1O7KA

Human p47 px domain complex with sulphates
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
HMGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL CYTOSOL FACTOR 1
publication title Binding of the Px Domain of P47Phox to Phosphatidylinositol 3.4-Bisphosphate and Phosphatidic Acid is Masked by an Intramolecular Interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 28
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 1o7kA00
2YPSA 3FOGA 4HASA 2L73A 4IKDA 4AKVA 3P0CA 4P2IA 4P2JA 4PQPA 1KMDA 3IQ2A 1XTNA 3HPBA 2AR5A 2REAA 2WWEA 3DYTA 4IKBB 4PZGA 1KQ6A 2I4KA 2CZOA 4PQOA 1XTEA 1GD5A 4ON3A 4IKBA 4OXWA 2CSKA 2RAJA 3HPCX 1O7KA 4BGJA 2IWLX 4AZ9A 2REDA 2RAIA 2V6VA 3LUIA 1OCUA 1H6HA 2ETTA 2V14A 1OCSA 2RAKA 2DYBA
chains in the Genus database with same CATH superfamily
2YPSA 3FOGA 4HASA 2L73A 4IKDA 4AKVA 3P0CA 4P2IA 4P2JA 4PQPA 1KMDA 3IQ2A 1XTNA 3HPBA 2AR5A 2REAA 2WWEA 3DYTA 4IKBB 4PZGA 1KQ6A 2I4KA 2CZOA 4PQOA 1XTEA 1GD5A 4ON3A 4IKBA 4OXWA 2CSKA 2RAJA 3HPCX 1O7KA 4BGJA 2IWLX 4AZ9A 2REDA 2RAIA 2V6VA 3LUIA 1OCUA 1H6HA 2ETTA 2V14A 1OCSA 2RAKA 2DYBA
chains in the Genus database with same CATH topology
2YPSA 3FOGA 4HASA 2L73A 4IKDA 4AKVA 3P0CA 4P2IA 4P2JA 4PQPA 1KMDA 3IQ2A 1XTNA 3HPBA 2AR5A 2REAA 2WWEA 3DYTA 4IKBB 4PZGA 1KQ6A 2I4KA 2CZOA 4PQOA 1XTEA 1GD5A 4ON3A 4IKBA 4OXWA 2CSKA 2RAJA 3HPCX 1O7KA 4BGJA 2IWLX 4AZ9A 2REDA 2RAIA 2V6VA 3LUIA 1OCUA 1H6HA 2ETTA 2V14A 1OCSA 2RAKA 2DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPS A;  3FOG A;  4HAS A;  2L73 A;  4IKD A;  4AKV A;  3P0C A;  4P2I A;  4P2J A;  4PQP A;  1KMD A;  3IQ2 A;  1XTN A;  3HPB A;  2AR5 A;  2REA A;  2WWE A;  3DYT A;  4IKB B;  4PZG A;  1KQ6 A;  2I4K A;  2CZO A;  4PQO A;  1XTE A;  1GD5 A;  4ON3 A;  4IKB A;  4OXW A;  2CSK A;  2RAJ A;  3HPC X;  1O7K A;  4BGJ A;  2IWL X;  4AZ9 A;  2RED A;  2RAI A;  2V6V A;  3LUI A;  1OCU A;  1H6H A;  2ETT A;  2V14 A;  1OCS A;  2RAK A;  2DYB A; 
#chains in the Genus database with same CATH topology
 2YPS A;  3FOG A;  4HAS A;  2L73 A;  4IKD A;  4AKV A;  3P0C A;  4P2I A;  4P2J A;  4PQP A;  1KMD A;  3IQ2 A;  1XTN A;  3HPB A;  2AR5 A;  2REA A;  2WWE A;  3DYT A;  4IKB B;  4PZG A;  1KQ6 A;  2I4K A;  2CZO A;  4PQO A;  1XTE A;  1GD5 A;  4ON3 A;  4IKB A;  4OXW A;  2CSK A;  2RAJ A;  3HPC X;  1O7K A;  4BGJ A;  2IWL X;  4AZ9 A;  2RED A;  2RAI A;  2V6V A;  3LUI A;  1OCU A;  1H6H A;  2ETT A;  2V14 A;  1OCS A;  2RAK A;  2DYB A; 
#chains in the Genus database with same CATH homology
 2YPS A;  3FOG A;  4HAS A;  2L73 A;  4IKD A;  4AKV A;  3P0C A;  4P2I A;  4P2J A;  4PQP A;  1KMD A;  3IQ2 A;  1XTN A;  3HPB A;  2AR5 A;  2REA A;  2WWE A;  3DYT A;  4IKB B;  4PZG A;  1KQ6 A;  2I4K A;  2CZO A;  4PQO A;  1XTE A;  1GD5 A;  4ON3 A;  4IKB A;  4OXW A;  2CSK A;  2RAJ A;  3HPC X;  1O7K A;  4BGJ A;  2IWL X;  4AZ9 A;  2RED A;  2RAI A;  2V6V A;  3LUI A;  1OCU A;  1H6H A;  2ETT A;  2V14 A;  1OCS A;  2RAK A;  2DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...