2V14A

Kinesin 16b phox-homology domain (kif16b)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
DLKDPIKISIPRYVLCGQGKDAHFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINESIN-LIKE MOTOR PROTEIN C20ORF23
publication title The Structural Basis of Novel Endosome Anchoring Activity of Kif16B Kinesin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 34
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2v14A00
4BGJA 1XTNA 2CSKA 4ON3A 2AR5A 2RAIA 1OCSA 4P2IA 2ETTA 4OXWA 1OCUA 3P0CA 3FOGA 1GD5A 4PQOA 3HPBA 1KQ6A 2RAKA 2WWEA 3IQ2A 4AZ9A 2REAA 4P2JA 4PQPA 2CZOA 2V6VA 1KMDA 2RAJA 2YPSA 2L73A 3DYTA 3LUIA 2REDA 4IKBA 2I4KA 2V14A 4HASA 4PZGA 1H6HA 4AKVA 2DYBA 1O7KA 2IWLX 1XTEA 4IKDA 4IKBB 3HPCX
chains in the Genus database with same CATH superfamily
4BGJA 1XTNA 2CSKA 4ON3A 2AR5A 2RAIA 1OCSA 4P2IA 2ETTA 4OXWA 1OCUA 3P0CA 3FOGA 1GD5A 4PQOA 3HPBA 1KQ6A 2RAKA 2WWEA 3IQ2A 4AZ9A 2REAA 4P2JA 4PQPA 2CZOA 2V6VA 1KMDA 2RAJA 2YPSA 2L73A 3DYTA 3LUIA 2REDA 4IKBA 2I4KA 2V14A 4HASA 4PZGA 1H6HA 4AKVA 2DYBA 1O7KA 2IWLX 1XTEA 4IKDA 4IKBB 3HPCX
chains in the Genus database with same CATH topology
4BGJA 1XTNA 2CSKA 4ON3A 2AR5A 2RAIA 1OCSA 4P2IA 2ETTA 4OXWA 1OCUA 3P0CA 3FOGA 1GD5A 4PQOA 3HPBA 1KQ6A 2RAKA 2WWEA 3IQ2A 4AZ9A 2REAA 4P2JA 4PQPA 2CZOA 2V6VA 1KMDA 2RAJA 2YPSA 2L73A 3DYTA 3LUIA 2REDA 4IKBA 2I4KA 2V14A 4HASA 4PZGA 1H6HA 4AKVA 2DYBA 1O7KA 2IWLX 1XTEA 4IKDA 4IKBB 3HPCX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGJ A;  1XTN A;  2CSK A;  4ON3 A;  2AR5 A;  2RAI A;  1OCS A;  4P2I A;  2ETT A;  4OXW A;  1OCU A;  3P0C A;  3FOG A;  1GD5 A;  4PQO A;  3HPB A;  1KQ6 A;  2RAK A;  2WWE A;  3IQ2 A;  4AZ9 A;  2REA A;  4P2J A;  4PQP A;  2CZO A;  2V6V A;  1KMD A;  2RAJ A;  2YPS A;  2L73 A;  3DYT A;  3LUI A;  2RED A;  4IKB A;  2I4K A;  2V14 A;  4HAS A;  4PZG A;  1H6H A;  4AKV A;  2DYB A;  1O7K A;  2IWL X;  1XTE A;  4IKD A;  4IKB B;  3HPC X; 
#chains in the Genus database with same CATH topology
 4BGJ A;  1XTN A;  2CSK A;  4ON3 A;  2AR5 A;  2RAI A;  1OCS A;  4P2I A;  2ETT A;  4OXW A;  1OCU A;  3P0C A;  3FOG A;  1GD5 A;  4PQO A;  3HPB A;  1KQ6 A;  2RAK A;  2WWE A;  3IQ2 A;  4AZ9 A;  2REA A;  4P2J A;  4PQP A;  2CZO A;  2V6V A;  1KMD A;  2RAJ A;  2YPS A;  2L73 A;  3DYT A;  3LUI A;  2RED A;  4IKB A;  2I4K A;  2V14 A;  4HAS A;  4PZG A;  1H6H A;  4AKV A;  2DYB A;  1O7K A;  2IWL X;  1XTE A;  4IKD A;  4IKB B;  3HPC X; 
#chains in the Genus database with same CATH homology
 4BGJ A;  1XTN A;  2CSK A;  4ON3 A;  2AR5 A;  2RAI A;  1OCS A;  4P2I A;  2ETT A;  4OXW A;  1OCU A;  3P0C A;  3FOG A;  1GD5 A;  4PQO A;  3HPB A;  1KQ6 A;  2RAK A;  2WWE A;  3IQ2 A;  4AZ9 A;  2REA A;  4P2J A;  4PQP A;  2CZO A;  2V6V A;  1KMD A;  2RAJ A;  2YPS A;  2L73 A;  3DYT A;  3LUI A;  2RED A;  4IKB A;  2I4K A;  2V14 A;  4HAS A;  4PZG A;  1H6H A;  4AKV A;  2DYB A;  1O7K A;  2IWL X;  1XTE A;  4IKD A;  4IKB B;  3HPC X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...