2RAJA

So4 bound px-bar membrane remodeling unit of sorting nexin 9
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
382
structure length
382
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 144
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2rajA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2rajA02
3QE6A 2RAIA 2YKTA 2EFKA 2L73A 2RAJA 1OCUA 2X3XA 4PZGA 2V6VA 1GD5A 2C08A 2Z0NA 3ABHA 4ATMA 4FZSA 4P2IA 5C5BA 2FICA 2X3VA 3HAHA 2V0OA 3Q84A 2AR5A 1H6HA 3M3WA 3G9GA 1I4DA 4BGJA 2WWEA 4ON3A 4BNEA 3SYVA 1ZWWA 2Z0OA 4I1QA 4PQOA 3FOGA 3ACOA 4IKBA 3HPBA 3HAJA 2IWLX 2REAA 2D4CA 1X04A 2X3WA 2CSKA 2ETTA 1KQ6A 1I4TA 4DCNC 4HASA 4IKBB 2Q12A 4AZ9A 2Q13A 2RAKA 4PQPA 5C5BB 1XTEA 4NSWA 4AKVA 4DYLA 1OCSA 3CAZA 2I4KA 1WDZA 1KMDA 4WPCA 2ELBA 2V14A 1I49A 2D1LA 4WPEA 3DYTA 1XTNA 3Q0KA 1Y2OA 3OK8A 1URUA 2CZOA 3LLLA 3IQ2A 1X03A 3SOGA 3PLTA 4AVMA 2Z0VA 3QNIA 1I4LA 4NQIA 1O7KA 3QWEA 2REDA 4IKDA 2YPSA 2EFLA 4OXWA 3HPCX 4H8SA 3I2WA 2DYBA 3LUIA 3P0CA 4P2JA 3HAIA
chains in the Genus database with same CATH superfamily
3QE6A 2YKTA 1HTYA 2X3XA 5E84A 1JQKA 1O7DB 3CV5A 2V6VA 1SU8A 4PZGA 2KHOA 4JWDA 3B53X 4ATMA 2N3KA 1DKZA 2OBMA 4FZSA 3OHXM 2FICA 3HAHA 3Q84A 3T49A 1R34A 3CVRA 4EZQA 2YIAA 4G6QA 3LMFA 3BVTA 4R5GA 3O3OB 4BGJA 4EZNA 2GA9D 4BNEA 3D2EA 3SYVA 3VEAA 2F1BA 4I1QA 1SU6A 3RPMA 2OBLA 3DX2A 2YIBA 3DX0A 4R5KA 3QA8A 3ACOA 2F18A 3EJUA 4NPHA 2O0I1 2REAA 2JNKA 3OWGA 1TQSA 2YL9A 1MJGA 3I39X 2RAKA 4JNFA 2OW7A 4R5IA 2MI7A 4JLCA 4AKVA 2YI9A 3CAZA 4EZXA 3LVTA 4R5LA 4WPEA 3D51A 3DYTA 1Y2OA 3D2FA 4EZVA 1URUA 2NCZA 2WYHA 1OAOA 1HXKA 3RV0A 1I4LA 1QX1A 3DPPA 4IKDA 3HPCX 4H8SA 2WYIA 1HWWA 2RT6A 2FYVA 2OW6A 2L73A 4HYBA 2QXLA 3DDGA 1GD5A 4AZBA 3ABHA 4AZ6A 3DPOA 5C5BA 1YWMA 1H6HA 3G9GA 2WWEA 3ERCC 2OO2A 2LXYA 4AZ5A 3QNJA 2Z0OA 4PQOA 3BUIA 3DX1A 3HPBA 1W9MA 3DX4A 4D8JA 4H6HA 4IM2A 4IKBB 4AZ9A 3CZSA 4AZ7A 1ZYLA 1DKYA 4PQPA 5C5BB 4R5JA 1O7DC 1XTEA 4FM3A 4DYLA 3RV1A 4WPCA 3T48A 2PY6A 4IM3A 4EZRA 4JWCA 2D1LA 3D50A 2EX3B 2YLLA 3Q0KA 4JNEA 3OK8A 3CKDA 4IWPA 3LLLA 1E2UA 1GNTA 2F1AA 2ALWA 2YL8A 3I04A 2Z0VA 4NQIA 2JNSA 2REDA 3EJRA 2YPSA 1DKXA 4JL9A 2EFLA 3B52X 2WINM 4F01A 2F7RA 3BUQA 1UPXA 4KIKA 2DYBA 2ZXQA 3LUIA 1GNLA 4JWIA 3KDRA 3BVVA 2RAIA 4AZCA 3BLBA 1TQWA 3BUBA 1E9VA 4IM0A 3ER8C 2EWFA 3T46A 5FIGA 2X3VA 2V0OA 2AR5A 4FZOA 1LQ7A 3M3WA 3D4ZA 1SU7A 1I4DA 3T4AG 3O3NB 5KBPA 3I01A 4IW0A 1OA1A 2YLAA 3FOGA 4IKBA 4KIKB 4E3CA 3HAJA 2YL5A 2X5CA 4F00A 2D4CA 1X04A 2X3WA 3ER9B 4AZCB 2ETTA 3C7NA 3L3PA 1KQ6A 1I4TA 4DCNC 3BVXA 3FD9A 2ND1A 2Q13A 3BUPA 4EZPA 2PMRA 1KMDA 4E81A 1WDZA 2I4KA 1OA0A 4JN4A 2YL6A 2ELBA 4EZSA 3VKHA 1I49A 2OZNB 2LM0A 4EZUA 1QWUA 1R33A 2CZOA 3KAWA 4IWOA 1E1DA 3L3OM 3SOGA 3PLTA 1PS3A 2YIVX 3GI7A 3QNIA 1O7KA 2GAFD 3D52A 5TKYA 3BVWA 3D4YA 3A98A 3UITA 4JWEA 1TQTA 3P0CA 3ZEDA 4P2JA 2EFKA 2F7QA 2RAJA 1OCUA 3B51X 3KAVA 4UDYX 3EJQA 1QWNA 2C08A 2Z0NA 4HY9A 1TQUA 4P2IA 3BVUA 2GF4A 4UDXX 3EJTA 5FLEX 4H6IA 3F7WA 4EZTA 4B9QA 3DX3A 4ON3A 3O3MB 3DDFA 4M0MA 1ZWWA 3EJSA 4EZZA 4AZIA 3EJPA 1R5EA 2IWLX 2CSKA 3T47A 4EZOA 3VEBA 4HASA 2Q12A 4HR1A 2QFFA 4EZWA 4NSWA 3DPQA 1OCSA 2ND0A 2V14A 1XTNA 2YI8A 4IWQA 4EZYA 2F7PA 3IQ2A 1TQVA 1X03A 3CZNA 2QKWA 1U00A 1GN9A 2Z8YA 4AVMA 1SUFA 2F7OA 3QWEA 4PO2A 4AZHA 4FZPA 4OXWA 4AZGA 3I2WA 3BUDA 4HR1B 3HAIA
chains in the Genus database with same CATH topology
3QE6A 2RAIA 2YKTA 2EFKA 2L73A 2RAJA 1OCUA 2X3XA 4PZGA 2V6VA 1GD5A 2C08A 2Z0NA 3ABHA 4ATMA 4FZSA 4P2IA 5C5BA 2FICA 2X3VA 3HAHA 2V0OA 3Q84A 2AR5A 1H6HA 3M3WA 3G9GA 1I4DA 4BGJA 2WWEA 4ON3A 4BNEA 3SYVA 1ZWWA 2Z0OA 4I1QA 4PQOA 3FOGA 3ACOA 4IKBA 3HPBA 3HAJA 2IWLX 2REAA 2D4CA 1X04A 2X3WA 2CSKA 2ETTA 1KQ6A 1I4TA 4DCNC 4HASA 4IKBB 2Q12A 4AZ9A 2Q13A 2RAKA 4PQPA 5C5BB 1XTEA 4NSWA 4AKVA 4DYLA 1OCSA 3CAZA 2I4KA 1WDZA 1KMDA 4WPCA 2ELBA 2V14A 1I49A 2D1LA 4WPEA 3DYTA 1XTNA 3Q0KA 1Y2OA 3OK8A 1URUA 2CZOA 3LLLA 3IQ2A 1X03A 3SOGA 3PLTA 4AVMA 2Z0VA 3QNIA 1I4LA 4NQIA 1O7KA 3QWEA 2REDA 4IKDA 2YPSA 2EFLA 4OXWA 3HPCX 4H8SA 3I2WA 2DYBA 3LUIA 3P0CA 4P2JA 3HAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QE6 A;  2RAI A;  2YKT A;  2EFK A;  2L73 A;  2RAJ A;  1OCU A;  2X3X A;  4PZG A;  2V6V A;  1GD5 A;  2C08 A;  2Z0N A;  3ABH A;  4ATM A;  4FZS A;  4P2I A;  5C5B A;  2FIC A;  2X3V A;  3HAH A;  2V0O A;  3Q84 A;  2AR5 A;  1H6H A;  3M3W A;  3G9G A;  1I4D A;  4BGJ A;  2WWE A;  4ON3 A;  4BNE A;  3SYV A;  1ZWW A;  2Z0O A;  4I1Q A;  4PQO A;  3FOG A;  3ACO A;  4IKB A;  3HPB A;  3HAJ A;  2IWL X;  2REA A;  2D4C A;  1X04 A;  2X3W A;  2CSK A;  2ETT A;  1KQ6 A;  1I4T A;  4DCN C;  4HAS A;  4IKB B;  2Q12 A;  4AZ9 A;  2Q13 A;  2RAK A;  4PQP A;  5C5B B;  1XTE A;  4NSW A;  4AKV A;  4DYL A;  1OCS A;  3CAZ A;  2I4K A;  1WDZ A;  1KMD A;  4WPC A;  2ELB A;  2V14 A;  1I49 A;  2D1L A;  4WPE A;  3DYT A;  1XTN A;  3Q0K A;  1Y2O A;  3OK8 A;  1URU A;  2CZO A;  3LLL A;  3IQ2 A;  1X03 A;  3SOG A;  3PLT A;  4AVM A;  2Z0V A;  3QNI A;  1I4L A;  4NQI A;  1O7K A;  3QWE A;  2RED A;  4IKD A;  2YPS A;  2EFL A;  4OXW A;  3HPC X;  4H8S A;  3I2W A;  2DYB A;  3LUI A;  3P0C A;  4P2J A;  3HAI A; 
#chains in the Genus database with same CATH topology
 3QE6 A;  2YKT A;  1HTY A;  2X3X A;  5E84 A;  1JQK A;  1O7D B;  3CV5 A;  2V6V A;  1SU8 A;  4PZG A;  2KHO A;  4JWD A;  3B53 X;  4ATM A;  2N3K A;  1DKZ A;  2OBM A;  4FZS A;  3OHX M;  2FIC A;  3HAH A;  3Q84 A;  3T49 A;  1R34 A;  3CVR A;  4EZQ A;  2YIA A;  4G6Q A;  3LMF A;  3BVT A;  4R5G A;  3O3O B;  4BGJ A;  4EZN A;  2GA9 D;  4BNE A;  3D2E A;  3SYV A;  3VEA A;  2F1B A;  4I1Q A;  1SU6 A;  3RPM A;  2OBL A;  3DX2 A;  2YIB A;  3DX0 A;  4R5K A;  3QA8 A;  3ACO A;  2F18 A;  3EJU A;  4NPH A;  2O0I 1;  2REA A;  2JNK A;  3OWG A;  1TQS A;  2YL9 A;  1MJG A;  3I39 X;  2RAK A;  4JNF A;  2OW7 A;  4R5I A;  2MI7 A;  4JLC A;  4AKV A;  2YI9 A;  3CAZ A;  4EZX A;  3LVT A;  4R5L A;  4WPE A;  3D51 A;  3DYT A;  1Y2O A;  3D2F A;  4EZV A;  1URU A;  2NCZ A;  2WYH A;  1OAO A;  1HXK A;  3RV0 A;  1I4L A;  1QX1 A;  3DPP A;  4IKD A;  3HPC X;  4H8S A;  2WYI A;  1HWW A;  2RT6 A;  2FYV A;  2OW6 A;  2L73 A;  4HYB A;  2QXL A;  3DDG A;  1GD5 A;  4AZB A;  3ABH A;  4AZ6 A;  3DPO A;  5C5B A;  1YWM A;  1H6H A;  3G9G A;  2WWE A;  3ERC C;  2OO2 A;  2LXY A;  4AZ5 A;  3QNJ A;  2Z0O A;  4PQO A;  3BUI A;  3DX1 A;  3HPB A;  1W9M A;  3DX4 A;  4D8J A;  4H6H A;  4IM2 A;  4IKB B;  4AZ9 A;  3CZS A;  4AZ7 A;  1ZYL A;  1DKY A;  4PQP A;  5C5B B;  4R5J A;  1O7D C;  1XTE A;  4FM3 A;  4DYL A;  3RV1 A;  4WPC A;  3T48 A;  2PY6 A;  4IM3 A;  4EZR A;  4JWC A;  2D1L A;  3D50 A;  2EX3 B;  2YLL A;  3Q0K A;  4JNE A;  3OK8 A;  3CKD A;  4IWP A;  3LLL A;  1E2U A;  1GNT A;  2F1A A;  2ALW A;  2YL8 A;  3I04 A;  2Z0V A;  4NQI A;  2JNS A;  2RED A;  3EJR A;  2YPS A;  1DKX A;  4JL9 A;  2EFL A;  3B52 X;  2WIN M;  4F01 A;  2F7R A;  3BUQ A;  1UPX A;  4KIK A;  2DYB A;  2ZXQ A;  3LUI A;  1GNL A;  4JWI A;  3KDR A;  3BVV A;  2RAI A;  4AZC A;  3BLB A;  1TQW A;  3BUB A;  1E9V A;  4IM0 A;  3ER8 C;  2EWF A;  3T46 A;  5FIG A;  2X3V A;  2V0O A;  2AR5 A;  4FZO A;  1LQ7 A;  3M3W A;  3D4Z A;  1SU7 A;  1I4D A;  3T4A G;  3O3N B;  5KBP A;  3I01 A;  4IW0 A;  1OA1 A;  2YLA A;  3FOG A;  4IKB A;  4KIK B;  4E3C A;  3HAJ A;  2YL5 A;  2X5C A;  4F00 A;  2D4C A;  1X04 A;  2X3W A;  3ER9 B;  4AZC B;  2ETT A;  3C7N A;  3L3P A;  1KQ6 A;  1I4T A;  4DCN C;  3BVX A;  3FD9 A;  2ND1 A;  2Q13 A;  3BUP A;  4EZP A;  2PMR A;  1KMD A;  4E81 A;  1WDZ A;  2I4K A;  1OA0 A;  4JN4 A;  2YL6 A;  2ELB A;  4EZS A;  3VKH A;  1I49 A;  2OZN B;  2LM0 A;  4EZU A;  1QWU A;  1R33 A;  2CZO A;  3KAW A;  4IWO A;  1E1D A;  3L3O M;  3SOG A;  3PLT A;  1PS3 A;  2YIV X;  3GI7 A;  3QNI A;  1O7K A;  2GAF D;  3D52 A;  5TKY A;  3BVW A;  3D4Y A;  3A98 A;  3UIT A;  4JWE A;  1TQT A;  3P0C A;  3ZED A;  4P2J A;  2EFK A;  2F7Q A;  2RAJ A;  1OCU A;  3B51 X;  3KAV A;  4UDY X;  3EJQ A;  1QWN A;  2C08 A;  2Z0N A;  4HY9 A;  1TQU A;  4P2I A;  3BVU A;  2GF4 A;  4UDX X;  3EJT A;  5FLE X;  4H6I A;  3F7W A;  4EZT A;  4B9Q A;  3DX3 A;  4ON3 A;  3O3M B;  3DDF A;  4M0M A;  1ZWW A;  3EJS A;  4EZZ A;  4AZI A;  3EJP A;  1R5E A;  2IWL X;  2CSK A;  3T47 A;  4EZO A;  3VEB A;  4HAS A;  2Q12 A;  4HR1 A;  2QFF A;  4EZW A;  4NSW A;  3DPQ A;  1OCS A;  2ND0 A;  2V14 A;  1XTN A;  2YI8 A;  4IWQ A;  4EZY A;  2F7P A;  3IQ2 A;  1TQV A;  1X03 A;  3CZN A;  2QKW A;  1U00 A;  1GN9 A;  2Z8Y A;  4AVM A;  1SUF A;  2F7O A;  3QWE A;  4PO2 A;  4AZH A;  4FZP A;  4OXW A;  4AZG A;  3I2W A;  3BUD A;  4HR1 B;  3HAI A; 
#chains in the Genus database with same CATH homology
 3QE6 A;  2RAI A;  2YKT A;  2EFK A;  2L73 A;  2RAJ A;  1OCU A;  2X3X A;  4PZG A;  2V6V A;  1GD5 A;  2C08 A;  2Z0N A;  3ABH A;  4ATM A;  4FZS A;  4P2I A;  5C5B A;  2FIC A;  2X3V A;  3HAH A;  2V0O A;  3Q84 A;  2AR5 A;  1H6H A;  3M3W A;  3G9G A;  1I4D A;  4BGJ A;  2WWE A;  4ON3 A;  4BNE A;  3SYV A;  1ZWW A;  2Z0O A;  4I1Q A;  4PQO A;  3FOG A;  3ACO A;  4IKB A;  3HPB A;  3HAJ A;  2IWL X;  2REA A;  2D4C A;  1X04 A;  2X3W A;  2CSK A;  2ETT A;  1KQ6 A;  1I4T A;  4DCN C;  4HAS A;  4IKB B;  2Q12 A;  4AZ9 A;  2Q13 A;  2RAK A;  4PQP A;  5C5B B;  1XTE A;  4NSW A;  4AKV A;  4DYL A;  1OCS A;  3CAZ A;  2I4K A;  1WDZ A;  1KMD A;  4WPC A;  2ELB A;  2V14 A;  1I49 A;  2D1L A;  4WPE A;  3DYT A;  1XTN A;  3Q0K A;  1Y2O A;  3OK8 A;  1URU A;  2CZO A;  3LLL A;  3IQ2 A;  1X03 A;  3SOG A;  3PLT A;  4AVM A;  2Z0V A;  3QNI A;  1I4L A;  4NQI A;  1O7K A;  3QWE A;  2RED A;  4IKD A;  2YPS A;  2EFL A;  4OXW A;  3HPC X;  4H8S A;  3I2W A;  2DYB A;  3LUI A;  3P0C A;  4P2J A;  3HAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...