTA 3UWLA 3KJRA 2H2QA 1HW3A 4KY4A 1TVVA 1AN5A 1FFLA 4FOAA 1J3JC 4XSCA 1NJBA 2A9WA 4ISWA 4FQSA 5WRNA 4XSEA 1BSPA 1TDBA 3HJ3A 2G89A 1NJEA 3I3RA 4ECKA 4FGTA 1DNAA 1TVUA 1BJGA 2BBQA 3BYXA
chains in the Genus database with same CATH superfamily
3B5BA 1BO7A 4UP1A 1QQQA 2VETA 1F4FA 3CLBA 1F28A 1SEJA 1THYA 1TDCA 3IK1A 4O7UA 3DL6A 1BQ1A 1NJCA 1B5DA 3EBUA 5HS3A 2FTNA 1F4BA 2G8XA 1EVGA 1KZIA 3NRRA 1LCEA 4KPWA 4PSGA 1BPJA 1F4DA 1BP0A 4DP3A 3EGYX 1BO8A 3EDWX 4DPDA 3C0AA 3HB8A 3DL5A 1F4GA 1CI7A 1RTSA 1HW4A 1HZWA 1JTQA 3IHIA 3UWLB 3INVA 1F4EA 4TMSA 4IRRA 1JMGA 3KGBA 3IRNA 1VZDA 1VZCA 4KNZA 3EAWX 1TSMA 4ISKA 3EJLA 1EVFA 1TISA 3GH0A 1LCBA 3BFIA 3BNZA 1ZPRA 2G8DA 4H0UA 1QZFA 5H3AA 4DQ1A 1BP6A 1BQ2A 1J3IC 4GEVA 1B49A 1TYSA 3IK0A 2AAZA 4EB4A 1VZBA 1TLSA 1KZJA 2KCEA 3ED7A 3IROA 3EHIX 4GYHA 4G2OX 4KYAA 4IQQA 4Q0EA 3TMSA 2TDMA 4H1IA 4G6WX 3N5EA 3C06A 1LCAA 1DDUA 1AJMA 2TDDA 2FTQA 1J3KC 1BIDA 1AIQA 1TSZA 2G86A 1TSYA 2TSRA 2RD8A 1FWMA 1BDUA 1TVWA 2RDAA 4GD7A 4EZ8A 5H38A 1JMFA 3IX6A 3BGXA 1B02A 4EILA 1JUJA 1YPVA 3QJ7A 3UM8A 1KCEA 4EINA 1BSFA 1EV5A 1TSLA 1JMIA 1BKPA 1TSVA 1AOBA 3UM5A 3B9HA 1NCEA 1AXWA 1JG0A 1I00A 1VZAA 3EF9A 1TSXA 3OB7A 1TLCA 1HVYA 4H0RA 3V8HA 4JEFA 1JU6A 4LRRA 4FOXA 4IQBA 3DG8C 3BHLA 2TSCA 3BZ0A 1NJAA 1TDAA 3QGTA 4O1XA 3DGAC 3CL9A 1F4CA 3GG5A 3H9KA 5BY6A 3IJZA 2FTOX 4E28A 1JMHA 3KJSA 4O1XD 5FCTA 2VF0A 4E5OA 3N5EB 1TSNA 3GH2X 4XSDA 3HBBA 1TRGA 1NJDA 1VZEA 1B5EA 1TSWA 4Q0DA 1TJSA 2RD8B 3N5GA 4O1UA 1EV8A 1JTUA 1TDUA 2G8AA 1SYNA 3BHRA 4F2VA 3QG2A 4DPHA 2ONBA 4FOGA 5J7WA 4KY8A 2OIPA 1TSDA 3IRMA 1BKOA 3JSUA 5H39A 3K2HA 3UM6A 1JUTA 3UWLA 3KJRA 2H2QA 1HW3A 4KY4A 1TVVA 1AN5A 1FFLA 4FOAA 1J3JC 4XSCA 1NJBA 2A9WA 4ISWA 4FQSA 5WRNA 4XSEA 1BSPA 1TDBA 3HJ3A 2G89A 1NJEA 3I3RA 4ECKA 4FGTA 1DNAA 1TVUA 1BJGA 2BBQA 3BYXA
chains in the Genus database with same CATH topology
3B5BA 1BO7A 4UP1A 1QQQA 2VETA 1F4FA 3CLBA 1F28A 1SEJA 1THYA 1TDCA 3IK1A 4O7UA 3DL6A 1BQ1A 1NJCA 1B5DA 3EBUA 5HS3A 2FTNA 1F4BA 2G8XA 1EVGA 1KZIA 3NRRA 1LCEA 4KPWA 4PSGA 1BPJA 1F4DA 1BP0A 4DP3A 3EGYX 1BO8A 3EDWX 4DPDA 3C0AA 3HB8A 3DL5A 1F4GA 1CI7A 1RTSA 1HW4A 1HZWA 1JTQA 3IHIA 3UWLB 3INVA 1F4EA 4TMSA 4IRRA 1JMGA 3KGBA 3IRNA 1VZDA 1VZCA 4KNZA 3EAWX 1TSMA 4ISKA 3EJLA 1EVFA 1TISA 3GH0A 1LCBA 3BFIA 3BNZA 1ZPRA 2G8DA 4H0UA 1QZFA 5H3AA 4DQ1A 1BP6A 1BQ2A 1J3IC 4GEVA 1B49A 1TYSA 3IK0A 2AAZA 4EB4A 1VZBA 1TLSA 1KZJA 2KCEA 3ED7A 3IROA 3EHIX 4GYHA 4G2OX 4KYAA 4IQQA 4Q0EA 3TMSA 2TDMA 4H1IA 4G6WX 3N5EA 3C06A 1LCAA 1DDUA 1AJMA 2TDDA 2FTQA 1J3KC 1BIDA 1AIQA 1TSZA 2G86A 1TSYA 2TSRA 2RD8A 1FWMA 1BDUA 1TVWA 2RDAA 4GD7A 4EZ8A 5H38A 1JMFA 3IX6A 3BGXA 1B02A 4EILA 1JUJA 1YPVA 3QJ7A 3UM8A 1KCEA 4EINA 1BSFA 1EV5A 1TSLA 1JMIA 1BKPA 1TSVA 1AOBA 3UM5A 3B9HA 1NCEA 1AXWA 1JG0A 1I00A 1VZAA 3EF9A 1TSXA 3OB7A 1TLCA 1HVYA 4H0RA 3V8HA 4JEFA 1JU6A 4LRRA 4FOXA 4IQBA 3DG8C 3BHLA 2TSCA 3BZ0A 1NJAA 1TDAA 3QGTA 4O1XA 3DGAC 3CL9A 1F4CA 3GG5A 3H9KA 5BY6A 3IJZA 2FTOX 4E28A 1JMHA 3KJSA 4O1XD 5FCTA 2VF0A 4E5OA 3N5EB 1TSNA 3GH2X 4XSDA 3HBBA 1TRGA 1NJDA 1VZEA 1B5EA 1TSWA 4Q0DA 1TJSA 2RD8B 3N5GA 4O1UA 1EV8A 1JTUA 1TDUA 2G8AA 1SYNA 3BHRA 4F2VA 3QG2A 4DPHA 2ONBA 4FOGA 5J7WA 4KY8A 2OIPA 1TSDA 3IRMA 1BKOA 3JSUA 5H39A 3K2HA 3UM6A 1JUTA 3UWLA 3KJRA 2H2QA 1HW3A 4KY4A 1TVVA 1AN5A 1FFLA 4FOAA 1J3JC 4XSCA 1NJBA 2A9WA 4ISWA 4FQSA 5WRNA 4XSEA 1BSPA 1TDBA 3HJ3A 2G89A 1NJEA 3I3RA 4ECKA 4FGTA 1DNAA 1TVUA 1BJGA 2BBQA 3BYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5B A;  1BO7 A;  4UP1 A;  1QQQ A;  2VET A;  1F4F A;  3CLB A;  1F28 A;  1SEJ A;  1THY A;  1TDC A;  3IK1 A;  4O7U A;  3DL6 A;  1BQ1 A;  1NJC A;  1B5D A;  3EBU A;  5HS3 A;  2FTN A;  1F4B A;  2G8X A;  1EVG A;  1KZI A;  3NRR A;  1LCE A;  4KPW A;  4PSG A;  1BPJ A;  1F4D A;  1BP0 A;  4DP3 A;  3EGY X;  1BO8 A;  3EDW X;  4DPD A;  3C0A A;  3HB8 A;  3DL5 A;  1F4G A;  1CI7 A;  1RTS A;  1HW4 A;  1HZW A;  1JTQ A;  3IHI A;  3UWL B;  3INV A;  1F4E A;  4TMS A;  4IRR A;  1JMG A;  3KGB A;  3IRN A;  1VZD A;  1VZC A;  4KNZ A;  3EAW X;  1TSM A;  4ISK A;  3EJL A;  1EVF A;  1TIS A;  3GH0 A;  1LCB A;  3BFI A;  3BNZ A;  1ZPR A;  2G8D A;  4H0U A;  1QZF A;  5H3A A;  4DQ1 A;  1BP6 A;  1BQ2 A;  1J3I C;  4GEV A;  1B49 A;  1TYS A;  3IK0 A;  2AAZ A;  4EB4 A;  1VZB A;  1TLS A;  1KZJ A;  2KCE A;  3ED7 A;  3IRO A;  3EHI X;  4GYH A;  4G2O X;  4KYA A;  4IQQ A;  4Q0E A;  3TMS A;  2TDM A;  4H1I A;  4G6W X;  3N5E A;  3C06 A;  1LCA A;  1DDU A;  1AJM A;  2TDD A;  2FTQ A;  1J3K C;  1BID A;  1AIQ A;  1TSZ A;  2G86 A;  1TSY A;  2TSR A;  2RD8 A;  1FWM A;  1BDU A;  1TVW A;  2RDA A;  4GD7 A;  4EZ8 A;  5H38 A;  1JMF A;  3IX6 A;  3BGX A;  1B02 A;  4EIL A;  1JUJ A;  1YPV A;  3QJ7 A;  3UM8 A;  1KCE A;  4EIN A;  1BSF A;  1EV5 A;  1TSL A;  1JMI A;  1BKP A;  1TSV A;  1AOB A;  3UM5 A;  3B9H A;  1NCE A;  1AXW A;  1JG0 A;  1I00 A;  1VZA A;  3EF9 A;  1TSX A;  3OB7 A;  1TLC A;  1HVY A;  4H0R A;  3V8H A;  4JEF A;  1JU6 A;  4LRR A;  4FOX A;  4IQB A;  3DG8 C;  3BHL A;  2TSC A;  3BZ0 A;  1NJA A;  1TDA A;  3QGT A;  4O1X A;  3DGA C;  3CL9 A;  1F4C A;  3GG5 A;  3H9K A;  5BY6 A;  3IJZ A;  2FTO X;  4E28 A;  1JMH A;  3KJS A;  4O1X D;  5FCT A;  2VF0 A;  4E5O A;  3N5E B;  1TSN A;  3GH2 X;  4XSD A;  3HBB A;  1TRG A;  1NJD A;  1VZE A;  1B5E A;  1TSW A;  4Q0D A;  1TJS A;  2RD8 B;  3N5G A;  4O1U A;  1EV8 A;  1JTU A;  1TDU A;  2G8A A;  1SYN A;  3BHR A;  4F2V A;  3QG2 A;  4DPH A;  2ONB A;  4FOG A;  5J7W A;  4KY8 A;  2OIP A;  1TSD A;  3IRM A;  1BKO A;  3JSU A;  5H39 A;  3K2H A;  3UM6 A;  1JUT A;  3UWL A;  3KJR A;  2H2Q A;  1HW3 A;  4KY4 A;  1TVV A;  1AN5 A;  1FFL A;  4FOA A;  1J3J C;  4XSC A;  1NJB A;  2A9W A;  4ISW A;  4FQS A;  5WRN A;  4XSE A;  1BSP A;  1TDB A;  3HJ3 A;  2G89 A;  1NJE A;  3I3R A;  4ECK A;  4FGT A;  1DNA A;  1TVU A;  1BJG A;  2BBQ A;  3BYX A; 
#chains in the Genus database with same CATH topology
 3B5B A;  1BO7 A;  4UP1 A;  1QQQ A;  2VET A;  1F4F A;  3CLB A;  1F28 A;  1SEJ A;  1THY A;  1TDC A;  3IK1 A;  4O7U A;  3DL6 A;  1BQ1 A;  1NJC A;  1B5D A;  3EBU A;  5HS3 A;  2FTN A;  1F4B A;  2G8X A;  1EVG A;  1KZI A;  3NRR A;  1LCE A;  4KPW A;  4PSG A;  1BPJ A;  1F4D A;  1BP0 A;  4DP3 A;  3EGY X;  1BO8 A;  3EDW X;  4DPD A;  3C0A A;  3HB8 A;  3DL5 A;  1F4G A;  1CI7 A;  1RTS A;  1HW4 A;  1HZW A;  1JTQ A;  3IHI A;  3UWL B;  3INV A;  1F4E A;  4TMS A;  4IRR A;  1JMG A;  3KGB A;  3IRN A;  1VZD A;  1VZC A;  4KNZ A;  3EAW X;  1TSM A;  4ISK A;  3EJL A;  1EVF A;  1TIS A;  3GH0 A;  1LCB A;  3BFI A;  3BNZ A;  1ZPR A;  2G8D A;  4H0U A;  1QZF A;  5H3A A;  4DQ1 A;  1BP6 A;  1BQ2 A;  1J3I C;  4GEV A;  1B49 A;  1TYS A;  3IK0 A;  2AAZ A;  4EB4 A;  1VZB A;  1TLS A;  1KZJ A;  2KCE A;  3ED7 A;  3IRO A;  3EHI X;  4GYH A;  4G2O X;  4KYA A;  4IQQ A;  4Q0E A;  3TMS A;  2TDM A;  4H1I A;  4G6W X;  3N5E A;  3C06 A;  1LCA A;  1DDU A;  1AJM A;  2TDD A;  2FTQ A;  1J3K C;  1BID A;  1AIQ A;  1TSZ A;  2G86 A;  1TSY A;  2TSR A;  2RD8 A;  1FWM A;  1BDU A;  1TVW A;  2RDA A;  4GD7 A;  4EZ8 A;  5H38 A;  1JMF A;  3IX6 A;  3BGX A;  1B02 A;  4EIL A;  1JUJ A;  1YPV A;  3QJ7 A;  3UM8 A;  1KCE A;  4EIN A;  1BSF A;  1EV5 A;  1TSL A;  1JMI A;  1BKP A;  1TSV A;  1AOB A;  3UM5 A;  3B9H A;  1NCE A;  1AXW A;  1JG0 A;  1I00 A;  1VZA A;  3EF9 A;  1TSX A;  3OB7 A;  1TLC A;  1HVY A;  4H0R A;  3V8H A;  4JEF A;  1JU6 A;  4LRR A;  4FOX A;  4IQB A;  3DG8 C;  3BHL A;  2TSC A;  3BZ0 A;  1NJA A;  1TDA A;  3QGT A;  4O1X A;  3DGA C;  3CL9 A;  1F4C A;  3GG5 A;  3H9K A;  5BY6 A;  3IJZ A;  2FTO X;  4E28 A;  1JMH A;  3KJS A;  4O1X D;  5FCT A;  2VF0 A;  4E5O A;  3N5E B;  1TSN A;  3GH2 X;  4XSD A;  3HBB A;  1TRG A;  1NJD A;  1VZE A;  1B5E A;  1TSW A;  4Q0D A;  1TJS A;  2RD8 B;  3N5G A;  4O1U A;  1EV8 A;  1JTU A;  1TDU A;  2G8A A;  1SYN A;  3BHR A;  4F2V A;  3QG2 A;  4DPH A;  2ONB A;  4FOG A;  5J7W A;  4KY8 A;  2OIP A;  1TSD A;  3IRM A;  1BKO A;  3JSU A;  5H39 A;  3K2H A;  3UM6 A;  1JUT A;  3UWL A;  3KJR A;  2H2Q A;  1HW3 A;  4KY4 A;  1TVV A;  1AN5 A;  1FFL A;  4FOA A;  1J3J C;  4XSC A;  1NJB A;  2A9W A;  4ISW A;  4FQS A;  5WRN A;  4XSE A;  1BSP A;  1TDB A;  3HJ3 A;  2G89 A;  1NJE A;  3I3R A;  4ECK A;  4FGT A;  1DNA A;  1TVU A;  1BJG A;  2BBQ A;  3BYX A; 
#chains in the Genus database with same CATH homology
 3B5B A;  1BO7 A;  4UP1 A;  1QQQ A;  2VET A;  1F4F A;  3CLB A;  1F28 A;  1SEJ A;  1THY A;  1TDC A;  3IK1 A;  4O7U A;  3DL6 A;  1BQ1 A;  1NJC A;  1B5D A;  3EBU A;  5HS3 A;  2FTN A;  1F4B A;  2G8X A;  1EVG A;  1KZI A;  3NRR A;  1LCE A;  4KPW A;  4PSG A;  1BPJ A;  1F4D A;  1BP0 A;  4DP3 A;  3EGY X;  1BO8 A;  3EDW X;  4DPD A;  3C0A A;  3HB8 A;  3DL5 A;  1F4G A;  1CI7 A;  1RTS A;  1HW4 A;  1HZW A;  1JTQ A;  3IHI A;  3UWL B;  3INV A;  1F4E A;  4TMS A;  4IRR A;  1JMG A;  3KGB A;  3IRN A;  1VZD A;  1VZC A;  4KNZ A;  3EAW X;  1TSM A;  4ISK A;  3EJL A;  1EVF A;  1TIS A;  3GH0 A;  1LCB A;  3BFI A;  3BNZ A;  1ZPR A;  2G8D A;  4H0U A;  1QZF A;  5H3A A;  4DQ1 A;  1BP6 A;  1BQ2 A;  1J3I C;  4GEV A;  1B49 A;  1TYS A;  3IK0 A;  2AAZ A;  4EB4 A;  1VZB A;  1TLS A;  1KZJ A;  2KCE A;  3ED7 A;  3IRO A;  3EHI X;  4GYH A;  4G2O X;  4KYA A;  4IQQ A;  4Q0E A;  3TMS A;  2TDM A;  4H1I A;  4G6W X;  3N5E A;  3C06 A;  1LCA A;  1DDU A;  1AJM A;  2TDD A;  2FTQ A;  1J3K C;  1BID A;  1AIQ A;  1TSZ A;  2G86 A;  1TSY A;  2TSR A;  2RD8 A;  1FWM A;  1BDU A;  1TVW A;  2RDA A;  4GD7 A;  4EZ8 A;  5H38 A;  1JMF A;  3IX6 A;  3BGX A;  1B02 A;  4EIL A;  1JUJ A;  1YPV A;  3QJ7 A;  3UM8 A;  1KCE A;  4EIN A;  1BSF A;  1EV5 A;  1TSL A;  1JMI A;  1BKP A;  1TSV A;  1AOB A;  3UM5 A;  3B9H A;  1NCE A;  1AXW A;  1JG0 A;  1I00 A;  1VZA A;  3EF9 A;  1TSX A;  3OB7 A;  1TLC A;  1HVY A;  4H0R A;  3V8H A;  4JEF A;  1JU6 A;  4LRR A;  4FOX A;  4IQB A;  3DG8 C;  3BHL A;  2TSC A;  3BZ0 A;  1NJA A;  1TDA A;  3QGT A;  4O1X A;  3DGA C;  3CL9 A;  1F4C A;  3GG5 A;  3H9K A;  5BY6 A;  3IJZ A;  2FTO X;  4E28 A;  1JMH A;  3KJS A;  4O1X D;  5FCT A;  2VF0 A;  4E5O A;  3N5E B;  1TSN A;  3GH2 X;  4XSD A;  3HBB A;  1TRG A;  1NJD A;  1VZE A;  1B5E A;  1TSW A;  4Q0D A;  1TJS A;  2RD8 B;  3N5G A;  4O1U A;  1EV8 A;  1JTU A;  1TDU A;  2G8A A;  1SYN A;  3BHR A;  4F2V A;  3QG2 A;  4DPH A;  2ONB A;  4FOG A;  5J7W A;  4KY8 A;  2OIP A;  1TSD A;  3IRM A;  1BKO A;  3JSU A;  5H39 A;  3K2H A;  3UM6 A;  1JUT A;  3UWL A;  3KJR A;  2H2Q A;  1HW3 A;  4KY4 A;  1TVV A;  1AN5 A;  1FFL A;  4FOA A;  1J3J C;  4XSC A;  1NJB A;  2A9W A;  4ISW A;  4FQS A;  5WRN A;  4XSE A;  1BSP A;  1TDB A;  3HJ3 A;  2G89 A;  1NJE A;  3I3R A;  4ECK A;  4FGT A;  1DNA A;  1TVU A;  1BJG A;  2BBQ A;  3BYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...