1J3JC

Double mutant (c59r+s108n) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with pyrimethamine, nadph, and dump
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
326
structure length
326
Chain Sequence
DDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into antifolate resistance from malarial DHFR-TS structures.
pubmed doi rcsb
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
molecule tags Oxidoreductase, transferase
source organism Plasmodium falciparum
total genus 103
structure length 326
sequence length 326
chains with identical sequence D
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1j3jC00
1F4CA 3BNZA 3N5GA 1CI7A 3EHIX 3IHIA 3IK0A 1AIQA 4KY4A 5BY6A 3QG2A 1TDCA 2RD8A 3IROA 1TDUA 2G8DA 1F4FA 1HVYA 3IRMA 2TDMA 4IQQA 1ZPRA 4EINA 4IRRA 1TVWA 4G2OX 3C0AA 3KJRA 4ECKA 4JEFA 4H1IA 1F4DA 1TSYA 1VZAA 3KGBA 1F4EA 3V8HA 3QGTA 1TSZA 3HB8A 3HBBA 4ISKA 1DNAA 4GD7A 4H0RA 1NJBA 1TSVA 1HZWA 4KPWA 3CLBA 3GH2X 4KNZA 1TSMA 1LCBA 1YPVA 3EJLA 3B9HA 1FFLA 3N5EB 1JUJA 5FCTA 1BP0A 2G8AA 4UP1A 1J3JC 4DPDA 4EILA 2VETA 4KYAA 1AJMA 3OB7A 4Q0DA 4Q0EA 1JMGA 3ED7A 3BYXA 3UM6A 2TSRA 2AAZA 1BSFA 1TDBA 3EAWX 1BO8A 1JUTA 3EBUA 3C06A 3IK1A 1LCAA 4IQBA 1B02A 1TLSA 5HS3A 3BZ0A 1B49A 3UM5A 1FWMA 1TVVA 2G89A 2FTNA 1B5EA 2TSCA 3IRNA 3DGAC 1JMHA 4H0UA 3GG5A 3QJ7A 4XSEA 1EV8A 3N5EA 3K2HA 1F28A 1BJGA 4XSCA 4EB4A 1BKPA 5H3AA 4E5OA 3UWLB 4EZ8A 1THYA 3UM8A 1QZFA 1JMFA 1DDUA 1HW3A 5WRNA 1AN5A 2ONBA 1BQ1A 3BHLA 5J7WA 3BGXA 1J3KC 1JMIA 3INVA 1BQ2A 1VZEA 3NRRA 3I3RA 4FOAA 2RD8B 1VZDA 2A9WA 1TYSA 2BBQA 1JU6A 1KCEA 1EVFA 4FQSA 2KCEA 1BSPA 3KJSA 3TMSA 3GH0A 4DQ1A 3JSUA 1NJAA 4XSDA 1TDAA 1TVUA 2H2QA 1RTSA 1NCEA 1BP6A 2FTOX 1JTUA 1QQQA 3IX6A 1TSDA 1TSWA 1TJSA 2TDDA 1EV5A 3EDWX 3H9KA 3HJ3A 1BPJA 4O7UA 1F4GA 1I00A 1NJDA 4FOXA 1EVGA 1KZJA 3EF9A 1BO7A 1TLCA 4GYHA 3DL5A 1F4BA 4ISWA 4LRRA 3BHRA 4FGTA 2OIPA 1BIDA 1NJCA 1SYNA 2RDAA 1LCEA 3B5BA 1JTQA 1J3IC 1AOBA 1KZIA 3IJZA 4O1XA 3EGYX 4DPHA 1TRGA 1VZBA 1JG0A 1TSLA 3CL9A 4O1UA 1VZCA 4TMSA 4FOGA 4PSGA 3DG8C 1NJEA 2G86A 4DP3A 1B5DA 5H38A 2FTQA 1TSNA 1BKOA 3BFIA 2VF0A 1AXWA 1BDUA 4GEVA 1SEJA 1TISA 2G8XA 4E28A 4KY8A 1HW4A 1TSXA 4G6WX 3UWLA 4O1XD 5H39A 4F2VA 3DL6A
chains in the Genus database with same CATH superfamily
1F4CA 3BNZA 3N5GA 1CI7A 3EHIX 3IHIA 3IK0A 1AIQA 4KY4A 5BY6A 3QG2A 1TDCA 2RD8A 3IROA 1TDUA 2G8DA 1F4FA 1HVYA 3IRMA 2TDMA 4IQQA 1ZPRA 4EINA 4IRRA 1TVWA 4G2OX 3C0AA 3KJRA 4ECKA 4JEFA 4H1IA 1F4DA 1TSYA 1VZAA 3KGBA 1F4EA 3V8HA 3QGTA 1TSZA 3HB8A 3HBBA 4ISKA 1DNAA 4GD7A 4H0RA 1NJBA 1TSVA 1HZWA 4KPWA 3CLBA 3GH2X 4KNZA 1TSMA 1LCBA 1YPVA 3EJLA 3B9HA 1FFLA 3N5EB 1JUJA 5FCTA 1BP0A 2G8AA 4UP1A 1J3JC 4DPDA 4EILA 2VETA 4KYAA 1AJMA 3OB7A 4Q0DA 4Q0EA 1JMGA 3ED7A 3BYXA 3UM6A 2TSRA 2AAZA 1BSFA 1TDBA 3EAWX 1BO8A 1JUTA 3EBUA 3C06A 3IK1A 1LCAA 4IQBA 1B02A 1TLSA 5HS3A 3BZ0A 1B49A 3UM5A 1FWMA 1TVVA 2G89A 2FTNA 1B5EA 2TSCA 3IRNA 3DGAC 1JMHA 4H0UA 3GG5A 3QJ7A 4XSEA 1EV8A 3N5EA 3K2HA 1F28A 1BJGA 4XSCA 4EB4A 1BKPA 5H3AA 4E5OA 3UWLB 4EZ8A 1THYA 3UM8A 1QZFA 1JMFA 1DDUA 1HW3A 5WRNA 1AN5A 2ONBA 1BQ1A 3BHLA 5J7WA 3BGXA 1J3KC 1JMIA 3INVA 1BQ2A 1VZEA 3NRRA 3I3RA 4FOAA 2RD8B 1VZDA 2A9WA 1TYSA 2BBQA 1JU6A 1KCEA 1EVFA 4FQSA 2KCEA 1BSPA 3KJSA 3TMSA 3GH0A 4DQ1A 3JSUA 1NJAA 4XSDA 1TDAA 1TVUA 2H2QA 1RTSA 1NCEA 1BP6A 2FTOX 1JTUA 1QQQA 3IX6A 1TSDA 1TSWA 1TJSA 2TDDA 1EV5A 3EDWX 3H9KA 3HJ3A 1BPJA 4O7UA 1F4GA 1I00A 1NJDA 4FOXA 1EVGA 1KZJA 3EF9A 1BO7A 1TLCA 4GYHA 3DL5A 1F4BA 4ISWA 4LRRA 3BHRA 4FGTA 2OIPA 1BIDA 1NJCA 1SYNA 2RDAA 1LCEA 3B5BA 1JTQA 1J3IC 1AOBA 1KZIA 3IJZA 4O1XA 3EGYX 4DPHA 1TRGA 1VZBA 1JG0A 1TSLA 3CL9A 4O1UA 1VZCA 4TMSA 4FOGA 4PSGA 3DG8C 1NJEA 2G86A 4DP3A 1B5DA 5H38A 2FTQA 1TSNA 1BKOA 3BFIA 2VF0A 1AXWA 1BDUA 4GEVA 1SEJA 1TISA 2G8XA 4E28A 4KY8A 1HW4A 1TSXA 4G6WX 3UWLA 4O1XD 5H39A 4F2VA 3DL6A
chains in the Genus database with same CATH topology
1F4CA 3BNZA 3N5GA 1CI7A 3EHIX 3IHIA 3IK0A 1AIQA 4KY4A 5BY6A 3QG2A 1TDCA 2RD8A 3IROA 1TDUA 2G8DA 1F4FA 1HVYA 3IRMA 2TDMA 4IQQA 1ZPRA 4EINA 4IRRA 1TVWA 4G2OX 3C0AA 3KJRA 4ECKA 4JEFA 4H1IA 1F4DA 1TSYA 1VZAA 3KGBA 1F4EA 3V8HA 3QGTA 1TSZA 3HB8A 3HBBA 4ISKA 1DNAA 4GD7A 4H0RA 1NJBA 1TSVA 1HZWA 4KPWA 3CLBA 3GH2X 4KNZA 1TSMA 1LCBA 1YPVA 3EJLA 3B9HA 1FFLA 3N5EB 1JUJA 5FCTA 1BP0A 2G8AA 4UP1A 1J3JC 4DPDA 4EILA 2VETA 4KYAA 1AJMA 3OB7A 4Q0DA 4Q0EA 1JMGA 3ED7A 3BYXA 3UM6A 2TSRA 2AAZA 1BSFA 1TDBA 3EAWX 1BO8A 1JUTA 3EBUA 3C06A 3IK1A 1LCAA 4IQBA 1B02A 1TLSA 5HS3A 3BZ0A 1B49A 3UM5A 1FWMA 1TVVA 2G89A 2FTNA 1B5EA 2TSCA 3IRNA 3DGAC 1JMHA 4H0UA 3GG5A 3QJ7A 4XSEA 1EV8A 3N5EA 3K2HA 1F28A 1BJGA 4XSCA 4EB4A 1BKPA 5H3AA 4E5OA 3UWLB 4EZ8A 1THYA 3UM8A 1QZFA 1JMFA 1DDUA 1HW3A 5WRNA 1AN5A 2ONBA 1BQ1A 3BHLA 5J7WA 3BGXA 1J3KC 1JMIA 3INVA 1BQ2A 1VZEA 3NRRA 3I3RA 4FOAA 2RD8B 1VZDA 2A9WA 1TYSA 2BBQA 1JU6A 1KCEA 1EVFA 4FQSA 2KCEA 1BSPA 3KJSA 3TMSA 3GH0A 4DQ1A 3JSUA 1NJAA 4XSDA 1TDAA 1TVUA 2H2QA 1RTSA 1NCEA 1BP6A 2FTOX 1JTUA 1QQQA 3IX6A 1TSDA 1TSWA 1TJSA 2TDDA 1EV5A 3EDWX 3H9KA 3HJ3A 1BPJA 4O7UA 1F4GA 1I00A 1NJDA 4FOXA 1EVGA 1KZJA 3EF9A 1BO7A 1TLCA 4GYHA 3DL5A 1F4BA 4ISWA 4LRRA 3BHRA 4FGTA 2OIPA 1BIDA 1NJCA 1SYNA 2RDAA 1LCEA 3B5BA 1JTQA 1J3IC 1AOBA 1KZIA 3IJZA 4O1XA 3EGYX 4DPHA 1TRGA 1VZBA 1JG0A 1TSLA 3CL9A 4O1UA 1VZCA 4TMSA 4FOGA 4PSGA 3DG8C 1NJEA 2G86A 4DP3A 1B5DA 5H38A 2FTQA 1TSNA 1BKOA 3BFIA 2VF0A 1AXWA 1BDUA 4GEVA 1SEJA 1TISA 2G8XA 4E28A 4KY8A 1HW4A 1TSXA 4G6WX 3UWLA 4O1XD 5H39A 4F2VA 3DL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4C A;  3BNZ A;  3N5G A;  1CI7 A;  3EHI X;  3IHI A;  3IK0 A;  1AIQ A;  4KY4 A;  5BY6 A;  3QG2 A;  1TDC A;  2RD8 A;  3IRO A;  1TDU A;  2G8D A;  1F4F A;  1HVY A;  3IRM A;  2TDM A;  4IQQ A;  1ZPR A;  4EIN A;  4IRR A;  1TVW A;  4G2O X;  3C0A A;  3KJR A;  4ECK A;  4JEF A;  4H1I A;  1F4D A;  1TSY A;  1VZA A;  3KGB A;  1F4E A;  3V8H A;  3QGT A;  1TSZ A;  3HB8 A;  3HBB A;  4ISK A;  1DNA A;  4GD7 A;  4H0R A;  1NJB A;  1TSV A;  1HZW A;  4KPW A;  3CLB A;  3GH2 X;  4KNZ A;  1TSM A;  1LCB A;  1YPV A;  3EJL A;  3B9H A;  1FFL A;  3N5E B;  1JUJ A;  5FCT A;  1BP0 A;  2G8A A;  4UP1 A;  1J3J C;  4DPD A;  4EIL A;  2VET A;  4KYA A;  1AJM A;  3OB7 A;  4Q0D A;  4Q0E A;  1JMG A;  3ED7 A;  3BYX A;  3UM6 A;  2TSR A;  2AAZ A;  1BSF A;  1TDB A;  3EAW X;  1BO8 A;  1JUT A;  3EBU A;  3C06 A;  3IK1 A;  1LCA A;  4IQB A;  1B02 A;  1TLS A;  5HS3 A;  3BZ0 A;  1B49 A;  3UM5 A;  1FWM A;  1TVV A;  2G89 A;  2FTN A;  1B5E A;  2TSC A;  3IRN A;  3DGA C;  1JMH A;  4H0U A;  3GG5 A;  3QJ7 A;  4XSE A;  1EV8 A;  3N5E A;  3K2H A;  1F28 A;  1BJG A;  4XSC A;  4EB4 A;  1BKP A;  5H3A A;  4E5O A;  3UWL B;  4EZ8 A;  1THY A;  3UM8 A;  1QZF A;  1JMF A;  1DDU A;  1HW3 A;  5WRN A;  1AN5 A;  2ONB A;  1BQ1 A;  3BHL A;  5J7W A;  3BGX A;  1J3K C;  1JMI A;  3INV A;  1BQ2 A;  1VZE A;  3NRR A;  3I3R A;  4FOA A;  2RD8 B;  1VZD A;  2A9W A;  1TYS A;  2BBQ A;  1JU6 A;  1KCE A;  1EVF A;  4FQS A;  2KCE A;  1BSP A;  3KJS A;  3TMS A;  3GH0 A;  4DQ1 A;  3JSU A;  1NJA A;  4XSD A;  1TDA A;  1TVU A;  2H2Q A;  1RTS A;  1NCE A;  1BP6 A;  2FTO X;  1JTU A;  1QQQ A;  3IX6 A;  1TSD A;  1TSW A;  1TJS A;  2TDD A;  1EV5 A;  3EDW X;  3H9K A;  3HJ3 A;  1BPJ A;  4O7U A;  1F4G A;  1I00 A;  1NJD A;  4FOX A;  1EVG A;  1KZJ A;  3EF9 A;  1BO7 A;  1TLC A;  4GYH A;  3DL5 A;  1F4B A;  4ISW A;  4LRR A;  3BHR A;  4FGT A;  2OIP A;  1BID A;  1NJC A;  1SYN A;  2RDA A;  1LCE A;  3B5B A;  1JTQ A;  1J3I C;  1AOB A;  1KZI A;  3IJZ A;  4O1X A;  3EGY X;  4DPH A;  1TRG A;  1VZB A;  1JG0 A;  1TSL A;  3CL9 A;  4O1U A;  1VZC A;  4TMS A;  4FOG A;  4PSG A;  3DG8 C;  1NJE A;  2G86 A;  4DP3 A;  1B5D A;  5H38 A;  2FTQ A;  1TSN A;  1BKO A;  3BFI A;  2VF0 A;  1AXW A;  1BDU A;  4GEV A;  1SEJ A;  1TIS A;  2G8X A;  4E28 A;  4KY8 A;  1HW4 A;  1TSX A;  4G6W X;  3UWL A;  4O1X D;  5H39 A;  4F2V A;  3DL6 A; 
#chains in the Genus database with same CATH topology
 1F4C A;  3BNZ A;  3N5G A;  1CI7 A;  3EHI X;  3IHI A;  3IK0 A;  1AIQ A;  4KY4 A;  5BY6 A;  3QG2 A;  1TDC A;  2RD8 A;  3IRO A;  1TDU A;  2G8D A;  1F4F A;  1HVY A;  3IRM A;  2TDM A;  4IQQ A;  1ZPR A;  4EIN A;  4IRR A;  1TVW A;  4G2O X;  3C0A A;  3KJR A;  4ECK A;  4JEF A;  4H1I A;  1F4D A;  1TSY A;  1VZA A;  3KGB A;  1F4E A;  3V8H A;  3QGT A;  1TSZ A;  3HB8 A;  3HBB A;  4ISK A;  1DNA A;  4GD7 A;  4H0R A;  1NJB A;  1TSV A;  1HZW A;  4KPW A;  3CLB A;  3GH2 X;  4KNZ A;  1TSM A;  1LCB A;  1YPV A;  3EJL A;  3B9H A;  1FFL A;  3N5E B;  1JUJ A;  5FCT A;  1BP0 A;  2G8A A;  4UP1 A;  1J3J C;  4DPD A;  4EIL A;  2VET A;  4KYA A;  1AJM A;  3OB7 A;  4Q0D A;  4Q0E A;  1JMG A;  3ED7 A;  3BYX A;  3UM6 A;  2TSR A;  2AAZ A;  1BSF A;  1TDB A;  3EAW X;  1BO8 A;  1JUT A;  3EBU A;  3C06 A;  3IK1 A;  1LCA A;  4IQB A;  1B02 A;  1TLS A;  5HS3 A;  3BZ0 A;  1B49 A;  3UM5 A;  1FWM A;  1TVV A;  2G89 A;  2FTN A;  1B5E A;  2TSC A;  3IRN A;  3DGA C;  1JMH A;  4H0U A;  3GG5 A;  3QJ7 A;  4XSE A;  1EV8 A;  3N5E A;  3K2H A;  1F28 A;  1BJG A;  4XSC A;  4EB4 A;  1BKP A;  5H3A A;  4E5O A;  3UWL B;  4EZ8 A;  1THY A;  3UM8 A;  1QZF A;  1JMF A;  1DDU A;  1HW3 A;  5WRN A;  1AN5 A;  2ONB A;  1BQ1 A;  3BHL A;  5J7W A;  3BGX A;  1J3K C;  1JMI A;  3INV A;  1BQ2 A;  1VZE A;  3NRR A;  3I3R A;  4FOA A;  2RD8 B;  1VZD A;  2A9W A;  1TYS A;  2BBQ A;  1JU6 A;  1KCE A;  1EVF A;  4FQS A;  2KCE A;  1BSP A;  3KJS A;  3TMS A;  3GH0 A;  4DQ1 A;  3JSU A;  1NJA A;  4XSD A;  1TDA A;  1TVU A;  2H2Q A;  1RTS A;  1NCE A;  1BP6 A;  2FTO X;  1JTU A;  1QQQ A;  3IX6 A;  1TSD A;  1TSW A;  1TJS A;  2TDD A;  1EV5 A;  3EDW X;  3H9K A;  3HJ3 A;  1BPJ A;  4O7U A;  1F4G A;  1I00 A;  1NJD A;  4FOX A;  1EVG A;  1KZJ A;  3EF9 A;  1BO7 A;  1TLC A;  4GYH A;  3DL5 A;  1F4B A;  4ISW A;  4LRR A;  3BHR A;  4FGT A;  2OIP A;  1BID A;  1NJC A;  1SYN A;  2RDA A;  1LCE A;  3B5B A;  1JTQ A;  1J3I C;  1AOB A;  1KZI A;  3IJZ A;  4O1X A;  3EGY X;  4DPH A;  1TRG A;  1VZB A;  1JG0 A;  1TSL A;  3CL9 A;  4O1U A;  1VZC A;  4TMS A;  4FOG A;  4PSG A;  3DG8 C;  1NJE A;  2G86 A;  4DP3 A;  1B5D A;  5H38 A;  2FTQ A;  1TSN A;  1BKO A;  3BFI A;  2VF0 A;  1AXW A;  1BDU A;  4GEV A;  1SEJ A;  1TIS A;  2G8X A;  4E28 A;  4KY8 A;  1HW4 A;  1TSX A;  4G6W X;  3UWL A;  4O1X D;  5H39 A;  4F2V A;  3DL6 A; 
#chains in the Genus database with same CATH homology
 1F4C A;  3BNZ A;  3N5G A;  1CI7 A;  3EHI X;  3IHI A;  3IK0 A;  1AIQ A;  4KY4 A;  5BY6 A;  3QG2 A;  1TDC A;  2RD8 A;  3IRO A;  1TDU A;  2G8D A;  1F4F A;  1HVY A;  3IRM A;  2TDM A;  4IQQ A;  1ZPR A;  4EIN A;  4IRR A;  1TVW A;  4G2O X;  3C0A A;  3KJR A;  4ECK A;  4JEF A;  4H1I A;  1F4D A;  1TSY A;  1VZA A;  3KGB A;  1F4E A;  3V8H A;  3QGT A;  1TSZ A;  3HB8 A;  3HBB A;  4ISK A;  1DNA A;  4GD7 A;  4H0R A;  1NJB A;  1TSV A;  1HZW A;  4KPW A;  3CLB A;  3GH2 X;  4KNZ A;  1TSM A;  1LCB A;  1YPV A;  3EJL A;  3B9H A;  1FFL A;  3N5E B;  1JUJ A;  5FCT A;  1BP0 A;  2G8A A;  4UP1 A;  1J3J C;  4DPD A;  4EIL A;  2VET A;  4KYA A;  1AJM A;  3OB7 A;  4Q0D A;  4Q0E A;  1JMG A;  3ED7 A;  3BYX A;  3UM6 A;  2TSR A;  2AAZ A;  1BSF A;  1TDB A;  3EAW X;  1BO8 A;  1JUT A;  3EBU A;  3C06 A;  3IK1 A;  1LCA A;  4IQB A;  1B02 A;  1TLS A;  5HS3 A;  3BZ0 A;  1B49 A;  3UM5 A;  1FWM A;  1TVV A;  2G89 A;  2FTN A;  1B5E A;  2TSC A;  3IRN A;  3DGA C;  1JMH A;  4H0U A;  3GG5 A;  3QJ7 A;  4XSE A;  1EV8 A;  3N5E A;  3K2H A;  1F28 A;  1BJG A;  4XSC A;  4EB4 A;  1BKP A;  5H3A A;  4E5O A;  3UWL B;  4EZ8 A;  1THY A;  3UM8 A;  1QZF A;  1JMF A;  1DDU A;  1HW3 A;  5WRN A;  1AN5 A;  2ONB A;  1BQ1 A;  3BHL A;  5J7W A;  3BGX A;  1J3K C;  1JMI A;  3INV A;  1BQ2 A;  1VZE A;  3NRR A;  3I3R A;  4FOA A;  2RD8 B;  1VZD A;  2A9W A;  1TYS A;  2BBQ A;  1JU6 A;  1KCE A;  1EVF A;  4FQS A;  2KCE A;  1BSP A;  3KJS A;  3TMS A;  3GH0 A;  4DQ1 A;  3JSU A;  1NJA A;  4XSD A;  1TDA A;  1TVU A;  2H2Q A;  1RTS A;  1NCE A;  1BP6 A;  2FTO X;  1JTU A;  1QQQ A;  3IX6 A;  1TSD A;  1TSW A;  1TJS A;  2TDD A;  1EV5 A;  3EDW X;  3H9K A;  3HJ3 A;  1BPJ A;  4O7U A;  1F4G A;  1I00 A;  1NJD A;  4FOX A;  1EVG A;  1KZJ A;  3EF9 A;  1BO7 A;  1TLC A;  4GYH A;  3DL5 A;  1F4B A;  4ISW A;  4LRR A;  3BHR A;  4FGT A;  2OIP A;  1BID A;  1NJC A;  1SYN A;  2RDA A;  1LCE A;  3B5B A;  1JTQ A;  1J3I C;  1AOB A;  1KZI A;  3IJZ A;  4O1X A;  3EGY X;  4DPH A;  1TRG A;  1VZB A;  1JG0 A;  1TSL A;  3CL9 A;  4O1U A;  1VZC A;  4TMS A;  4FOG A;  4PSG A;  3DG8 C;  1NJE A;  2G86 A;  4DP3 A;  1B5D A;  5H38 A;  2FTQ A;  1TSN A;  1BKO A;  3BFI A;  2VF0 A;  1AXW A;  1BDU A;  4GEV A;  1SEJ A;  1TIS A;  2G8X A;  4E28 A;  4KY8 A;  1HW4 A;  1TSX A;  4G6W X;  3UWL A;  4O1X D;  5H39 A;  4F2V A;  3DL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...