2RAIA

The px-bar membrane remodeling unit of sorting nexin 9
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
382
structure length
363
Chain Sequence
b'PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
molecule tags Structural protein
source organism Homo sapiens
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
total genus 118
structure length 363
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2raiA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2raiA02
1KMDA 3HAIA 3FOGA 1WDZA 4WPEA 4NQIA 2Q13A 2X3XA 4PZGA 3Q0KA 1I4TA 5C5BA 4ON3A 2L73A 3LUIA 3ACOA 2CSKA 3M3WA 4P2IA 1X03A 3HPCX 2V0OA 4FZSA 2IWLX 4PQPA 2C08A 4P2JA 2V6VA 2Z0OA 3PLTA 2Q12A 4H8SA 2D4CA 5C5BB 4AKVA 4ATMA 2WWEA 3P0CA 3G9GA 1Y2OA 2FICA 4DCNC 2ELBA 2RAKA 3IQ2A 3HPBA 2Z0NA 1GD5A 1URUA 1X04A 2X3WA 3QE6A 3ABHA 2CZOA 3Q84A 3LLLA 3SOGA 1ZWWA 4PQOA 1I4LA 3HAJA 4AVMA 3QNIA 2REAA 1XTEA 4AZ9A 4WPCA 2Z0VA 4IKDA 4OXWA 2I4KA 2EFKA 2DYBA 3HAHA 1OCSA 2YPSA 2ETTA 4BNEA 3SYVA 1OCUA 1H6HA 2AR5A 1XTNA 1I49A 4NSWA 2RAIA 1I4DA 3I2WA 4I1QA 3CAZA 1O7KA 4HASA 3DYTA 2X3VA 1KQ6A 4DYLA 2D1LA 2V14A 4BGJA 2EFLA 4IKBA 3OK8A 2REDA 4IKBB 2RAJA 2YKTA 3QWEA
chains in the Genus database with same CATH superfamily
3B52X 3FOGA 3DX1A 3BVUA 2F18A 3KDRA 2JNSA 3DPPA 3Q0KA 4HR1A 3DX4A 4FM3A 2F7QA 2F1BA 4EZPA 2CSKA 2OW7A 1GNTA 1MJGA 4JWCA 2YI9A 3GI7A 4EZNA 3RPMA 1R33A 2IWLX 2GA9D 3KAWA 2Z0OA 3T4AG 2YIAA 2Q12A 3KAVA 1OAOA 5C5BB 4AKVA 4EZUA 2LM0A 3P0CA 2ELBA 3LMFA 3FD9A 1URUA 3B53X 3O3NB 1ZWWA 3LLLA 3RV0A 2F7OA 2KHOA 2YIVX 3C7NA 5KBPA 1GN9A 4AZ9A 3I01A 3OWGA 4FZPA 2EFKA 2DYBA 2RT6A 3HAHA 3CZNA 3BUPA 4BNEA 1E1DA 3VEBA 1E2UA 2AR5A 1TQSA 1I49A 4H6IA 4R5JA 2RAIA 2X5CA 3EJQA 3DDFA 2WYIA 2ALWA 2X3VA 2ND1A 3D51A 3CZSA 2EFLA 4E3CA 2YL5A 1SU6A 1GNLA 5FIGA 4PO2A 2LXYA 1WDZA 3L3PA 1QWNA 2X3XA 3UITA 4PZGA 3I04A 4ON3A 2QXLA 3QNJA 4JWDA 3D50A 1SU8A 3B51X 4EZYA 4AZ5A 2YL6A 3M3WA 5FLEX 2PMRA 4P2IA 1UPXA 3D2FA 2YI8A 4HY9A 4H6HA 4PQPA 3BUBA 2ND0A 3EJRA 4NPHA 3RV1A 4UDXX 2OZNB 2Z0NA 3BVVA 3DDGA 3ABHA 2CZOA 3BUDA 3EJSA 2FYVA 4AZ6A 3LVTA 2F1AA 1OA1A 4IWOA 2Z0VA 4IKDA 1E9VA 2I4KA 4M0MA 3DPQA 1OA0A 4EZVA 1HWWA 3T46A 4JNEA 2OO2A 1I4DA 1TQTA 4IWPA 1O7KA 3DYTA 3BUQA 3VKHA 4R5GA 1KQ6A 5E84A 4UDYX 4B9QA 1TQVA 4IKBB 2RAJA 4EZWA 4EZOA 3QWEA 4E81A 1KMDA 3HAIA 4G6QA 2YL9A 4AZIA 4F01A 4JWIA 2Q13A 3A98A 4JWEA 3LUIA 4FZOA 4JL9A 3HPCX 4AZ7A 2QFFA 4IM3A 4AZBA 2C08A 1W9MA 4EZQA 2YLLA 3BVXA 3BVWA 4H8SA 1DKZA 1QWUA 4F00A 2WWEA 3EJTA 3DPOA 3IQ2A 2WYHA 1X04A 2X3WA 2GF4A 3D4ZA 1ZYLA 3Q84A 3T47A 3HAJA 3O3MB 1R34A 3QNIA 3ER9B 3T49A 3ER8C 3I39X 2WINM 3D2EA 3D4YA 3CVRA 1DKYA 3EJUA 1OCSA 2OBLA 2ETTA 1OCUA 3BVTA 1QX1A 4JNFA 2O0I1 4KIKA 3CKDA 3I2WA 3T48A 4EZZA 3CAZA 4JLCA 1DKXA 4HASA 4D8JA 3OHXM 3ZEDA 3CV5A 2OW6A 4EZRA 2V14A 3OK8A 4IM2A 3ERCC 3BLBA 2OBMA 1U00A 4IW0A 3D52A 4EZSA 4WPEA 2F7RA 4NQIA 2ZXQA 5C5BA 1I4TA 4IWQA 4JN4A 2EWFA 2L73A 1PS3A 2MI7A 2QKWA 4IM0A 3ACOA 1JQKA 4R5LA 1X03A 2GAFD 2V0OA 3O3OB 2N3KA 2F7PA 4FZSA 4P2JA 2PY6A 2JNKA 2V6VA 3DX2A 3PLTA 4AZGA 3EJPA 3DX0A 2D4CA 4HR1B 4ATMA 4EZTA 3G9GA 1Y2OA 1SUFA 2FICA 4DCNC 2RAKA 3HPBA 1GD5A 3QE6A 2EX3B 3QA8A 3SOGA 1R5EA 1TQUA 4PQOA 1I4LA 5TKYA 4AVMA 4R5IA 3VEAA 2REAA 4KIKB 1XTEA 4WPCA 1O7DC 4OXWA 1SU7A 4AZCA 2YL8A 3BUIA 2YLAA 1HXKA 2YPSA 3SYVA 2YIBA 4HYBA 1H6HA 1XTNA 2Z8YA 4NSWA 4AZCB 4I1QA 3L3OM 4EZXA 3DX3A 3F7WA 1LQ7A 1HTYA 4R5KA 1YWMA 4DYLA 2D1LA 4BGJA 1TQWA 2REDA 1O7DB 4AZHA 2YKTA 4IKBA 2NCZA
chains in the Genus database with same CATH topology
1KMDA 3HAIA 3FOGA 1WDZA 4WPEA 4NQIA 2Q13A 2X3XA 4PZGA 3Q0KA 1I4TA 5C5BA 4ON3A 2L73A 3LUIA 3ACOA 2CSKA 3M3WA 4P2IA 1X03A 3HPCX 2V0OA 4FZSA 2IWLX 4PQPA 2C08A 4P2JA 2V6VA 2Z0OA 3PLTA 2Q12A 4H8SA 2D4CA 5C5BB 4AKVA 4ATMA 2WWEA 3P0CA 3G9GA 1Y2OA 2FICA 4DCNC 2ELBA 2RAKA 3IQ2A 3HPBA 2Z0NA 1GD5A 1URUA 1X04A 2X3WA 3QE6A 3ABHA 2CZOA 3Q84A 3LLLA 3SOGA 1ZWWA 4PQOA 1I4LA 3HAJA 4AVMA 3QNIA 2REAA 1XTEA 4AZ9A 4WPCA 2Z0VA 4IKDA 4OXWA 2I4KA 2EFKA 2DYBA 3HAHA 1OCSA 2YPSA 2ETTA 4BNEA 3SYVA 1OCUA 1H6HA 2AR5A 1XTNA 1I49A 4NSWA 2RAIA 1I4DA 3I2WA 4I1QA 3CAZA 1O7KA 4HASA 3DYTA 2X3VA 1KQ6A 4DYLA 2D1LA 2V14A 4BGJA 2EFLA 4IKBA 3OK8A 2REDA 4IKBB 2RAJA 2YKTA 3QWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMD A;  3HAI A;  3FOG A;  1WDZ A;  4WPE A;  4NQI A;  2Q13 A;  2X3X A;  4PZG A;  3Q0K A;  1I4T A;  5C5B A;  4ON3 A;  2L73 A;  3LUI A;  3ACO A;  2CSK A;  3M3W A;  4P2I A;  1X03 A;  3HPC X;  2V0O A;  4FZS A;  2IWL X;  4PQP A;  2C08 A;  4P2J A;  2V6V A;  2Z0O A;  3PLT A;  2Q12 A;  4H8S A;  2D4C A;  5C5B B;  4AKV A;  4ATM A;  2WWE A;  3P0C A;  3G9G A;  1Y2O A;  2FIC A;  4DCN C;  2ELB A;  2RAK A;  3IQ2 A;  3HPB A;  2Z0N A;  1GD5 A;  1URU A;  1X04 A;  2X3W A;  3QE6 A;  3ABH A;  2CZO A;  3Q84 A;  3LLL A;  3SOG A;  1ZWW A;  4PQO A;  1I4L A;  3HAJ A;  4AVM A;  3QNI A;  2REA A;  1XTE A;  4AZ9 A;  4WPC A;  2Z0V A;  4IKD A;  4OXW A;  2I4K A;  2EFK A;  2DYB A;  3HAH A;  1OCS A;  2YPS A;  2ETT A;  4BNE A;  3SYV A;  1OCU A;  1H6H A;  2AR5 A;  1XTN A;  1I49 A;  4NSW A;  2RAI A;  1I4D A;  3I2W A;  4I1Q A;  3CAZ A;  1O7K A;  4HAS A;  3DYT A;  2X3V A;  1KQ6 A;  4DYL A;  2D1L A;  2V14 A;  4BGJ A;  2EFL A;  4IKB A;  3OK8 A;  2RED A;  4IKB B;  2RAJ A;  2YKT A;  3QWE A; 
#chains in the Genus database with same CATH topology
 3B52 X;  3FOG A;  3DX1 A;  3BVU A;  2F18 A;  3KDR A;  2JNS A;  3DPP A;  3Q0K A;  4HR1 A;  3DX4 A;  4FM3 A;  2F7Q A;  2F1B A;  4EZP A;  2CSK A;  2OW7 A;  1GNT A;  1MJG A;  4JWC A;  2YI9 A;  3GI7 A;  4EZN A;  3RPM A;  1R33 A;  2IWL X;  2GA9 D;  3KAW A;  2Z0O A;  3T4A G;  2YIA A;  2Q12 A;  3KAV A;  1OAO A;  5C5B B;  4AKV A;  4EZU A;  2LM0 A;  3P0C A;  2ELB A;  3LMF A;  3FD9 A;  1URU A;  3B53 X;  3O3N B;  1ZWW A;  3LLL A;  3RV0 A;  2F7O A;  2KHO A;  2YIV X;  3C7N A;  5KBP A;  1GN9 A;  4AZ9 A;  3I01 A;  3OWG A;  4FZP A;  2EFK A;  2DYB A;  2RT6 A;  3HAH A;  3CZN A;  3BUP A;  4BNE A;  1E1D A;  3VEB A;  1E2U A;  2AR5 A;  1TQS A;  1I49 A;  4H6I A;  4R5J A;  2RAI A;  2X5C A;  3EJQ A;  3DDF A;  2WYI A;  2ALW A;  2X3V A;  2ND1 A;  3D51 A;  3CZS A;  2EFL A;  4E3C A;  2YL5 A;  1SU6 A;  1GNL A;  5FIG A;  4PO2 A;  2LXY A;  1WDZ A;  3L3P A;  1QWN A;  2X3X A;  3UIT A;  4PZG A;  3I04 A;  4ON3 A;  2QXL A;  3QNJ A;  4JWD A;  3D50 A;  1SU8 A;  3B51 X;  4EZY A;  4AZ5 A;  2YL6 A;  3M3W A;  5FLE X;  2PMR A;  4P2I A;  1UPX A;  3D2F A;  2YI8 A;  4HY9 A;  4H6H A;  4PQP A;  3BUB A;  2ND0 A;  3EJR A;  4NPH A;  3RV1 A;  4UDX X;  2OZN B;  2Z0N A;  3BVV A;  3DDG A;  3ABH A;  2CZO A;  3BUD A;  3EJS A;  2FYV A;  4AZ6 A;  3LVT A;  2F1A A;  1OA1 A;  4IWO A;  2Z0V A;  4IKD A;  1E9V A;  2I4K A;  4M0M A;  3DPQ A;  1OA0 A;  4EZV A;  1HWW A;  3T46 A;  4JNE A;  2OO2 A;  1I4D A;  1TQT A;  4IWP A;  1O7K A;  3DYT A;  3BUQ A;  3VKH A;  4R5G A;  1KQ6 A;  5E84 A;  4UDY X;  4B9Q A;  1TQV A;  4IKB B;  2RAJ A;  4EZW A;  4EZO A;  3QWE A;  4E81 A;  1KMD A;  3HAI A;  4G6Q A;  2YL9 A;  4AZI A;  4F01 A;  4JWI A;  2Q13 A;  3A98 A;  4JWE A;  3LUI A;  4FZO A;  4JL9 A;  3HPC X;  4AZ7 A;  2QFF A;  4IM3 A;  4AZB A;  2C08 A;  1W9M A;  4EZQ A;  2YLL A;  3BVX A;  3BVW A;  4H8S A;  1DKZ A;  1QWU A;  4F00 A;  2WWE A;  3EJT A;  3DPO A;  3IQ2 A;  2WYH A;  1X04 A;  2X3W A;  2GF4 A;  3D4Z A;  1ZYL A;  3Q84 A;  3T47 A;  3HAJ A;  3O3M B;  1R34 A;  3QNI A;  3ER9 B;  3T49 A;  3ER8 C;  3I39 X;  2WIN M;  3D2E A;  3D4Y A;  3CVR A;  1DKY A;  3EJU A;  1OCS A;  2OBL A;  2ETT A;  1OCU A;  3BVT A;  1QX1 A;  4JNF A;  2O0I 1;  4KIK A;  3CKD A;  3I2W A;  3T48 A;  4EZZ A;  3CAZ A;  4JLC A;  1DKX A;  4HAS A;  4D8J A;  3OHX M;  3ZED A;  3CV5 A;  2OW6 A;  4EZR A;  2V14 A;  3OK8 A;  4IM2 A;  3ERC C;  3BLB A;  2OBM A;  1U00 A;  4IW0 A;  3D52 A;  4EZS A;  4WPE A;  2F7R A;  4NQI A;  2ZXQ A;  5C5B A;  1I4T A;  4IWQ A;  4JN4 A;  2EWF A;  2L73 A;  1PS3 A;  2MI7 A;  2QKW A;  4IM0 A;  3ACO A;  1JQK A;  4R5L A;  1X03 A;  2GAF D;  2V0O A;  3O3O B;  2N3K A;  2F7P A;  4FZS A;  4P2J A;  2PY6 A;  2JNK A;  2V6V A;  3DX2 A;  3PLT A;  4AZG A;  3EJP A;  3DX0 A;  2D4C A;  4HR1 B;  4ATM A;  4EZT A;  3G9G A;  1Y2O A;  1SUF A;  2FIC A;  4DCN C;  2RAK A;  3HPB A;  1GD5 A;  3QE6 A;  2EX3 B;  3QA8 A;  3SOG A;  1R5E A;  1TQU A;  4PQO A;  1I4L A;  5TKY A;  4AVM A;  4R5I A;  3VEA A;  2REA A;  4KIK B;  1XTE A;  4WPC A;  1O7D C;  4OXW A;  1SU7 A;  4AZC A;  2YL8 A;  3BUI A;  2YLA A;  1HXK A;  2YPS A;  3SYV A;  2YIB A;  4HYB A;  1H6H A;  1XTN A;  2Z8Y A;  4NSW A;  4AZC B;  4I1Q A;  3L3O M;  4EZX A;  3DX3 A;  3F7W A;  1LQ7 A;  1HTY A;  4R5K A;  1YWM A;  4DYL A;  2D1L A;  4BGJ A;  1TQW A;  2RED A;  1O7D B;  4AZH A;  2YKT A;  4IKB A;  2NCZ A; 
#chains in the Genus database with same CATH homology
 1KMD A;  3HAI A;  3FOG A;  1WDZ A;  4WPE A;  4NQI A;  2Q13 A;  2X3X A;  4PZG A;  3Q0K A;  1I4T A;  5C5B A;  4ON3 A;  2L73 A;  3LUI A;  3ACO A;  2CSK A;  3M3W A;  4P2I A;  1X03 A;  3HPC X;  2V0O A;  4FZS A;  2IWL X;  4PQP A;  2C08 A;  4P2J A;  2V6V A;  2Z0O A;  3PLT A;  2Q12 A;  4H8S A;  2D4C A;  5C5B B;  4AKV A;  4ATM A;  2WWE A;  3P0C A;  3G9G A;  1Y2O A;  2FIC A;  4DCN C;  2ELB A;  2RAK A;  3IQ2 A;  3HPB A;  2Z0N A;  1GD5 A;  1URU A;  1X04 A;  2X3W A;  3QE6 A;  3ABH A;  2CZO A;  3Q84 A;  3LLL A;  3SOG A;  1ZWW A;  4PQO A;  1I4L A;  3HAJ A;  4AVM A;  3QNI A;  2REA A;  1XTE A;  4AZ9 A;  4WPC A;  2Z0V A;  4IKD A;  4OXW A;  2I4K A;  2EFK A;  2DYB A;  3HAH A;  1OCS A;  2YPS A;  2ETT A;  4BNE A;  3SYV A;  1OCU A;  1H6H A;  2AR5 A;  1XTN A;  1I49 A;  4NSW A;  2RAI A;  1I4D A;  3I2W A;  4I1Q A;  3CAZ A;  1O7K A;  4HAS A;  3DYT A;  2X3V A;  1KQ6 A;  4DYL A;  2D1L A;  2V14 A;  4BGJ A;  2EFL A;  4IKB A;  3OK8 A;  2RED A;  4IKB B;  2RAJ A;  2YKT A;  3QWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...