4ECKA

Crystal structure of the toxoplasma gondii ts-dhfr
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
608
structure length
498
Chain Sequence
KPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTTPEFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKEEDIAAKEGQQRVRVCASLPAALSLEEYKDSVDQIFVVGAGLYEAALSGVASHLYITRVAREFPCDVFFPAPGDDILTYRPIFISKTFSDNGVPYDFVVLEKRSSAAAIAPVLAWMDEDRELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title First Three-Dimensional Structure of Toxoplasma gondii Thymidylate Synthase-Dihydrofolate Reductase: Insights for Catalysis, Interdomain Interactions, and Substrate Channeling.
pubmed doi rcsb
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
molecule tags Transferase, oxidoreductase
source organism Toxoplasma gondii
total genus 108
structure length 498
sequence length 608
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4eckA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4eckA01
1BJGA 4X5JA 3FREX 4I1NA 3FYVX 4KNEA 1JMHA 2BBQA 3KJRA 3D80A 3M08A 3NZAX 1DHFA 3SAIA 5DXVA 1AO8A 3IA4A 3EEMA 3NZDA 1QQQA 2OIPA 3IROA 1LUDA 4LEKX 1BO7A 2FZHA 1TLCA 1VJ3A 3ZPCA 1FFLA 1RB2A 4KJJA 1TVVA 4EILA 1JUJA 3SH2A 3QGTA 1DHJA 1JOMA 4FOAA 3FRFX 1J3JA 1J3IC 2BLAA 1BO8A 1B5EA 1HW4A 1TLSA 5E8QA 1F4BA 5FCTA 3ED7A 1F4FA 2C2TA 3ROAA 4QJCA 4KM0A 3EEJA 1DNAA 4TMSA 2C2SA 2CIGA 2ANOA 3IJZA 4IQBA 1RA1A 4FGGA 1M79A 3VCOA 3N5GA 1VZCA 3JW5A 1TSDA 3FS6A 1AOBA 3DG8A 1AXWA 2G8DA 3FL8A 4H98A 1VZAA 3FRAX 1TVWA 4FOXA 1RA2A 4QHVA 1OHJA 4P66A 1KMVA 3NXYA 3GHWA 1U71A 1RA3A 3BFIA 4HOEA 1EV5A 4DFRA 4KL9A 4KM2A 3BHRA 4EB4A 4KJLA 4EJ1A 3C06A 4Q0DA 2G89A 4P68A 1DYJA 3FRDX 4IXGX 1TSMA 3KGBA 2W3VA 2DRCA 4M7VA 1TRGA 5H38A 4LAGX 3JWFA 1J3KA 4QLEA 3UM8A 1BKOA 3DAUA 3SGYA 3SR5X 1RX9A 1RX7A 2TSCA 4G95A 3B9HA 1DG5A 1TDCA 4I13A 1CD2A 5U27A 5U26A 3NZ6X 3N5EA 1SYNA 3EEKA 4M6KA 5HI6A 4KFJA 3L3RA 5HF2X 1OHKA 2D5NA 1NJBA 5HUIA 3JWCA 3BGXA 1DLRA 1DR4A 1RX5A 3D84X 1BSPA 1PD8A 4KYAA 3GH0A 4PSGA 4PTHA 4XSCA 1PDBA 5FDAA 3RG9A 3JSUA 4X5GA 3IRMA 1BP6A 4TU5X 1JMIA 4NX6A 2FTNA 3B5BA 1FWMA 2G86A 3FYWX 1DG8A 1ZPRA 5HPBA 4EIGA 3KFYA 3IHIA 2HXVA 4X5FA 3QJ7A 3R33A 1M78A 1RX2A 3QL3A 4PDJA 3FRBX 4XRBA 3SQYX 3TQ8A 8DFRA 4DPHA 4O1XD 5CC9A 1NJEA 3NXVA 4LAHX 4EINA 2CD2A 3K47A 1DISA 3QL0A 3BNZA 3INVA 1BKPA 2FTOX 3TMSA 2FTQA 1AJMA 4FOGA 1RX6A 1TSVA 3V8HA 4PSTA 3QYOA 4KY8A 1DRBA 4PSYA 1YPVA 4GYHA 3FY8X 3NU0A 2O7PA 3QLXA 2TSRA 5HQYA 1DR6A 1EVFA 1AI9A 1TISA 1I00A 2W9SA 4GH8A 2JYBA 4FHBA 4ELBA 3FQZA 1DR5A 3FQVA 3UWLA 1RH3A 3JW3A 1TJSA 3Q1HA 1TVUA 4CD2A 1DAJA 1DR7A 3I8AX 5HSRA 2QK8A 3EAWX 1HVYA 4ISKA 1RA9A 4H0RA 3SRQX 3F0BX 1CZ3A 1BZFA 3FQFA 4RGCA 1DDRA 3NXOA 3ZPGA 4LAEX 4XSDA 5H3AA 1LCAA 3NZ9X 1TSLA 1VZEA 3N5EB 1HFRA 4P3QA 3EF9A 4IRRA 1DHIA 4QLFA 4OSGA 3I3RA 1RX8A 1E26A 1S3VA 4G8ZX 2A9WA 1TSXA 3JVXA 5J7WA 3SA2A 3SRRX 1THYA 4M6JA 1BPJA 4HOFA 3EIGA 2D0KA 1EVGA 3IK0A 4E28A 2ANQA 1TDUA 1BOZA 1S3UA 3NXXA 1RG7A 4H95A 4H0UA 5JG0X 3IK1A 3GHCA 1AOEA 4XT7A 1JTQA 3JTWA 1RX4A 1MVSA 2BLCA 4KLXA 4KY4A 2INQA 3KJSA 3KY8A 1TYSA 4IXFX 2L28A 3CLBA 3HB8A 3DGAC 3K2HA 2BL9A 1DIUA 1U72A 1HW3A 3F0QX 3F0VX 4H97A 4EIZA 1AIQA 4M2XA 3SRUX 3DL5A 1TSWA 3UM6A 5HS3A 3S9UA 4EZ8A 2W9GA 3EDWX 1HFPA 3F0XX 1MVTA 1RB3A 1RD7A 4Q0EA 2XW7A 2HM9A 1EV8A 3FQCA 3QFXA 3GI2A 1TSYA 1B02A 4XECX 4XE6X 3QLSA 1TDBA 3BYXA 3UWLB 4KPWA 1B5DA 1RTSA 1RC4A 3EJLA 1IA2A 3F91A 1BQ2A 1DYRA 3GG5A 5HVBA 3OCHA 2W3AA 4QLGA 1DYHA 2AZNA 2KCEA 2AAZA 3FY9X 4O7UA 1KZJA 4KAKA 5EAJA 5HT4A 4LRRA 2G8AA 1U70A 1IA4A 4O1UA 4Q67A 4XT4A 2DHFA 3GYFA 7DFRA 5HQZA 1RE7A 1CI7A 5ECXA 5DFRA 1TDAA 1F4DA 4OR7A 3QLYA 4ELEA 1M7AA 3F0UX 4H1IA 4X5IA 2RD8A 6DFRA 3NXRA 1DLSA 4DP3A 1RA8A 3BHLA 1JG0A 1D1GA 2ONBA 5HF0X 1BQ1A 1F4EA 2P4GA 2BLBA 4KBNA 3TD8A 4KJKA 1NJAA 2OBCA 3QYLA 4M6LA 1LY3A 3IX9A 4X5HA 5HVEA 2B3ZA 2ITHA 1J3JC 1DREA 3QG2A 1DYIA 1S3WA 1AN5A 3KGYA 3NXTA 4JEFA 1DR3A 4KD7A 3UM5A 1LCBA 3S3VA 1SEJA 5HSUA 3S7AA 4PSSA 3F8ZA 1JUVA 1J3IA 4ECKA 1TDRA 1JTUA 4E5OA 3DG8C 3F0SX 1RX1A 4G3MA 3SA1A 3LG4A 1B49A 1JOLA 1DDUA 1NCEA 3K45A 4GD7A 4KNZA 1RX3A 3N0HA 1F4CA 3RO9A 3OB7A 3DATA 4HOGA 3TQBA 1VZDA 1LY4A 3EELA 2FZIA 3FQOA 4FGHA 2ZZAA 1YHOA 4PTJA 4DDRA 3TQAA 1DRAA 3JWMA 3HJ3A 1PD9A 2W3MA 3F8YA 3NZCX 2GD9A 4FQSA 1BP0A 1DR1A 3CSEA 1DF7A 1BDUA 2TDMA 5H39A 1NJCA 4XT8A 3IX6A 1J3KC 3IRNA 4NX7A 1JU6A 3QLWA 2W9TA 1JUTA 3K74A 4H96A 1F28A 1DRFA 4DPDA 1DDSA 4M7UA 4XT5A 1TSZA 4ISWA 3EGYX 3QLZA 3DGAA 1KMSA 1JMFA 1HFQA 3EBUA 1DG7A 3SRSX 1S3YA 4IXED 3C0AA 4XSEA 4G2OX 4Q6AA 2W3BA 2KGKA 3M09A 4UP1A 2RD8B 1IA3A 2W9HA 1NJDA 3SRWX 3CD2A 5HT5A 3BZ0A 1F4GA 3DL6A 1KZIA 1LCEA 1KCEA 1BSFA 1ZDRA 2W3WA 4ELGA 3FQ0A 3EX8A 1TSNA 4HA7A 3NZBX 1BIDA 4GEVA 2RDAA 3JWKA 3GH2X 3DFRA 1KLKA 2FZJA 4XT6A 4ELFA 2TDDA 1DRHA 3E0BA 4G6WX 4QJZD 4QI9A 2VF0A 4F2VA 2G6VA 3OAFA 2VETA 1RF7A 3H9KA 4KEBA 3NTZA 5ECCA 1VDRA 4P3RA 2G8XA 3DRCA 4ELHA 3NRRA 3TQ9A 3IA5A 5CCCA 3EHIX 2LF1A 5WRNA 1HZWA 1DR2A 1JMGA 4HA9A 3QLRA 3FL9A 3GHVA 2H2QA 1QZFA 3HBBA 4O1XA 5BY6A 5JA3A 1VZBA 3CL9A 4FGTA 1IA1A 2HQPA 4IQQA 4DQ1A
chains in the Genus database with same CATH superfamily
1BJGA 4X5JA 3FREX 4I1NA 3FYVX 4KNEA 1JMHA 2BBQA 3KJRA 3D80A 3M08A 3NZAX 1DHFA 3SAIA 5DXVA 1AO8A 3IA4A 3EEMA 3NZDA 1QQQA 2OIPA 3IROA 1LUDA 4LEKX 1BO7A 2FZHA 1TLCA 1VJ3A 3ZPCA 1FFLA 1RB2A 4KJJA 1TVVA 4EILA 1JUJA 3SH2A 3QGTA 1DHJA 1JOMA 4FOAA 3FRFX 1J3JA 1J3IC 2BLAA 1BO8A 1B5EA 1HW4A 1TLSA 5E8QA 1F4BA 5FCTA 3ED7A 1F4FA 2C2TA 3ROAA 4QJCA 4KM0A 3EEJA 1DNAA 4TMSA 2C2SA 2CIGA 2ANOA 3IJZA 4IQBA 1RA1A 4FGGA 1M79A 3VCOA 3N5GA 1VZCA 3JW5A 1TSDA 3FS6A 1AOBA 3DG8A 1AXWA 2G8DA 3FL8A 4H98A 1VZAA 3FRAX 1TVWA 4FOXA 1RA2A 4QHVA 1OHJA 4P66A 1KMVA 3NXYA 3GHWA 1U71A 1RA3A 3BFIA 4HOEA 1EV5A 4DFRA 4KL9A 4KM2A 3BHRA 4EB4A 4KJLA 4EJ1A 3C06A 4Q0DA 2G89A 4P68A 1DYJA 3FRDX 4IXGX 1TSMA 3KGBA 2W3VA 2DRCA 4M7VA 1TRGA 5H38A 4LAGX 3JWFA 1J3KA 4QLEA 3UM8A 1BKOA 3DAUA 3SGYA 3SR5X 1RX9A 1RX7A 2TSCA 4G95A 3B9HA 1DG5A 1TDCA 4I13A 1CD2A 5U27A 5U26A 3NZ6X 3N5EA 1SYNA 3EEKA 4M6KA 5HI6A 4KFJA 3L3RA 5HF2X 1OHKA 2D5NA 1NJBA 5HUIA 3JWCA 3BGXA 1DLRA 1DR4A 1RX5A 3D84X 1BSPA 1PD8A 4KYAA 3GH0A 4PSGA 4PTHA 4XSCA 1PDBA 5FDAA 3RG9A 3JSUA 4X5GA 3IRMA 1BP6A 4TU5X 1JMIA 4NX6A 2FTNA 3B5BA 1FWMA 2G86A 3FYWX 1DG8A 1ZPRA 5HPBA 4EIGA 3KFYA 3IHIA 2HXVA 4X5FA 3QJ7A 3R33A 1M78A 1RX2A 3QL3A 4PDJA 3FRBX 4XRBA 3SQYX 3TQ8A 8DFRA 4DPHA 4O1XD 5CC9A 1NJEA 3NXVA 4LAHX 4EINA 2CD2A 3K47A 1DISA 3QL0A 3BNZA 3INVA 1BKPA 2FTOX 3TMSA 2FTQA 1AJMA 4FOGA 1RX6A 1TSVA 3V8HA 4PSTA 3QYOA 4KY8A 1DRBA 4PSYA 1YPVA 4GYHA 3FY8X 3NU0A 2O7PA 3QLXA 2TSRA 5HQYA 1DR6A 1EVFA 1AI9A 1TISA 1I00A 2W9SA 4GH8A 2JYBA 4FHBA 4ELBA 3FQZA 1DR5A 3FQVA 3UWLA 1RH3A 3JW3A 1TJSA 3Q1HA 1TVUA 4CD2A 1DAJA 1DR7A 3I8AX 5HSRA 2QK8A 3EAWX 1HVYA 4ISKA 1RA9A 4H0RA 3SRQX 3F0BX 1CZ3A 1BZFA 3FQFA 4RGCA 1DDRA 3NXOA 3ZPGA 4LAEX 4XSDA 5H3AA 1LCAA 3NZ9X 1TSLA 1VZEA 3N5EB 1HFRA 4P3QA 3EF9A 4IRRA 1DHIA 4QLFA 4OSGA 3I3RA 1RX8A 1E26A 1S3VA 4G8ZX 2A9WA 1TSXA 3JVXA 5J7WA 3SA2A 3SRRX 1THYA 4M6JA 1BPJA 4HOFA 3EIGA 2D0KA 1EVGA 3IK0A 4E28A 2ANQA 1TDUA 1BOZA 1S3UA 3NXXA 1RG7A 4H95A 4H0UA 5JG0X 3IK1A 3GHCA 1AOEA 4XT7A 1JTQA 3JTWA 1RX4A 1MVSA 2BLCA 4KLXA 4KY4A 2INQA 3KJSA 3KY8A 1TYSA 4IXFX 2L28A 3CLBA 3HB8A 3DGAC 3K2HA 2BL9A 1DIUA 1U72A 1HW3A 3F0QX 3F0VX 4H97A 4EIZA 1AIQA 4M2XA 3SRUX 3DL5A 1TSWA 3UM6A 5HS3A 3S9UA 4EZ8A 2W9GA 3EDWX 1HFPA 3F0XX 1MVTA 1RB3A 1RD7A 4Q0EA 2XW7A 2HM9A 1EV8A 3FQCA 3QFXA 3GI2A 1TSYA 1B02A 4XECX 4XE6X 3QLSA 1TDBA 3BYXA 3UWLB 4KPWA 1B5DA 1RTSA 1RC4A 3EJLA 1IA2A 3F91A 1BQ2A 1DYRA 3GG5A 5HVBA 3OCHA 2W3AA 4QLGA 1DYHA 2AZNA 2KCEA 2AAZA 3FY9X 4O7UA 1KZJA 4KAKA 5EAJA 5HT4A 4LRRA 2G8AA 1U70A 1IA4A 4O1UA 4Q67A 4XT4A 2DHFA 3GYFA 7DFRA 5HQZA 1RE7A 1CI7A 5ECXA 5DFRA 1TDAA 1F4DA 4OR7A 3QLYA 4ELEA 1M7AA 3F0UX 4H1IA 4X5IA 2RD8A 6DFRA 3NXRA 1DLSA 4DP3A 1RA8A 3BHLA 1JG0A 1D1GA 2ONBA 5HF0X 1BQ1A 1F4EA 2P4GA 2BLBA 4KBNA 3TD8A 4KJKA 1NJAA 2OBCA 3QYLA 4M6LA 1LY3A 3IX9A 4X5HA 5HVEA 2B3ZA 2ITHA 1J3JC 1DREA 3QG2A 1DYIA 1S3WA 1AN5A 3KGYA 3NXTA 4JEFA 1DR3A 4KD7A 3UM5A 1LCBA 3S3VA 1SEJA 5HSUA 3S7AA 4PSSA 3F8ZA 1JUVA 1J3IA 4ECKA 1TDRA 1JTUA 4E5OA 3DG8C 3F0SX 1RX1A 4G3MA 3SA1A 3LG4A 1B49A 1JOLA 1DDUA 1NCEA 3K45A 4GD7A 4KNZA 1RX3A 3N0HA 1F4CA 3RO9A 3OB7A 3DATA 4HOGA 3TQBA 1VZDA 1LY4A 3EELA 2FZIA 3FQOA 4FGHA 2ZZAA 1YHOA 4PTJA 4DDRA 3TQAA 1DRAA 3JWMA 3HJ3A 1PD9A 2W3MA 3F8YA 3NZCX 2GD9A 4FQSA 1BP0A 1DR1A 3CSEA 1DF7A 1BDUA 2TDMA 5H39A 1NJCA 4XT8A 3IX6A 1J3KC 3IRNA 4NX7A 1JU6A 3QLWA 2W9TA 1JUTA 3K74A 4H96A 1F28A 1DRFA 4DPDA 1DDSA 4M7UA 4XT5A 1TSZA 4ISWA 3EGYX 3QLZA 3DGAA 1KMSA 1JMFA 1HFQA 3EBUA 1DG7A 3SRSX 1S3YA 4IXED 3C0AA 4XSEA 4G2OX 4Q6AA 2W3BA 2KGKA 3M09A 4UP1A 2RD8B 1IA3A 2W9HA 1NJDA 3SRWX 3CD2A 5HT5A 3BZ0A 1F4GA 3DL6A 1KZIA 1LCEA 1KCEA 1BSFA 1ZDRA 2W3WA 4ELGA 3FQ0A 3EX8A 1TSNA 4HA7A 3NZBX 1BIDA 4GEVA 2RDAA 3JWKA 3GH2X 3DFRA 1KLKA 2FZJA 4XT6A 4ELFA 2TDDA 1DRHA 3E0BA 4G6WX 4QJZD 4QI9A 2VF0A 4F2VA 2G6VA 3OAFA 2VETA 1RF7A 3H9KA 4KEBA 3NTZA 5ECCA 1VDRA 4P3RA 2G8XA 3DRCA 4ELHA 3NRRA 3TQ9A 3IA5A 5CCCA 3EHIX 2LF1A 5WRNA 1HZWA 1DR2A 1JMGA 4HA9A 3QLRA 3FL9A 3GHVA 2H2QA 1QZFA 3HBBA 4O1XA 5BY6A 5JA3A 1VZBA 3CL9A 4FGTA 1IA1A 2HQPA 4IQQA 4DQ1A
chains in the Genus database with same CATH topology
1BJGA 4X5JA 3FREX 4I1NA 3FYVX 4KNEA 1JMHA 2BBQA 3KJRA 3D80A 3M08A 3NZAX 1DHFA 3SAIA 5DXVA 1AO8A 3IA4A 3EEMA 3NZDA 1QQQA 2OIPA 3IROA 1LUDA 4LEKX 1BO7A 2FZHA 1TLCA 1VJ3A 3ZPCA 1FFLA 1RB2A 4KJJA 1TVVA 4EILA 1JUJA 3SH2A 3QGTA 1DHJA 1JOMA 4FOAA 3FRFX 1J3JA 1J3IC 2BLAA 1BO8A 1B5EA 1HW4A 1TLSA 5E8QA 1F4BA 5FCTA 3ED7A 1F4FA 2C2TA 3ROAA 4QJCA 4KM0A 3EEJA 1DNAA 4TMSA 2C2SA 2CIGA 2ANOA 3IJZA 4IQBA 1RA1A 4FGGA 1M79A 3VCOA 3N5GA 1VZCA 3JW5A 1TSDA 3FS6A 1AOBA 3DG8A 1AXWA 2G8DA 3FL8A 4H98A 1VZAA 3FRAX 1TVWA 4FOXA 1RA2A 4QHVA 1OHJA 4P66A 1KMVA 3NXYA 3GHWA 1U71A 1RA3A 3BFIA 4HOEA 1EV5A 4DFRA 4KL9A 4KM2A 3BHRA 4EB4A 4KJLA 4EJ1A 3C06A 4Q0DA 2G89A 4P68A 1DYJA 3FRDX 4IXGX 1TSMA 3KGBA 2W3VA 2DRCA 4M7VA 1TRGA 5H38A 4LAGX 3JWFA 1J3KA 4QLEA 3UM8A 1BKOA 3DAUA 3SGYA 3SR5X 1RX9A 1RX7A 2TSCA 4G95A 3B9HA 1DG5A 1TDCA 4I13A 1CD2A 5U27A 5U26A 3NZ6X 3N5EA 1SYNA 3EEKA 4M6KA 5HI6A 4KFJA 3L3RA 5HF2X 1OHKA 2D5NA 1NJBA 5HUIA 3JWCA 3BGXA 1DLRA 1DR4A 1RX5A 3D84X 1BSPA 1PD8A 4KYAA 3GH0A 4PSGA 4PTHA 4XSCA 1PDBA 5FDAA 3RG9A 3JSUA 4X5GA 3IRMA 1BP6A 4TU5X 1JMIA 4NX6A 2FTNA 3B5BA 1FWMA 2G86A 3FYWX 1DG8A 1ZPRA 5HPBA 4EIGA 3KFYA 3IHIA 2HXVA 4X5FA 3QJ7A 3R33A 1M78A 1RX2A 3QL3A 4PDJA 3FRBX 4XRBA 3SQYX 3TQ8A 8DFRA 4DPHA 4O1XD 5CC9A 1NJEA 3NXVA 4LAHX 4EINA 2CD2A 3K47A 1DISA 3QL0A 3BNZA 3INVA 1BKPA 2FTOX 3TMSA 2FTQA 1AJMA 4FOGA 1RX6A 1TSVA 3V8HA 4PSTA 3QYOA 4KY8A 1DRBA 4PSYA 1YPVA 4GYHA 3FY8X 3NU0A 2O7PA 3QLXA 2TSRA 5HQYA 1DR6A 1EVFA 1AI9A 1TISA 1I00A 2W9SA 4GH8A 2JYBA 4FHBA 4ELBA 3FQZA 1DR5A 3FQVA 3UWLA 1RH3A 3JW3A 1TJSA 3Q1HA 1TVUA 4CD2A 1DAJA 1DR7A 3I8AX 5HSRA 2QK8A 3EAWX 1HVYA 4ISKA 1RA9A 4H0RA 3SRQX 3F0BX 1CZ3A 1BZFA 3FQFA 4RGCA 1DDRA 3NXOA 3ZPGA 4LAEX 4XSDA 5H3AA 1LCAA 3NZ9X 1TSLA 1VZEA 3N5EB 1HFRA 4P3QA 3EF9A 4IRRA 1DHIA 4QLFA 4OSGA 3I3RA 1RX8A 1E26A 1S3VA 4G8ZX 2A9WA 1TSXA 3JVXA 5J7WA 3SA2A 3SRRX 1THYA 4M6JA 1BPJA 4HOFA 3EIGA 2D0KA 1EVGA 3IK0A 4E28A 2ANQA 1TDUA 1BOZA 1S3UA 3NXXA 1RG7A 4H95A 4H0UA 5JG0X 3IK1A 3GHCA 1AOEA 4XT7A 1JTQA 3JTWA 1RX4A 1MVSA 2BLCA 4KLXA 4KY4A 2INQA 3KJSA 3KY8A 1TYSA 4IXFX 2L28A 3CLBA 3HB8A 3DGAC 3K2HA 2BL9A 1DIUA 1U72A 1HW3A 3F0QX 3F0VX 4H97A 4EIZA 1AIQA 4M2XA 3SRUX 3DL5A 1TSWA 3UM6A 5HS3A 3S9UA 4EZ8A 2W9GA 3EDWX 1HFPA 3F0XX 1MVTA 1RB3A 1RD7A 4Q0EA 2XW7A 2HM9A 1EV8A 3FQCA 3QFXA 3GI2A 1TSYA 1B02A 4XECX 4XE6X 3QLSA 1TDBA 3BYXA 3UWLB 4KPWA 1B5DA 1RTSA 1RC4A 3EJLA 1IA2A 3F91A 1BQ2A 1DYRA 3GG5A 5HVBA 3OCHA 2W3AA 4QLGA 1DYHA 2AZNA 2KCEA 2AAZA 3FY9X 4O7UA 1KZJA 4KAKA 5EAJA 5HT4A 4LRRA 2G8AA 1U70A 1IA4A 4O1UA 4Q67A 4XT4A 2DHFA 3GYFA 7DFRA 5HQZA 1RE7A 1CI7A 5ECXA 5DFRA 1TDAA 1F4DA 4OR7A 3QLYA 4ELEA 1M7AA 3F0UX 4H1IA 4X5IA 2RD8A 6DFRA 3NXRA 1DLSA 4DP3A 1RA8A 3BHLA 1JG0A 1D1GA 2ONBA 5HF0X 1BQ1A 1F4EA 2P4GA 2BLBA 4KBNA 3TD8A 4KJKA 1NJAA 2OBCA 3QYLA 4M6LA 1LY3A 3IX9A 4X5HA 5HVEA 2B3ZA 2ITHA 1J3JC 1DREA 3QG2A 1DYIA 1S3WA 1AN5A 3KGYA 3NXTA 4JEFA 1DR3A 4KD7A 3UM5A 1LCBA 3S3VA 1SEJA 5HSUA 3S7AA 4PSSA 3F8ZA 1JUVA 1J3IA 4ECKA 1TDRA 1JTUA 4E5OA 3DG8C 3F0SX 1RX1A 4G3MA 3SA1A 3LG4A 1B49A 1JOLA 1DDUA 1NCEA 3K45A 4GD7A 4KNZA 1RX3A 3N0HA 1F4CA 3RO9A 3OB7A 3DATA 4HOGA 3TQBA 1VZDA 1LY4A 3EELA 2FZIA 3FQOA 4FGHA 2ZZAA 1YHOA 4PTJA 4DDRA 3TQAA 1DRAA 3JWMA 3HJ3A 1PD9A 2W3MA 3F8YA 3NZCX 2GD9A 4FQSA 1BP0A 1DR1A 3CSEA 1DF7A 1BDUA 2TDMA 5H39A 1NJCA 4XT8A 3IX6A 1J3KC 3IRNA 4NX7A 1JU6A 3QLWA 2W9TA 1JUTA 3K74A 4H96A 1F28A 1DRFA 4DPDA 1DDSA 4M7UA 4XT5A 1TSZA 4ISWA 3EGYX 3QLZA 3DGAA 1KMSA 1JMFA 1HFQA 3EBUA 1DG7A 3SRSX 1S3YA 4IXED 3C0AA 4XSEA 4G2OX 4Q6AA 2W3BA 2KGKA 3M09A 4UP1A 2RD8B 1IA3A 2W9HA 1NJDA 3SRWX 3CD2A 5HT5A 3BZ0A 1F4GA 3DL6A 1KZIA 1LCEA 1KCEA 1BSFA 1ZDRA 2W3WA 4ELGA 3FQ0A 3EX8A 1TSNA 4HA7A 3NZBX 1BIDA 4GEVA 2RDAA 3JWKA 3GH2X 3DFRA 1KLKA 2FZJA 4XT6A 4ELFA 2TDDA 1DRHA 3E0BA 4G6WX 4QJZD 4QI9A 2VF0A 4F2VA 2G6VA 3OAFA 2VETA 1RF7A 3H9KA 4KEBA 3NTZA 5ECCA 1VDRA 4P3RA 2G8XA 3DRCA 4ELHA 3NRRA 3TQ9A 3IA5A 5CCCA 3EHIX 2LF1A 5WRNA 1HZWA 1DR2A 1JMGA 4HA9A 3QLRA 3FL9A 3GHVA 2H2QA 1QZFA 3HBBA 4O1XA 5BY6A 5JA3A 1VZBA 3CL9A 4FGTA 1IA1A 2HQPA 4IQQA 4DQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJG A;  4X5J A;  3FRE X;  4I1N A;  3FYV X;  4KNE A;  1JMH A;  2BBQ A;  3KJR A;  3D80 A;  3M08 A;  3NZA X;  1DHF A;  3SAI A;  5DXV A;  1AO8 A;  3IA4 A;  3EEM A;  3NZD A;  1QQQ A;  2OIP A;  3IRO A;  1LUD A;  4LEK X;  1BO7 A;  2FZH A;  1TLC A;  1VJ3 A;  3ZPC A;  1FFL A;  1RB2 A;  4KJJ A;  1TVV A;  4EIL A;  1JUJ A;  3SH2 A;  3QGT A;  1DHJ A;  1JOM A;  4FOA A;  3FRF X;  1J3J A;  1J3I C;  2BLA A;  1BO8 A;  1B5E A;  1HW4 A;  1TLS A;  5E8Q A;  1F4B A;  5FCT A;  3ED7 A;  1F4F A;  2C2T A;  3ROA A;  4QJC A;  4KM0 A;  3EEJ A;  1DNA A;  4TMS A;  2C2S A;  2CIG A;  2ANO A;  3IJZ A;  4IQB A;  1RA1 A;  4FGG A;  1M79 A;  3VCO A;  3N5G A;  1VZC A;  3JW5 A;  1TSD A;  3FS6 A;  1AOB A;  3DG8 A;  1AXW A;  2G8D A;  3FL8 A;  4H98 A;  1VZA A;  3FRA X;  1TVW A;  4FOX A;  1RA2 A;  4QHV A;  1OHJ A;  4P66 A;  1KMV A;  3NXY A;  3GHW A;  1U71 A;  1RA3 A;  3BFI A;  4HOE A;  1EV5 A;  4DFR A;  4KL9 A;  4KM2 A;  3BHR A;  4EB4 A;  4KJL A;  4EJ1 A;  3C06 A;  4Q0D A;  2G89 A;  4P68 A;  1DYJ A;  3FRD X;  4IXG X;  1TSM A;  3KGB A;  2W3V A;  2DRC A;  4M7V A;  1TRG A;  5H38 A;  4LAG X;  3JWF A;  1J3K A;  4QLE A;  3UM8 A;  1BKO A;  3DAU A;  3SGY A;  3SR5 X;  1RX9 A;  1RX7 A;  2TSC A;  4G95 A;  3B9H A;  1DG5 A;  1TDC A;  4I13 A;  1CD2 A;  5U27 A;  5U26 A;  3NZ6 X;  3N5E A;  1SYN A;  3EEK A;  4M6K A;  5HI6 A;  4KFJ A;  3L3R A;  5HF2 X;  1OHK A;  2D5N A;  1NJB A;  5HUI A;  3JWC A;  3BGX A;  1DLR A;  1DR4 A;  1RX5 A;  3D84 X;  1BSP A;  1PD8 A;  4KYA A;  3GH0 A;  4PSG A;  4PTH A;  4XSC A;  1PDB A;  5FDA A;  3RG9 A;  3JSU A;  4X5G A;  3IRM A;  1BP6 A;  4TU5 X;  1JMI A;  4NX6 A;  2FTN A;  3B5B A;  1FWM A;  2G86 A;  3FYW X;  1DG8 A;  1ZPR A;  5HPB A;  4EIG A;  3KFY A;  3IHI A;  2HXV A;  4X5F A;  3QJ7 A;  3R33 A;  1M78 A;  1RX2 A;  3QL3 A;  4PDJ A;  3FRB X;  4XRB A;  3SQY X;  3TQ8 A;  8DFR A;  4DPH A;  4O1X D;  5CC9 A;  1NJE A;  3NXV A;  4LAH X;  4EIN A;  2CD2 A;  3K47 A;  1DIS A;  3QL0 A;  3BNZ A;  3INV A;  1BKP A;  2FTO X;  3TMS A;  2FTQ A;  1AJM A;  4FOG A;  1RX6 A;  1TSV A;  3V8H A;  4PST A;  3QYO A;  4KY8 A;  1DRB A;  4PSY A;  1YPV A;  4GYH A;  3FY8 X;  3NU0 A;  2O7P A;  3QLX A;  2TSR A;  5HQY A;  1DR6 A;  1EVF A;  1AI9 A;  1TIS A;  1I00 A;  2W9S A;  4GH8 A;  2JYB A;  4FHB A;  4ELB A;  3FQZ A;  1DR5 A;  3FQV A;  3UWL A;  1RH3 A;  3JW3 A;  1TJS A;  3Q1H A;  1TVU A;  4CD2 A;  1DAJ A;  1DR7 A;  3I8A X;  5HSR A;  2QK8 A;  3EAW X;  1HVY A;  4ISK A;  1RA9 A;  4H0R A;  3SRQ X;  3F0B X;  1CZ3 A;  1BZF A;  3FQF A;  4RGC A;  1DDR A;  3NXO A;  3ZPG A;  4LAE X;  4XSD A;  5H3A A;  1LCA A;  3NZ9 X;  1TSL A;  1VZE A;  3N5E B;  1HFR A;  4P3Q A;  3EF9 A;  4IRR A;  1DHI A;  4QLF A;  4OSG A;  3I3R A;  1RX8 A;  1E26 A;  1S3V A;  4G8Z X;  2A9W A;  1TSX A;  3JVX A;  5J7W A;  3SA2 A;  3SRR X;  1THY A;  4M6J A;  1BPJ A;  4HOF A;  3EIG A;  2D0K A;  1EVG A;  3IK0 A;  4E28 A;  2ANQ A;  1TDU A;  1BOZ A;  1S3U A;  3NXX A;  1RG7 A;  4H95 A;  4H0U A;  5JG0 X;  3IK1 A;  3GHC A;  1AOE A;  4XT7 A;  1JTQ A;  3JTW A;  1RX4 A;  1MVS A;  2BLC A;  4KLX A;  4KY4 A;  2INQ A;  3KJS A;  3KY8 A;  1TYS A;  4IXF X;  2L28 A;  3CLB A;  3HB8 A;  3DGA C;  3K2H A;  2BL9 A;  1DIU A;  1U72 A;  1HW3 A;  3F0Q X;  3F0V X;  4H97 A;  4EIZ A;  1AIQ A;  4M2X A;  3SRU X;  3DL5 A;  1TSW A;  3UM6 A;  5HS3 A;  3S9U A;  4EZ8 A;  2W9G A;  3EDW X;  1HFP A;  3F0X X;  1MVT A;  1RB3 A;  1RD7 A;  4Q0E A;  2XW7 A;  2HM9 A;  1EV8 A;  3FQC A;  3QFX A;  3GI2 A;  1TSY A;  1B02 A;  4XEC X;  4XE6 X;  3QLS A;  1TDB A;  3BYX A;  3UWL B;  4KPW A;  1B5D A;  1RTS A;  1RC4 A;  3EJL A;  1IA2 A;  3F91 A;  1BQ2 A;  1DYR A;  3GG5 A;  5HVB A;  3OCH A;  2W3A A;  4QLG A;  1DYH A;  2AZN A;  2KCE A;  2AAZ A;  3FY9 X;  4O7U A;  1KZJ A;  4KAK A;  5EAJ A;  5HT4 A;  4LRR A;  2G8A A;  1U70 A;  1IA4 A;  4O1U A;  4Q67 A;  4XT4 A;  2DHF A;  3GYF A;  7DFR A;  5HQZ A;  1RE7 A;  1CI7 A;  5ECX A;  5DFR A;  1TDA A;  1F4D A;  4OR7 A;  3QLY A;  4ELE A;  1M7A A;  3F0U X;  4H1I A;  4X5I A;  2RD8 A;  6DFR A;  3NXR A;  1DLS A;  4DP3 A;  1RA8 A;  3BHL A;  1JG0 A;  1D1G A;  2ONB A;  5HF0 X;  1BQ1 A;  1F4E A;  2P4G A;  2BLB A;  4KBN A;  3TD8 A;  4KJK A;  1NJA A;  2OBC A;  3QYL A;  4M6L A;  1LY3 A;  3IX9 A;  4X5H A;  5HVE A;  2B3Z A;  2ITH A;  1J3J C;  1DRE A;  3QG2 A;  1DYI A;  1S3W A;  1AN5 A;  3KGY A;  3NXT A;  4JEF A;  1DR3 A;  4KD7 A;  3UM5 A;  1LCB A;  3S3V A;  1SEJ A;  5HSU A;  3S7A A;  4PSS A;  3F8Z A;  1JUV A;  1J3I A;  4ECK A;  1TDR A;  1JTU A;  4E5O A;  3DG8 C;  3F0S X;  1RX1 A;  4G3M A;  3SA1 A;  3LG4 A;  1B49 A;  1JOL A;  1DDU A;  1NCE A;  3K45 A;  4GD7 A;  4KNZ A;  1RX3 A;  3N0H A;  1F4C A;  3RO9 A;  3OB7 A;  3DAT A;  4HOG A;  3TQB A;  1VZD A;  1LY4 A;  3EEL A;  2FZI A;  3FQO A;  4FGH A;  2ZZA A;  1YHO A;  4PTJ A;  4DDR A;  3TQA A;  1DRA A;  3JWM A;  3HJ3 A;  1PD9 A;  2W3M A;  3F8Y A;  3NZC X;  2GD9 A;  4FQS A;  1BP0 A;  1DR1 A;  3CSE A;  1DF7 A;  1BDU A;  2TDM A;  5H39 A;  1NJC A;  4XT8 A;  3IX6 A;  1J3K C;  3IRN A;  4NX7 A;  1JU6 A;  3QLW A;  2W9T A;  1JUT A;  3K74 A;  4H96 A;  1F28 A;  1DRF A;  4DPD A;  1DDS A;  4M7U A;  4XT5 A;  1TSZ A;  4ISW A;  3EGY X;  3QLZ A;  3DGA A;  1KMS A;  1JMF A;  1HFQ A;  3EBU A;  1DG7 A;  3SRS X;  1S3Y A;  4IXE D;  3C0A A;  4XSE A;  4G2O X;  4Q6A A;  2W3B A;  2KGK A;  3M09 A;  4UP1 A;  2RD8 B;  1IA3 A;  2W9H A;  1NJD A;  3SRW X;  3CD2 A;  5HT5 A;  3BZ0 A;  1F4G A;  3DL6 A;  1KZI A;  1LCE A;  1KCE A;  1BSF A;  1ZDR A;  2W3W A;  4ELG A;  3FQ0 A;  3EX8 A;  1TSN A;  4HA7 A;  3NZB X;  1BID A;  4GEV A;  2RDA A;  3JWK A;  3GH2 X;  3DFR A;  1KLK A;  2FZJ A;  4XT6 A;  4ELF A;  2TDD A;  1DRH A;  3E0B A;  4G6W X;  4QJZ D;  4QI9 A;  2VF0 A;  4F2V A;  2G6V A;  3OAF A;  2VET A;  1RF7 A;  3H9K A;  4KEB A;  3NTZ A;  5ECC A;  1VDR A;  4P3R A;  2G8X A;  3DRC A;  4ELH A;  3NRR A;  3TQ9 A;  3IA5 A;  5CCC A;  3EHI X;  2LF1 A;  5WRN A;  1HZW A;  1DR2 A;  1JMG A;  4HA9 A;  3QLR A;  3FL9 A;  3GHV A;  2H2Q A;  1QZF A;  3HBB A;  4O1X A;  5BY6 A;  5JA3 A;  1VZB A;  3CL9 A;  4FGT A;  1IA1 A;  2HQP A;  4IQQ A;  4DQ1 A; 
#chains in the Genus database with same CATH topology
 1BJG A;  4X5J A;  3FRE X;  4I1N A;  3FYV X;  4KNE A;  1JMH A;  2BBQ A;  3KJR A;  3D80 A;  3M08 A;  3NZA X;  1DHF A;  3SAI A;  5DXV A;  1AO8 A;  3IA4 A;  3EEM A;  3NZD A;  1QQQ A;  2OIP A;  3IRO A;  1LUD A;  4LEK X;  1BO7 A;  2FZH A;  1TLC A;  1VJ3 A;  3ZPC A;  1FFL A;  1RB2 A;  4KJJ A;  1TVV A;  4EIL A;  1JUJ A;  3SH2 A;  3QGT A;  1DHJ A;  1JOM A;  4FOA A;  3FRF X;  1J3J A;  1J3I C;  2BLA A;  1BO8 A;  1B5E A;  1HW4 A;  1TLS A;  5E8Q A;  1F4B A;  5FCT A;  3ED7 A;  1F4F A;  2C2T A;  3ROA A;  4QJC A;  4KM0 A;  3EEJ A;  1DNA A;  4TMS A;  2C2S A;  2CIG A;  2ANO A;  3IJZ A;  4IQB A;  1RA1 A;  4FGG A;  1M79 A;  3VCO A;  3N5G A;  1VZC A;  3JW5 A;  1TSD A;  3FS6 A;  1AOB A;  3DG8 A;  1AXW A;  2G8D A;  3FL8 A;  4H98 A;  1VZA A;  3FRA X;  1TVW A;  4FOX A;  1RA2 A;  4QHV A;  1OHJ A;  4P66 A;  1KMV A;  3NXY A;  3GHW A;  1U71 A;  1RA3 A;  3BFI A;  4HOE A;  1EV5 A;  4DFR A;  4KL9 A;  4KM2 A;  3BHR A;  4EB4 A;  4KJL A;  4EJ1 A;  3C06 A;  4Q0D A;  2G89 A;  4P68 A;  1DYJ A;  3FRD X;  4IXG X;  1TSM A;  3KGB A;  2W3V A;  2DRC A;  4M7V A;  1TRG A;  5H38 A;  4LAG X;  3JWF A;  1J3K A;  4QLE A;  3UM8 A;  1BKO A;  3DAU A;  3SGY A;  3SR5 X;  1RX9 A;  1RX7 A;  2TSC A;  4G95 A;  3B9H A;  1DG5 A;  1TDC A;  4I13 A;  1CD2 A;  5U27 A;  5U26 A;  3NZ6 X;  3N5E A;  1SYN A;  3EEK A;  4M6K A;  5HI6 A;  4KFJ A;  3L3R A;  5HF2 X;  1OHK A;  2D5N A;  1NJB A;  5HUI A;  3JWC A;  3BGX A;  1DLR A;  1DR4 A;  1RX5 A;  3D84 X;  1BSP A;  1PD8 A;  4KYA A;  3GH0 A;  4PSG A;  4PTH A;  4XSC A;  1PDB A;  5FDA A;  3RG9 A;  3JSU A;  4X5G A;  3IRM A;  1BP6 A;  4TU5 X;  1JMI A;  4NX6 A;  2FTN A;  3B5B A;  1FWM A;  2G86 A;  3FYW X;  1DG8 A;  1ZPR A;  5HPB A;  4EIG A;  3KFY A;  3IHI A;  2HXV A;  4X5F A;  3QJ7 A;  3R33 A;  1M78 A;  1RX2 A;  3QL3 A;  4PDJ A;  3FRB X;  4XRB A;  3SQY X;  3TQ8 A;  8DFR A;  4DPH A;  4O1X D;  5CC9 A;  1NJE A;  3NXV A;  4LAH X;  4EIN A;  2CD2 A;  3K47 A;  1DIS A;  3QL0 A;  3BNZ A;  3INV A;  1BKP A;  2FTO X;  3TMS A;  2FTQ A;  1AJM A;  4FOG A;  1RX6 A;  1TSV A;  3V8H A;  4PST A;  3QYO A;  4KY8 A;  1DRB A;  4PSY A;  1YPV A;  4GYH A;  3FY8 X;  3NU0 A;  2O7P A;  3QLX A;  2TSR A;  5HQY A;  1DR6 A;  1EVF A;  1AI9 A;  1TIS A;  1I00 A;  2W9S A;  4GH8 A;  2JYB A;  4FHB A;  4ELB A;  3FQZ A;  1DR5 A;  3FQV A;  3UWL A;  1RH3 A;  3JW3 A;  1TJS A;  3Q1H A;  1TVU A;  4CD2 A;  1DAJ A;  1DR7 A;  3I8A X;  5HSR A;  2QK8 A;  3EAW X;  1HVY A;  4ISK A;  1RA9 A;  4H0R A;  3SRQ X;  3F0B X;  1CZ3 A;  1BZF A;  3FQF A;  4RGC A;  1DDR A;  3NXO A;  3ZPG A;  4LAE X;  4XSD A;  5H3A A;  1LCA A;  3NZ9 X;  1TSL A;  1VZE A;  3N5E B;  1HFR A;  4P3Q A;  3EF9 A;  4IRR A;  1DHI A;  4QLF A;  4OSG A;  3I3R A;  1RX8 A;  1E26 A;  1S3V A;  4G8Z X;  2A9W A;  1TSX A;  3JVX A;  5J7W A;  3SA2 A;  3SRR X;  1THY A;  4M6J A;  1BPJ A;  4HOF A;  3EIG A;  2D0K A;  1EVG A;  3IK0 A;  4E28 A;  2ANQ A;  1TDU A;  1BOZ A;  1S3U A;  3NXX A;  1RG7 A;  4H95 A;  4H0U A;  5JG0 X;  3IK1 A;  3GHC A;  1AOE A;  4XT7 A;  1JTQ A;  3JTW A;  1RX4 A;  1MVS A;  2BLC A;  4KLX A;  4KY4 A;  2INQ A;  3KJS A;  3KY8 A;  1TYS A;  4IXF X;  2L28 A;  3CLB A;  3HB8 A;  3DGA C;  3K2H A;  2BL9 A;  1DIU A;  1U72 A;  1HW3 A;  3F0Q X;  3F0V X;  4H97 A;  4EIZ A;  1AIQ A;  4M2X A;  3SRU X;  3DL5 A;  1TSW A;  3UM6 A;  5HS3 A;  3S9U A;  4EZ8 A;  2W9G A;  3EDW X;  1HFP A;  3F0X X;  1MVT A;  1RB3 A;  1RD7 A;  4Q0E A;  2XW7 A;  2HM9 A;  1EV8 A;  3FQC A;  3QFX A;  3GI2 A;  1TSY A;  1B02 A;  4XEC X;  4XE6 X;  3QLS A;  1TDB A;  3BYX A;  3UWL B;  4KPW A;  1B5D A;  1RTS A;  1RC4 A;  3EJL A;  1IA2 A;  3F91 A;  1BQ2 A;  1DYR A;  3GG5 A;  5HVB A;  3OCH A;  2W3A A;  4QLG A;  1DYH A;  2AZN A;  2KCE A;  2AAZ A;  3FY9 X;  4O7U A;  1KZJ A;  4KAK A;  5EAJ A;  5HT4 A;  4LRR A;  2G8A A;  1U70 A;  1IA4 A;  4O1U A;  4Q67 A;  4XT4 A;  2DHF A;  3GYF A;  7DFR A;  5HQZ A;  1RE7 A;  1CI7 A;  5ECX A;  5DFR A;  1TDA A;  1F4D A;  4OR7 A;  3QLY A;  4ELE A;  1M7A A;  3F0U X;  4H1I A;  4X5I A;  2RD8 A;  6DFR A;  3NXR A;  1DLS A;  4DP3 A;  1RA8 A;  3BHL A;  1JG0 A;  1D1G A;  2ONB A;  5HF0 X;  1BQ1 A;  1F4E A;  2P4G A;  2BLB A;  4KBN A;  3TD8 A;  4KJK A;  1NJA A;  2OBC A;  3QYL A;  4M6L A;  1LY3 A;  3IX9 A;  4X5H A;  5HVE A;  2B3Z A;  2ITH A;  1J3J C;  1DRE A;  3QG2 A;  1DYI A;  1S3W A;  1AN5 A;  3KGY A;  3NXT A;  4JEF A;  1DR3 A;  4KD7 A;  3UM5 A;  1LCB A;  3S3V A;  1SEJ A;  5HSU A;  3S7A A;  4PSS A;  3F8Z A;  1JUV A;  1J3I A;  4ECK A;  1TDR A;  1JTU A;  4E5O A;  3DG8 C;  3F0S X;  1RX1 A;  4G3M A;  3SA1 A;  3LG4 A;  1B49 A;  1JOL A;  1DDU A;  1NCE A;  3K45 A;  4GD7 A;  4KNZ A;  1RX3 A;  3N0H A;  1F4C A;  3RO9 A;  3OB7 A;  3DAT A;  4HOG A;  3TQB A;  1VZD A;  1LY4 A;  3EEL A;  2FZI A;  3FQO A;  4FGH A;  2ZZA A;  1YHO A;  4PTJ A;  4DDR A;  3TQA A;  1DRA A;  3JWM A;  3HJ3 A;  1PD9 A;  2W3M A;  3F8Y A;  3NZC X;  2GD9 A;  4FQS A;  1BP0 A;  1DR1 A;  3CSE A;  1DF7 A;  1BDU A;  2TDM A;  5H39 A;  1NJC A;  4XT8 A;  3IX6 A;  1J3K C;  3IRN A;  4NX7 A;  1JU6 A;  3QLW A;  2W9T A;  1JUT A;  3K74 A;  4H96 A;  1F28 A;  1DRF A;  4DPD A;  1DDS A;  4M7U A;  4XT5 A;  1TSZ A;  4ISW A;  3EGY X;  3QLZ A;  3DGA A;  1KMS A;  1JMF A;  1HFQ A;  3EBU A;  1DG7 A;  3SRS X;  1S3Y A;  4IXE D;  3C0A A;  4XSE A;  4G2O X;  4Q6A A;  2W3B A;  2KGK A;  3M09 A;  4UP1 A;  2RD8 B;  1IA3 A;  2W9H A;  1NJD A;  3SRW X;  3CD2 A;  5HT5 A;  3BZ0 A;  1F4G A;  3DL6 A;  1KZI A;  1LCE A;  1KCE A;  1BSF A;  1ZDR A;  2W3W A;  4ELG A;  3FQ0 A;  3EX8 A;  1TSN A;  4HA7 A;  3NZB X;  1BID A;  4GEV A;  2RDA A;  3JWK A;  3GH2 X;  3DFR A;  1KLK A;  2FZJ A;  4XT6 A;  4ELF A;  2TDD A;  1DRH A;  3E0B A;  4G6W X;  4QJZ D;  4QI9 A;  2VF0 A;  4F2V A;  2G6V A;  3OAF A;  2VET A;  1RF7 A;  3H9K A;  4KEB A;  3NTZ A;  5ECC A;  1VDR A;  4P3R A;  2G8X A;  3DRC A;  4ELH A;  3NRR A;  3TQ9 A;  3IA5 A;  5CCC A;  3EHI X;  2LF1 A;  5WRN A;  1HZW A;  1DR2 A;  1JMG A;  4HA9 A;  3QLR A;  3FL9 A;  3GHV A;  2H2Q A;  1QZF A;  3HBB A;  4O1X A;  5BY6 A;  5JA3 A;  1VZB A;  3CL9 A;  4FGT A;  1IA1 A;  2HQP A;  4IQQ A;  4DQ1 A; 
#chains in the Genus database with same CATH homology
 1BJG A;  4X5J A;  3FRE X;  4I1N A;  3FYV X;  4KNE A;  1JMH A;  2BBQ A;  3KJR A;  3D80 A;  3M08 A;  3NZA X;  1DHF A;  3SAI A;  5DXV A;  1AO8 A;  3IA4 A;  3EEM A;  3NZD A;  1QQQ A;  2OIP A;  3IRO A;  1LUD A;  4LEK X;  1BO7 A;  2FZH A;  1TLC A;  1VJ3 A;  3ZPC A;  1FFL A;  1RB2 A;  4KJJ A;  1TVV A;  4EIL A;  1JUJ A;  3SH2 A;  3QGT A;  1DHJ A;  1JOM A;  4FOA A;  3FRF X;  1J3J A;  1J3I C;  2BLA A;  1BO8 A;  1B5E A;  1HW4 A;  1TLS A;  5E8Q A;  1F4B A;  5FCT A;  3ED7 A;  1F4F A;  2C2T A;  3ROA A;  4QJC A;  4KM0 A;  3EEJ A;  1DNA A;  4TMS A;  2C2S A;  2CIG A;  2ANO A;  3IJZ A;  4IQB A;  1RA1 A;  4FGG A;  1M79 A;  3VCO A;  3N5G A;  1VZC A;  3JW5 A;  1TSD A;  3FS6 A;  1AOB A;  3DG8 A;  1AXW A;  2G8D A;  3FL8 A;  4H98 A;  1VZA A;  3FRA X;  1TVW A;  4FOX A;  1RA2 A;  4QHV A;  1OHJ A;  4P66 A;  1KMV A;  3NXY A;  3GHW A;  1U71 A;  1RA3 A;  3BFI A;  4HOE A;  1EV5 A;  4DFR A;  4KL9 A;  4KM2 A;  3BHR A;  4EB4 A;  4KJL A;  4EJ1 A;  3C06 A;  4Q0D A;  2G89 A;  4P68 A;  1DYJ A;  3FRD X;  4IXG X;  1TSM A;  3KGB A;  2W3V A;  2DRC A;  4M7V A;  1TRG A;  5H38 A;  4LAG X;  3JWF A;  1J3K A;  4QLE A;  3UM8 A;  1BKO A;  3DAU A;  3SGY A;  3SR5 X;  1RX9 A;  1RX7 A;  2TSC A;  4G95 A;  3B9H A;  1DG5 A;  1TDC A;  4I13 A;  1CD2 A;  5U27 A;  5U26 A;  3NZ6 X;  3N5E A;  1SYN A;  3EEK A;  4M6K A;  5HI6 A;  4KFJ A;  3L3R A;  5HF2 X;  1OHK A;  2D5N A;  1NJB A;  5HUI A;  3JWC A;  3BGX A;  1DLR A;  1DR4 A;  1RX5 A;  3D84 X;  1BSP A;  1PD8 A;  4KYA A;  3GH0 A;  4PSG A;  4PTH A;  4XSC A;  1PDB A;  5FDA A;  3RG9 A;  3JSU A;  4X5G A;  3IRM A;  1BP6 A;  4TU5 X;  1JMI A;  4NX6 A;  2FTN A;  3B5B A;  1FWM A;  2G86 A;  3FYW X;  1DG8 A;  1ZPR A;  5HPB A;  4EIG A;  3KFY A;  3IHI A;  2HXV A;  4X5F A;  3QJ7 A;  3R33 A;  1M78 A;  1RX2 A;  3QL3 A;  4PDJ A;  3FRB X;  4XRB A;  3SQY X;  3TQ8 A;  8DFR A;  4DPH A;  4O1X D;  5CC9 A;  1NJE A;  3NXV A;  4LAH X;  4EIN A;  2CD2 A;  3K47 A;  1DIS A;  3QL0 A;  3BNZ A;  3INV A;  1BKP A;  2FTO X;  3TMS A;  2FTQ A;  1AJM A;  4FOG A;  1RX6 A;  1TSV A;  3V8H A;  4PST A;  3QYO A;  4KY8 A;  1DRB A;  4PSY A;  1YPV A;  4GYH A;  3FY8 X;  3NU0 A;  2O7P A;  3QLX A;  2TSR A;  5HQY A;  1DR6 A;  1EVF A;  1AI9 A;  1TIS A;  1I00 A;  2W9S A;  4GH8 A;  2JYB A;  4FHB A;  4ELB A;  3FQZ A;  1DR5 A;  3FQV A;  3UWL A;  1RH3 A;  3JW3 A;  1TJS A;  3Q1H A;  1TVU A;  4CD2 A;  1DAJ A;  1DR7 A;  3I8A X;  5HSR A;  2QK8 A;  3EAW X;  1HVY A;  4ISK A;  1RA9 A;  4H0R A;  3SRQ X;  3F0B X;  1CZ3 A;  1BZF A;  3FQF A;  4RGC A;  1DDR A;  3NXO A;  3ZPG A;  4LAE X;  4XSD A;  5H3A A;  1LCA A;  3NZ9 X;  1TSL A;  1VZE A;  3N5E B;  1HFR A;  4P3Q A;  3EF9 A;  4IRR A;  1DHI A;  4QLF A;  4OSG A;  3I3R A;  1RX8 A;  1E26 A;  1S3V A;  4G8Z X;  2A9W A;  1TSX A;  3JVX A;  5J7W A;  3SA2 A;  3SRR X;  1THY A;  4M6J A;  1BPJ A;  4HOF A;  3EIG A;  2D0K A;  1EVG A;  3IK0 A;  4E28 A;  2ANQ A;  1TDU A;  1BOZ A;  1S3U A;  3NXX A;  1RG7 A;  4H95 A;  4H0U A;  5JG0 X;  3IK1 A;  3GHC A;  1AOE A;  4XT7 A;  1JTQ A;  3JTW A;  1RX4 A;  1MVS A;  2BLC A;  4KLX A;  4KY4 A;  2INQ A;  3KJS A;  3KY8 A;  1TYS A;  4IXF X;  2L28 A;  3CLB A;  3HB8 A;  3DGA C;  3K2H A;  2BL9 A;  1DIU A;  1U72 A;  1HW3 A;  3F0Q X;  3F0V X;  4H97 A;  4EIZ A;  1AIQ A;  4M2X A;  3SRU X;  3DL5 A;  1TSW A;  3UM6 A;  5HS3 A;  3S9U A;  4EZ8 A;  2W9G A;  3EDW X;  1HFP A;  3F0X X;  1MVT A;  1RB3 A;  1RD7 A;  4Q0E A;  2XW7 A;  2HM9 A;  1EV8 A;  3FQC A;  3QFX A;  3GI2 A;  1TSY A;  1B02 A;  4XEC X;  4XE6 X;  3QLS A;  1TDB A;  3BYX A;  3UWL B;  4KPW A;  1B5D A;  1RTS A;  1RC4 A;  3EJL A;  1IA2 A;  3F91 A;  1BQ2 A;  1DYR A;  3GG5 A;  5HVB A;  3OCH A;  2W3A A;  4QLG A;  1DYH A;  2AZN A;  2KCE A;  2AAZ A;  3FY9 X;  4O7U A;  1KZJ A;  4KAK A;  5EAJ A;  5HT4 A;  4LRR A;  2G8A A;  1U70 A;  1IA4 A;  4O1U A;  4Q67 A;  4XT4 A;  2DHF A;  3GYF A;  7DFR A;  5HQZ A;  1RE7 A;  1CI7 A;  5ECX A;  5DFR A;  1TDA A;  1F4D A;  4OR7 A;  3QLY A;  4ELE A;  1M7A A;  3F0U X;  4H1I A;  4X5I A;  2RD8 A;  6DFR A;  3NXR A;  1DLS A;  4DP3 A;  1RA8 A;  3BHL A;  1JG0 A;  1D1G A;  2ONB A;  5HF0 X;  1BQ1 A;  1F4E A;  2P4G A;  2BLB A;  4KBN A;  3TD8 A;  4KJK A;  1NJA A;  2OBC A;  3QYL A;  4M6L A;  1LY3 A;  3IX9 A;  4X5H A;  5HVE A;  2B3Z A;  2ITH A;  1J3J C;  1DRE A;  3QG2 A;  1DYI A;  1S3W A;  1AN5 A;  3KGY A;  3NXT A;  4JEF A;  1DR3 A;  4KD7 A;  3UM5 A;  1LCB A;  3S3V A;  1SEJ A;  5HSU A;  3S7A A;  4PSS A;  3F8Z A;  1JUV A;  1J3I A;  4ECK A;  1TDR A;  1JTU A;  4E5O A;  3DG8 C;  3F0S X;  1RX1 A;  4G3M A;  3SA1 A;  3LG4 A;  1B49 A;  1JOL A;  1DDU A;  1NCE A;  3K45 A;  4GD7 A;  4KNZ A;  1RX3 A;  3N0H A;  1F4C A;  3RO9 A;  3OB7 A;  3DAT A;  4HOG A;  3TQB A;  1VZD A;  1LY4 A;  3EEL A;  2FZI A;  3FQO A;  4FGH A;  2ZZA A;  1YHO A;  4PTJ A;  4DDR A;  3TQA A;  1DRA A;  3JWM A;  3HJ3 A;  1PD9 A;  2W3M A;  3F8Y A;  3NZC X;  2GD9 A;  4FQS A;  1BP0 A;  1DR1 A;  3CSE A;  1DF7 A;  1BDU A;  2TDM A;  5H39 A;  1NJC A;  4XT8 A;  3IX6 A;  1J3K C;  3IRN A;  4NX7 A;  1JU6 A;  3QLW A;  2W9T A;  1JUT A;  3K74 A;  4H96 A;  1F28 A;  1DRF A;  4DPD A;  1DDS A;  4M7U A;  4XT5 A;  1TSZ A;  4ISW A;  3EGY X;  3QLZ A;  3DGA A;  1KMS A;  1JMF A;  1HFQ A;  3EBU A;  1DG7 A;  3SRS X;  1S3Y A;  4IXE D;  3C0A A;  4XSE A;  4G2O X;  4Q6A A;  2W3B A;  2KGK A;  3M09 A;  4UP1 A;  2RD8 B;  1IA3 A;  2W9H A;  1NJD A;  3SRW X;  3CD2 A;  5HT5 A;  3BZ0 A;  1F4G A;  3DL6 A;  1KZI A;  1LCE A;  1KCE A;  1BSF A;  1ZDR A;  2W3W A;  4ELG A;  3FQ0 A;  3EX8 A;  1TSN A;  4HA7 A;  3NZB X;  1BID A;  4GEV A;  2RDA A;  3JWK A;  3GH2 X;  3DFR A;  1KLK A;  2FZJ A;  4XT6 A;  4ELF A;  2TDD A;  1DRH A;  3E0B A;  4G6W X;  4QJZ D;  4QI9 A;  2VF0 A;  4F2V A;  2G6V A;  3OAF A;  2VET A;  1RF7 A;  3H9K A;  4KEB A;  3NTZ A;  5ECC A;  1VDR A;  4P3R A;  2G8X A;  3DRC A;  4ELH A;  3NRR A;  3TQ9 A;  3IA5 A;  5CCC A;  3EHI X;  2LF1 A;  5WRN A;  1HZW A;  1DR2 A;  1JMG A;  4HA9 A;  3QLR A;  3FL9 A;  3GHV A;  2H2Q A;  1QZF A;  3HBB A;  4O1X A;  5BY6 A;  5JA3 A;  1VZB A;  3CL9 A;  4FGT A;  1IA1 A;  2HQP A;  4IQQ A;  4DQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...