2RAJA

So4 bound px-bar membrane remodeling unit of sorting nexin 9
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
382
structure length
382
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 144
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2rajA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2rajA02
4IKDA 3Q84A 2RAIA 3Q0KA 1XTEA 1I4TA 2D4CA 3PLTA 2ELBA 3LLLA 1O7KA 3I2WA 4AKVA 2V6VA 1Y2OA 2Z0NA 2YKTA 2V0OA 2DYBA 4H8SA 4DCNC 4BNEA 2D1LA 4PQOA 2Q12A 2V14A 3DYTA 3LUIA 5C5BB 3QE6A 4IKBA 4ON3A 4PQPA 2AR5A 3CAZA 2REDA 2L73A 4NSWA 2EFLA 3SOGA 2WWEA 3HAJA 4AVMA 3IQ2A 3M3WA 3SYVA 3HPCX 1I4DA 2EFKA 1KMDA 3QNIA 2ETTA 2X3WA 3OK8A 4NQIA 3QWEA 3HAHA 4WPCA 1ZWWA 2REAA 3P0CA 3HAIA 1KQ6A 1URUA 4P2IA 4IKBB 4FZSA 4I1QA 1X03A 2CZOA 4ATMA 4WPEA 2Q13A 2RAKA 2RAJA 3G9GA 2X3XA 3ABHA 2YPSA 2IWLX 1H6HA 1OCUA 4OXWA 3ACOA 3FOGA 2FICA 4DYLA 4BGJA 2X3VA 5C5BA 2I4KA 1XTNA 2CSKA 1I4LA 1OCSA 4HASA 2Z0VA 1GD5A 3HPBA 2Z0OA 4AZ9A 4P2JA 2C08A 1WDZA 4PZGA 1X04A 1I49A
chains in the Genus database with same CATH superfamily
2F7RA 3Q84A 1SU6A 1XTEA 1I4TA 3PLTA 1QWNA 2ELBA 4EZQA 1SUFA 4IW0A 4EZRA 4EZZA 1HWWA 1U00A 4UDYX 2Z8YA 3DX4A 4IWOA 2F7PA 3ZEDA 4H8SA 1HTYA 4EZNA 4BNEA 3D51A 4IWQA 1GN9A 2YL6A 5FIGA 3OHXM 4PQPA 3RPMA 3VKHA 2REDA 4HR1B 2L73A 2YI8A 3D4YA 2MI7A 4AZCA 3SOGA 3KDRA 1TQWA 1GNTA 3IQ2A 1DKXA 1TQSA 4R5JA 2YL5A 3BUDA 2GAFD 3OK8A 3QWEA 4WPCA 3D50A 1QWUA 2F7OA 4M0MA 4PO2A 3KAWA 3DX2A 1OA1A 3VEBA 3BVTA 1MJGA 4I1QA 4R5LA 3O3NB 2NCZA 4WPEA 2OZNB 2X3XA 3B53X 4IM2A 2YIVX 1SU8A 1E9VA 2YIBA 4JL9A 5C5BA 1GNLA 3EJSA 1TQVA 3T4AG 3HPBA 3T49A 1DKZA 2O0I1 1R34A 2RAIA 3Q0KA 2D4CA 4JN4A 1O7DC 2PY6A 3T47A 3D52A 3D2FA 2V6VA 1Y2OA 1DKYA 3DPQA 2ALWA 4R5GA 2GF4A 2Q12A 4KIKA 3RV0A 3DYTA 4EZPA 3LUIA 5C5BB 4EZSA 4IKBA 4ON3A 3D2EA 3CAZA 3BUIA 4FZOA 3DDGA 1LQ7A 4JWDA 3HAJA 4E3CA 3B51X 5E84A 3SYVA 1OA0A 2EFKA 4IM3A 3O3OB 2WINM 4AZBA 1SU7A 2ETTA 2OO2A 1ZWWA 2REAA 1QX1A 2LM0A 1KQ6A 1JQKA 1URUA 1R5EA 3BUQA 2PMRA 4IKBB 5TKYA 4R5IA 3OWGA 4AZ7A 2CZOA 4ATMA 2Q13A 4EZWA 3ABHA 4E81A 2LXYA 2YPSA 4F00A 1OCUA 4OXWA 3ACOA 2X5CA 3ERCC 4BGJA 2X3VA 4JWCA 2OBLA 1XTNA 1I4LA 1YWMA 4JWIA 3BUBA 2Z0OA 1E2UA 4P2JA 2C08A 1X04A 1W9MA 3ER8C 3B52X 4AZCB 3BUPA 4EZUA 3EJQA 4JWEA 2F7QA 3RV1A 4AZHA 4AKVA 3T46A 4EZTA 1E1DA 2OW7A 3DPOA 2D1LA 4UDXX 4PQOA 2WYIA 4FZPA 4R5KA 3QE6A 4G6QA 2AR5A 4EZYA 4NSWA 4FM3A 3F7WA 2WWEA 3BVWA 3GI7A 2YLLA 4AVMA 3HPCX 3KAVA 3CZNA 3QNIA 3O3MB 4NQIA 3QA8A 2YL9A 3CZSA 4F01A 2GA9D 3VEAA 4AZGA 4EZVA 4P2IA 2JNSA 1R33A 4HR1A 1HXKA 1X03A 3LMFA 3BVXA 2QKWA 2RAKA 2RAJA 3G9GA 3T48A 2ND0A 3CKDA 4JNFA 3BVUA 2KHOA 3BVVA 4H6IA 2I4KA 2CSKA 1OAOA 4KIKB 4HASA 3L3PA 2EX3B 2EWFA 2WYHA 3BLBA 1GD5A 2OBMA 1WDZA 3D4ZA 4IWPA 2F1AA 4HY9A 4IM0A 4AZIA 1I49A 3FOGA 4IKDA 3LLLA 2YIAA 5FLEX 3DX1A 3DDFA 1O7KA 1UPXA 3I2WA 2Z0NA 2N3KA 2YKTA 2V0OA 2DYBA 4DCNC 2F18A 4JLCA 3DX0A 2V14A 3EJPA 3CVRA 4B9QA 3EJRA 2EFLA 3EJUA 4NPHA 4AZ6A 2JNKA 3M3WA 2QFFA 1I4DA 1KMDA 2X3WA 5KBPA 4AZ5A 3HAHA 3I04A 3P0CA 1PS3A 4HYBA 3FD9A 3HAIA 1TQTA 2ZXQA 3CV5A 2YL8A 2OW6A 4FZSA 2RT6A 1TQUA 3EJTA 3I39X 1O7DB 4D8JA 2IWLX 1H6HA 2QXLA 1ZYLA 2YLAA 2FICA 4JNEA 4DYLA 3I01A 3C7NA 3A98A 3LVTA 2ND1A 1OCSA 3ER9B 2Z0VA 3UITA 2YI9A 3L3OM 2FYVA 4AZ9A 3DX3A 2F1BA 4PZGA 4EZXA 3QNJA 3DPPA 4H6HA 4EZOA
chains in the Genus database with same CATH topology
4IKDA 3Q84A 2RAIA 3Q0KA 1XTEA 1I4TA 2D4CA 3PLTA 2ELBA 3LLLA 1O7KA 3I2WA 4AKVA 2V6VA 1Y2OA 2Z0NA 2YKTA 2V0OA 2DYBA 4H8SA 4DCNC 4BNEA 2D1LA 4PQOA 2Q12A 2V14A 3DYTA 3LUIA 5C5BB 3QE6A 4IKBA 4ON3A 4PQPA 2AR5A 3CAZA 2REDA 2L73A 4NSWA 2EFLA 3SOGA 2WWEA 3HAJA 4AVMA 3IQ2A 3M3WA 3SYVA 3HPCX 1I4DA 2EFKA 1KMDA 3QNIA 2ETTA 2X3WA 3OK8A 4NQIA 3QWEA 3HAHA 4WPCA 1ZWWA 2REAA 3P0CA 3HAIA 1KQ6A 1URUA 4P2IA 4IKBB 4FZSA 4I1QA 1X03A 2CZOA 4ATMA 4WPEA 2Q13A 2RAKA 2RAJA 3G9GA 2X3XA 3ABHA 2YPSA 2IWLX 1H6HA 1OCUA 4OXWA 3ACOA 3FOGA 2FICA 4DYLA 4BGJA 2X3VA 5C5BA 2I4KA 1XTNA 2CSKA 1I4LA 1OCSA 4HASA 2Z0VA 1GD5A 3HPBA 2Z0OA 4AZ9A 4P2JA 2C08A 1WDZA 4PZGA 1X04A 1I49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKD A;  3Q84 A;  2RAI A;  3Q0K A;  1XTE A;  1I4T A;  2D4C A;  3PLT A;  2ELB A;  3LLL A;  1O7K A;  3I2W A;  4AKV A;  2V6V A;  1Y2O A;  2Z0N A;  2YKT A;  2V0O A;  2DYB A;  4H8S A;  4DCN C;  4BNE A;  2D1L A;  4PQO A;  2Q12 A;  2V14 A;  3DYT A;  3LUI A;  5C5B B;  3QE6 A;  4IKB A;  4ON3 A;  4PQP A;  2AR5 A;  3CAZ A;  2RED A;  2L73 A;  4NSW A;  2EFL A;  3SOG A;  2WWE A;  3HAJ A;  4AVM A;  3IQ2 A;  3M3W A;  3SYV A;  3HPC X;  1I4D A;  2EFK A;  1KMD A;  3QNI A;  2ETT A;  2X3W A;  3OK8 A;  4NQI A;  3QWE A;  3HAH A;  4WPC A;  1ZWW A;  2REA A;  3P0C A;  3HAI A;  1KQ6 A;  1URU A;  4P2I A;  4IKB B;  4FZS A;  4I1Q A;  1X03 A;  2CZO A;  4ATM A;  4WPE A;  2Q13 A;  2RAK A;  2RAJ A;  3G9G A;  2X3X A;  3ABH A;  2YPS A;  2IWL X;  1H6H A;  1OCU A;  4OXW A;  3ACO A;  3FOG A;  2FIC A;  4DYL A;  4BGJ A;  2X3V A;  5C5B A;  2I4K A;  1XTN A;  2CSK A;  1I4L A;  1OCS A;  4HAS A;  2Z0V A;  1GD5 A;  3HPB A;  2Z0O A;  4AZ9 A;  4P2J A;  2C08 A;  1WDZ A;  4PZG A;  1X04 A;  1I49 A; 
#chains in the Genus database with same CATH topology
 2F7R A;  3Q84 A;  1SU6 A;  1XTE A;  1I4T A;  3PLT A;  1QWN A;  2ELB A;  4EZQ A;  1SUF A;  4IW0 A;  4EZR A;  4EZZ A;  1HWW A;  1U00 A;  4UDY X;  2Z8Y A;  3DX4 A;  4IWO A;  2F7P A;  3ZED A;  4H8S A;  1HTY A;  4EZN A;  4BNE A;  3D51 A;  4IWQ A;  1GN9 A;  2YL6 A;  5FIG A;  3OHX M;  4PQP A;  3RPM A;  3VKH A;  2RED A;  4HR1 B;  2L73 A;  2YI8 A;  3D4Y A;  2MI7 A;  4AZC A;  3SOG A;  3KDR A;  1TQW A;  1GNT A;  3IQ2 A;  1DKX A;  1TQS A;  4R5J A;  2YL5 A;  3BUD A;  2GAF D;  3OK8 A;  3QWE A;  4WPC A;  3D50 A;  1QWU A;  2F7O A;  4M0M A;  4PO2 A;  3KAW A;  3DX2 A;  1OA1 A;  3VEB A;  3BVT A;  1MJG A;  4I1Q A;  4R5L A;  3O3N B;  2NCZ A;  4WPE A;  2OZN B;  2X3X A;  3B53 X;  4IM2 A;  2YIV X;  1SU8 A;  1E9V A;  2YIB A;  4JL9 A;  5C5B A;  1GNL A;  3EJS A;  1TQV A;  3T4A G;  3HPB A;  3T49 A;  1DKZ A;  2O0I 1;  1R34 A;  2RAI A;  3Q0K A;  2D4C A;  4JN4 A;  1O7D C;  2PY6 A;  3T47 A;  3D52 A;  3D2F A;  2V6V A;  1Y2O A;  1DKY A;  3DPQ A;  2ALW A;  4R5G A;  2GF4 A;  2Q12 A;  4KIK A;  3RV0 A;  3DYT A;  4EZP A;  3LUI A;  5C5B B;  4EZS A;  4IKB A;  4ON3 A;  3D2E A;  3CAZ A;  3BUI A;  4FZO A;  3DDG A;  1LQ7 A;  4JWD A;  3HAJ A;  4E3C A;  3B51 X;  5E84 A;  3SYV A;  1OA0 A;  2EFK A;  4IM3 A;  3O3O B;  2WIN M;  4AZB A;  1SU7 A;  2ETT A;  2OO2 A;  1ZWW A;  2REA A;  1QX1 A;  2LM0 A;  1KQ6 A;  1JQK A;  1URU A;  1R5E A;  3BUQ A;  2PMR A;  4IKB B;  5TKY A;  4R5I A;  3OWG A;  4AZ7 A;  2CZO A;  4ATM A;  2Q13 A;  4EZW A;  3ABH A;  4E81 A;  2LXY A;  2YPS A;  4F00 A;  1OCU A;  4OXW A;  3ACO A;  2X5C A;  3ERC C;  4BGJ A;  2X3V A;  4JWC A;  2OBL A;  1XTN A;  1I4L A;  1YWM A;  4JWI A;  3BUB A;  2Z0O A;  1E2U A;  4P2J A;  2C08 A;  1X04 A;  1W9M A;  3ER8 C;  3B52 X;  4AZC B;  3BUP A;  4EZU A;  3EJQ A;  4JWE A;  2F7Q A;  3RV1 A;  4AZH A;  4AKV A;  3T46 A;  4EZT A;  1E1D A;  2OW7 A;  3DPO A;  2D1L A;  4UDX X;  4PQO A;  2WYI A;  4FZP A;  4R5K A;  3QE6 A;  4G6Q A;  2AR5 A;  4EZY A;  4NSW A;  4FM3 A;  3F7W A;  2WWE A;  3BVW A;  3GI7 A;  2YLL A;  4AVM A;  3HPC X;  3KAV A;  3CZN A;  3QNI A;  3O3M B;  4NQI A;  3QA8 A;  2YL9 A;  3CZS A;  4F01 A;  2GA9 D;  3VEA A;  4AZG A;  4EZV A;  4P2I A;  2JNS A;  1R33 A;  4HR1 A;  1HXK A;  1X03 A;  3LMF A;  3BVX A;  2QKW A;  2RAK A;  2RAJ A;  3G9G A;  3T48 A;  2ND0 A;  3CKD A;  4JNF A;  3BVU A;  2KHO A;  3BVV A;  4H6I A;  2I4K A;  2CSK A;  1OAO A;  4KIK B;  4HAS A;  3L3P A;  2EX3 B;  2EWF A;  2WYH A;  3BLB A;  1GD5 A;  2OBM A;  1WDZ A;  3D4Z A;  4IWP A;  2F1A A;  4HY9 A;  4IM0 A;  4AZI A;  1I49 A;  3FOG A;  4IKD A;  3LLL A;  2YIA A;  5FLE X;  3DX1 A;  3DDF A;  1O7K A;  1UPX A;  3I2W A;  2Z0N A;  2N3K A;  2YKT A;  2V0O A;  2DYB A;  4DCN C;  2F18 A;  4JLC A;  3DX0 A;  2V14 A;  3EJP A;  3CVR A;  4B9Q A;  3EJR A;  2EFL A;  3EJU A;  4NPH A;  4AZ6 A;  2JNK A;  3M3W A;  2QFF A;  1I4D A;  1KMD A;  2X3W A;  5KBP A;  4AZ5 A;  3HAH A;  3I04 A;  3P0C A;  1PS3 A;  4HYB A;  3FD9 A;  3HAI A;  1TQT A;  2ZXQ A;  3CV5 A;  2YL8 A;  2OW6 A;  4FZS A;  2RT6 A;  1TQU A;  3EJT A;  3I39 X;  1O7D B;  4D8J A;  2IWL X;  1H6H A;  2QXL A;  1ZYL A;  2YLA A;  2FIC A;  4JNE A;  4DYL A;  3I01 A;  3C7N A;  3A98 A;  3LVT A;  2ND1 A;  1OCS A;  3ER9 B;  2Z0V A;  3UIT A;  2YI9 A;  3L3O M;  2FYV A;  4AZ9 A;  3DX3 A;  2F1B A;  4PZG A;  4EZX A;  3QNJ A;  3DPP A;  4H6H A;  4EZO A; 
#chains in the Genus database with same CATH homology
 4IKD A;  3Q84 A;  2RAI A;  3Q0K A;  1XTE A;  1I4T A;  2D4C A;  3PLT A;  2ELB A;  3LLL A;  1O7K A;  3I2W A;  4AKV A;  2V6V A;  1Y2O A;  2Z0N A;  2YKT A;  2V0O A;  2DYB A;  4H8S A;  4DCN C;  4BNE A;  2D1L A;  4PQO A;  2Q12 A;  2V14 A;  3DYT A;  3LUI A;  5C5B B;  3QE6 A;  4IKB A;  4ON3 A;  4PQP A;  2AR5 A;  3CAZ A;  2RED A;  2L73 A;  4NSW A;  2EFL A;  3SOG A;  2WWE A;  3HAJ A;  4AVM A;  3IQ2 A;  3M3W A;  3SYV A;  3HPC X;  1I4D A;  2EFK A;  1KMD A;  3QNI A;  2ETT A;  2X3W A;  3OK8 A;  4NQI A;  3QWE A;  3HAH A;  4WPC A;  1ZWW A;  2REA A;  3P0C A;  3HAI A;  1KQ6 A;  1URU A;  4P2I A;  4IKB B;  4FZS A;  4I1Q A;  1X03 A;  2CZO A;  4ATM A;  4WPE A;  2Q13 A;  2RAK A;  2RAJ A;  3G9G A;  2X3X A;  3ABH A;  2YPS A;  2IWL X;  1H6H A;  1OCU A;  4OXW A;  3ACO A;  3FOG A;  2FIC A;  4DYL A;  4BGJ A;  2X3V A;  5C5B A;  2I4K A;  1XTN A;  2CSK A;  1I4L A;  1OCS A;  4HAS A;  2Z0V A;  1GD5 A;  3HPB A;  2Z0O A;  4AZ9 A;  4P2J A;  2C08 A;  1WDZ A;  4PZG A;  1X04 A;  1I49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...