4PZGA

Crystal structure of human sorting nexin 10 (snx10)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
EEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-10
publication title Structure of human SNX10 reveals insights into its role in human autosomal recessive osteopetrosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 49
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4pzgA00
1H6HA 2REDA 2RAKA 2YPSA 2V14A 2L73A 4PQPA 4IKDA 4P2IA 2I4KA 2REAA 2AR5A 1OCSA 4AZ9A 1O7KA 4IKBB 1KMDA 2RAJA 4P2JA 3LUIA 4HASA 2CZOA 1KQ6A 4PZGA 3IQ2A 3FOGA 1XTNA 4IKBA 2WWEA 3DYTA 3HPBA 2DYBA 2RAIA 3HPCX 4ON3A 3P0CA 2CSKA 1GD5A 2IWLX 2ETTA 4AKVA 4BGJA 1OCUA 4OXWA 4PQOA 1XTEA 2V6VA
chains in the Genus database with same CATH superfamily
1H6HA 2REDA 2RAKA 2YPSA 2V14A 2L73A 4PQPA 4IKDA 4P2IA 2I4KA 2REAA 2AR5A 1OCSA 4AZ9A 1O7KA 4IKBB 1KMDA 2RAJA 4P2JA 3LUIA 4HASA 2CZOA 1KQ6A 4PZGA 3IQ2A 3FOGA 1XTNA 4IKBA 2WWEA 3DYTA 3HPBA 2DYBA 2RAIA 3HPCX 4ON3A 3P0CA 2CSKA 1GD5A 2IWLX 2ETTA 4AKVA 4BGJA 1OCUA 4OXWA 4PQOA 1XTEA 2V6VA
chains in the Genus database with same CATH topology
1H6HA 2REDA 2RAKA 2YPSA 2V14A 2L73A 4PQPA 4IKDA 4P2IA 2I4KA 2REAA 2AR5A 1OCSA 4AZ9A 1O7KA 4IKBB 1KMDA 2RAJA 4P2JA 3LUIA 4HASA 2CZOA 1KQ6A 4PZGA 3IQ2A 3FOGA 1XTNA 4IKBA 2WWEA 3DYTA 3HPBA 2DYBA 2RAIA 3HPCX 4ON3A 3P0CA 2CSKA 1GD5A 2IWLX 2ETTA 4AKVA 4BGJA 1OCUA 4OXWA 4PQOA 1XTEA 2V6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6H A;  2RED A;  2RAK A;  2YPS A;  2V14 A;  2L73 A;  4PQP A;  4IKD A;  4P2I A;  2I4K A;  2REA A;  2AR5 A;  1OCS A;  4AZ9 A;  1O7K A;  4IKB B;  1KMD A;  2RAJ A;  4P2J A;  3LUI A;  4HAS A;  2CZO A;  1KQ6 A;  4PZG A;  3IQ2 A;  3FOG A;  1XTN A;  4IKB A;  2WWE A;  3DYT A;  3HPB A;  2DYB A;  2RAI A;  3HPC X;  4ON3 A;  3P0C A;  2CSK A;  1GD5 A;  2IWL X;  2ETT A;  4AKV A;  4BGJ A;  1OCU A;  4OXW A;  4PQO A;  1XTE A;  2V6V A; 
#chains in the Genus database with same CATH topology
 1H6H A;  2RED A;  2RAK A;  2YPS A;  2V14 A;  2L73 A;  4PQP A;  4IKD A;  4P2I A;  2I4K A;  2REA A;  2AR5 A;  1OCS A;  4AZ9 A;  1O7K A;  4IKB B;  1KMD A;  2RAJ A;  4P2J A;  3LUI A;  4HAS A;  2CZO A;  1KQ6 A;  4PZG A;  3IQ2 A;  3FOG A;  1XTN A;  4IKB A;  2WWE A;  3DYT A;  3HPB A;  2DYB A;  2RAI A;  3HPC X;  4ON3 A;  3P0C A;  2CSK A;  1GD5 A;  2IWL X;  2ETT A;  4AKV A;  4BGJ A;  1OCU A;  4OXW A;  4PQO A;  1XTE A;  2V6V A; 
#chains in the Genus database with same CATH homology
 1H6H A;  2RED A;  2RAK A;  2YPS A;  2V14 A;  2L73 A;  4PQP A;  4IKD A;  4P2I A;  2I4K A;  2REA A;  2AR5 A;  1OCS A;  4AZ9 A;  1O7K A;  4IKB B;  1KMD A;  2RAJ A;  4P2J A;  3LUI A;  4HAS A;  2CZO A;  1KQ6 A;  4PZG A;  3IQ2 A;  3FOG A;  1XTN A;  4IKB A;  2WWE A;  3DYT A;  3HPB A;  2DYB A;  2RAI A;  3HPC X;  4ON3 A;  3P0C A;  2CSK A;  1GD5 A;  2IWL X;  2ETT A;  4AKV A;  4BGJ A;  1OCU A;  4OXW A;  4PQO A;  1XTE A;  2V6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...