2RAIA

The px-bar membrane remodeling unit of sorting nexin 9
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
382
structure length
363
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 118
structure length 363
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2raiA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2raiA02
3P0CA 2V0OA 1I4DA 2X3VA 2Z0VA 2C08A 2D1LA 4I1QA 2EFLA 4DYLA 2IWLX 2ETTA 1Y2OA 3HPCX 2DYBA 4ATMA 4BNEA 2Z0NA 3I2WA 2X3WA 4PQPA 4PQOA 3ACOA 4AZ9A 5C5BA 3SYVA 1URUA 2YKTA 4DCNC 2V6VA 3IQ2A 3HAHA 3PLTA 3LUIA 1GD5A 2RAIA 2I4KA 4P2JA 1WDZA 4OXWA 3Q84A 3Q0KA 4NSWA 3QWEA 2D4CA 2FICA 2L73A 2V14A 2AR5A 3G9GA 4FZSA 2Z0OA 4AVMA 2CZOA 3QE6A 4IKBB 2Q13A 3FOGA 2EFKA 1O7KA 1OCUA 4ON3A 1I4LA 3DYTA 1KQ6A 1OCSA 2WWEA 4P2IA 2RAKA 4AKVA 3ABHA 4WPCA 1I4TA 4NQIA 2RAJA 2CSKA 2REDA 1X03A 2X3XA 1I49A 3QNIA 2REAA 3SOGA 5C5BB 4BGJA 2ELBA 4WPEA 3HAIA 3M3WA 4HASA 4IKDA 2YPSA 1KMDA 4PZGA 3LLLA 1XTNA 2Q12A 3HAJA 1H6HA 1XTEA 4IKBA 3CAZA 3HPBA 4H8SA 3OK8A 1X04A 1ZWWA
chains in the Genus database with same CATH superfamily
1R34A 2Z0VA 5TKYA 2C08A 4HR1B 4I1QA 3L3PA 3HPCX 2DYBA 4ATMA 3BVTA 4EZNA 2LXYA 3I2WA 3BUBA 4AZ9A 2Z8YA 1HXKA 3O3OB 4AZCA 2V6VA 1GD5A 3FD9A 2O0I1 3CVRA 4OXWA 2JNSA 2QFFA 3D51A 3QWEA 3OHXM 1ZYLA 2FICA 2V14A 2Z0OA 3RPMA 3QE6A 1O7DB 4AZ7A 4EZQA 2ND0A 1OCUA 1I4LA 2JNKA 3D4YA 1GNLA 2RAKA 1GN9A 2QXLA 2KHOA 3KAVA 4WPCA 4E3CA 1I4TA 3BUIA 4R5KA 3BLBA 4EZXA 3A98A 1O7DC 3CZNA 4HR1A 4FM3A 4AZ5A 2OO2A 4EZWA 3T48A 3KDRA 1SU8A 4EZTA 3LLLA 3T46A 2Q12A 1MJGA 1U00A 1H6HA 1JQKA 3DDFA 2GA9D 3EJTA 4F00A 3CAZA 4R5IA 3BVXA 3DX0A 1SU6A 1TQVA 1SU7A 3P0CA 2FYVA 4JWDA 1QX1A 3QA8A 4DYLA 5FIGA 2OZNB 2YLAA 3T47A 3CKDA 4BNEA 5E84A 2YIBA 4PQPA 4PQOA 4EZOA 5C5BA 4B9QA 2GAFD 4KIKA 4EZRA 4FZPA 1QWUA 2YLLA 3ERCC 3Q84A 2EWFA 1GNTA 1HWWA 3EJPA 1OAOA 4JWIA 4FZOA 2QKWA 3VEAA 2PY6A 1E2UA 4JLCA 4G6QA 3DYTA 1OCSA 4P2IA 4JL9A 4NQIA 4AZ6A 2ZXQA 2CSKA 1YWMA 2REDA 1X03A 2X3XA 1TQSA 3RV0A 2YL8A 3BVVA 3BUDA 3GI7A 3UITA 4IM0A 1R5EA 2REAA 5FLEX 4AZHA 2MI7A 2F1AA 3D2FA 5C5BB 2ELBA 4E81A 3BVUA 4IKDA 3BVWA 1QWNA 4KIKB 4IM3A 2OW6A 4IKBA 3DDGA 3OWGA 3OK8A 1SUFA 2V0OA 4R5JA 2X3VA 3ER9B 3ZEDA 2YI9A 4H6IA 4H6HA 1R33A 2ETTA 1Y2OA 2YI8A 3B53X 2Z0NA 3ACOA 2F1BA 3SYVA 4IWQA 2YKTA 2LM0A 1OA1A 3HAHA 1DKXA 3LUIA 2RT6A 1TQTA 3C7NA 4JNEA 4IWPA 2X5CA 4NSWA 2F7OA 3T4AG 2AR5A 3G9GA 4FZSA 4JN4A 2YIVX 3KAWA 4AVMA 4IKBB 3FOGA 1E1DA 1W9MA 2EFKA 1O7KA 2OBMA 4D8JA 1KQ6A 3D52A 2WWEA 3DX4A 4M0MA 3B51X 4JNFA 3ABHA 4IWOA 3RV1A 1TQUA 3EJRA 2RAJA 3F7WA 4F01A 1I49A 4JWEA 1PS3A 3SOGA 4AZBA 4BGJA 4EZPA 1KMDA 2F7QA 1DKZA 3EJQA 4EZYA 4IM2A 4EZUA 2NCZA 1XTEA 3QNJA 4H8SA 1ZWWA 2YIAA 3DPQA 4EZVA 1I4DA 2PMRA 2D1LA 1UPXA 2EFLA 3DX1A 2IWLX 3D4ZA 1E9VA 4AZIA 4PO2A 3DX2A 2X3WA 3I39X 3EJSA 1URUA 2OBLA 3B52X 4DCNC 3IQ2A 2YL9A 3PLTA 2RAIA 3VKHA 4EZSA 2YL5A 2I4KA 4IW0A 2WINM 4P2JA 1WDZA 3Q0KA 2WYHA 2D4CA 3VEBA 1HTYA 2L73A 3ER8C 3BUQA 3I01A 4R5LA 2EX3B 2CZOA 4UDYX 1TQWA 2Q13A 2F7PA 3LVTA 2F18A 2N3KA 4HY9A 4AZCB 3EJUA 4ON3A 3L3OM 1LQ7A 3O3MB 3O3NB 3DPPA 4AZGA 2OW7A 4AKVA 3D2EA 2YL6A 4HYBA 4JWCA 1OA0A 2ALWA 3BUPA 3QNIA 3CZSA 4UDXX 4WPEA 5KBPA 3HAIA 3M3WA 4HASA 3D50A 2YPSA 1DKYA 4PZGA 3T49A 2F7RA 2WYIA 3I04A 1XTNA 3HAJA 3DX3A 4NPHA 3DPOA 2ND1A 3CV5A 4R5GA 3HPBA 2GF4A 1X04A 3LMFA 4EZZA
chains in the Genus database with same CATH topology
3P0CA 2V0OA 1I4DA 2X3VA 2Z0VA 2C08A 2D1LA 4I1QA 2EFLA 4DYLA 2IWLX 2ETTA 1Y2OA 3HPCX 2DYBA 4ATMA 4BNEA 2Z0NA 3I2WA 2X3WA 4PQPA 4PQOA 3ACOA 4AZ9A 5C5BA 3SYVA 1URUA 2YKTA 4DCNC 2V6VA 3IQ2A 3HAHA 3PLTA 3LUIA 1GD5A 2RAIA 2I4KA 4P2JA 1WDZA 4OXWA 3Q84A 3Q0KA 4NSWA 3QWEA 2D4CA 2FICA 2L73A 2V14A 2AR5A 3G9GA 4FZSA 2Z0OA 4AVMA 2CZOA 3QE6A 4IKBB 2Q13A 3FOGA 2EFKA 1O7KA 1OCUA 4ON3A 1I4LA 3DYTA 1KQ6A 1OCSA 2WWEA 4P2IA 2RAKA 4AKVA 3ABHA 4WPCA 1I4TA 4NQIA 2RAJA 2CSKA 2REDA 1X03A 2X3XA 1I49A 3QNIA 2REAA 3SOGA 5C5BB 4BGJA 2ELBA 4WPEA 3HAIA 3M3WA 4HASA 4IKDA 2YPSA 1KMDA 4PZGA 3LLLA 1XTNA 2Q12A 3HAJA 1H6HA 1XTEA 4IKBA 3CAZA 3HPBA 4H8SA 3OK8A 1X04A 1ZWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P0C A;  2V0O A;  1I4D A;  2X3V A;  2Z0V A;  2C08 A;  2D1L A;  4I1Q A;  2EFL A;  4DYL A;  2IWL X;  2ETT A;  1Y2O A;  3HPC X;  2DYB A;  4ATM A;  4BNE A;  2Z0N A;  3I2W A;  2X3W A;  4PQP A;  4PQO A;  3ACO A;  4AZ9 A;  5C5B A;  3SYV A;  1URU A;  2YKT A;  4DCN C;  2V6V A;  3IQ2 A;  3HAH A;  3PLT A;  3LUI A;  1GD5 A;  2RAI A;  2I4K A;  4P2J A;  1WDZ A;  4OXW A;  3Q84 A;  3Q0K A;  4NSW A;  3QWE A;  2D4C A;  2FIC A;  2L73 A;  2V14 A;  2AR5 A;  3G9G A;  4FZS A;  2Z0O A;  4AVM A;  2CZO A;  3QE6 A;  4IKB B;  2Q13 A;  3FOG A;  2EFK A;  1O7K A;  1OCU A;  4ON3 A;  1I4L A;  3DYT A;  1KQ6 A;  1OCS A;  2WWE A;  4P2I A;  2RAK A;  4AKV A;  3ABH A;  4WPC A;  1I4T A;  4NQI A;  2RAJ A;  2CSK A;  2RED A;  1X03 A;  2X3X A;  1I49 A;  3QNI A;  2REA A;  3SOG A;  5C5B B;  4BGJ A;  2ELB A;  4WPE A;  3HAI A;  3M3W A;  4HAS A;  4IKD A;  2YPS A;  1KMD A;  4PZG A;  3LLL A;  1XTN A;  2Q12 A;  3HAJ A;  1H6H A;  1XTE A;  4IKB A;  3CAZ A;  3HPB A;  4H8S A;  3OK8 A;  1X04 A;  1ZWW A; 
#chains in the Genus database with same CATH topology
 1R34 A;  2Z0V A;  5TKY A;  2C08 A;  4HR1 B;  4I1Q A;  3L3P A;  3HPC X;  2DYB A;  4ATM A;  3BVT A;  4EZN A;  2LXY A;  3I2W A;  3BUB A;  4AZ9 A;  2Z8Y A;  1HXK A;  3O3O B;  4AZC A;  2V6V A;  1GD5 A;  3FD9 A;  2O0I 1;  3CVR A;  4OXW A;  2JNS A;  2QFF A;  3D51 A;  3QWE A;  3OHX M;  1ZYL A;  2FIC A;  2V14 A;  2Z0O A;  3RPM A;  3QE6 A;  1O7D B;  4AZ7 A;  4EZQ A;  2ND0 A;  1OCU A;  1I4L A;  2JNK A;  3D4Y A;  1GNL A;  2RAK A;  1GN9 A;  2QXL A;  2KHO A;  3KAV A;  4WPC A;  4E3C A;  1I4T A;  3BUI A;  4R5K A;  3BLB A;  4EZX A;  3A98 A;  1O7D C;  3CZN A;  4HR1 A;  4FM3 A;  4AZ5 A;  2OO2 A;  4EZW A;  3T48 A;  3KDR A;  1SU8 A;  4EZT A;  3LLL A;  3T46 A;  2Q12 A;  1MJG A;  1U00 A;  1H6H A;  1JQK A;  3DDF A;  2GA9 D;  3EJT A;  4F00 A;  3CAZ A;  4R5I A;  3BVX A;  3DX0 A;  1SU6 A;  1TQV A;  1SU7 A;  3P0C A;  2FYV A;  4JWD A;  1QX1 A;  3QA8 A;  4DYL A;  5FIG A;  2OZN B;  2YLA A;  3T47 A;  3CKD A;  4BNE A;  5E84 A;  2YIB A;  4PQP A;  4PQO A;  4EZO A;  5C5B A;  4B9Q A;  2GAF D;  4KIK A;  4EZR A;  4FZP A;  1QWU A;  2YLL A;  3ERC C;  3Q84 A;  2EWF A;  1GNT A;  1HWW A;  3EJP A;  1OAO A;  4JWI A;  4FZO A;  2QKW A;  3VEA A;  2PY6 A;  1E2U A;  4JLC A;  4G6Q A;  3DYT A;  1OCS A;  4P2I A;  4JL9 A;  4NQI A;  4AZ6 A;  2ZXQ A;  2CSK A;  1YWM A;  2RED A;  1X03 A;  2X3X A;  1TQS A;  3RV0 A;  2YL8 A;  3BVV A;  3BUD A;  3GI7 A;  3UIT A;  4IM0 A;  1R5E A;  2REA A;  5FLE X;  4AZH A;  2MI7 A;  2F1A A;  3D2F A;  5C5B B;  2ELB A;  4E81 A;  3BVU A;  4IKD A;  3BVW A;  1QWN A;  4KIK B;  4IM3 A;  2OW6 A;  4IKB A;  3DDG A;  3OWG A;  3OK8 A;  1SUF A;  2V0O A;  4R5J A;  2X3V A;  3ER9 B;  3ZED A;  2YI9 A;  4H6I A;  4H6H A;  1R33 A;  2ETT A;  1Y2O A;  2YI8 A;  3B53 X;  2Z0N A;  3ACO A;  2F1B A;  3SYV A;  4IWQ A;  2YKT A;  2LM0 A;  1OA1 A;  3HAH A;  1DKX A;  3LUI A;  2RT6 A;  1TQT A;  3C7N A;  4JNE A;  4IWP A;  2X5C A;  4NSW A;  2F7O A;  3T4A G;  2AR5 A;  3G9G A;  4FZS A;  4JN4 A;  2YIV X;  3KAW A;  4AVM A;  4IKB B;  3FOG A;  1E1D A;  1W9M A;  2EFK A;  1O7K A;  2OBM A;  4D8J A;  1KQ6 A;  3D52 A;  2WWE A;  3DX4 A;  4M0M A;  3B51 X;  4JNF A;  3ABH A;  4IWO A;  3RV1 A;  1TQU A;  3EJR A;  2RAJ A;  3F7W A;  4F01 A;  1I49 A;  4JWE A;  1PS3 A;  3SOG A;  4AZB A;  4BGJ A;  4EZP A;  1KMD A;  2F7Q A;  1DKZ A;  3EJQ A;  4EZY A;  4IM2 A;  4EZU A;  2NCZ A;  1XTE A;  3QNJ A;  4H8S A;  1ZWW A;  2YIA A;  3DPQ A;  4EZV A;  1I4D A;  2PMR A;  2D1L A;  1UPX A;  2EFL A;  3DX1 A;  2IWL X;  3D4Z A;  1E9V A;  4AZI A;  4PO2 A;  3DX2 A;  2X3W A;  3I39 X;  3EJS A;  1URU A;  2OBL A;  3B52 X;  4DCN C;  3IQ2 A;  2YL9 A;  3PLT A;  2RAI A;  3VKH A;  4EZS A;  2YL5 A;  2I4K A;  4IW0 A;  2WIN M;  4P2J A;  1WDZ A;  3Q0K A;  2WYH A;  2D4C A;  3VEB A;  1HTY A;  2L73 A;  3ER8 C;  3BUQ A;  3I01 A;  4R5L A;  2EX3 B;  2CZO A;  4UDY X;  1TQW A;  2Q13 A;  2F7P A;  3LVT A;  2F18 A;  2N3K A;  4HY9 A;  4AZC B;  3EJU A;  4ON3 A;  3L3O M;  1LQ7 A;  3O3M B;  3O3N B;  3DPP A;  4AZG A;  2OW7 A;  4AKV A;  3D2E A;  2YL6 A;  4HYB A;  4JWC A;  1OA0 A;  2ALW A;  3BUP A;  3QNI A;  3CZS A;  4UDX X;  4WPE A;  5KBP A;  3HAI A;  3M3W A;  4HAS A;  3D50 A;  2YPS A;  1DKY A;  4PZG A;  3T49 A;  2F7R A;  2WYI A;  3I04 A;  1XTN A;  3HAJ A;  3DX3 A;  4NPH A;  3DPO A;  2ND1 A;  3CV5 A;  4R5G A;  3HPB A;  2GF4 A;  1X04 A;  3LMF A;  4EZZ A; 
#chains in the Genus database with same CATH homology
 3P0C A;  2V0O A;  1I4D A;  2X3V A;  2Z0V A;  2C08 A;  2D1L A;  4I1Q A;  2EFL A;  4DYL A;  2IWL X;  2ETT A;  1Y2O A;  3HPC X;  2DYB A;  4ATM A;  4BNE A;  2Z0N A;  3I2W A;  2X3W A;  4PQP A;  4PQO A;  3ACO A;  4AZ9 A;  5C5B A;  3SYV A;  1URU A;  2YKT A;  4DCN C;  2V6V A;  3IQ2 A;  3HAH A;  3PLT A;  3LUI A;  1GD5 A;  2RAI A;  2I4K A;  4P2J A;  1WDZ A;  4OXW A;  3Q84 A;  3Q0K A;  4NSW A;  3QWE A;  2D4C A;  2FIC A;  2L73 A;  2V14 A;  2AR5 A;  3G9G A;  4FZS A;  2Z0O A;  4AVM A;  2CZO A;  3QE6 A;  4IKB B;  2Q13 A;  3FOG A;  2EFK A;  1O7K A;  1OCU A;  4ON3 A;  1I4L A;  3DYT A;  1KQ6 A;  1OCS A;  2WWE A;  4P2I A;  2RAK A;  4AKV A;  3ABH A;  4WPC A;  1I4T A;  4NQI A;  2RAJ A;  2CSK A;  2RED A;  1X03 A;  2X3X A;  1I49 A;  3QNI A;  2REA A;  3SOG A;  5C5B B;  4BGJ A;  2ELB A;  4WPE A;  3HAI A;  3M3W A;  4HAS A;  4IKD A;  2YPS A;  1KMD A;  4PZG A;  3LLL A;  1XTN A;  2Q12 A;  3HAJ A;  1H6H A;  1XTE A;  4IKB A;  3CAZ A;  3HPB A;  4H8S A;  3OK8 A;  1X04 A;  1ZWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...