2FTQA

E. coli thymidylate synthase at 1.8 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subtle Conformational Differences between Escherichia coli Thymidylate Synthase and Specific Mutants of this Enzyme
rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Escherichia coli
total genus 86
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 2ftqA00
3B9HA 4H1IA 5BY6A 3C0AA 1VZDA 3BHRA 3DL6A 5HS3A 1VZEA 2TSRA 1F4GA 1BSFA 1F4EA 2OIPA 4LRRA 2ONBA 4FOAA 2RDAA 4H0RA 5FCTA 4KNZA 2RD8B 4O1XA 3UM8A 1DDUA 4DPDA 1BP0A 1HW4A 5H38A 1HVYA 5H3AA 2TSCA 1JMHA 1JUTA 3JSUA 1BO7A 4DP3A 1I00A 4DQ1A 1TLSA 4E28A 1NJDA 3DGAC 3EDWX 1BQ2A 3EGYX 1B5DA 3GH2X 3KGBA 1TSDA 4XSCA 1TVWA 1VZCA 1BQ1A 2A9WA 2G89A 2VETA 1AN5A 3IRMA 1JMIA 3CLBA 3IK1A 1VZAA 1FFLA 4KYAA 1SEJA 1F4DA 1TSLA 3N5EB 4PSGA 1TDBA 1KCEA 1JTQA 3EJLA 1TRGA 3H9KA 4FGTA 1NCEA 4O1UA 2VF0A 1F4CA 4IQBA 3BZ0A 3QG2A 2BBQA 4Q0EA 4ISWA 3B5BA 3IHIA 1YPVA 1QZFA 4GD7A 1EVFA 3IRNA 5WRNA 4F2VA 1TSWA 4EZ8A 2AAZA 1BO8A 3HJ3A 4KY4A 1NJBA 2G8XA 1KZIA 1TYSA 3IROA 3V8HA 4UP1A 4KY8A 2FTQA 3I3RA 1JUJA 3EF9A 4FOGA 3QGTA 4EB4A 3EHIX 3BGXA 1BSPA 1LCEA 1TSXA 2G8DA 3BNZA 3BYXA 1BIDA 1BKPA 1J3KC 3QJ7A 4FOXA 1BJGA 3GH0A 3UM5A 4KPWA 4O7UA 2TDDA 1KZJA 1NJEA 1TJSA 1J3JC 3HBBA 1TDUA 1TLCA 3N5EA 1BDUA 4GYHA 1F4BA 2KCEA 3N5GA 3HB8A 4GEVA 3UWLA 1NJCA 1RTSA 4IRRA 4H0UA 4XSDA 3IX6A 4E5OA 1TSMA 1AJMA 3EAWX 1THYA 3INVA 3KJSA 3BFIA 1AOBA 4EILA 1HW3A 1TVVA 2RD8A 1BKOA 1JMFA 1TSNA 3DG8C 3GG5A 1VZBA 1F28A 1CI7A 3CL9A 1BPJA 2H2QA 4ECKA 3DL5A 1TVUA 4O1XD 1JU6A 1JG0A 1LCBA 1EV5A 3KJRA 3EBUA 1ZPRA 1DNAA 1J3IC 1TSVA 2G8AA 1EVGA 1AXWA 4XSEA 3UM6A 3TMSA 2TDMA 4JEFA 1QQQA 1JTUA 3BHLA 3NRRA 1EV8A 3K2HA 1FWMA 1LCAA 1HZWA 1TISA 2FTNA 3OB7A 1B02A 4IQQA 4TMSA 1AIQA 1TSYA 3ED7A 1TDCA 3C06A 4ISKA 1BP6A 4DPHA 1B5EA 1SYNA 3IK0A 3IJZA 2FTOX 1TDAA 4G6WX 1B49A 1F4FA 1JMGA 5H39A 1NJAA 4Q0DA 2G86A 1TSZA 3UWLB 4G2OX 5J7WA 4FQSA 4EINA
chains in the Genus database with same CATH superfamily
3B9HA 4H1IA 5BY6A 3C0AA 1VZDA 3BHRA 3DL6A 5HS3A 1VZEA 2TSRA 1F4GA 1BSFA 1F4EA 2OIPA 4LRRA 2ONBA 4FOAA 2RDAA 4H0RA 5FCTA 4KNZA 2RD8B 4O1XA 3UM8A 1DDUA 4DPDA 1BP0A 1HW4A 5H38A 1HVYA 5H3AA 2TSCA 1JMHA 1JUTA 3JSUA 1BO7A 4DP3A 1I00A 4DQ1A 1TLSA 4E28A 1NJDA 3DGAC 3EDWX 1BQ2A 3EGYX 1B5DA 3GH2X 3KGBA 1TSDA 4XSCA 1TVWA 1VZCA 1BQ1A 2A9WA 2G89A 2VETA 1AN5A 3IRMA 1JMIA 3CLBA 3IK1A 1VZAA 1FFLA 4KYAA 1SEJA 1F4DA 1TSLA 3N5EB 4PSGA 1TDBA 1KCEA 1JTQA 3EJLA 1TRGA 3H9KA 4FGTA 1NCEA 4O1UA 2VF0A 1F4CA 4IQBA 3BZ0A 3QG2A 2BBQA 4Q0EA 4ISWA 3B5BA 3IHIA 1YPVA 1QZFA 4GD7A 1EVFA 3IRNA 5WRNA 4F2VA 1TSWA 4EZ8A 2AAZA 1BO8A 3HJ3A 4KY4A 1NJBA 2G8XA 1KZIA 1TYSA 3IROA 3V8HA 4UP1A 4KY8A 2FTQA 3I3RA 1JUJA 3EF9A 4FOGA 3QGTA 4EB4A 3EHIX 3BGXA 1BSPA 1LCEA 1TSXA 2G8DA 3BNZA 3BYXA 1BIDA 1BKPA 1J3KC 3QJ7A 4FOXA 1BJGA 3GH0A 3UM5A 4KPWA 4O7UA 2TDDA 1KZJA 1NJEA 1TJSA 1J3JC 3HBBA 1TDUA 1TLCA 3N5EA 1BDUA 4GYHA 1F4BA 2KCEA 3N5GA 3HB8A 4GEVA 3UWLA 1NJCA 1RTSA 4IRRA 4H0UA 4XSDA 3IX6A 4E5OA 1TSMA 1AJMA 3EAWX 1THYA 3INVA 3KJSA 3BFIA 1AOBA 4EILA 1HW3A 1TVVA 2RD8A 1BKOA 1JMFA 1TSNA 3DG8C 3GG5A 1VZBA 1F28A 1CI7A 3CL9A 1BPJA 2H2QA 4ECKA 3DL5A 1TVUA 4O1XD 1JU6A 1JG0A 1LCBA 1EV5A 3KJRA 3EBUA 1ZPRA 1DNAA 1J3IC 1TSVA 2G8AA 1EVGA 1AXWA 4XSEA 3UM6A 3TMSA 2TDMA 4JEFA 1QQQA 1JTUA 3BHLA 3NRRA 1EV8A 3K2HA 1FWMA 1LCAA 1HZWA 1TISA 2FTNA 3OB7A 1B02A 4IQQA 4TMSA 1AIQA 1TSYA 3ED7A 1TDCA 3C06A 4ISKA 1BP6A 4DPHA 1B5EA 1SYNA 3IK0A 3IJZA 2FTOX 1TDAA 4G6WX 1B49A 1F4FA 1JMGA 5H39A 1NJAA 4Q0DA 2G86A 1TSZA 3UWLB 4G2OX 5J7WA 4FQSA 4EINA
chains in the Genus database with same CATH topology
3B9HA 4H1IA 5BY6A 3C0AA 1VZDA 3BHRA 3DL6A 5HS3A 1VZEA 2TSRA 1F4GA 1BSFA 1F4EA 2OIPA 4LRRA 2ONBA 4FOAA 2RDAA 4H0RA 5FCTA 4KNZA 2RD8B 4O1XA 3UM8A 1DDUA 4DPDA 1BP0A 1HW4A 5H38A 1HVYA 5H3AA 2TSCA 1JMHA 1JUTA 3JSUA 1BO7A 4DP3A 1I00A 4DQ1A 1TLSA 4E28A 1NJDA 3DGAC 3EDWX 1BQ2A 3EGYX 1B5DA 3GH2X 3KGBA 1TSDA 4XSCA 1TVWA 1VZCA 1BQ1A 2A9WA 2G89A 2VETA 1AN5A 3IRMA 1JMIA 3CLBA 3IK1A 1VZAA 1FFLA 4KYAA 1SEJA 1F4DA 1TSLA 3N5EB 4PSGA 1TDBA 1KCEA 1JTQA 3EJLA 1TRGA 3H9KA 4FGTA 1NCEA 4O1UA 2VF0A 1F4CA 4IQBA 3BZ0A 3QG2A 2BBQA 4Q0EA 4ISWA 3B5BA 3IHIA 1YPVA 1QZFA 4GD7A 1EVFA 3IRNA 5WRNA 4F2VA 1TSWA 4EZ8A 2AAZA 1BO8A 3HJ3A 4KY4A 1NJBA 2G8XA 1KZIA 1TYSA 3IROA 3V8HA 4UP1A 4KY8A 2FTQA 3I3RA 1JUJA 3EF9A 4FOGA 3QGTA 4EB4A 3EHIX 3BGXA 1BSPA 1LCEA 1TSXA 2G8DA 3BNZA 3BYXA 1BIDA 1BKPA 1J3KC 3QJ7A 4FOXA 1BJGA 3GH0A 3UM5A 4KPWA 4O7UA 2TDDA 1KZJA 1NJEA 1TJSA 1J3JC 3HBBA 1TDUA 1TLCA 3N5EA 1BDUA 4GYHA 1F4BA 2KCEA 3N5GA 3HB8A 4GEVA 3UWLA 1NJCA 1RTSA 4IRRA 4H0UA 4XSDA 3IX6A 4E5OA 1TSMA 1AJMA 3EAWX 1THYA 3INVA 3KJSA 3BFIA 1AOBA 4EILA 1HW3A 1TVVA 2RD8A 1BKOA 1JMFA 1TSNA 3DG8C 3GG5A 1VZBA 1F28A 1CI7A 3CL9A 1BPJA 2H2QA 4ECKA 3DL5A 1TVUA 4O1XD 1JU6A 1JG0A 1LCBA 1EV5A 3KJRA 3EBUA 1ZPRA 1DNAA 1J3IC 1TSVA 2G8AA 1EVGA 1AXWA 4XSEA 3UM6A 3TMSA 2TDMA 4JEFA 1QQQA 1JTUA 3BHLA 3NRRA 1EV8A 3K2HA 1FWMA 1LCAA 1HZWA 1TISA 2FTNA 3OB7A 1B02A 4IQQA 4TMSA 1AIQA 1TSYA 3ED7A 1TDCA 3C06A 4ISKA 1BP6A 4DPHA 1B5EA 1SYNA 3IK0A 3IJZA 2FTOX 1TDAA 4G6WX 1B49A 1F4FA 1JMGA 5H39A 1NJAA 4Q0DA 2G86A 1TSZA 3UWLB 4G2OX 5J7WA 4FQSA 4EINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9H A;  4H1I A;  5BY6 A;  3C0A A;  1VZD A;  3BHR A;  3DL6 A;  5HS3 A;  1VZE A;  2TSR A;  1F4G A;  1BSF A;  1F4E A;  2OIP A;  4LRR A;  2ONB A;  4FOA A;  2RDA A;  4H0R A;  5FCT A;  4KNZ A;  2RD8 B;  4O1X A;  3UM8 A;  1DDU A;  4DPD A;  1BP0 A;  1HW4 A;  5H38 A;  1HVY A;  5H3A A;  2TSC A;  1JMH A;  1JUT A;  3JSU A;  1BO7 A;  4DP3 A;  1I00 A;  4DQ1 A;  1TLS A;  4E28 A;  1NJD A;  3DGA C;  3EDW X;  1BQ2 A;  3EGY X;  1B5D A;  3GH2 X;  3KGB A;  1TSD A;  4XSC A;  1TVW A;  1VZC A;  1BQ1 A;  2A9W A;  2G89 A;  2VET A;  1AN5 A;  3IRM A;  1JMI A;  3CLB A;  3IK1 A;  1VZA A;  1FFL A;  4KYA A;  1SEJ A;  1F4D A;  1TSL A;  3N5E B;  4PSG A;  1TDB A;  1KCE A;  1JTQ A;  3EJL A;  1TRG A;  3H9K A;  4FGT A;  1NCE A;  4O1U A;  2VF0 A;  1F4C A;  4IQB A;  3BZ0 A;  3QG2 A;  2BBQ A;  4Q0E A;  4ISW A;  3B5B A;  3IHI A;  1YPV A;  1QZF A;  4GD7 A;  1EVF A;  3IRN A;  5WRN A;  4F2V A;  1TSW A;  4EZ8 A;  2AAZ A;  1BO8 A;  3HJ3 A;  4KY4 A;  1NJB A;  2G8X A;  1KZI A;  1TYS A;  3IRO A;  3V8H A;  4UP1 A;  4KY8 A;  2FTQ A;  3I3R A;  1JUJ A;  3EF9 A;  4FOG A;  3QGT A;  4EB4 A;  3EHI X;  3BGX A;  1BSP A;  1LCE A;  1TSX A;  2G8D A;  3BNZ A;  3BYX A;  1BID A;  1BKP A;  1J3K C;  3QJ7 A;  4FOX A;  1BJG A;  3GH0 A;  3UM5 A;  4KPW A;  4O7U A;  2TDD A;  1KZJ A;  1NJE A;  1TJS A;  1J3J C;  3HBB A;  1TDU A;  1TLC A;  3N5E A;  1BDU A;  4GYH A;  1F4B A;  2KCE A;  3N5G A;  3HB8 A;  4GEV A;  3UWL A;  1NJC A;  1RTS A;  4IRR A;  4H0U A;  4XSD A;  3IX6 A;  4E5O A;  1TSM A;  1AJM A;  3EAW X;  1THY A;  3INV A;  3KJS A;  3BFI A;  1AOB A;  4EIL A;  1HW3 A;  1TVV A;  2RD8 A;  1BKO A;  1JMF A;  1TSN A;  3DG8 C;  3GG5 A;  1VZB A;  1F28 A;  1CI7 A;  3CL9 A;  1BPJ A;  2H2Q A;  4ECK A;  3DL5 A;  1TVU A;  4O1X D;  1JU6 A;  1JG0 A;  1LCB A;  1EV5 A;  3KJR A;  3EBU A;  1ZPR A;  1DNA A;  1J3I C;  1TSV A;  2G8A A;  1EVG A;  1AXW A;  4XSE A;  3UM6 A;  3TMS A;  2TDM A;  4JEF A;  1QQQ A;  1JTU A;  3BHL A;  3NRR A;  1EV8 A;  3K2H A;  1FWM A;  1LCA A;  1HZW A;  1TIS A;  2FTN A;  3OB7 A;  1B02 A;  4IQQ A;  4TMS A;  1AIQ A;  1TSY A;  3ED7 A;  1TDC A;  3C06 A;  4ISK A;  1BP6 A;  4DPH A;  1B5E A;  1SYN A;  3IK0 A;  3IJZ A;  2FTO X;  1TDA A;  4G6W X;  1B49 A;  1F4F A;  1JMG A;  5H39 A;  1NJA A;  4Q0D A;  2G86 A;  1TSZ A;  3UWL B;  4G2O X;  5J7W A;  4FQS A;  4EIN A; 
#chains in the Genus database with same CATH topology
 3B9H A;  4H1I A;  5BY6 A;  3C0A A;  1VZD A;  3BHR A;  3DL6 A;  5HS3 A;  1VZE A;  2TSR A;  1F4G A;  1BSF A;  1F4E A;  2OIP A;  4LRR A;  2ONB A;  4FOA A;  2RDA A;  4H0R A;  5FCT A;  4KNZ A;  2RD8 B;  4O1X A;  3UM8 A;  1DDU A;  4DPD A;  1BP0 A;  1HW4 A;  5H38 A;  1HVY A;  5H3A A;  2TSC A;  1JMH A;  1JUT A;  3JSU A;  1BO7 A;  4DP3 A;  1I00 A;  4DQ1 A;  1TLS A;  4E28 A;  1NJD A;  3DGA C;  3EDW X;  1BQ2 A;  3EGY X;  1B5D A;  3GH2 X;  3KGB A;  1TSD A;  4XSC A;  1TVW A;  1VZC A;  1BQ1 A;  2A9W A;  2G89 A;  2VET A;  1AN5 A;  3IRM A;  1JMI A;  3CLB A;  3IK1 A;  1VZA A;  1FFL A;  4KYA A;  1SEJ A;  1F4D A;  1TSL A;  3N5E B;  4PSG A;  1TDB A;  1KCE A;  1JTQ A;  3EJL A;  1TRG A;  3H9K A;  4FGT A;  1NCE A;  4O1U A;  2VF0 A;  1F4C A;  4IQB A;  3BZ0 A;  3QG2 A;  2BBQ A;  4Q0E A;  4ISW A;  3B5B A;  3IHI A;  1YPV A;  1QZF A;  4GD7 A;  1EVF A;  3IRN A;  5WRN A;  4F2V A;  1TSW A;  4EZ8 A;  2AAZ A;  1BO8 A;  3HJ3 A;  4KY4 A;  1NJB A;  2G8X A;  1KZI A;  1TYS A;  3IRO A;  3V8H A;  4UP1 A;  4KY8 A;  2FTQ A;  3I3R A;  1JUJ A;  3EF9 A;  4FOG A;  3QGT A;  4EB4 A;  3EHI X;  3BGX A;  1BSP A;  1LCE A;  1TSX A;  2G8D A;  3BNZ A;  3BYX A;  1BID A;  1BKP A;  1J3K C;  3QJ7 A;  4FOX A;  1BJG A;  3GH0 A;  3UM5 A;  4KPW A;  4O7U A;  2TDD A;  1KZJ A;  1NJE A;  1TJS A;  1J3J C;  3HBB A;  1TDU A;  1TLC A;  3N5E A;  1BDU A;  4GYH A;  1F4B A;  2KCE A;  3N5G A;  3HB8 A;  4GEV A;  3UWL A;  1NJC A;  1RTS A;  4IRR A;  4H0U A;  4XSD A;  3IX6 A;  4E5O A;  1TSM A;  1AJM A;  3EAW X;  1THY A;  3INV A;  3KJS A;  3BFI A;  1AOB A;  4EIL A;  1HW3 A;  1TVV A;  2RD8 A;  1BKO A;  1JMF A;  1TSN A;  3DG8 C;  3GG5 A;  1VZB A;  1F28 A;  1CI7 A;  3CL9 A;  1BPJ A;  2H2Q A;  4ECK A;  3DL5 A;  1TVU A;  4O1X D;  1JU6 A;  1JG0 A;  1LCB A;  1EV5 A;  3KJR A;  3EBU A;  1ZPR A;  1DNA A;  1J3I C;  1TSV A;  2G8A A;  1EVG A;  1AXW A;  4XSE A;  3UM6 A;  3TMS A;  2TDM A;  4JEF A;  1QQQ A;  1JTU A;  3BHL A;  3NRR A;  1EV8 A;  3K2H A;  1FWM A;  1LCA A;  1HZW A;  1TIS A;  2FTN A;  3OB7 A;  1B02 A;  4IQQ A;  4TMS A;  1AIQ A;  1TSY A;  3ED7 A;  1TDC A;  3C06 A;  4ISK A;  1BP6 A;  4DPH A;  1B5E A;  1SYN A;  3IK0 A;  3IJZ A;  2FTO X;  1TDA A;  4G6W X;  1B49 A;  1F4F A;  1JMG A;  5H39 A;  1NJA A;  4Q0D A;  2G86 A;  1TSZ A;  3UWL B;  4G2O X;  5J7W A;  4FQS A;  4EIN A; 
#chains in the Genus database with same CATH homology
 3B9H A;  4H1I A;  5BY6 A;  3C0A A;  1VZD A;  3BHR A;  3DL6 A;  5HS3 A;  1VZE A;  2TSR A;  1F4G A;  1BSF A;  1F4E A;  2OIP A;  4LRR A;  2ONB A;  4FOA A;  2RDA A;  4H0R A;  5FCT A;  4KNZ A;  2RD8 B;  4O1X A;  3UM8 A;  1DDU A;  4DPD A;  1BP0 A;  1HW4 A;  5H38 A;  1HVY A;  5H3A A;  2TSC A;  1JMH A;  1JUT A;  3JSU A;  1BO7 A;  4DP3 A;  1I00 A;  4DQ1 A;  1TLS A;  4E28 A;  1NJD A;  3DGA C;  3EDW X;  1BQ2 A;  3EGY X;  1B5D A;  3GH2 X;  3KGB A;  1TSD A;  4XSC A;  1TVW A;  1VZC A;  1BQ1 A;  2A9W A;  2G89 A;  2VET A;  1AN5 A;  3IRM A;  1JMI A;  3CLB A;  3IK1 A;  1VZA A;  1FFL A;  4KYA A;  1SEJ A;  1F4D A;  1TSL A;  3N5E B;  4PSG A;  1TDB A;  1KCE A;  1JTQ A;  3EJL A;  1TRG A;  3H9K A;  4FGT A;  1NCE A;  4O1U A;  2VF0 A;  1F4C A;  4IQB A;  3BZ0 A;  3QG2 A;  2BBQ A;  4Q0E A;  4ISW A;  3B5B A;  3IHI A;  1YPV A;  1QZF A;  4GD7 A;  1EVF A;  3IRN A;  5WRN A;  4F2V A;  1TSW A;  4EZ8 A;  2AAZ A;  1BO8 A;  3HJ3 A;  4KY4 A;  1NJB A;  2G8X A;  1KZI A;  1TYS A;  3IRO A;  3V8H A;  4UP1 A;  4KY8 A;  2FTQ A;  3I3R A;  1JUJ A;  3EF9 A;  4FOG A;  3QGT A;  4EB4 A;  3EHI X;  3BGX A;  1BSP A;  1LCE A;  1TSX A;  2G8D A;  3BNZ A;  3BYX A;  1BID A;  1BKP A;  1J3K C;  3QJ7 A;  4FOX A;  1BJG A;  3GH0 A;  3UM5 A;  4KPW A;  4O7U A;  2TDD A;  1KZJ A;  1NJE A;  1TJS A;  1J3J C;  3HBB A;  1TDU A;  1TLC A;  3N5E A;  1BDU A;  4GYH A;  1F4B A;  2KCE A;  3N5G A;  3HB8 A;  4GEV A;  3UWL A;  1NJC A;  1RTS A;  4IRR A;  4H0U A;  4XSD A;  3IX6 A;  4E5O A;  1TSM A;  1AJM A;  3EAW X;  1THY A;  3INV A;  3KJS A;  3BFI A;  1AOB A;  4EIL A;  1HW3 A;  1TVV A;  2RD8 A;  1BKO A;  1JMF A;  1TSN A;  3DG8 C;  3GG5 A;  1VZB A;  1F28 A;  1CI7 A;  3CL9 A;  1BPJ A;  2H2Q A;  4ECK A;  3DL5 A;  1TVU A;  4O1X D;  1JU6 A;  1JG0 A;  1LCB A;  1EV5 A;  3KJR A;  3EBU A;  1ZPR A;  1DNA A;  1J3I C;  1TSV A;  2G8A A;  1EVG A;  1AXW A;  4XSE A;  3UM6 A;  3TMS A;  2TDM A;  4JEF A;  1QQQ A;  1JTU A;  3BHL A;  3NRR A;  1EV8 A;  3K2H A;  1FWM A;  1LCA A;  1HZW A;  1TIS A;  2FTN A;  3OB7 A;  1B02 A;  4IQQ A;  4TMS A;  1AIQ A;  1TSY A;  3ED7 A;  1TDC A;  3C06 A;  4ISK A;  1BP6 A;  4DPH A;  1B5E A;  1SYN A;  3IK0 A;  3IJZ A;  2FTO X;  1TDA A;  4G6W X;  1B49 A;  1F4F A;  1JMG A;  5H39 A;  1NJA A;  4Q0D A;  2G86 A;  1TSZ A;  3UWL B;  4G2O X;  5J7W A;  4FQS A;  4EIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...