2RAIA

The px-bar membrane remodeling unit of sorting nexin 9
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
382
structure length
363
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 118
structure length 363
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2raiA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2raiA02
1KQ6A 2I4KA 3HPCX 4BGJA 4AKVA 2Q13A 2EFLA 2D4CA 2C08A 5C5BB 3ACOA 3QNIA 2YKTA 4NSWA 2AR5A 1X04A 4ON3A 1URUA 4IKDA 3M3WA 4BNEA 1O7KA 2V14A 2Z0OA 2X3VA 4DCNC 1I4DA 4ATMA 2L73A 3Q84A 3LLLA 2Q12A 2D1LA 3HAIA 2Z0VA 3SOGA 4OXWA 2FICA 1KMDA 2CSKA 2CZOA 4DYLA 2V6VA 3LUIA 1I49A 4PQOA 2X3WA 3CAZA 3P0CA 1Y2OA 4P2JA 4HASA 4PQPA 4P2IA 1GD5A 3PLTA 2ETTA 2DYBA 2RAIA 2YPSA 5C5BA 1H6HA 1XTNA 3HAHA 4AVMA 4I1QA 4NQIA 2ELBA 3G9GA 1I4LA 2IWLX 2WWEA 3HPBA 2RAKA 1XTEA 4AZ9A 4H8SA 3QWEA 1X03A 4FZSA 2REAA 2RAJA 3OK8A 2Z0NA 1WDZA 3ABHA 1OCSA 4IKBB 3DYTA 3QE6A 3HAJA 3FOGA 1I4TA 2X3XA 2EFKA 4WPCA 2REDA 3IQ2A 3SYVA 4PZGA 1OCUA 1ZWWA 2V0OA 3Q0KA 4WPEA 4IKBA 3I2WA
chains in the Genus database with same CATH superfamily
4FZPA 1YWMA 2MI7A 4BGJA 3EJQA 4B9QA 3CZSA 1ZYLA 4NSWA 3O3MB 3UITA 4D8JA 1DKXA 1URUA 2N3KA 2YL9A 3BUDA 2GA9D 4E3CA 1U00A 1E9VA 2X3VA 2YLLA 4ATMA 2GAFD 1TQVA 2QXLA 3T4AG 2YIBA 4DYLA 1JQKA 4PO2A 3EJTA 3D4YA 1I49A 3CAZA 1Y2OA 4P2JA 2QFFA 4HASA 4PQPA 3EJSA 3DX0A 4EZNA 1OAOA 3PLTA 3T48A 2F1BA 4AZIA 3O3NB 2LM0A 5C5BA 2YI8A 4JLCA 1H6HA 4JWDA 1QX1A 3ERCC 4EZSA 2IWLX 4AZ9A 4IWQA 4FZSA 1HTYA 3DPPA 1DKYA 3RV0A 3ABHA 1OCSA 2OZNB 3BUBA 3DDFA 1I4TA 2X3XA 3RPMA 4EZUA 2REDA 2F7QA 1GNLA 4AZBA 2OBLA 1HXKA 2KHOA 2V0OA 3Q0KA 4IKBA 4JNFA 2NCZA 3B53X 1KQ6A 3HPCX 4AZ5A 4EZYA 4AZCA 2X5CA 2O0I1 2Q13A 5E84A 2EFLA 2D4CA 2YI9A 2PY6A 5C5BB 3QNIA 3BVWA 2YKTA 4HR1A 3VKHA 2JNKA 1X04A 4ON3A 4IKDA 3RV1A 2Z0OA 3DPOA 2WYHA 3ER8C 4DCNC 4EZPA 4EZRA 1I4DA 2L73A 3Q84A 3LLLA 2D1LA 3HAIA 1GNTA 3I39X 2Z0VA 3EJUA 4OXWA 2FICA 1UPXA 2ND0A 4F01A 3GI7A 2YL6A 2V6VA 4JWIA 2F18A 1GD5A 3KAWA 2YL8A 1SU8A 3C7NA 3KAVA 4UDYX 3T49A 1W9MA 3OHXM 4KIKA 4NQIA 2ELBA 3BVXA 1R33A 1TQTA 3BUQA 4AZCB 1I4LA 4AZ6A 2LXYA 3O3OB 4AZGA 1GN9A 3QWEA 3BUPA 5KBPA 4HR1B 3CZNA 4EZTA 4EZQA 4JL9A 1TQUA 4AZHA 3DX3A 4WPCA 3BVUA 2YIVX 4PZGA 3EJRA 4IM2A 1ZWWA 3EJPA 4R5LA 3QA8A 3I2WA 3DDGA 4R5KA 2FYVA 3CVRA 2I4KA 1OA1A 2OO2A 2F7PA 2Z8YA 4AKVA 3DX1A 4JWCA 2C08A 4KIKB 4R5JA 2AR5A 3CKDA 3BLBA 4BNEA 1O7KA 4IWPA 3BVTA 2Q12A 3SOGA 2WYIA 1KMDA 4F00A 2CSKA 1MJGA 4G6QA 3ZEDA 2WINM 3CV5A 3LUIA 3P0CA 2JNSA 2F7RA 4FZOA 2ETTA 2DYBA 2YPSA 3DX2A 3T47A 2OBMA 3A98A 2YLAA 4H6HA 3OWGA 4I1QA 4M0MA 2OW7A 1R5EA 2EWFA 2WWEA 3HPBA 4EZWA 2RAKA 3VEBA 1XTEA 3F7WA 4H8SA 5FLEX 3LVTA 4EZXA 1X03A 4EZOA 3LMFA 4R5GA 2F1AA 2YIAA 2Z0NA 4HY9A 3BVVA 3FD9A 1QWNA 4HYBA 4IKBB 3HAJA 4NPHA 3FOGA 2ND1A 4IWOA 2QKWA 3SYVA 5FIGA 3I01A 3DX4A 2PMRA 2RT6A 3ER9B 1TQWA 3I04A 4IW0A 4UDXX 3ACOA 3B52X 4JN4A 3T46A 3M3WA 2V14A 1SU7A 1QWUA 2F7OA 3KDRA 5TKYA 3D52A 3D2FA 1PS3A 1E2UA 1OA0A 3BUIA 2CZOA 3D2EA 4JNEA 1E1DA 1SU6A 4PQOA 2X3WA 2ALWA 4AZ7A 4P2IA 3B51X 2RAIA 4IM0A 1HWWA 2OW6A 1DKZA 1XTNA 3HAHA 2ZXQA 4AVMA 2GF4A 1LQ7A 4H6IA 3VEAA 3G9GA 1SUFA 3D50A 1R34A 1TQSA 4EZZA 4FM3A 3L3OM 3D4ZA 2REAA 2RAJA 3OK8A 4IM3A 1WDZA 4JWEA 3D51A 3DYTA 3QE6A 1O7DB 3DPQA 3L3PA 2EFKA 4E81A 2YL5A 3IQ2A 2EX3B 3QNJA 4EZVA 4R5IA 1OCUA 1O7DC 4WPEA
chains in the Genus database with same CATH topology
1KQ6A 2I4KA 3HPCX 4BGJA 4AKVA 2Q13A 2EFLA 2D4CA 2C08A 5C5BB 3ACOA 3QNIA 2YKTA 4NSWA 2AR5A 1X04A 4ON3A 1URUA 4IKDA 3M3WA 4BNEA 1O7KA 2V14A 2Z0OA 2X3VA 4DCNC 1I4DA 4ATMA 2L73A 3Q84A 3LLLA 2Q12A 2D1LA 3HAIA 2Z0VA 3SOGA 4OXWA 2FICA 1KMDA 2CSKA 2CZOA 4DYLA 2V6VA 3LUIA 1I49A 4PQOA 2X3WA 3CAZA 3P0CA 1Y2OA 4P2JA 4HASA 4PQPA 4P2IA 1GD5A 3PLTA 2ETTA 2DYBA 2RAIA 2YPSA 5C5BA 1H6HA 1XTNA 3HAHA 4AVMA 4I1QA 4NQIA 2ELBA 3G9GA 1I4LA 2IWLX 2WWEA 3HPBA 2RAKA 1XTEA 4AZ9A 4H8SA 3QWEA 1X03A 4FZSA 2REAA 2RAJA 3OK8A 2Z0NA 1WDZA 3ABHA 1OCSA 4IKBB 3DYTA 3QE6A 3HAJA 3FOGA 1I4TA 2X3XA 2EFKA 4WPCA 2REDA 3IQ2A 3SYVA 4PZGA 1OCUA 1ZWWA 2V0OA 3Q0KA 4WPEA 4IKBA 3I2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ6 A;  2I4K A;  3HPC X;  4BGJ A;  4AKV A;  2Q13 A;  2EFL A;  2D4C A;  2C08 A;  5C5B B;  3ACO A;  3QNI A;  2YKT A;  4NSW A;  2AR5 A;  1X04 A;  4ON3 A;  1URU A;  4IKD A;  3M3W A;  4BNE A;  1O7K A;  2V14 A;  2Z0O A;  2X3V A;  4DCN C;  1I4D A;  4ATM A;  2L73 A;  3Q84 A;  3LLL A;  2Q12 A;  2D1L A;  3HAI A;  2Z0V A;  3SOG A;  4OXW A;  2FIC A;  1KMD A;  2CSK A;  2CZO A;  4DYL A;  2V6V A;  3LUI A;  1I49 A;  4PQO A;  2X3W A;  3CAZ A;  3P0C A;  1Y2O A;  4P2J A;  4HAS A;  4PQP A;  4P2I A;  1GD5 A;  3PLT A;  2ETT A;  2DYB A;  2RAI A;  2YPS A;  5C5B A;  1H6H A;  1XTN A;  3HAH A;  4AVM A;  4I1Q A;  4NQI A;  2ELB A;  3G9G A;  1I4L A;  2IWL X;  2WWE A;  3HPB A;  2RAK A;  1XTE A;  4AZ9 A;  4H8S A;  3QWE A;  1X03 A;  4FZS A;  2REA A;  2RAJ A;  3OK8 A;  2Z0N A;  1WDZ A;  3ABH A;  1OCS A;  4IKB B;  3DYT A;  3QE6 A;  3HAJ A;  3FOG A;  1I4T A;  2X3X A;  2EFK A;  4WPC A;  2RED A;  3IQ2 A;  3SYV A;  4PZG A;  1OCU A;  1ZWW A;  2V0O A;  3Q0K A;  4WPE A;  4IKB A;  3I2W A; 
#chains in the Genus database with same CATH topology
 4FZP A;  1YWM A;  2MI7 A;  4BGJ A;  3EJQ A;  4B9Q A;  3CZS A;  1ZYL A;  4NSW A;  3O3M B;  3UIT A;  4D8J A;  1DKX A;  1URU A;  2N3K A;  2YL9 A;  3BUD A;  2GA9 D;  4E3C A;  1U00 A;  1E9V A;  2X3V A;  2YLL A;  4ATM A;  2GAF D;  1TQV A;  2QXL A;  3T4A G;  2YIB A;  4DYL A;  1JQK A;  4PO2 A;  3EJT A;  3D4Y A;  1I49 A;  3CAZ A;  1Y2O A;  4P2J A;  2QFF A;  4HAS A;  4PQP A;  3EJS A;  3DX0 A;  4EZN A;  1OAO A;  3PLT A;  3T48 A;  2F1B A;  4AZI A;  3O3N B;  2LM0 A;  5C5B A;  2YI8 A;  4JLC A;  1H6H A;  4JWD A;  1QX1 A;  3ERC C;  4EZS A;  2IWL X;  4AZ9 A;  4IWQ A;  4FZS A;  1HTY A;  3DPP A;  1DKY A;  3RV0 A;  3ABH A;  1OCS A;  2OZN B;  3BUB A;  3DDF A;  1I4T A;  2X3X A;  3RPM A;  4EZU A;  2RED A;  2F7Q A;  1GNL A;  4AZB A;  2OBL A;  1HXK A;  2KHO A;  2V0O A;  3Q0K A;  4IKB A;  4JNF A;  2NCZ A;  3B53 X;  1KQ6 A;  3HPC X;  4AZ5 A;  4EZY A;  4AZC A;  2X5C A;  2O0I 1;  2Q13 A;  5E84 A;  2EFL A;  2D4C A;  2YI9 A;  2PY6 A;  5C5B B;  3QNI A;  3BVW A;  2YKT A;  4HR1 A;  3VKH A;  2JNK A;  1X04 A;  4ON3 A;  4IKD A;  3RV1 A;  2Z0O A;  3DPO A;  2WYH A;  3ER8 C;  4DCN C;  4EZP A;  4EZR A;  1I4D A;  2L73 A;  3Q84 A;  3LLL A;  2D1L A;  3HAI A;  1GNT A;  3I39 X;  2Z0V A;  3EJU A;  4OXW A;  2FIC A;  1UPX A;  2ND0 A;  4F01 A;  3GI7 A;  2YL6 A;  2V6V A;  4JWI A;  2F18 A;  1GD5 A;  3KAW A;  2YL8 A;  1SU8 A;  3C7N A;  3KAV A;  4UDY X;  3T49 A;  1W9M A;  3OHX M;  4KIK A;  4NQI A;  2ELB A;  3BVX A;  1R33 A;  1TQT A;  3BUQ A;  4AZC B;  1I4L A;  4AZ6 A;  2LXY A;  3O3O B;  4AZG A;  1GN9 A;  3QWE A;  3BUP A;  5KBP A;  4HR1 B;  3CZN A;  4EZT A;  4EZQ A;  4JL9 A;  1TQU A;  4AZH A;  3DX3 A;  4WPC A;  3BVU A;  2YIV X;  4PZG A;  3EJR A;  4IM2 A;  1ZWW A;  3EJP A;  4R5L A;  3QA8 A;  3I2W A;  3DDG A;  4R5K A;  2FYV A;  3CVR A;  2I4K A;  1OA1 A;  2OO2 A;  2F7P A;  2Z8Y A;  4AKV A;  3DX1 A;  4JWC A;  2C08 A;  4KIK B;  4R5J A;  2AR5 A;  3CKD A;  3BLB A;  4BNE A;  1O7K A;  4IWP A;  3BVT A;  2Q12 A;  3SOG A;  2WYI A;  1KMD A;  4F00 A;  2CSK A;  1MJG A;  4G6Q A;  3ZED A;  2WIN M;  3CV5 A;  3LUI A;  3P0C A;  2JNS A;  2F7R A;  4FZO A;  2ETT A;  2DYB A;  2YPS A;  3DX2 A;  3T47 A;  2OBM A;  3A98 A;  2YLA A;  4H6H A;  3OWG A;  4I1Q A;  4M0M A;  2OW7 A;  1R5E A;  2EWF A;  2WWE A;  3HPB A;  4EZW A;  2RAK A;  3VEB A;  1XTE A;  3F7W A;  4H8S A;  5FLE X;  3LVT A;  4EZX A;  1X03 A;  4EZO A;  3LMF A;  4R5G A;  2F1A A;  2YIA A;  2Z0N A;  4HY9 A;  3BVV A;  3FD9 A;  1QWN A;  4HYB A;  4IKB B;  3HAJ A;  4NPH A;  3FOG A;  2ND1 A;  4IWO A;  2QKW A;  3SYV A;  5FIG A;  3I01 A;  3DX4 A;  2PMR A;  2RT6 A;  3ER9 B;  1TQW A;  3I04 A;  4IW0 A;  4UDX X;  3ACO A;  3B52 X;  4JN4 A;  3T46 A;  3M3W A;  2V14 A;  1SU7 A;  1QWU A;  2F7O A;  3KDR A;  5TKY A;  3D52 A;  3D2F A;  1PS3 A;  1E2U A;  1OA0 A;  3BUI A;  2CZO A;  3D2E A;  4JNE A;  1E1D A;  1SU6 A;  4PQO A;  2X3W A;  2ALW A;  4AZ7 A;  4P2I A;  3B51 X;  2RAI A;  4IM0 A;  1HWW A;  2OW6 A;  1DKZ A;  1XTN A;  3HAH A;  2ZXQ A;  4AVM A;  2GF4 A;  1LQ7 A;  4H6I A;  3VEA A;  3G9G A;  1SUF A;  3D50 A;  1R34 A;  1TQS A;  4EZZ A;  4FM3 A;  3L3O M;  3D4Z A;  2REA A;  2RAJ A;  3OK8 A;  4IM3 A;  1WDZ A;  4JWE A;  3D51 A;  3DYT A;  3QE6 A;  1O7D B;  3DPQ A;  3L3P A;  2EFK A;  4E81 A;  2YL5 A;  3IQ2 A;  2EX3 B;  3QNJ A;  4EZV A;  4R5I A;  1OCU A;  1O7D C;  4WPE A; 
#chains in the Genus database with same CATH homology
 1KQ6 A;  2I4K A;  3HPC X;  4BGJ A;  4AKV A;  2Q13 A;  2EFL A;  2D4C A;  2C08 A;  5C5B B;  3ACO A;  3QNI A;  2YKT A;  4NSW A;  2AR5 A;  1X04 A;  4ON3 A;  1URU A;  4IKD A;  3M3W A;  4BNE A;  1O7K A;  2V14 A;  2Z0O A;  2X3V A;  4DCN C;  1I4D A;  4ATM A;  2L73 A;  3Q84 A;  3LLL A;  2Q12 A;  2D1L A;  3HAI A;  2Z0V A;  3SOG A;  4OXW A;  2FIC A;  1KMD A;  2CSK A;  2CZO A;  4DYL A;  2V6V A;  3LUI A;  1I49 A;  4PQO A;  2X3W A;  3CAZ A;  3P0C A;  1Y2O A;  4P2J A;  4HAS A;  4PQP A;  4P2I A;  1GD5 A;  3PLT A;  2ETT A;  2DYB A;  2RAI A;  2YPS A;  5C5B A;  1H6H A;  1XTN A;  3HAH A;  4AVM A;  4I1Q A;  4NQI A;  2ELB A;  3G9G A;  1I4L A;  2IWL X;  2WWE A;  3HPB A;  2RAK A;  1XTE A;  4AZ9 A;  4H8S A;  3QWE A;  1X03 A;  4FZS A;  2REA A;  2RAJ A;  3OK8 A;  2Z0N A;  1WDZ A;  3ABH A;  1OCS A;  4IKB B;  3DYT A;  3QE6 A;  3HAJ A;  3FOG A;  1I4T A;  2X3X A;  2EFK A;  4WPC A;  2RED A;  3IQ2 A;  3SYV A;  4PZG A;  1OCU A;  1ZWW A;  2V0O A;  3Q0K A;  4WPE A;  4IKB A;  3I2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...