2RAIA

The px-bar membrane remodeling unit of sorting nexin 9
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
382
structure length
363
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Sorting nexin-9
total genus 118
structure length 363
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2raiA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2raiA02
2FICA 4WPCA 3FOGA 4PZGA 4DCNC 4NQIA 4IKBB 2X3XA 2I4KA 1O7KA 1I4DA 1ZWWA 2DYBA 1Y2OA 2V0OA 3OK8A 2V6VA 2CSKA 4PQOA 2D4CA 4FZSA 3HAIA 3LUIA 2V14A 4NSWA 3I2WA 1KMDA 2RAJA 2Q13A 3PLTA 2RAIA 2X3VA 4I1QA 1GD5A 1X03A 2D1LA 3HPBA 4WPEA 4OXWA 3DYTA 4AKVA 1I49A 3SYVA 2RAKA 2YKTA 4IKBA 2Z0NA 2X3WA 5C5BB 4ATMA 2EFKA 1OCSA 3ACOA 3HPCX 4AZ9A 3QNIA 1H6HA 4H8SA 1XTNA 2Z0OA 3ABHA 3Q0KA 2Z0VA 2ELBA 3M3WA 2IWLX 3QE6A 3Q84A 1KQ6A 4DYLA 3SOGA 1I4TA 2C08A 4BGJA 1WDZA 3LLLA 1I4LA 2AR5A 3HAHA 4BNEA 4P2IA 2CZOA 2WWEA 3HAJA 2L73A 3IQ2A 4IKDA 4PQPA 2YPSA 4HASA 4ON3A 3CAZA 2REDA 4P2JA 1OCUA 1XTEA 2EFLA 4AVMA 5C5BA 3QWEA 2REAA 3G9GA 1X04A 1URUA 2ETTA 3P0CA 2Q12A
chains in the Genus database with same CATH superfamily
3FD9A 1MJGA 4AZ5A 2FICA 3CZSA 3VKHA 2YIBA 3CV5A 1I4DA 4IWQA 2DYBA 1Y2OA 2OBLA 4M0MA 4IWPA 2MI7A 4IM2A 4G6QA 3CKDA 2V14A 3RPMA 2O0I1 3DX3A 4NSWA 4EZSA 1QWNA 4FM3A 2GAFD 1GNTA 1E2UA 3PLTA 2RAIA 1HTYA 3EJRA 4JWIA 3D51A 1X03A 2QFFA 4AZ7A 3SYVA 2RAKA 4B9QA 4IKBA 4IW0A 4EZPA 1DKZA 2YLAA 5TKYA 5C5BB 1OA1A 4ATMA 3I01A 2WYHA 3BUIA 4AZ6A 4AZ9A 3QNIA 3ABHA 3OHXM 2IWLX 3Q84A 2PY6A 1TQUA 3SOGA 4BGJA 2F1BA 3RV1A 1W9MA 4AZCB 2YL8A 2AR5A 2OBMA 4P2IA 2CZOA 2WWEA 4F01A 4KIKB 2OZNB 4HR1B 4HASA 3T47A 2QXLA 3D2FA 4EZZA 2GF4A 2REDA 4P2JA 3EJUA 1OCUA 4D8JA 3BUPA 5C5BA 4E81A 4UDXX 2REAA 3DPPA 3G9GA 1X04A 3RV0A 4R5KA 2Q12A 4R5IA 4WPCA 3FOGA 2X3XA 2I4KA 4KIKA 4HR1A 5FIGA 2V6VA 4PQOA 3ER9B 3DX4A 1SU6A 2QKWA 4EZYA 4JLCA 4FZPA 2RAJA 3EJTA 2GA9D 1QX1A 1GN9A 1OA0A 4EZWA 3BVXA 2X3VA 3DX0A 4IM3A 2ND1A 1GD5A 4F00A 1UPXA 3HPBA 4WPEA 2F18A 3DYTA 4JWCA 3T4AG 2ND0A 1R5EA 2EFKA 3ACOA 1DKYA 4EZRA 4H8SA 1XTNA 1OAOA 1JQKA 2ELBA 3C7NA 1KQ6A 2YL5A 4DYLA 2RT6A 2JNKA 4AZGA 3DX2A 2C08A 4EZNA 1WDZA 3I39X 4EZVA 4JWDA 4JNFA 2X5CA 4PO2A 2YIVX 2YIAA 2YI9A 4EZTA 4AVMA 3QWEA 2NCZA 4R5LA 3GI7A 2FYVA 4H6IA 3OWGA 1R33A 4DCNC 2YL9A 4NQIA 3ERCC 4IWOA 1DKXA 1GNLA 1O7KA 1ZWWA 2V0OA 2CSKA 3EJSA 3T49A 2D4CA 3HAIA 3CVRA 3I2WA 1KMDA 2Q13A 2WINM 4EZQA 1TQWA 3DX1A 2D1LA 3A98A 5E84A 3L3PA 4AKVA 3BUBA 3CZNA 5KBPA 3LVTA 4JNEA 2X3WA 3B53X 1PS3A 1SUFA 2F7RA 5FLEX 3VEAA 3HPCX 2KHOA 2OW7A 1H6HA 4E3CA 3T46A 1R34A 3O3MB 3Q0KA 1E1DA 4HY9A 3M3WA 1E9VA 3B51X 2LM0A 1O7DC 3LMFA 4JN4A 3ZEDA 1I4LA 3BUDA 4BNEA 3HAJA 3IQ2A 1SU7A 4PQPA 3BVUA 3CAZA 2F7QA 1XTEA 2EFLA 2PMRA 1ZYLA 4FZOA 3BLBA 3D50A 3KAVA 4IM0A 1URUA 2ETTA 2F1AA 3O3OB 3P0CA 1HXKA 3D2EA 4PZGA 4R5GA 2ALWA 4IKBB 1LQ7A 2EWFA 3QA8A 2F7PA 3OK8A 1QWUA 2JNSA 1O7DB 2Z8YA 4FZSA 3LUIA 3DPQA 4JL9A 2LXYA 3EJPA 1SU8A 4HYBA 4I1QA 2OO2A 3D4YA 4OXWA 3F7WA 1I49A 2YI8A 3BVTA 2ZXQA 3L3OM 2YKTA 3DDFA 4AZHA 2Z0NA 3BVVA 3EJQA 2OW6A 3QNJA 1OCSA 4AZBA 4H6HA 3DPOA 4EZUA 2YL6A 3I04A 4EZOA 4NPHA 3B52X 2Z0OA 4UDYX 2Z0VA 3D4ZA 3O3NB 3QE6A 3KDRA 3UITA 1I4TA 4EZXA 3KAWA 3LLLA 3ER8C 2WYIA 3BUQA 3HAHA 2YLLA 1HWWA 1TQSA 4R5JA 2EX3B 1TQVA 3BVWA 2L73A 4IKDA 1TQTA 4JWEA 2YPSA 4ON3A 1U00A 3VEBA 2N3KA 4AZIA 1YWMA 3DDGA 4AZCA 3T48A 3D52A 2F7OA
chains in the Genus database with same CATH topology
2FICA 4WPCA 3FOGA 4PZGA 4DCNC 4NQIA 4IKBB 2X3XA 2I4KA 1O7KA 1I4DA 1ZWWA 2DYBA 1Y2OA 2V0OA 3OK8A 2V6VA 2CSKA 4PQOA 2D4CA 4FZSA 3HAIA 3LUIA 2V14A 4NSWA 3I2WA 1KMDA 2RAJA 2Q13A 3PLTA 2RAIA 2X3VA 4I1QA 1GD5A 1X03A 2D1LA 3HPBA 4WPEA 4OXWA 3DYTA 4AKVA 1I49A 3SYVA 2RAKA 2YKTA 4IKBA 2Z0NA 2X3WA 5C5BB 4ATMA 2EFKA 1OCSA 3ACOA 3HPCX 4AZ9A 3QNIA 1H6HA 4H8SA 1XTNA 2Z0OA 3ABHA 3Q0KA 2Z0VA 2ELBA 3M3WA 2IWLX 3QE6A 3Q84A 1KQ6A 4DYLA 3SOGA 1I4TA 2C08A 4BGJA 1WDZA 3LLLA 1I4LA 2AR5A 3HAHA 4BNEA 4P2IA 2CZOA 2WWEA 3HAJA 2L73A 3IQ2A 4IKDA 4PQPA 2YPSA 4HASA 4ON3A 3CAZA 2REDA 4P2JA 1OCUA 1XTEA 2EFLA 4AVMA 5C5BA 3QWEA 2REAA 3G9GA 1X04A 1URUA 2ETTA 3P0CA 2Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIC A;  4WPC A;  3FOG A;  4PZG A;  4DCN C;  4NQI A;  4IKB B;  2X3X A;  2I4K A;  1O7K A;  1I4D A;  1ZWW A;  2DYB A;  1Y2O A;  2V0O A;  3OK8 A;  2V6V A;  2CSK A;  4PQO A;  2D4C A;  4FZS A;  3HAI A;  3LUI A;  2V14 A;  4NSW A;  3I2W A;  1KMD A;  2RAJ A;  2Q13 A;  3PLT A;  2RAI A;  2X3V A;  4I1Q A;  1GD5 A;  1X03 A;  2D1L A;  3HPB A;  4WPE A;  4OXW A;  3DYT A;  4AKV A;  1I49 A;  3SYV A;  2RAK A;  2YKT A;  4IKB A;  2Z0N A;  2X3W A;  5C5B B;  4ATM A;  2EFK A;  1OCS A;  3ACO A;  3HPC X;  4AZ9 A;  3QNI A;  1H6H A;  4H8S A;  1XTN A;  2Z0O A;  3ABH A;  3Q0K A;  2Z0V A;  2ELB A;  3M3W A;  2IWL X;  3QE6 A;  3Q84 A;  1KQ6 A;  4DYL A;  3SOG A;  1I4T A;  2C08 A;  4BGJ A;  1WDZ A;  3LLL A;  1I4L A;  2AR5 A;  3HAH A;  4BNE A;  4P2I A;  2CZO A;  2WWE A;  3HAJ A;  2L73 A;  3IQ2 A;  4IKD A;  4PQP A;  2YPS A;  4HAS A;  4ON3 A;  3CAZ A;  2RED A;  4P2J A;  1OCU A;  1XTE A;  2EFL A;  4AVM A;  5C5B A;  3QWE A;  2REA A;  3G9G A;  1X04 A;  1URU A;  2ETT A;  3P0C A;  2Q12 A; 
#chains in the Genus database with same CATH topology
 3FD9 A;  1MJG A;  4AZ5 A;  2FIC A;  3CZS A;  3VKH A;  2YIB A;  3CV5 A;  1I4D A;  4IWQ A;  2DYB A;  1Y2O A;  2OBL A;  4M0M A;  4IWP A;  2MI7 A;  4IM2 A;  4G6Q A;  3CKD A;  2V14 A;  3RPM A;  2O0I 1;  3DX3 A;  4NSW A;  4EZS A;  1QWN A;  4FM3 A;  2GAF D;  1GNT A;  1E2U A;  3PLT A;  2RAI A;  1HTY A;  3EJR A;  4JWI A;  3D51 A;  1X03 A;  2QFF A;  4AZ7 A;  3SYV A;  2RAK A;  4B9Q A;  4IKB A;  4IW0 A;  4EZP A;  1DKZ A;  2YLA A;  5TKY A;  5C5B B;  1OA1 A;  4ATM A;  3I01 A;  2WYH A;  3BUI A;  4AZ6 A;  4AZ9 A;  3QNI A;  3ABH A;  3OHX M;  2IWL X;  3Q84 A;  2PY6 A;  1TQU A;  3SOG A;  4BGJ A;  2F1B A;  3RV1 A;  1W9M A;  4AZC B;  2YL8 A;  2AR5 A;  2OBM A;  4P2I A;  2CZO A;  2WWE A;  4F01 A;  4KIK B;  2OZN B;  4HR1 B;  4HAS A;  3T47 A;  2QXL A;  3D2F A;  4EZZ A;  2GF4 A;  2RED A;  4P2J A;  3EJU A;  1OCU A;  4D8J A;  3BUP A;  5C5B A;  4E81 A;  4UDX X;  2REA A;  3DPP A;  3G9G A;  1X04 A;  3RV0 A;  4R5K A;  2Q12 A;  4R5I A;  4WPC A;  3FOG A;  2X3X A;  2I4K A;  4KIK A;  4HR1 A;  5FIG A;  2V6V A;  4PQO A;  3ER9 B;  3DX4 A;  1SU6 A;  2QKW A;  4EZY A;  4JLC A;  4FZP A;  2RAJ A;  3EJT A;  2GA9 D;  1QX1 A;  1GN9 A;  1OA0 A;  4EZW A;  3BVX A;  2X3V A;  3DX0 A;  4IM3 A;  2ND1 A;  1GD5 A;  4F00 A;  1UPX A;  3HPB A;  4WPE A;  2F18 A;  3DYT A;  4JWC A;  3T4A G;  2ND0 A;  1R5E A;  2EFK A;  3ACO A;  1DKY A;  4EZR A;  4H8S A;  1XTN A;  1OAO A;  1JQK A;  2ELB A;  3C7N A;  1KQ6 A;  2YL5 A;  4DYL A;  2RT6 A;  2JNK A;  4AZG A;  3DX2 A;  2C08 A;  4EZN A;  1WDZ A;  3I39 X;  4EZV A;  4JWD A;  4JNF A;  2X5C A;  4PO2 A;  2YIV X;  2YIA A;  2YI9 A;  4EZT A;  4AVM A;  3QWE A;  2NCZ A;  4R5L A;  3GI7 A;  2FYV A;  4H6I A;  3OWG A;  1R33 A;  4DCN C;  2YL9 A;  4NQI A;  3ERC C;  4IWO A;  1DKX A;  1GNL A;  1O7K A;  1ZWW A;  2V0O A;  2CSK A;  3EJS A;  3T49 A;  2D4C A;  3HAI A;  3CVR A;  3I2W A;  1KMD A;  2Q13 A;  2WIN M;  4EZQ A;  1TQW A;  3DX1 A;  2D1L A;  3A98 A;  5E84 A;  3L3P A;  4AKV A;  3BUB A;  3CZN A;  5KBP A;  3LVT A;  4JNE A;  2X3W A;  3B53 X;  1PS3 A;  1SUF A;  2F7R A;  5FLE X;  3VEA A;  3HPC X;  2KHO A;  2OW7 A;  1H6H A;  4E3C A;  3T46 A;  1R34 A;  3O3M B;  3Q0K A;  1E1D A;  4HY9 A;  3M3W A;  1E9V A;  3B51 X;  2LM0 A;  1O7D C;  3LMF A;  4JN4 A;  3ZED A;  1I4L A;  3BUD A;  4BNE A;  3HAJ A;  3IQ2 A;  1SU7 A;  4PQP A;  3BVU A;  3CAZ A;  2F7Q A;  1XTE A;  2EFL A;  2PMR A;  1ZYL A;  4FZO A;  3BLB A;  3D50 A;  3KAV A;  4IM0 A;  1URU A;  2ETT A;  2F1A A;  3O3O B;  3P0C A;  1HXK A;  3D2E A;  4PZG A;  4R5G A;  2ALW A;  4IKB B;  1LQ7 A;  2EWF A;  3QA8 A;  2F7P A;  3OK8 A;  1QWU A;  2JNS A;  1O7D B;  2Z8Y A;  4FZS A;  3LUI A;  3DPQ A;  4JL9 A;  2LXY A;  3EJP A;  1SU8 A;  4HYB A;  4I1Q A;  2OO2 A;  3D4Y A;  4OXW A;  3F7W A;  1I49 A;  2YI8 A;  3BVT A;  2ZXQ A;  3L3O M;  2YKT A;  3DDF A;  4AZH A;  2Z0N A;  3BVV A;  3EJQ A;  2OW6 A;  3QNJ A;  1OCS A;  4AZB A;  4H6H A;  3DPO A;  4EZU A;  2YL6 A;  3I04 A;  4EZO A;  4NPH A;  3B52 X;  2Z0O A;  4UDY X;  2Z0V A;  3D4Z A;  3O3N B;  3QE6 A;  3KDR A;  3UIT A;  1I4T A;  4EZX A;  3KAW A;  3LLL A;  3ER8 C;  2WYI A;  3BUQ A;  3HAH A;  2YLL A;  1HWW A;  1TQS A;  4R5J A;  2EX3 B;  1TQV A;  3BVW A;  2L73 A;  4IKD A;  1TQT A;  4JWE A;  2YPS A;  4ON3 A;  1U00 A;  3VEB A;  2N3K A;  4AZI A;  1YWM A;  3DDG A;  4AZC A;  3T48 A;  3D52 A;  2F7O A; 
#chains in the Genus database with same CATH homology
 2FIC A;  4WPC A;  3FOG A;  4PZG A;  4DCN C;  4NQI A;  4IKB B;  2X3X A;  2I4K A;  1O7K A;  1I4D A;  1ZWW A;  2DYB A;  1Y2O A;  2V0O A;  3OK8 A;  2V6V A;  2CSK A;  4PQO A;  2D4C A;  4FZS A;  3HAI A;  3LUI A;  2V14 A;  4NSW A;  3I2W A;  1KMD A;  2RAJ A;  2Q13 A;  3PLT A;  2RAI A;  2X3V A;  4I1Q A;  1GD5 A;  1X03 A;  2D1L A;  3HPB A;  4WPE A;  4OXW A;  3DYT A;  4AKV A;  1I49 A;  3SYV A;  2RAK A;  2YKT A;  4IKB A;  2Z0N A;  2X3W A;  5C5B B;  4ATM A;  2EFK A;  1OCS A;  3ACO A;  3HPC X;  4AZ9 A;  3QNI A;  1H6H A;  4H8S A;  1XTN A;  2Z0O A;  3ABH A;  3Q0K A;  2Z0V A;  2ELB A;  3M3W A;  2IWL X;  3QE6 A;  3Q84 A;  1KQ6 A;  4DYL A;  3SOG A;  1I4T A;  2C08 A;  4BGJ A;  1WDZ A;  3LLL A;  1I4L A;  2AR5 A;  3HAH A;  4BNE A;  4P2I A;  2CZO A;  2WWE A;  3HAJ A;  2L73 A;  3IQ2 A;  4IKD A;  4PQP A;  2YPS A;  4HAS A;  4ON3 A;  3CAZ A;  2RED A;  4P2J A;  1OCU A;  1XTE A;  2EFL A;  4AVM A;  5C5B A;  3QWE A;  2REA A;  3G9G A;  1X04 A;  1URU A;  2ETT A;  3P0C A;  2Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...