3P0CA

Nischarin px-domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
NLYFQSMEARVVGSELVDTYTVYIIQVTDGSHEWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nischarin
publication title Crystal structure of Nischarin PX-domain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3p0cA00
2V6VA 2WWEA 4PQPA 3HPBA 2RAKA 4BGJA 1GD5A 1XTNA 1XTEA 2RAJA 2DYBA 4P2JA 2YPSA 4ON3A 3LUIA 4AZ9A 1OCSA 4IKDA 4HASA 2IWLX 2RAIA 2V14A 2REDA 2CZOA 1KMDA 2REAA 3IQ2A 4IKBB 1KQ6A 2I4KA 4OXWA 3DYTA 4IKBA 3P0CA 2AR5A 1OCUA 4P2IA 1O7KA 4PQOA 3HPCX 4PZGA 1H6HA 2CSKA 2ETTA 4AKVA 2L73A 3FOGA
chains in the Genus database with same CATH superfamily
2V6VA 2WWEA 4PQPA 3HPBA 2RAKA 4BGJA 1GD5A 1XTNA 1XTEA 2RAJA 2DYBA 4P2JA 2YPSA 4ON3A 3LUIA 4AZ9A 1OCSA 4IKDA 4HASA 2IWLX 2RAIA 2V14A 2REDA 2CZOA 1KMDA 2REAA 3IQ2A 4IKBB 1KQ6A 2I4KA 4OXWA 3DYTA 4IKBA 3P0CA 2AR5A 1OCUA 4P2IA 1O7KA 4PQOA 3HPCX 4PZGA 1H6HA 2CSKA 2ETTA 4AKVA 2L73A 3FOGA
chains in the Genus database with same CATH topology
2V6VA 2WWEA 4PQPA 3HPBA 2RAKA 4BGJA 1GD5A 1XTNA 1XTEA 2RAJA 2DYBA 4P2JA 2YPSA 4ON3A 3LUIA 4AZ9A 1OCSA 4IKDA 4HASA 2IWLX 2RAIA 2V14A 2REDA 2CZOA 1KMDA 2REAA 3IQ2A 4IKBB 1KQ6A 2I4KA 4OXWA 3DYTA 4IKBA 3P0CA 2AR5A 1OCUA 4P2IA 1O7KA 4PQOA 3HPCX 4PZGA 1H6HA 2CSKA 2ETTA 4AKVA 2L73A 3FOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6V A;  2WWE A;  4PQP A;  3HPB A;  2RAK A;  4BGJ A;  1GD5 A;  1XTN A;  1XTE A;  2RAJ A;  2DYB A;  4P2J A;  2YPS A;  4ON3 A;  3LUI A;  4AZ9 A;  1OCS A;  4IKD A;  4HAS A;  2IWL X;  2RAI A;  2V14 A;  2RED A;  2CZO A;  1KMD A;  2REA A;  3IQ2 A;  4IKB B;  1KQ6 A;  2I4K A;  4OXW A;  3DYT A;  4IKB A;  3P0C A;  2AR5 A;  1OCU A;  4P2I A;  1O7K A;  4PQO A;  3HPC X;  4PZG A;  1H6H A;  2CSK A;  2ETT A;  4AKV A;  2L73 A;  3FOG A; 
#chains in the Genus database with same CATH topology
 2V6V A;  2WWE A;  4PQP A;  3HPB A;  2RAK A;  4BGJ A;  1GD5 A;  1XTN A;  1XTE A;  2RAJ A;  2DYB A;  4P2J A;  2YPS A;  4ON3 A;  3LUI A;  4AZ9 A;  1OCS A;  4IKD A;  4HAS A;  2IWL X;  2RAI A;  2V14 A;  2RED A;  2CZO A;  1KMD A;  2REA A;  3IQ2 A;  4IKB B;  1KQ6 A;  2I4K A;  4OXW A;  3DYT A;  4IKB A;  3P0C A;  2AR5 A;  1OCU A;  4P2I A;  1O7K A;  4PQO A;  3HPC X;  4PZG A;  1H6H A;  2CSK A;  2ETT A;  4AKV A;  2L73 A;  3FOG A; 
#chains in the Genus database with same CATH homology
 2V6V A;  2WWE A;  4PQP A;  3HPB A;  2RAK A;  4BGJ A;  1GD5 A;  1XTN A;  1XTE A;  2RAJ A;  2DYB A;  4P2J A;  2YPS A;  4ON3 A;  3LUI A;  4AZ9 A;  1OCS A;  4IKD A;  4HAS A;  2IWL X;  2RAI A;  2V14 A;  2RED A;  2CZO A;  1KMD A;  2REA A;  3IQ2 A;  4IKB B;  1KQ6 A;  2I4K A;  4OXW A;  3DYT A;  4IKB A;  3P0C A;  2AR5 A;  1OCU A;  4P2I A;  1O7K A;  4PQO A;  3HPC X;  4PZG A;  1H6H A;  2CSK A;  2ETT A;  4AKV A;  2L73 A;  3FOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...