4EILA

Crystal structure of the loop truncated toxoplasma gondii ts-dhfr
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
563
structure length
510
Chain Sequence
PVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPASRFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAEKPQAEGQQRVRVCASLPAALSLLEEEYKDSVDQIFVVGGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKATYRPIFISKTFSDNGVPYDFVVLEKRRSSAAAIAPVLAWMDELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title First Three-Dimensional Structure of Toxoplasma gondii Thymidylate Synthase-Dihydrofolate Reductase: Insights for Catalysis, Interdomain Interactions, and Substrate Channeling.
pubmed doi rcsb
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
molecule tags Oxidoreductase, transferase
source organism Toxoplasma gondii
total genus 171
structure length 510
sequence length 563
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4eilA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4eilA01
3C0AA 3M08A 4ELHA 3BYXA 3GI2A 1VJ3A 3N5EA 4KLXA 4ELFA 1LY3A 4M2XA 3F0BX 1RX7A 3SRQX 1F4CA 1BP6A 3BHRA 4DFRA 4QJCA 4XT7A 4IRRA 1TVWA 4ELEA 4P66A 1VZBA 4EILA 4E5OA 3FRAX 1M7AA 3NXRA 4H0UA 1TSXA 3C06A 1F4FA 4IXFX 1U72A 2HQPA 3FRFX 4M6JA 1RD7A 1S3UA 3EF9A 1SEJA 1DDUA 1DRBA 2OIPA 3D84X 1JMIA 3TD8A 3KY8A 1TDRA 4XSCA 2FTQA 3L3RA 1DG8A 1PDBA 2P4GA 4Q67A 4IXGX 5FDAA 1E26A 2W9HA 4X5IA 1NJAA 5WRNA 2C2TA 1B02A 1RA2A 4FOAA 3DFRA 4M6LA 1DR7A 3EEKA 1TYSA 2CIGA 3JWMA 1AJMA 4HOGA 3NZBX 3GHCA 3VCOA 4H0RA 3F0UX 4EINA 4XRBA 3QGTA 3K2HA 1RA9A 4X5HA 1DNAA 3QLWA 1RX3A 3EEJA 3DGAC 4I13A 2FTNA 5HS3A 1DREA 1TDCA 1VZDA 5DXVA 1M78A 3F0XX 3F91A 1TJSA 1RX8A 3NZDA 1JUJA 3NU0A 3D80A 4GYHA 3F8YA 2FZJA 1S3WA 2AAZA 4G6WX 1DAJA 1LCEA 1B5EA 1DISA 3S9UA 3SGYA 2TSCA 3JW3A 4XT5A 5HI6A 3I3RA 3NZ6X 3GHWA 1BKPA 1S3VA 3N5GA 2D5NA 1TSYA 2W3AA 5EAJA 3NXXA 1RA1A 4FGGA 1TSNA 2G8AA 1NCEA 1BKOA 4FHBA 4LAGX 4IQQA 1CD2A 4P68A 3QYLA 4X5GA 4KYAA 1LCBA 1CI7A 3JW5A 3BFIA 1F4GA 3OB7A 3BHLA 3KGYA 2ANQA 2BBQA 4NX6A 2G89A 2AZNA 3QL0A 3QLXA 1TSZA 4O1XA 3FQZA 3K74A 1BIDA 5HPBA 5HSUA 1QQQA 3IRMA 2OBCA 1DR4A 1HW3A 1RA3A 5JA3A 1HFRA 4KBNA 1AOEA 1JU6A 3N5EB 1DHFA 3ZPCA 4H98A 4M7UA 1YPVA 3KJRA 3DGAA 3QLYA 4KM0A 3FRBX 3LG4A 1D1GA 1KZIA 2W9GA 1F28A 5ECXA 3BZ0A 1DR3A 4H97A 3RO9A 1DR6A 4G8ZX 5HUIA 1KZJA 3QJ7A 3K45A 1MVTA 4O1UA 3FQ0A 3QLZA 4KNEA 3NXVA 2RD8A 2ONBA 1HZWA 4XECX 2W3BA 5H38A 1RH3A 1HFQA 3CSEA 1KCEA 3SRSX 1DYIA 4HOEA 2FTOX 1AOBA 4HOFA 4OR7A 2HM9A 4LEKX 1I00A 4DPHA 3F0QX 1JUTA 4QI9A 3FL8A 3ROAA 1RG7A 4KM2A 1F4DA 3NXTA 1TSDA 4IQBA 4CD2A 3FQVA 4EZ8A 3FYWX 1TVUA 2TSRA 1DYRA 3NZ9X 4KEBA 1THYA 4F2VA 5HF2X 4PTHA 2W3VA 1BDUA 3QL3A 4KAKA 2BLBA 2CD2A 3UM5A 1MVSA 1RF7A 2G6VA 1TSVA 2KGKA 1EVFA 4ECKA 1BO8A 1BQ1A 1AXWA 1KLKA 1TISA 3JWFA 3QFXA 4G95A 1DG7A 5FCTA 4PSSA 3I8AX 4FOXA 4TU5X 4H1IA 1DIUA 1DHIA 1JTUA 1RX1A 4PTJA 1LCAA 1RC4A 2BLCA 2VETA 3BNZA 3IHIA 3V8HA 2O7PA 2W3MA 3FQOA 3EGYX 3EDWX 1HFPA 3N0HA 3QLSA 5HT5A 4P3RA 1JUVA 3DL5A 3GG5A 3H9KA 1VZCA 4KL9A 4EIZA 4O1XD 3E0BA 3FY9X 1S3YA 4M7VA 1TSWA 5HF0X 1AN5A 3TQ9A 4XSDA 3IX9A 3IJZA 5H39A 1AIQA 1DR1A 1NJDA 1HW4A 3FL9A 3JWKA 5E8QA 8DFRA 4P3QA 5HQZA 1DRFA 4KD7A 3M09A 4QLGA 1DG5A 3TQAA 1FFLA 1NJCA 1J3KC 4G3MA 3IROA 1EV8A 4EJ1A 2RD8B 5U27A 1JOLA 3DAUA 1RB2A 4KJJA 3SA1A 1VZEA 2H2QA 4EB4A 4XT4A 4Q0DA 3JTWA 4FGHA 1DHJA 2BLAA 3EX8A 3SR5X 1DDSA 1KMSA 4XSEA 3NXYA 1NJEA 4PSTA 1BJGA 4KY8A 1RTSA 1PD8A 1F4BA 4NX7A 3NXOA 4ELGA 2VF0A 1RX4A 1TVVA 1VDRA 5ECCA 1JOMA 3FRDX 2BL9A 4QLFA 3NZCX 1DYHA 4RGCA 1U71A 3DATA 3IX6A 1IA3A 1YHOA 1BZFA 4GH8A 5HSRA 2FZIA 1BSPA 3DG8C 4XE6X 3TQBA 1JMGA 3F8ZA 3FQCA 3JSUA 3JWCA 3IK1A 1TSMA 4H95A 4KPWA 2INQA 5H3AA 5BY6A 3R33A 1IA2A 1JMHA 3OAFA 3S3VA 3GH2X 4QLEA 1RX2A 6DFRA 4Q0EA 4TMSA 1LY4A 4DPDA 1J3KA 3GYFA 3UM6A 1FWMA 4X5FA 1QZFA 1BP0A 4KJLA 2DHFA 3NZAX 3TMSA 1F4EA 4DP3A 4LRRA 1DF7A 5CC9A 3EBUA 3IK0A 3IRNA 1VZAA 5DFRA 1AO8A 3RG9A 3UWLB 2B3ZA 2HXVA 3QYOA 2QK8A 3EELA 3OCHA 1DLSA 1KMVA 4QHVA 1TDAA 1J3IC 3BGXA 3EHIX 1DRHA 2D0KA 1DYJA 3NRRA 1NJBA 3HJ3A 1RX9A 2W9TA 4HA9A 4IXED 3KJSA 1ZDRA 1RX5A 3CLBA 3S7AA 2XW7A 1TDBA 1EVGA 1JMFA 2LF1A 5CCCA 3SRRX 3DG8A 1B5DA 3GH0A 4QJZD 3SQYX 1DDRA 1DR5A 3GHVA 2ZZAA 3SRWX 4KFJA 3EJLA 3SH2A 3B9HA 4PDJA 3UWLA 3CL9A 1J3JC 3NTZA 4KJKA 3SAIA 1IA4A 2C2SA 4OSGA 1DLRA 3FYVX 3QLRA 1CZ3A 3IA5A 2FZHA 4FOGA 4G2OX 4PSGA 2W3WA 3IA4A 2TDDA 2KCEA 3UM8A 3K47A 3DRCA 1BSFA 7DFRA 3F0SX 3EEMA 1M79A 4ISWA 2ITHA 3SRUX 2JYBA 3HB8A 1OHKA 3JVXA 1TLSA 1U70A 4ELBA 3FREX 4EIGA 2A9WA 3ED7A 2G8XA 4XT6A 2L28A 2GD9A 4JEFA 1TSLA 5JG0X 1OHJA 3Q1HA 1SYNA 2W9SA 1BOZA 1RB3A 4H96A 1DR2A 3QG2A 4Q6AA 3DL6A 3FQFA 3INVA 2ANOA 1J3IA 4I1NA 2TDMA 5HVEA 3CD2A 4M6KA 3HBBA 3F0VX 4LAEX 4ISKA 1LUDA 1BQ2A 3FY8X 3TQ8A 1TRGA 3EIGA 1B49A 1AI9A 4DDRA 1BO7A 1HVYA 4PSYA 3FS6A 4O7UA 5HQYA 1ZPRA 1BPJA 2RDAA 4GEVA 1TDUA 1IA1A 1TLCA 1RA8A 1DRAA 1J3JA 2G8DA 4X5JA 4FQSA 5HVBA 1PD9A 3EAWX 4KNZA 1EV5A 4GD7A 1JG0A 4KY4A 3ZPGA 3KGBA 4LAHX 1RX6A 4HA7A 5U26A 3KFYA 4E28A 2DRCA 4XT8A 4FGTA 2G86A 3B5BA 1RE7A 5HT4A 3SA2A 1JTQA 5J7WA 4UP1A 4DQ1A
chains in the Genus database with same CATH superfamily
3C0AA 3M08A 4ELHA 3BYXA 3GI2A 1VJ3A 3N5EA 4KLXA 4ELFA 1LY3A 4M2XA 3F0BX 1RX7A 3SRQX 1F4CA 1BP6A 3BHRA 4DFRA 4QJCA 4XT7A 4IRRA 1TVWA 4ELEA 4P66A 1VZBA 4EILA 4E5OA 3FRAX 1M7AA 3NXRA 4H0UA 1TSXA 3C06A 1F4FA 4IXFX 1U72A 2HQPA 3FRFX 4M6JA 1RD7A 1S3UA 3EF9A 1SEJA 1DDUA 1DRBA 2OIPA 3D84X 1JMIA 3TD8A 3KY8A 1TDRA 4XSCA 2FTQA 3L3RA 1DG8A 1PDBA 2P4GA 4Q67A 4IXGX 5FDAA 1E26A 2W9HA 4X5IA 1NJAA 5WRNA 2C2TA 1B02A 1RA2A 4FOAA 3DFRA 4M6LA 1DR7A 3EEKA 1TYSA 2CIGA 3JWMA 1AJMA 4HOGA 3NZBX 3GHCA 3VCOA 4H0RA 3F0UX 4EINA 4XRBA 3QGTA 3K2HA 1RA9A 4X5HA 1DNAA 3QLWA 1RX3A 3EEJA 3DGAC 4I13A 2FTNA 5HS3A 1DREA 1TDCA 1VZDA 5DXVA 1M78A 3F0XX 3F91A 1TJSA 1RX8A 3NZDA 1JUJA 3NU0A 3D80A 4GYHA 3F8YA 2FZJA 1S3WA 2AAZA 4G6WX 1DAJA 1LCEA 1B5EA 1DISA 3S9UA 3SGYA 2TSCA 3JW3A 4XT5A 5HI6A 3I3RA 3NZ6X 3GHWA 1BKPA 1S3VA 3N5GA 2D5NA 1TSYA 2W3AA 5EAJA 3NXXA 1RA1A 4FGGA 1TSNA 2G8AA 1NCEA 1BKOA 4FHBA 4LAGX 4IQQA 1CD2A 4P68A 3QYLA 4X5GA 4KYAA 1LCBA 1CI7A 3JW5A 3BFIA 1F4GA 3OB7A 3BHLA 3KGYA 2ANQA 2BBQA 4NX6A 2G89A 2AZNA 3QL0A 3QLXA 1TSZA 4O1XA 3FQZA 3K74A 1BIDA 5HPBA 5HSUA 1QQQA 3IRMA 2OBCA 1DR4A 1HW3A 1RA3A 5JA3A 1HFRA 4KBNA 1AOEA 1JU6A 3N5EB 1DHFA 3ZPCA 4H98A 4M7UA 1YPVA 3KJRA 3DGAA 3QLYA 4KM0A 3FRBX 3LG4A 1D1GA 1KZIA 2W9GA 1F28A 5ECXA 3BZ0A 1DR3A 4H97A 3RO9A 1DR6A 4G8ZX 5HUIA 1KZJA 3QJ7A 3K45A 1MVTA 4O1UA 3FQ0A 3QLZA 4KNEA 3NXVA 2RD8A 2ONBA 1HZWA 4XECX 2W3BA 5H38A 1RH3A 1HFQA 3CSEA 1KCEA 3SRSX 1DYIA 4HOEA 2FTOX 1AOBA 4HOFA 4OR7A 2HM9A 4LEKX 1I00A 4DPHA 3F0QX 1JUTA 4QI9A 3FL8A 3ROAA 1RG7A 4KM2A 1F4DA 3NXTA 1TSDA 4IQBA 4CD2A 3FQVA 4EZ8A 3FYWX 1TVUA 2TSRA 1DYRA 3NZ9X 4KEBA 1THYA 4F2VA 5HF2X 4PTHA 2W3VA 1BDUA 3QL3A 4KAKA 2BLBA 2CD2A 3UM5A 1MVSA 1RF7A 2G6VA 1TSVA 2KGKA 1EVFA 4ECKA 1BO8A 1BQ1A 1AXWA 1KLKA 1TISA 3JWFA 3QFXA 4G95A 1DG7A 5FCTA 4PSSA 3I8AX 4FOXA 4TU5X 4H1IA 1DIUA 1DHIA 1JTUA 1RX1A 4PTJA 1LCAA 1RC4A 2BLCA 2VETA 3BNZA 3IHIA 3V8HA 2O7PA 2W3MA 3FQOA 3EGYX 3EDWX 1HFPA 3N0HA 3QLSA 5HT5A 4P3RA 1JUVA 3DL5A 3GG5A 3H9KA 1VZCA 4KL9A 4EIZA 4O1XD 3E0BA 3FY9X 1S3YA 4M7VA 1TSWA 5HF0X 1AN5A 3TQ9A 4XSDA 3IX9A 3IJZA 5H39A 1AIQA 1DR1A 1NJDA 1HW4A 3FL9A 3JWKA 5E8QA 8DFRA 4P3QA 5HQZA 1DRFA 4KD7A 3M09A 4QLGA 1DG5A 3TQAA 1FFLA 1NJCA 1J3KC 4G3MA 3IROA 1EV8A 4EJ1A 2RD8B 5U27A 1JOLA 3DAUA 1RB2A 4KJJA 3SA1A 1VZEA 2H2QA 4EB4A 4XT4A 4Q0DA 3JTWA 4FGHA 1DHJA 2BLAA 3EX8A 3SR5X 1DDSA 1KMSA 4XSEA 3NXYA 1NJEA 4PSTA 1BJGA 4KY8A 1RTSA 1PD8A 1F4BA 4NX7A 3NXOA 4ELGA 2VF0A 1RX4A 1TVVA 1VDRA 5ECCA 1JOMA 3FRDX 2BL9A 4QLFA 3NZCX 1DYHA 4RGCA 1U71A 3DATA 3IX6A 1IA3A 1YHOA 1BZFA 4GH8A 5HSRA 2FZIA 1BSPA 3DG8C 4XE6X 3TQBA 1JMGA 3F8ZA 3FQCA 3JSUA 3JWCA 3IK1A 1TSMA 4H95A 4KPWA 2INQA 5H3AA 5BY6A 3R33A 1IA2A 1JMHA 3OAFA 3S3VA 3GH2X 4QLEA 1RX2A 6DFRA 4Q0EA 4TMSA 1LY4A 4DPDA 1J3KA 3GYFA 3UM6A 1FWMA 4X5FA 1QZFA 1BP0A 4KJLA 2DHFA 3NZAX 3TMSA 1F4EA 4DP3A 4LRRA 1DF7A 5CC9A 3EBUA 3IK0A 3IRNA 1VZAA 5DFRA 1AO8A 3RG9A 3UWLB 2B3ZA 2HXVA 3QYOA 2QK8A 3EELA 3OCHA 1DLSA 1KMVA 4QHVA 1TDAA 1J3IC 3BGXA 3EHIX 1DRHA 2D0KA 1DYJA 3NRRA 1NJBA 3HJ3A 1RX9A 2W9TA 4HA9A 4IXED 3KJSA 1ZDRA 1RX5A 3CLBA 3S7AA 2XW7A 1TDBA 1EVGA 1JMFA 2LF1A 5CCCA 3SRRX 3DG8A 1B5DA 3GH0A 4QJZD 3SQYX 1DDRA 1DR5A 3GHVA 2ZZAA 3SRWX 4KFJA 3EJLA 3SH2A 3B9HA 4PDJA 3UWLA 3CL9A 1J3JC 3NTZA 4KJKA 3SAIA 1IA4A 2C2SA 4OSGA 1DLRA 3FYVX 3QLRA 1CZ3A 3IA5A 2FZHA 4FOGA 4G2OX 4PSGA 2W3WA 3IA4A 2TDDA 2KCEA 3UM8A 3K47A 3DRCA 1BSFA 7DFRA 3F0SX 3EEMA 1M79A 4ISWA 2ITHA 3SRUX 2JYBA 3HB8A 1OHKA 3JVXA 1TLSA 1U70A 4ELBA 3FREX 4EIGA 2A9WA 3ED7A 2G8XA 4XT6A 2L28A 2GD9A 4JEFA 1TSLA 5JG0X 1OHJA 3Q1HA 1SYNA 2W9SA 1BOZA 1RB3A 4H96A 1DR2A 3QG2A 4Q6AA 3DL6A 3FQFA 3INVA 2ANOA 1J3IA 4I1NA 2TDMA 5HVEA 3CD2A 4M6KA 3HBBA 3F0VX 4LAEX 4ISKA 1LUDA 1BQ2A 3FY8X 3TQ8A 1TRGA 3EIGA 1B49A 1AI9A 4DDRA 1BO7A 1HVYA 4PSYA 3FS6A 4O7UA 5HQYA 1ZPRA 1BPJA 2RDAA 4GEVA 1TDUA 1IA1A 1TLCA 1RA8A 1DRAA 1J3JA 2G8DA 4X5JA 4FQSA 5HVBA 1PD9A 3EAWX 4KNZA 1EV5A 4GD7A 1JG0A 4KY4A 3ZPGA 3KGBA 4LAHX 1RX6A 4HA7A 5U26A 3KFYA 4E28A 2DRCA 4XT8A 4FGTA 2G86A 3B5BA 1RE7A 5HT4A 3SA2A 1JTQA 5J7WA 4UP1A 4DQ1A
chains in the Genus database with same CATH topology
3C0AA 3M08A 4ELHA 3BYXA 3GI2A 1VJ3A 3N5EA 4KLXA 4ELFA 1LY3A 4M2XA 3F0BX 1RX7A 3SRQX 1F4CA 1BP6A 3BHRA 4DFRA 4QJCA 4XT7A 4IRRA 1TVWA 4ELEA 4P66A 1VZBA 4EILA 4E5OA 3FRAX 1M7AA 3NXRA 4H0UA 1TSXA 3C06A 1F4FA 4IXFX 1U72A 2HQPA 3FRFX 4M6JA 1RD7A 1S3UA 3EF9A 1SEJA 1DDUA 1DRBA 2OIPA 3D84X 1JMIA 3TD8A 3KY8A 1TDRA 4XSCA 2FTQA 3L3RA 1DG8A 1PDBA 2P4GA 4Q67A 4IXGX 5FDAA 1E26A 2W9HA 4X5IA 1NJAA 5WRNA 2C2TA 1B02A 1RA2A 4FOAA 3DFRA 4M6LA 1DR7A 3EEKA 1TYSA 2CIGA 3JWMA 1AJMA 4HOGA 3NZBX 3GHCA 3VCOA 4H0RA 3F0UX 4EINA 4XRBA 3QGTA 3K2HA 1RA9A 4X5HA 1DNAA 3QLWA 1RX3A 3EEJA 3DGAC 4I13A 2FTNA 5HS3A 1DREA 1TDCA 1VZDA 5DXVA 1M78A 3F0XX 3F91A 1TJSA 1RX8A 3NZDA 1JUJA 3NU0A 3D80A 4GYHA 3F8YA 2FZJA 1S3WA 2AAZA 4G6WX 1DAJA 1LCEA 1B5EA 1DISA 3S9UA 3SGYA 2TSCA 3JW3A 4XT5A 5HI6A 3I3RA 3NZ6X 3GHWA 1BKPA 1S3VA 3N5GA 2D5NA 1TSYA 2W3AA 5EAJA 3NXXA 1RA1A 4FGGA 1TSNA 2G8AA 1NCEA 1BKOA 4FHBA 4LAGX 4IQQA 1CD2A 4P68A 3QYLA 4X5GA 4KYAA 1LCBA 1CI7A 3JW5A 3BFIA 1F4GA 3OB7A 3BHLA 3KGYA 2ANQA 2BBQA 4NX6A 2G89A 2AZNA 3QL0A 3QLXA 1TSZA 4O1XA 3FQZA 3K74A 1BIDA 5HPBA 5HSUA 1QQQA 3IRMA 2OBCA 1DR4A 1HW3A 1RA3A 5JA3A 1HFRA 4KBNA 1AOEA 1JU6A 3N5EB 1DHFA 3ZPCA 4H98A 4M7UA 1YPVA 3KJRA 3DGAA 3QLYA 4KM0A 3FRBX 3LG4A 1D1GA 1KZIA 2W9GA 1F28A 5ECXA 3BZ0A 1DR3A 4H97A 3RO9A 1DR6A 4G8ZX 5HUIA 1KZJA 3QJ7A 3K45A 1MVTA 4O1UA 3FQ0A 3QLZA 4KNEA 3NXVA 2RD8A 2ONBA 1HZWA 4XECX 2W3BA 5H38A 1RH3A 1HFQA 3CSEA 1KCEA 3SRSX 1DYIA 4HOEA 2FTOX 1AOBA 4HOFA 4OR7A 2HM9A 4LEKX 1I00A 4DPHA 3F0QX 1JUTA 4QI9A 3FL8A 3ROAA 1RG7A 4KM2A 1F4DA 3NXTA 1TSDA 4IQBA 4CD2A 3FQVA 4EZ8A 3FYWX 1TVUA 2TSRA 1DYRA 3NZ9X 4KEBA 1THYA 4F2VA 5HF2X 4PTHA 2W3VA 1BDUA 3QL3A 4KAKA 2BLBA 2CD2A 3UM5A 1MVSA 1RF7A 2G6VA 1TSVA 2KGKA 1EVFA 4ECKA 1BO8A 1BQ1A 1AXWA 1KLKA 1TISA 3JWFA 3QFXA 4G95A 1DG7A 5FCTA 4PSSA 3I8AX 4FOXA 4TU5X 4H1IA 1DIUA 1DHIA 1JTUA 1RX1A 4PTJA 1LCAA 1RC4A 2BLCA 2VETA 3BNZA 3IHIA 3V8HA 2O7PA 2W3MA 3FQOA 3EGYX 3EDWX 1HFPA 3N0HA 3QLSA 5HT5A 4P3RA 1JUVA 3DL5A 3GG5A 3H9KA 1VZCA 4KL9A 4EIZA 4O1XD 3E0BA 3FY9X 1S3YA 4M7VA 1TSWA 5HF0X 1AN5A 3TQ9A 4XSDA 3IX9A 3IJZA 5H39A 1AIQA 1DR1A 1NJDA 1HW4A 3FL9A 3JWKA 5E8QA 8DFRA 4P3QA 5HQZA 1DRFA 4KD7A 3M09A 4QLGA 1DG5A 3TQAA 1FFLA 1NJCA 1J3KC 4G3MA 3IROA 1EV8A 4EJ1A 2RD8B 5U27A 1JOLA 3DAUA 1RB2A 4KJJA 3SA1A 1VZEA 2H2QA 4EB4A 4XT4A 4Q0DA 3JTWA 4FGHA 1DHJA 2BLAA 3EX8A 3SR5X 1DDSA 1KMSA 4XSEA 3NXYA 1NJEA 4PSTA 1BJGA 4KY8A 1RTSA 1PD8A 1F4BA 4NX7A 3NXOA 4ELGA 2VF0A 1RX4A 1TVVA 1VDRA 5ECCA 1JOMA 3FRDX 2BL9A 4QLFA 3NZCX 1DYHA 4RGCA 1U71A 3DATA 3IX6A 1IA3A 1YHOA 1BZFA 4GH8A 5HSRA 2FZIA 1BSPA 3DG8C 4XE6X 3TQBA 1JMGA 3F8ZA 3FQCA 3JSUA 3JWCA 3IK1A 1TSMA 4H95A 4KPWA 2INQA 5H3AA 5BY6A 3R33A 1IA2A 1JMHA 3OAFA 3S3VA 3GH2X 4QLEA 1RX2A 6DFRA 4Q0EA 4TMSA 1LY4A 4DPDA 1J3KA 3GYFA 3UM6A 1FWMA 4X5FA 1QZFA 1BP0A 4KJLA 2DHFA 3NZAX 3TMSA 1F4EA 4DP3A 4LRRA 1DF7A 5CC9A 3EBUA 3IK0A 3IRNA 1VZAA 5DFRA 1AO8A 3RG9A 3UWLB 2B3ZA 2HXVA 3QYOA 2QK8A 3EELA 3OCHA 1DLSA 1KMVA 4QHVA 1TDAA 1J3IC 3BGXA 3EHIX 1DRHA 2D0KA 1DYJA 3NRRA 1NJBA 3HJ3A 1RX9A 2W9TA 4HA9A 4IXED 3KJSA 1ZDRA 1RX5A 3CLBA 3S7AA 2XW7A 1TDBA 1EVGA 1JMFA 2LF1A 5CCCA 3SRRX 3DG8A 1B5DA 3GH0A 4QJZD 3SQYX 1DDRA 1DR5A 3GHVA 2ZZAA 3SRWX 4KFJA 3EJLA 3SH2A 3B9HA 4PDJA 3UWLA 3CL9A 1J3JC 3NTZA 4KJKA 3SAIA 1IA4A 2C2SA 4OSGA 1DLRA 3FYVX 3QLRA 1CZ3A 3IA5A 2FZHA 4FOGA 4G2OX 4PSGA 2W3WA 3IA4A 2TDDA 2KCEA 3UM8A 3K47A 3DRCA 1BSFA 7DFRA 3F0SX 3EEMA 1M79A 4ISWA 2ITHA 3SRUX 2JYBA 3HB8A 1OHKA 3JVXA 1TLSA 1U70A 4ELBA 3FREX 4EIGA 2A9WA 3ED7A 2G8XA 4XT6A 2L28A 2GD9A 4JEFA 1TSLA 5JG0X 1OHJA 3Q1HA 1SYNA 2W9SA 1BOZA 1RB3A 4H96A 1DR2A 3QG2A 4Q6AA 3DL6A 3FQFA 3INVA 2ANOA 1J3IA 4I1NA 2TDMA 5HVEA 3CD2A 4M6KA 3HBBA 3F0VX 4LAEX 4ISKA 1LUDA 1BQ2A 3FY8X 3TQ8A 1TRGA 3EIGA 1B49A 1AI9A 4DDRA 1BO7A 1HVYA 4PSYA 3FS6A 4O7UA 5HQYA 1ZPRA 1BPJA 2RDAA 4GEVA 1TDUA 1IA1A 1TLCA 1RA8A 1DRAA 1J3JA 2G8DA 4X5JA 4FQSA 5HVBA 1PD9A 3EAWX 4KNZA 1EV5A 4GD7A 1JG0A 4KY4A 3ZPGA 3KGBA 4LAHX 1RX6A 4HA7A 5U26A 3KFYA 4E28A 2DRCA 4XT8A 4FGTA 2G86A 3B5BA 1RE7A 5HT4A 3SA2A 1JTQA 5J7WA 4UP1A 4DQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0A A;  3M08 A;  4ELH A;  3BYX A;  3GI2 A;  1VJ3 A;  3N5E A;  4KLX A;  4ELF A;  1LY3 A;  4M2X A;  3F0B X;  1RX7 A;  3SRQ X;  1F4C A;  1BP6 A;  3BHR A;  4DFR A;  4QJC A;  4XT7 A;  4IRR A;  1TVW A;  4ELE A;  4P66 A;  1VZB A;  4EIL A;  4E5O A;  3FRA X;  1M7A A;  3NXR A;  4H0U A;  1TSX A;  3C06 A;  1F4F A;  4IXF X;  1U72 A;  2HQP A;  3FRF X;  4M6J A;  1RD7 A;  1S3U A;  3EF9 A;  1SEJ A;  1DDU A;  1DRB A;  2OIP A;  3D84 X;  1JMI A;  3TD8 A;  3KY8 A;  1TDR A;  4XSC A;  2FTQ A;  3L3R A;  1DG8 A;  1PDB A;  2P4G A;  4Q67 A;  4IXG X;  5FDA A;  1E26 A;  2W9H A;  4X5I A;  1NJA A;  5WRN A;  2C2T A;  1B02 A;  1RA2 A;  4FOA A;  3DFR A;  4M6L A;  1DR7 A;  3EEK A;  1TYS A;  2CIG A;  3JWM A;  1AJM A;  4HOG A;  3NZB X;  3GHC A;  3VCO A;  4H0R A;  3F0U X;  4EIN A;  4XRB A;  3QGT A;  3K2H A;  1RA9 A;  4X5H A;  1DNA A;  3QLW A;  1RX3 A;  3EEJ A;  3DGA C;  4I13 A;  2FTN A;  5HS3 A;  1DRE A;  1TDC A;  1VZD A;  5DXV A;  1M78 A;  3F0X X;  3F91 A;  1TJS A;  1RX8 A;  3NZD A;  1JUJ A;  3NU0 A;  3D80 A;  4GYH A;  3F8Y A;  2FZJ A;  1S3W A;  2AAZ A;  4G6W X;  1DAJ A;  1LCE A;  1B5E A;  1DIS A;  3S9U A;  3SGY A;  2TSC A;  3JW3 A;  4XT5 A;  5HI6 A;  3I3R A;  3NZ6 X;  3GHW A;  1BKP A;  1S3V A;  3N5G A;  2D5N A;  1TSY A;  2W3A A;  5EAJ A;  3NXX A;  1RA1 A;  4FGG A;  1TSN A;  2G8A A;  1NCE A;  1BKO A;  4FHB A;  4LAG X;  4IQQ A;  1CD2 A;  4P68 A;  3QYL A;  4X5G A;  4KYA A;  1LCB A;  1CI7 A;  3JW5 A;  3BFI A;  1F4G A;  3OB7 A;  3BHL A;  3KGY A;  2ANQ A;  2BBQ A;  4NX6 A;  2G89 A;  2AZN A;  3QL0 A;  3QLX A;  1TSZ A;  4O1X A;  3FQZ A;  3K74 A;  1BID A;  5HPB A;  5HSU A;  1QQQ A;  3IRM A;  2OBC A;  1DR4 A;  1HW3 A;  1RA3 A;  5JA3 A;  1HFR A;  4KBN A;  1AOE A;  1JU6 A;  3N5E B;  1DHF A;  3ZPC A;  4H98 A;  4M7U A;  1YPV A;  3KJR A;  3DGA A;  3QLY A;  4KM0 A;  3FRB X;  3LG4 A;  1D1G A;  1KZI A;  2W9G A;  1F28 A;  5ECX A;  3BZ0 A;  1DR3 A;  4H97 A;  3RO9 A;  1DR6 A;  4G8Z X;  5HUI A;  1KZJ A;  3QJ7 A;  3K45 A;  1MVT A;  4O1U A;  3FQ0 A;  3QLZ A;  4KNE A;  3NXV A;  2RD8 A;  2ONB A;  1HZW A;  4XEC X;  2W3B A;  5H38 A;  1RH3 A;  1HFQ A;  3CSE A;  1KCE A;  3SRS X;  1DYI A;  4HOE A;  2FTO X;  1AOB A;  4HOF A;  4OR7 A;  2HM9 A;  4LEK X;  1I00 A;  4DPH A;  3F0Q X;  1JUT A;  4QI9 A;  3FL8 A;  3ROA A;  1RG7 A;  4KM2 A;  1F4D A;  3NXT A;  1TSD A;  4IQB A;  4CD2 A;  3FQV A;  4EZ8 A;  3FYW X;  1TVU A;  2TSR A;  1DYR A;  3NZ9 X;  4KEB A;  1THY A;  4F2V A;  5HF2 X;  4PTH A;  2W3V A;  1BDU A;  3QL3 A;  4KAK A;  2BLB A;  2CD2 A;  3UM5 A;  1MVS A;  1RF7 A;  2G6V A;  1TSV A;  2KGK A;  1EVF A;  4ECK A;  1BO8 A;  1BQ1 A;  1AXW A;  1KLK A;  1TIS A;  3JWF A;  3QFX A;  4G95 A;  1DG7 A;  5FCT A;  4PSS A;  3I8A X;  4FOX A;  4TU5 X;  4H1I A;  1DIU A;  1DHI A;  1JTU A;  1RX1 A;  4PTJ A;  1LCA A;  1RC4 A;  2BLC A;  2VET A;  3BNZ A;  3IHI A;  3V8H A;  2O7P A;  2W3M A;  3FQO A;  3EGY X;  3EDW X;  1HFP A;  3N0H A;  3QLS A;  5HT5 A;  4P3R A;  1JUV A;  3DL5 A;  3GG5 A;  3H9K A;  1VZC A;  4KL9 A;  4EIZ A;  4O1X D;  3E0B A;  3FY9 X;  1S3Y A;  4M7V A;  1TSW A;  5HF0 X;  1AN5 A;  3TQ9 A;  4XSD A;  3IX9 A;  3IJZ A;  5H39 A;  1AIQ A;  1DR1 A;  1NJD A;  1HW4 A;  3FL9 A;  3JWK A;  5E8Q A;  8DFR A;  4P3Q A;  5HQZ A;  1DRF A;  4KD7 A;  3M09 A;  4QLG A;  1DG5 A;  3TQA A;  1FFL A;  1NJC A;  1J3K C;  4G3M A;  3IRO A;  1EV8 A;  4EJ1 A;  2RD8 B;  5U27 A;  1JOL A;  3DAU A;  1RB2 A;  4KJJ A;  3SA1 A;  1VZE A;  2H2Q A;  4EB4 A;  4XT4 A;  4Q0D A;  3JTW A;  4FGH A;  1DHJ A;  2BLA A;  3EX8 A;  3SR5 X;  1DDS A;  1KMS A;  4XSE A;  3NXY A;  1NJE A;  4PST A;  1BJG A;  4KY8 A;  1RTS A;  1PD8 A;  1F4B A;  4NX7 A;  3NXO A;  4ELG A;  2VF0 A;  1RX4 A;  1TVV A;  1VDR A;  5ECC A;  1JOM A;  3FRD X;  2BL9 A;  4QLF A;  3NZC X;  1DYH A;  4RGC A;  1U71 A;  3DAT A;  3IX6 A;  1IA3 A;  1YHO A;  1BZF A;  4GH8 A;  5HSR A;  2FZI A;  1BSP A;  3DG8 C;  4XE6 X;  3TQB A;  1JMG A;  3F8Z A;  3FQC A;  3JSU A;  3JWC A;  3IK1 A;  1TSM A;  4H95 A;  4KPW A;  2INQ A;  5H3A A;  5BY6 A;  3R33 A;  1IA2 A;  1JMH A;  3OAF A;  3S3V A;  3GH2 X;  4QLE A;  1RX2 A;  6DFR A;  4Q0E A;  4TMS A;  1LY4 A;  4DPD A;  1J3K A;  3GYF A;  3UM6 A;  1FWM A;  4X5F A;  1QZF A;  1BP0 A;  4KJL A;  2DHF A;  3NZA X;  3TMS A;  1F4E A;  4DP3 A;  4LRR A;  1DF7 A;  5CC9 A;  3EBU A;  3IK0 A;  3IRN A;  1VZA A;  5DFR A;  1AO8 A;  3RG9 A;  3UWL B;  2B3Z A;  2HXV A;  3QYO A;  2QK8 A;  3EEL A;  3OCH A;  1DLS A;  1KMV A;  4QHV A;  1TDA A;  1J3I C;  3BGX A;  3EHI X;  1DRH A;  2D0K A;  1DYJ A;  3NRR A;  1NJB A;  3HJ3 A;  1RX9 A;  2W9T A;  4HA9 A;  4IXE D;  3KJS A;  1ZDR A;  1RX5 A;  3CLB A;  3S7A A;  2XW7 A;  1TDB A;  1EVG A;  1JMF A;  2LF1 A;  5CCC A;  3SRR X;  3DG8 A;  1B5D A;  3GH0 A;  4QJZ D;  3SQY X;  1DDR A;  1DR5 A;  3GHV A;  2ZZA A;  3SRW X;  4KFJ A;  3EJL A;  3SH2 A;  3B9H A;  4PDJ A;  3UWL A;  3CL9 A;  1J3J C;  3NTZ A;  4KJK A;  3SAI A;  1IA4 A;  2C2S A;  4OSG A;  1DLR A;  3FYV X;  3QLR A;  1CZ3 A;  3IA5 A;  2FZH A;  4FOG A;  4G2O X;  4PSG A;  2W3W A;  3IA4 A;  2TDD A;  2KCE A;  3UM8 A;  3K47 A;  3DRC A;  1BSF A;  7DFR A;  3F0S X;  3EEM A;  1M79 A;  4ISW A;  2ITH A;  3SRU X;  2JYB A;  3HB8 A;  1OHK A;  3JVX A;  1TLS A;  1U70 A;  4ELB A;  3FRE X;  4EIG A;  2A9W A;  3ED7 A;  2G8X A;  4XT6 A;  2L28 A;  2GD9 A;  4JEF A;  1TSL A;  5JG0 X;  1OHJ A;  3Q1H A;  1SYN A;  2W9S A;  1BOZ A;  1RB3 A;  4H96 A;  1DR2 A;  3QG2 A;  4Q6A A;  3DL6 A;  3FQF A;  3INV A;  2ANO A;  1J3I A;  4I1N A;  2TDM A;  5HVE A;  3CD2 A;  4M6K A;  3HBB A;  3F0V X;  4LAE X;  4ISK A;  1LUD A;  1BQ2 A;  3FY8 X;  3TQ8 A;  1TRG A;  3EIG A;  1B49 A;  1AI9 A;  4DDR A;  1BO7 A;  1HVY A;  4PSY A;  3FS6 A;  4O7U A;  5HQY A;  1ZPR A;  1BPJ A;  2RDA A;  4GEV A;  1TDU A;  1IA1 A;  1TLC A;  1RA8 A;  1DRA A;  1J3J A;  2G8D A;  4X5J A;  4FQS A;  5HVB A;  1PD9 A;  3EAW X;  4KNZ A;  1EV5 A;  4GD7 A;  1JG0 A;  4KY4 A;  3ZPG A;  3KGB A;  4LAH X;  1RX6 A;  4HA7 A;  5U26 A;  3KFY A;  4E28 A;  2DRC A;  4XT8 A;  4FGT A;  2G86 A;  3B5B A;  1RE7 A;  5HT4 A;  3SA2 A;  1JTQ A;  5J7W A;  4UP1 A;  4DQ1 A; 
#chains in the Genus database with same CATH topology
 3C0A A;  3M08 A;  4ELH A;  3BYX A;  3GI2 A;  1VJ3 A;  3N5E A;  4KLX A;  4ELF A;  1LY3 A;  4M2X A;  3F0B X;  1RX7 A;  3SRQ X;  1F4C A;  1BP6 A;  3BHR A;  4DFR A;  4QJC A;  4XT7 A;  4IRR A;  1TVW A;  4ELE A;  4P66 A;  1VZB A;  4EIL A;  4E5O A;  3FRA X;  1M7A A;  3NXR A;  4H0U A;  1TSX A;  3C06 A;  1F4F A;  4IXF X;  1U72 A;  2HQP A;  3FRF X;  4M6J A;  1RD7 A;  1S3U A;  3EF9 A;  1SEJ A;  1DDU A;  1DRB A;  2OIP A;  3D84 X;  1JMI A;  3TD8 A;  3KY8 A;  1TDR A;  4XSC A;  2FTQ A;  3L3R A;  1DG8 A;  1PDB A;  2P4G A;  4Q67 A;  4IXG X;  5FDA A;  1E26 A;  2W9H A;  4X5I A;  1NJA A;  5WRN A;  2C2T A;  1B02 A;  1RA2 A;  4FOA A;  3DFR A;  4M6L A;  1DR7 A;  3EEK A;  1TYS A;  2CIG A;  3JWM A;  1AJM A;  4HOG A;  3NZB X;  3GHC A;  3VCO A;  4H0R A;  3F0U X;  4EIN A;  4XRB A;  3QGT A;  3K2H A;  1RA9 A;  4X5H A;  1DNA A;  3QLW A;  1RX3 A;  3EEJ A;  3DGA C;  4I13 A;  2FTN A;  5HS3 A;  1DRE A;  1TDC A;  1VZD A;  5DXV A;  1M78 A;  3F0X X;  3F91 A;  1TJS A;  1RX8 A;  3NZD A;  1JUJ A;  3NU0 A;  3D80 A;  4GYH A;  3F8Y A;  2FZJ A;  1S3W A;  2AAZ A;  4G6W X;  1DAJ A;  1LCE A;  1B5E A;  1DIS A;  3S9U A;  3SGY A;  2TSC A;  3JW3 A;  4XT5 A;  5HI6 A;  3I3R A;  3NZ6 X;  3GHW A;  1BKP A;  1S3V A;  3N5G A;  2D5N A;  1TSY A;  2W3A A;  5EAJ A;  3NXX A;  1RA1 A;  4FGG A;  1TSN A;  2G8A A;  1NCE A;  1BKO A;  4FHB A;  4LAG X;  4IQQ A;  1CD2 A;  4P68 A;  3QYL A;  4X5G A;  4KYA A;  1LCB A;  1CI7 A;  3JW5 A;  3BFI A;  1F4G A;  3OB7 A;  3BHL A;  3KGY A;  2ANQ A;  2BBQ A;  4NX6 A;  2G89 A;  2AZN A;  3QL0 A;  3QLX A;  1TSZ A;  4O1X A;  3FQZ A;  3K74 A;  1BID A;  5HPB A;  5HSU A;  1QQQ A;  3IRM A;  2OBC A;  1DR4 A;  1HW3 A;  1RA3 A;  5JA3 A;  1HFR A;  4KBN A;  1AOE A;  1JU6 A;  3N5E B;  1DHF A;  3ZPC A;  4H98 A;  4M7U A;  1YPV A;  3KJR A;  3DGA A;  3QLY A;  4KM0 A;  3FRB X;  3LG4 A;  1D1G A;  1KZI A;  2W9G A;  1F28 A;  5ECX A;  3BZ0 A;  1DR3 A;  4H97 A;  3RO9 A;  1DR6 A;  4G8Z X;  5HUI A;  1KZJ A;  3QJ7 A;  3K45 A;  1MVT A;  4O1U A;  3FQ0 A;  3QLZ A;  4KNE A;  3NXV A;  2RD8 A;  2ONB A;  1HZW A;  4XEC X;  2W3B A;  5H38 A;  1RH3 A;  1HFQ A;  3CSE A;  1KCE A;  3SRS X;  1DYI A;  4HOE A;  2FTO X;  1AOB A;  4HOF A;  4OR7 A;  2HM9 A;  4LEK X;  1I00 A;  4DPH A;  3F0Q X;  1JUT A;  4QI9 A;  3FL8 A;  3ROA A;  1RG7 A;  4KM2 A;  1F4D A;  3NXT A;  1TSD A;  4IQB A;  4CD2 A;  3FQV A;  4EZ8 A;  3FYW X;  1TVU A;  2TSR A;  1DYR A;  3NZ9 X;  4KEB A;  1THY A;  4F2V A;  5HF2 X;  4PTH A;  2W3V A;  1BDU A;  3QL3 A;  4KAK A;  2BLB A;  2CD2 A;  3UM5 A;  1MVS A;  1RF7 A;  2G6V A;  1TSV A;  2KGK A;  1EVF A;  4ECK A;  1BO8 A;  1BQ1 A;  1AXW A;  1KLK A;  1TIS A;  3JWF A;  3QFX A;  4G95 A;  1DG7 A;  5FCT A;  4PSS A;  3I8A X;  4FOX A;  4TU5 X;  4H1I A;  1DIU A;  1DHI A;  1JTU A;  1RX1 A;  4PTJ A;  1LCA A;  1RC4 A;  2BLC A;  2VET A;  3BNZ A;  3IHI A;  3V8H A;  2O7P A;  2W3M A;  3FQO A;  3EGY X;  3EDW X;  1HFP A;  3N0H A;  3QLS A;  5HT5 A;  4P3R A;  1JUV A;  3DL5 A;  3GG5 A;  3H9K A;  1VZC A;  4KL9 A;  4EIZ A;  4O1X D;  3E0B A;  3FY9 X;  1S3Y A;  4M7V A;  1TSW A;  5HF0 X;  1AN5 A;  3TQ9 A;  4XSD A;  3IX9 A;  3IJZ A;  5H39 A;  1AIQ A;  1DR1 A;  1NJD A;  1HW4 A;  3FL9 A;  3JWK A;  5E8Q A;  8DFR A;  4P3Q A;  5HQZ A;  1DRF A;  4KD7 A;  3M09 A;  4QLG A;  1DG5 A;  3TQA A;  1FFL A;  1NJC A;  1J3K C;  4G3M A;  3IRO A;  1EV8 A;  4EJ1 A;  2RD8 B;  5U27 A;  1JOL A;  3DAU A;  1RB2 A;  4KJJ A;  3SA1 A;  1VZE A;  2H2Q A;  4EB4 A;  4XT4 A;  4Q0D A;  3JTW A;  4FGH A;  1DHJ A;  2BLA A;  3EX8 A;  3SR5 X;  1DDS A;  1KMS A;  4XSE A;  3NXY A;  1NJE A;  4PST A;  1BJG A;  4KY8 A;  1RTS A;  1PD8 A;  1F4B A;  4NX7 A;  3NXO A;  4ELG A;  2VF0 A;  1RX4 A;  1TVV A;  1VDR A;  5ECC A;  1JOM A;  3FRD X;  2BL9 A;  4QLF A;  3NZC X;  1DYH A;  4RGC A;  1U71 A;  3DAT A;  3IX6 A;  1IA3 A;  1YHO A;  1BZF A;  4GH8 A;  5HSR A;  2FZI A;  1BSP A;  3DG8 C;  4XE6 X;  3TQB A;  1JMG A;  3F8Z A;  3FQC A;  3JSU A;  3JWC A;  3IK1 A;  1TSM A;  4H95 A;  4KPW A;  2INQ A;  5H3A A;  5BY6 A;  3R33 A;  1IA2 A;  1JMH A;  3OAF A;  3S3V A;  3GH2 X;  4QLE A;  1RX2 A;  6DFR A;  4Q0E A;  4TMS A;  1LY4 A;  4DPD A;  1J3K A;  3GYF A;  3UM6 A;  1FWM A;  4X5F A;  1QZF A;  1BP0 A;  4KJL A;  2DHF A;  3NZA X;  3TMS A;  1F4E A;  4DP3 A;  4LRR A;  1DF7 A;  5CC9 A;  3EBU A;  3IK0 A;  3IRN A;  1VZA A;  5DFR A;  1AO8 A;  3RG9 A;  3UWL B;  2B3Z A;  2HXV A;  3QYO A;  2QK8 A;  3EEL A;  3OCH A;  1DLS A;  1KMV A;  4QHV A;  1TDA A;  1J3I C;  3BGX A;  3EHI X;  1DRH A;  2D0K A;  1DYJ A;  3NRR A;  1NJB A;  3HJ3 A;  1RX9 A;  2W9T A;  4HA9 A;  4IXE D;  3KJS A;  1ZDR A;  1RX5 A;  3CLB A;  3S7A A;  2XW7 A;  1TDB A;  1EVG A;  1JMF A;  2LF1 A;  5CCC A;  3SRR X;  3DG8 A;  1B5D A;  3GH0 A;  4QJZ D;  3SQY X;  1DDR A;  1DR5 A;  3GHV A;  2ZZA A;  3SRW X;  4KFJ A;  3EJL A;  3SH2 A;  3B9H A;  4PDJ A;  3UWL A;  3CL9 A;  1J3J C;  3NTZ A;  4KJK A;  3SAI A;  1IA4 A;  2C2S A;  4OSG A;  1DLR A;  3FYV X;  3QLR A;  1CZ3 A;  3IA5 A;  2FZH A;  4FOG A;  4G2O X;  4PSG A;  2W3W A;  3IA4 A;  2TDD A;  2KCE A;  3UM8 A;  3K47 A;  3DRC A;  1BSF A;  7DFR A;  3F0S X;  3EEM A;  1M79 A;  4ISW A;  2ITH A;  3SRU X;  2JYB A;  3HB8 A;  1OHK A;  3JVX A;  1TLS A;  1U70 A;  4ELB A;  3FRE X;  4EIG A;  2A9W A;  3ED7 A;  2G8X A;  4XT6 A;  2L28 A;  2GD9 A;  4JEF A;  1TSL A;  5JG0 X;  1OHJ A;  3Q1H A;  1SYN A;  2W9S A;  1BOZ A;  1RB3 A;  4H96 A;  1DR2 A;  3QG2 A;  4Q6A A;  3DL6 A;  3FQF A;  3INV A;  2ANO A;  1J3I A;  4I1N A;  2TDM A;  5HVE A;  3CD2 A;  4M6K A;  3HBB A;  3F0V X;  4LAE X;  4ISK A;  1LUD A;  1BQ2 A;  3FY8 X;  3TQ8 A;  1TRG A;  3EIG A;  1B49 A;  1AI9 A;  4DDR A;  1BO7 A;  1HVY A;  4PSY A;  3FS6 A;  4O7U A;  5HQY A;  1ZPR A;  1BPJ A;  2RDA A;  4GEV A;  1TDU A;  1IA1 A;  1TLC A;  1RA8 A;  1DRA A;  1J3J A;  2G8D A;  4X5J A;  4FQS A;  5HVB A;  1PD9 A;  3EAW X;  4KNZ A;  1EV5 A;  4GD7 A;  1JG0 A;  4KY4 A;  3ZPG A;  3KGB A;  4LAH X;  1RX6 A;  4HA7 A;  5U26 A;  3KFY A;  4E28 A;  2DRC A;  4XT8 A;  4FGT A;  2G86 A;  3B5B A;  1RE7 A;  5HT4 A;  3SA2 A;  1JTQ A;  5J7W A;  4UP1 A;  4DQ1 A; 
#chains in the Genus database with same CATH homology
 3C0A A;  3M08 A;  4ELH A;  3BYX A;  3GI2 A;  1VJ3 A;  3N5E A;  4KLX A;  4ELF A;  1LY3 A;  4M2X A;  3F0B X;  1RX7 A;  3SRQ X;  1F4C A;  1BP6 A;  3BHR A;  4DFR A;  4QJC A;  4XT7 A;  4IRR A;  1TVW A;  4ELE A;  4P66 A;  1VZB A;  4EIL A;  4E5O A;  3FRA X;  1M7A A;  3NXR A;  4H0U A;  1TSX A;  3C06 A;  1F4F A;  4IXF X;  1U72 A;  2HQP A;  3FRF X;  4M6J A;  1RD7 A;  1S3U A;  3EF9 A;  1SEJ A;  1DDU A;  1DRB A;  2OIP A;  3D84 X;  1JMI A;  3TD8 A;  3KY8 A;  1TDR A;  4XSC A;  2FTQ A;  3L3R A;  1DG8 A;  1PDB A;  2P4G A;  4Q67 A;  4IXG X;  5FDA A;  1E26 A;  2W9H A;  4X5I A;  1NJA A;  5WRN A;  2C2T A;  1B02 A;  1RA2 A;  4FOA A;  3DFR A;  4M6L A;  1DR7 A;  3EEK A;  1TYS A;  2CIG A;  3JWM A;  1AJM A;  4HOG A;  3NZB X;  3GHC A;  3VCO A;  4H0R A;  3F0U X;  4EIN A;  4XRB A;  3QGT A;  3K2H A;  1RA9 A;  4X5H A;  1DNA A;  3QLW A;  1RX3 A;  3EEJ A;  3DGA C;  4I13 A;  2FTN A;  5HS3 A;  1DRE A;  1TDC A;  1VZD A;  5DXV A;  1M78 A;  3F0X X;  3F91 A;  1TJS A;  1RX8 A;  3NZD A;  1JUJ A;  3NU0 A;  3D80 A;  4GYH A;  3F8Y A;  2FZJ A;  1S3W A;  2AAZ A;  4G6W X;  1DAJ A;  1LCE A;  1B5E A;  1DIS A;  3S9U A;  3SGY A;  2TSC A;  3JW3 A;  4XT5 A;  5HI6 A;  3I3R A;  3NZ6 X;  3GHW A;  1BKP A;  1S3V A;  3N5G A;  2D5N A;  1TSY A;  2W3A A;  5EAJ A;  3NXX A;  1RA1 A;  4FGG A;  1TSN A;  2G8A A;  1NCE A;  1BKO A;  4FHB A;  4LAG X;  4IQQ A;  1CD2 A;  4P68 A;  3QYL A;  4X5G A;  4KYA A;  1LCB A;  1CI7 A;  3JW5 A;  3BFI A;  1F4G A;  3OB7 A;  3BHL A;  3KGY A;  2ANQ A;  2BBQ A;  4NX6 A;  2G89 A;  2AZN A;  3QL0 A;  3QLX A;  1TSZ A;  4O1X A;  3FQZ A;  3K74 A;  1BID A;  5HPB A;  5HSU A;  1QQQ A;  3IRM A;  2OBC A;  1DR4 A;  1HW3 A;  1RA3 A;  5JA3 A;  1HFR A;  4KBN A;  1AOE A;  1JU6 A;  3N5E B;  1DHF A;  3ZPC A;  4H98 A;  4M7U A;  1YPV A;  3KJR A;  3DGA A;  3QLY A;  4KM0 A;  3FRB X;  3LG4 A;  1D1G A;  1KZI A;  2W9G A;  1F28 A;  5ECX A;  3BZ0 A;  1DR3 A;  4H97 A;  3RO9 A;  1DR6 A;  4G8Z X;  5HUI A;  1KZJ A;  3QJ7 A;  3K45 A;  1MVT A;  4O1U A;  3FQ0 A;  3QLZ A;  4KNE A;  3NXV A;  2RD8 A;  2ONB A;  1HZW A;  4XEC X;  2W3B A;  5H38 A;  1RH3 A;  1HFQ A;  3CSE A;  1KCE A;  3SRS X;  1DYI A;  4HOE A;  2FTO X;  1AOB A;  4HOF A;  4OR7 A;  2HM9 A;  4LEK X;  1I00 A;  4DPH A;  3F0Q X;  1JUT A;  4QI9 A;  3FL8 A;  3ROA A;  1RG7 A;  4KM2 A;  1F4D A;  3NXT A;  1TSD A;  4IQB A;  4CD2 A;  3FQV A;  4EZ8 A;  3FYW X;  1TVU A;  2TSR A;  1DYR A;  3NZ9 X;  4KEB A;  1THY A;  4F2V A;  5HF2 X;  4PTH A;  2W3V A;  1BDU A;  3QL3 A;  4KAK A;  2BLB A;  2CD2 A;  3UM5 A;  1MVS A;  1RF7 A;  2G6V A;  1TSV A;  2KGK A;  1EVF A;  4ECK A;  1BO8 A;  1BQ1 A;  1AXW A;  1KLK A;  1TIS A;  3JWF A;  3QFX A;  4G95 A;  1DG7 A;  5FCT A;  4PSS A;  3I8A X;  4FOX A;  4TU5 X;  4H1I A;  1DIU A;  1DHI A;  1JTU A;  1RX1 A;  4PTJ A;  1LCA A;  1RC4 A;  2BLC A;  2VET A;  3BNZ A;  3IHI A;  3V8H A;  2O7P A;  2W3M A;  3FQO A;  3EGY X;  3EDW X;  1HFP A;  3N0H A;  3QLS A;  5HT5 A;  4P3R A;  1JUV A;  3DL5 A;  3GG5 A;  3H9K A;  1VZC A;  4KL9 A;  4EIZ A;  4O1X D;  3E0B A;  3FY9 X;  1S3Y A;  4M7V A;  1TSW A;  5HF0 X;  1AN5 A;  3TQ9 A;  4XSD A;  3IX9 A;  3IJZ A;  5H39 A;  1AIQ A;  1DR1 A;  1NJD A;  1HW4 A;  3FL9 A;  3JWK A;  5E8Q A;  8DFR A;  4P3Q A;  5HQZ A;  1DRF A;  4KD7 A;  3M09 A;  4QLG A;  1DG5 A;  3TQA A;  1FFL A;  1NJC A;  1J3K C;  4G3M A;  3IRO A;  1EV8 A;  4EJ1 A;  2RD8 B;  5U27 A;  1JOL A;  3DAU A;  1RB2 A;  4KJJ A;  3SA1 A;  1VZE A;  2H2Q A;  4EB4 A;  4XT4 A;  4Q0D A;  3JTW A;  4FGH A;  1DHJ A;  2BLA A;  3EX8 A;  3SR5 X;  1DDS A;  1KMS A;  4XSE A;  3NXY A;  1NJE A;  4PST A;  1BJG A;  4KY8 A;  1RTS A;  1PD8 A;  1F4B A;  4NX7 A;  3NXO A;  4ELG A;  2VF0 A;  1RX4 A;  1TVV A;  1VDR A;  5ECC A;  1JOM A;  3FRD X;  2BL9 A;  4QLF A;  3NZC X;  1DYH A;  4RGC A;  1U71 A;  3DAT A;  3IX6 A;  1IA3 A;  1YHO A;  1BZF A;  4GH8 A;  5HSR A;  2FZI A;  1BSP A;  3DG8 C;  4XE6 X;  3TQB A;  1JMG A;  3F8Z A;  3FQC A;  3JSU A;  3JWC A;  3IK1 A;  1TSM A;  4H95 A;  4KPW A;  2INQ A;  5H3A A;  5BY6 A;  3R33 A;  1IA2 A;  1JMH A;  3OAF A;  3S3V A;  3GH2 X;  4QLE A;  1RX2 A;  6DFR A;  4Q0E A;  4TMS A;  1LY4 A;  4DPD A;  1J3K A;  3GYF A;  3UM6 A;  1FWM A;  4X5F A;  1QZF A;  1BP0 A;  4KJL A;  2DHF A;  3NZA X;  3TMS A;  1F4E A;  4DP3 A;  4LRR A;  1DF7 A;  5CC9 A;  3EBU A;  3IK0 A;  3IRN A;  1VZA A;  5DFR A;  1AO8 A;  3RG9 A;  3UWL B;  2B3Z A;  2HXV A;  3QYO A;  2QK8 A;  3EEL A;  3OCH A;  1DLS A;  1KMV A;  4QHV A;  1TDA A;  1J3I C;  3BGX A;  3EHI X;  1DRH A;  2D0K A;  1DYJ A;  3NRR A;  1NJB A;  3HJ3 A;  1RX9 A;  2W9T A;  4HA9 A;  4IXE D;  3KJS A;  1ZDR A;  1RX5 A;  3CLB A;  3S7A A;  2XW7 A;  1TDB A;  1EVG A;  1JMF A;  2LF1 A;  5CCC A;  3SRR X;  3DG8 A;  1B5D A;  3GH0 A;  4QJZ D;  3SQY X;  1DDR A;  1DR5 A;  3GHV A;  2ZZA A;  3SRW X;  4KFJ A;  3EJL A;  3SH2 A;  3B9H A;  4PDJ A;  3UWL A;  3CL9 A;  1J3J C;  3NTZ A;  4KJK A;  3SAI A;  1IA4 A;  2C2S A;  4OSG A;  1DLR A;  3FYV X;  3QLR A;  1CZ3 A;  3IA5 A;  2FZH A;  4FOG A;  4G2O X;  4PSG A;  2W3W A;  3IA4 A;  2TDD A;  2KCE A;  3UM8 A;  3K47 A;  3DRC A;  1BSF A;  7DFR A;  3F0S X;  3EEM A;  1M79 A;  4ISW A;  2ITH A;  3SRU X;  2JYB A;  3HB8 A;  1OHK A;  3JVX A;  1TLS A;  1U70 A;  4ELB A;  3FRE X;  4EIG A;  2A9W A;  3ED7 A;  2G8X A;  4XT6 A;  2L28 A;  2GD9 A;  4JEF A;  1TSL A;  5JG0 X;  1OHJ A;  3Q1H A;  1SYN A;  2W9S A;  1BOZ A;  1RB3 A;  4H96 A;  1DR2 A;  3QG2 A;  4Q6A A;  3DL6 A;  3FQF A;  3INV A;  2ANO A;  1J3I A;  4I1N A;  2TDM A;  5HVE A;  3CD2 A;  4M6K A;  3HBB A;  3F0V X;  4LAE X;  4ISK A;  1LUD A;  1BQ2 A;  3FY8 X;  3TQ8 A;  1TRG A;  3EIG A;  1B49 A;  1AI9 A;  4DDR A;  1BO7 A;  1HVY A;  4PSY A;  3FS6 A;  4O7U A;  5HQY A;  1ZPR A;  1BPJ A;  2RDA A;  4GEV A;  1TDU A;  1IA1 A;  1TLC A;  1RA8 A;  1DRA A;  1J3J A;  2G8D A;  4X5J A;  4FQS A;  5HVB A;  1PD9 A;  3EAW X;  4KNZ A;  1EV5 A;  4GD7 A;  1JG0 A;  4KY4 A;  3ZPG A;  3KGB A;  4LAH X;  1RX6 A;  4HA7 A;  5U26 A;  3KFY A;  4E28 A;  2DRC A;  4XT8 A;  4FGT A;  2G86 A;  3B5B A;  1RE7 A;  5HT4 A;  3SA2 A;  1JTQ A;  5J7W A;  4UP1 A;  4DQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...