2RAIA

The px-bar membrane remodeling unit of sorting nexin 9
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
382
structure length
363
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 363
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2raiA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2raiA02
2WWEA 4ON3A 2RAJA 2CZOA 4IKBA 3ACOA 4P2IA 4I1QA 2REAA 3I2WA 3HPCX 1I4LA 1XTEA 4DCNC 1I4DA 4FZSA 2C08A 2FICA 2X3VA 3CAZA 4AVMA 2I4KA 4WPEA 1X03A 1GD5A 2Q13A 5C5BA 1I49A 4DYLA 2EFLA 4WPCA 2CSKA 4BGJA 3QWEA 4NSWA 2Z0OA 4NQIA 3IQ2A 2AR5A 3G9GA 1I4TA 3HAIA 2EFKA 3M3WA 3OK8A 3HPBA 3HAHA 1H6HA 3QE6A 4OXWA 2DYBA 1URUA 2Z0NA 1Y2OA 4BNEA 2RAKA 1KQ6A 1XTNA 4IKDA 2ETTA 2YKTA 1OCSA 4AZ9A 2IWLX 4HASA 3ABHA 1O7KA 2V14A 4PQPA 2V6VA 4IKBB 3P0CA 1ZWWA 3Q84A 3SOGA 2L73A 1OCUA 3LUIA 3HAJA 2V0OA 3PLTA 2X3WA 3DYTA 2Q12A 4ATMA 2RAIA 2YPSA 4P2JA 5C5BB 3QNIA 2REDA 2D4CA 3SYVA 4PQOA 1WDZA 4H8SA 2Z0VA 2D1LA 1X04A 4AKVA 2X3XA 3Q0KA 1KMDA 3LLLA 2ELBA 3FOGA 4PZGA
chains in the Genus database with same CATH superfamily
4IKBA 1GN9A 3EJQA 3ER9B 2OW7A 1SU7A 3UITA 4EZOA 2N3KA 1I4DA 3D50A 4AZ7A 4UDXX 2QXLA 4AVMA 1GD5A 4EZYA 3KDRA 4DYLA 4HR1B 4BGJA 3QWEA 1I4TA 3OK8A 3HPBA 3RV1A 1H6HA 3EJSA 2DYBA 3CV5A 4BNEA 4IKDA 1O7DB 1OA0A 1QX1A 1W9MA 3B51X 4JWDA 4IWPA 3RPMA 5FIGA 1YWMA 4PQPA 2V6VA 4IKBB 3I04A 1DKYA 1ZWWA 4EZSA 3DPPA 1OCUA 2ALWA 1TQWA 2V0OA 2QFFA 3GI7A 3D4ZA 3O3MB 4M0MA 3BUDA 1WDZA 1TQTA 3DX2A 2OO2A 2YIVX 2Z8YA 3LLLA 4JWEA 4AZBA 3T47A 3ACOA 4P2IA 5KBPA 4I1QA 2REAA 4D8JA 2GA9D 3DPOA 4AZ5A 3A98A 1I4LA 3C7NA 2EWFA 2C08A 4EZUA 1SU8A 4AZIA 2I4KA 3CAZA 4WPEA 1I49A 3D52A 2CSKA 2F1BA 3EJPA 4AZ6A 3DX1A 3HAHA 2PMRA 3QE6A 3DX0A 2RAKA 2ETTA 2MI7A 4HASA 3ABHA 1R5EA 3DPQA 4R5GA 3KAVA 3D51A 3CVRA 1SUFA 2F18A 1E2UA 3CZSA 2V14A 3BUIA 3P0CA 4R5IA 3SOGA 2YL8A 2L73A 1LQ7A 4NPHA 2ZXQA 4R5KA 4JNEA 3DYTA 3VKHA 2F7RA 4H6IA 2ND0A 1DKXA 2LXYA 4P2JA 3QNIA 4AZCA 2D4CA 1QWNA 1E1DA 3DX3A 4H8SA 3QNJA 3BVXA 1OA1A 3L3PA 2JNSA 2F7QA 4AKVA 3D4YA 2YL9A 2GF4A 2ELBA 4PZGA 4ON3A 4E3CA 3CKDA 1U00A 3O3OB 3I2WA 1HTYA 3O3NB 1XTEA 4G6QA 1TQVA 4HYBA 4DCNC 4FZSA 4EZNA 3ZEDA 1X03A 2KHOA 2X5CA 2EFLA 4NSWA 4KIKB 2OZNB 1R34A 2GAFD 4JWCA 3G9GA 2ND1A 2EFKA 1ZYLA 4AZCB 4OXWA 2YL6A 1URUA 3BVVA 2YLAA 1UPXA 4AZ9A 4JLCA 1XTNA 2OW6A 3BUBA 2PY6A 1PS3A 1TQUA 1O7KA 2YIBA 2JNKA 3T48A 4EZRA 1O7DC 4EZTA 2F1AA 3ER8C 3T49A 4IWQA 3PLTA 2X3WA 4R5JA 3B53X 4JWIA 4ATMA 2RAIA 3RV0A 3L3OM 2O0I1 3BUPA 2YL5A 4UDYX 2WYIA 4IM3A 2REDA 4IW0A 3D2FA 2YI8A 4F01A 3D2EA 5E84A 4AZGA 2D1LA 2LM0A 2X3XA 1E9VA 3BLBA 3B52X 2WWEA 4KIKA 3T46A 2FYVA 1HWWA 2RAJA 3VEAA 2CZOA 1TQSA 4FM3A 2OBMA 3DX4A 3HPCX 4FZOA 5TKYA 3DDGA 3EJUA 2WINM 3QA8A 2FICA 2X3VA 4JN4A 2Q13A 5C5BA 3BVUA 3BVTA 2YLLA 4WPCA 3F7WA 3I01A 2NCZA 2Z0OA 4NQIA 2WYHA 3LVTA 3EJRA 4HY9A 3IQ2A 2AR5A 4JNFA 3HAIA 4PO2A 4H6HA 3M3WA 2YIAA 1GNLA 1OAOA 2EX3B 4EZXA 4IM2A 2Z0NA 1Y2OA 1KQ6A 4JL9A 2YKTA 1OCSA 2IWLX 2RT6A 4EZVA 3FD9A 3OHXM 2F7PA 4F00A 3Q84A 4EZZA 3EJTA 4R5LA 5FLEX 4EZWA 4B9QA 3LUIA 3HAJA 3I39X 3ERCC 2QKWA 1R33A 4HR1A 1QWUA 2Q12A 4AZHA 2YPSA 1HXKA 2OBLA 3LMFA 5C5BB 2YI9A 3T4AG 2F7OA 3KAWA 3SYVA 4PQOA 3OWGA 1GNTA 3CZNA 3BVWA 1JQKA 1SU6A 1DKZA 4E81A 3DDFA 4FZPA 3VEBA 4EZPA 2Z0VA 1X04A 3Q0KA 4IWOA 3BUQA 1KMDA 4EZQA 3FOGA 1MJGA 4IM0A
chains in the Genus database with same CATH topology
2WWEA 4ON3A 2RAJA 2CZOA 4IKBA 3ACOA 4P2IA 4I1QA 2REAA 3I2WA 3HPCX 1I4LA 1XTEA 4DCNC 1I4DA 4FZSA 2C08A 2FICA 2X3VA 3CAZA 4AVMA 2I4KA 4WPEA 1X03A 1GD5A 2Q13A 5C5BA 1I49A 4DYLA 2EFLA 4WPCA 2CSKA 4BGJA 3QWEA 4NSWA 2Z0OA 4NQIA 3IQ2A 2AR5A 3G9GA 1I4TA 3HAIA 2EFKA 3M3WA 3OK8A 3HPBA 3HAHA 1H6HA 3QE6A 4OXWA 2DYBA 1URUA 2Z0NA 1Y2OA 4BNEA 2RAKA 1KQ6A 1XTNA 4IKDA 2ETTA 2YKTA 1OCSA 4AZ9A 2IWLX 4HASA 3ABHA 1O7KA 2V14A 4PQPA 2V6VA 4IKBB 3P0CA 1ZWWA 3Q84A 3SOGA 2L73A 1OCUA 3LUIA 3HAJA 2V0OA 3PLTA 2X3WA 3DYTA 2Q12A 4ATMA 2RAIA 2YPSA 4P2JA 5C5BB 3QNIA 2REDA 2D4CA 3SYVA 4PQOA 1WDZA 4H8SA 2Z0VA 2D1LA 1X04A 4AKVA 2X3XA 3Q0KA 1KMDA 3LLLA 2ELBA 3FOGA 4PZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWE A;  4ON3 A;  2RAJ A;  2CZO A;  4IKB A;  3ACO A;  4P2I A;  4I1Q A;  2REA A;  3I2W A;  3HPC X;  1I4L A;  1XTE A;  4DCN C;  1I4D A;  4FZS A;  2C08 A;  2FIC A;  2X3V A;  3CAZ A;  4AVM A;  2I4K A;  4WPE A;  1X03 A;  1GD5 A;  2Q13 A;  5C5B A;  1I49 A;  4DYL A;  2EFL A;  4WPC A;  2CSK A;  4BGJ A;  3QWE A;  4NSW A;  2Z0O A;  4NQI A;  3IQ2 A;  2AR5 A;  3G9G A;  1I4T A;  3HAI A;  2EFK A;  3M3W A;  3OK8 A;  3HPB A;  3HAH A;  1H6H A;  3QE6 A;  4OXW A;  2DYB A;  1URU A;  2Z0N A;  1Y2O A;  4BNE A;  2RAK A;  1KQ6 A;  1XTN A;  4IKD A;  2ETT A;  2YKT A;  1OCS A;  4AZ9 A;  2IWL X;  4HAS A;  3ABH A;  1O7K A;  2V14 A;  4PQP A;  2V6V A;  4IKB B;  3P0C A;  1ZWW A;  3Q84 A;  3SOG A;  2L73 A;  1OCU A;  3LUI A;  3HAJ A;  2V0O A;  3PLT A;  2X3W A;  3DYT A;  2Q12 A;  4ATM A;  2RAI A;  2YPS A;  4P2J A;  5C5B B;  3QNI A;  2RED A;  2D4C A;  3SYV A;  4PQO A;  1WDZ A;  4H8S A;  2Z0V A;  2D1L A;  1X04 A;  4AKV A;  2X3X A;  3Q0K A;  1KMD A;  3LLL A;  2ELB A;  3FOG A;  4PZG A; 
#chains in the Genus database with same CATH topology
 4IKB A;  1GN9 A;  3EJQ A;  3ER9 B;  2OW7 A;  1SU7 A;  3UIT A;  4EZO A;  2N3K A;  1I4D A;  3D50 A;  4AZ7 A;  4UDX X;  2QXL A;  4AVM A;  1GD5 A;  4EZY A;  3KDR A;  4DYL A;  4HR1 B;  4BGJ A;  3QWE A;  1I4T A;  3OK8 A;  3HPB A;  3RV1 A;  1H6H A;  3EJS A;  2DYB A;  3CV5 A;  4BNE A;  4IKD A;  1O7D B;  1OA0 A;  1QX1 A;  1W9M A;  3B51 X;  4JWD A;  4IWP A;  3RPM A;  5FIG A;  1YWM A;  4PQP A;  2V6V A;  4IKB B;  3I04 A;  1DKY A;  1ZWW A;  4EZS A;  3DPP A;  1OCU A;  2ALW A;  1TQW A;  2V0O A;  2QFF A;  3GI7 A;  3D4Z A;  3O3M B;  4M0M A;  3BUD A;  1WDZ A;  1TQT A;  3DX2 A;  2OO2 A;  2YIV X;  2Z8Y A;  3LLL A;  4JWE A;  4AZB A;  3T47 A;  3ACO A;  4P2I A;  5KBP A;  4I1Q A;  2REA A;  4D8J A;  2GA9 D;  3DPO A;  4AZ5 A;  3A98 A;  1I4L A;  3C7N A;  2EWF A;  2C08 A;  4EZU A;  1SU8 A;  4AZI A;  2I4K A;  3CAZ A;  4WPE A;  1I49 A;  3D52 A;  2CSK A;  2F1B A;  3EJP A;  4AZ6 A;  3DX1 A;  3HAH A;  2PMR A;  3QE6 A;  3DX0 A;  2RAK A;  2ETT A;  2MI7 A;  4HAS A;  3ABH A;  1R5E A;  3DPQ A;  4R5G A;  3KAV A;  3D51 A;  3CVR A;  1SUF A;  2F18 A;  1E2U A;  3CZS A;  2V14 A;  3BUI A;  3P0C A;  4R5I A;  3SOG A;  2YL8 A;  2L73 A;  1LQ7 A;  4NPH A;  2ZXQ A;  4R5K A;  4JNE A;  3DYT A;  3VKH A;  2F7R A;  4H6I A;  2ND0 A;  1DKX A;  2LXY A;  4P2J A;  3QNI A;  4AZC A;  2D4C A;  1QWN A;  1E1D A;  3DX3 A;  4H8S A;  3QNJ A;  3BVX A;  1OA1 A;  3L3P A;  2JNS A;  2F7Q A;  4AKV A;  3D4Y A;  2YL9 A;  2GF4 A;  2ELB A;  4PZG A;  4ON3 A;  4E3C A;  3CKD A;  1U00 A;  3O3O B;  3I2W A;  1HTY A;  3O3N B;  1XTE A;  4G6Q A;  1TQV A;  4HYB A;  4DCN C;  4FZS A;  4EZN A;  3ZED A;  1X03 A;  2KHO A;  2X5C A;  2EFL A;  4NSW A;  4KIK B;  2OZN B;  1R34 A;  2GAF D;  4JWC A;  3G9G A;  2ND1 A;  2EFK A;  1ZYL A;  4AZC B;  4OXW A;  2YL6 A;  1URU A;  3BVV A;  2YLA A;  1UPX A;  4AZ9 A;  4JLC A;  1XTN A;  2OW6 A;  3BUB A;  2PY6 A;  1PS3 A;  1TQU A;  1O7K A;  2YIB A;  2JNK A;  3T48 A;  4EZR A;  1O7D C;  4EZT A;  2F1A A;  3ER8 C;  3T49 A;  4IWQ A;  3PLT A;  2X3W A;  4R5J A;  3B53 X;  4JWI A;  4ATM A;  2RAI A;  3RV0 A;  3L3O M;  2O0I 1;  3BUP A;  2YL5 A;  4UDY X;  2WYI A;  4IM3 A;  2RED A;  4IW0 A;  3D2F A;  2YI8 A;  4F01 A;  3D2E A;  5E84 A;  4AZG A;  2D1L A;  2LM0 A;  2X3X A;  1E9V A;  3BLB A;  3B52 X;  2WWE A;  4KIK A;  3T46 A;  2FYV A;  1HWW A;  2RAJ A;  3VEA A;  2CZO A;  1TQS A;  4FM3 A;  2OBM A;  3DX4 A;  3HPC X;  4FZO A;  5TKY A;  3DDG A;  3EJU A;  2WIN M;  3QA8 A;  2FIC A;  2X3V A;  4JN4 A;  2Q13 A;  5C5B A;  3BVU A;  3BVT A;  2YLL A;  4WPC A;  3F7W A;  3I01 A;  2NCZ A;  2Z0O A;  4NQI A;  2WYH A;  3LVT A;  3EJR A;  4HY9 A;  3IQ2 A;  2AR5 A;  4JNF A;  3HAI A;  4PO2 A;  4H6H A;  3M3W A;  2YIA A;  1GNL A;  1OAO A;  2EX3 B;  4EZX A;  4IM2 A;  2Z0N A;  1Y2O A;  1KQ6 A;  4JL9 A;  2YKT A;  1OCS A;  2IWL X;  2RT6 A;  4EZV A;  3FD9 A;  3OHX M;  2F7P A;  4F00 A;  3Q84 A;  4EZZ A;  3EJT A;  4R5L A;  5FLE X;  4EZW A;  4B9Q A;  3LUI A;  3HAJ A;  3I39 X;  3ERC C;  2QKW A;  1R33 A;  4HR1 A;  1QWU A;  2Q12 A;  4AZH A;  2YPS A;  1HXK A;  2OBL A;  3LMF A;  5C5B B;  2YI9 A;  3T4A G;  2F7O A;  3KAW A;  3SYV A;  4PQO A;  3OWG A;  1GNT A;  3CZN A;  3BVW A;  1JQK A;  1SU6 A;  1DKZ A;  4E81 A;  3DDF A;  4FZP A;  3VEB A;  4EZP A;  2Z0V A;  1X04 A;  3Q0K A;  4IWO A;  3BUQ A;  1KMD A;  4EZQ A;  3FOG A;  1MJG A;  4IM0 A; 
#chains in the Genus database with same CATH homology
 2WWE A;  4ON3 A;  2RAJ A;  2CZO A;  4IKB A;  3ACO A;  4P2I A;  4I1Q A;  2REA A;  3I2W A;  3HPC X;  1I4L A;  1XTE A;  4DCN C;  1I4D A;  4FZS A;  2C08 A;  2FIC A;  2X3V A;  3CAZ A;  4AVM A;  2I4K A;  4WPE A;  1X03 A;  1GD5 A;  2Q13 A;  5C5B A;  1I49 A;  4DYL A;  2EFL A;  4WPC A;  2CSK A;  4BGJ A;  3QWE A;  4NSW A;  2Z0O A;  4NQI A;  3IQ2 A;  2AR5 A;  3G9G A;  1I4T A;  3HAI A;  2EFK A;  3M3W A;  3OK8 A;  3HPB A;  3HAH A;  1H6H A;  3QE6 A;  4OXW A;  2DYB A;  1URU A;  2Z0N A;  1Y2O A;  4BNE A;  2RAK A;  1KQ6 A;  1XTN A;  4IKD A;  2ETT A;  2YKT A;  1OCS A;  4AZ9 A;  2IWL X;  4HAS A;  3ABH A;  1O7K A;  2V14 A;  4PQP A;  2V6V A;  4IKB B;  3P0C A;  1ZWW A;  3Q84 A;  3SOG A;  2L73 A;  1OCU A;  3LUI A;  3HAJ A;  2V0O A;  3PLT A;  2X3W A;  3DYT A;  2Q12 A;  4ATM A;  2RAI A;  2YPS A;  4P2J A;  5C5B B;  3QNI A;  2RED A;  2D4C A;  3SYV A;  4PQO A;  1WDZ A;  4H8S A;  2Z0V A;  2D1L A;  1X04 A;  4AKV A;  2X3X A;  3Q0K A;  1KMD A;  3LLL A;  2ELB A;  3FOG A;  4PZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...