4IKDA

Crystal structure of snx11 px domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
142
Chain Sequence
QEQEEVITVRVQDPRVQNEGSWNSYVDYIFLHTNSAFTATSCVRRRYREFVWLRQLQRNAGLVPVPELPGTFFGTSDEFIERRQGLQHFLEVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-11
publication title Structure of Sorting Nexin 11 (SNX11) Reveals a Novel Extended PX Domain (PXe Domain) Critical for the Inhibition of Sorting Nexin 10 (SNX10) Induced Vacuolation
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 39
structure length 142
sequence length 150
ec nomenclature
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4ikdA00
2DYBA 4AKVA 2RAIA 2RAJA 3IQ2A 3LUIA 2YPSA 4AZ9A 2CSKA 4ON3A 2RAKA 4IKDA 1OCUA 3P0CA 4PQPA 2WWEA 2I4KA 1KMDA 1GD5A 2L73A 2V6VA 1XTEA 2REAA 1XTNA 4OXWA 4PZGA 2AR5A 2V14A 2REDA 4BGJA 2IWLX 1H6HA 3HPCX 3DYTA 4IKBA 2ETTA 4IKBB 3FOGA 4P2JA 4HASA 4P2IA 1OCSA 1O7KA 1KQ6A 3HPBA 4PQOA 2CZOA
chains in the Genus database with same CATH superfamily
2DYBA 4AKVA 2RAIA 2RAJA 3IQ2A 3LUIA 2YPSA 4AZ9A 2CSKA 4ON3A 2RAKA 4IKDA 1OCUA 3P0CA 4PQPA 2WWEA 2I4KA 1KMDA 1GD5A 2L73A 2V6VA 1XTEA 2REAA 1XTNA 4OXWA 4PZGA 2AR5A 2V14A 2REDA 4BGJA 2IWLX 1H6HA 3HPCX 3DYTA 4IKBA 2ETTA 4IKBB 3FOGA 4P2JA 4HASA 4P2IA 1OCSA 1O7KA 1KQ6A 3HPBA 4PQOA 2CZOA
chains in the Genus database with same CATH topology
2DYBA 4AKVA 2RAIA 2RAJA 3IQ2A 3LUIA 2YPSA 4AZ9A 2CSKA 4ON3A 2RAKA 4IKDA 1OCUA 3P0CA 4PQPA 2WWEA 2I4KA 1KMDA 1GD5A 2L73A 2V6VA 1XTEA 2REAA 1XTNA 4OXWA 4PZGA 2AR5A 2V14A 2REDA 4BGJA 2IWLX 1H6HA 3HPCX 3DYTA 4IKBA 2ETTA 4IKBB 3FOGA 4P2JA 4HASA 4P2IA 1OCSA 1O7KA 1KQ6A 3HPBA 4PQOA 2CZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  4AKV A;  2RAI A;  2RAJ A;  3IQ2 A;  3LUI A;  2YPS A;  4AZ9 A;  2CSK A;  4ON3 A;  2RAK A;  4IKD A;  1OCU A;  3P0C A;  4PQP A;  2WWE A;  2I4K A;  1KMD A;  1GD5 A;  2L73 A;  2V6V A;  1XTE A;  2REA A;  1XTN A;  4OXW A;  4PZG A;  2AR5 A;  2V14 A;  2RED A;  4BGJ A;  2IWL X;  1H6H A;  3HPC X;  3DYT A;  4IKB A;  2ETT A;  4IKB B;  3FOG A;  4P2J A;  4HAS A;  4P2I A;  1OCS A;  1O7K A;  1KQ6 A;  3HPB A;  4PQO A;  2CZO A; 
#chains in the Genus database with same CATH topology
 2DYB A;  4AKV A;  2RAI A;  2RAJ A;  3IQ2 A;  3LUI A;  2YPS A;  4AZ9 A;  2CSK A;  4ON3 A;  2RAK A;  4IKD A;  1OCU A;  3P0C A;  4PQP A;  2WWE A;  2I4K A;  1KMD A;  1GD5 A;  2L73 A;  2V6V A;  1XTE A;  2REA A;  1XTN A;  4OXW A;  4PZG A;  2AR5 A;  2V14 A;  2RED A;  4BGJ A;  2IWL X;  1H6H A;  3HPC X;  3DYT A;  4IKB A;  2ETT A;  4IKB B;  3FOG A;  4P2J A;  4HAS A;  4P2I A;  1OCS A;  1O7K A;  1KQ6 A;  3HPB A;  4PQO A;  2CZO A; 
#chains in the Genus database with same CATH homology
 2DYB A;  4AKV A;  2RAI A;  2RAJ A;  3IQ2 A;  3LUI A;  2YPS A;  4AZ9 A;  2CSK A;  4ON3 A;  2RAK A;  4IKD A;  1OCU A;  3P0C A;  4PQP A;  2WWE A;  2I4K A;  1KMD A;  1GD5 A;  2L73 A;  2V6V A;  1XTE A;  2REA A;  1XTN A;  4OXW A;  4PZG A;  2AR5 A;  2V14 A;  2RED A;  4BGJ A;  2IWL X;  1H6H A;  3HPC X;  3DYT A;  4IKB A;  2ETT A;  4IKB B;  3FOG A;  4P2J A;  4HAS A;  4P2I A;  1OCS A;  1O7K A;  1KQ6 A;  3HPB A;  4PQO A;  2CZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...