2RAJA

So4 bound px-bar membrane remodeling unit of sorting nexin 9
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
382
structure length
382
Chain Sequence
PGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Sorting nexin-9
publication title The PX-BAR membrane-remodeling unit of sorting nexin 9
pubmed doi rcsb
source organism Homo sapiens
total genus 144
structure length 382
sequence length 382
ec nomenclature
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2rajA03
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2rajA02
1I4DA 2DYBA 4ON3A 1O7KA 2X3VA 2CZOA 2IWLX 3Q0KA 4I1QA 3OK8A 2X3XA 3CAZA 4WPCA 1KQ6A 3SYVA 3M3WA 2ETTA 2WWEA 1WDZA 4IKBB 4IKBA 4PQOA 4P2JA 2V6VA 3HPBA 2Z0VA 1H6HA 2RAIA 3HAHA 4AZ9A 4AVMA 4AKVA 2ELBA 4BGJA 2V0OA 3LUIA 1KMDA 4FZSA 4DCNC 1GD5A 1Y2OA 4NQIA 3QNIA 2C08A 4PQPA 4HASA 1I49A 1X03A 2YPSA 2AR5A 3PLTA 3ABHA 4H8SA 1XTEA 3LLLA 1OCUA 4OXWA 2RAKA 2YKTA 1I4LA 3ACOA 2Q12A 2EFKA 4ATMA 2EFLA 2Z0NA 1X04A 2Z0OA 3QE6A 2L73A 3P0CA 3IQ2A 3G9GA 1URUA 2FICA 4PZGA 1I4TA 3HPCX 2D1LA 2CSKA 3FOGA 4IKDA 2RAJA 4BNEA 3DYTA 1OCSA 4P2IA 2D4CA 2I4KA 4NSWA 3I2WA 2REDA 1ZWWA 1XTNA 2Q13A 3HAIA 2V14A 2X3WA 2REAA 3HAJA 3Q84A 5C5BB 3QWEA 5C5BA 3SOGA 4DYLA 4WPEA
chains in the Genus database with same CATH superfamily
4ON3A 2YLAA 1R33A 2IWLX 3F7WA 2ND0A 2OBMA 4FZOA 3EJSA 1DKXA 2X3XA 4FM3A 2WWEA 1R34A 4IKBA 3BLBA 4AZCA 1H6HA 4JNEA 4AVMA 3DPQA 4EZUA 3EJUA 1GD5A 5FLEX 1Y2OA 4EZZA 4HR1A 2YL8A 4NQIA 2OW7A 3FD9A 4IWQA 1TQVA 2C08A 3QA8A 4IM3A 2PY6A 4B9QA 2YPSA 2F7QA 4JWEA 2PMRA 3I04A 4OXWA 2WINM 2YKTA 4R5LA 1I4LA 3ACOA 1R5EA 3C7NA 1OA1A 2F7RA 4JWIA 3G9GA 1URUA 2LXYA 4IWPA 3DX2A 4PZGA 1TQTA 2D1LA 1DKZA 1HTYA 4IKDA 3CVRA 3BVVA 3DYTA 1HWWA 4EZQA 4AZHA 4EZWA 3GI7A 2ALWA 4IM2A 2Q13A 4AZCB 2YLLA 3HAIA 3ZEDA 2WYIA 3KAWA 3QWEA 2X5CA 3EJPA 4E81A 4EZSA 3B53X 1TQUA 2GAFD 1LQ7A 2QFFA 3O3NB 4HR1B 4F00A 4JWCA 1O7KA 2X3VA 4I1QA 3OK8A 4KIKB 3CV5A 4WPCA 1W9MA 2LM0A 2JNKA 2V6VA 4P2JA 3HPBA 2RAIA 4G6QA 3I39X 4AZ9A 2N3KA 4BGJA 3VEAA 3LUIA 2KHOA 3CKDA 4FZSA 3EJRA 4EZXA 2ZXQA 2RT6A 4R5GA 4PQPA 1DKYA 4IM0A 1I49A 1X03A 4AZIA 3PLTA 3ABHA 4AZ5A 1OCUA 1O7DB 4R5JA 3EJTA 5TKYA 3RV1A 5KBPA 3QE6A 1SU6A 3BVUA 4E3CA 2FICA 3LMFA 1I4TA 2QXLA 2WYHA 1GN9A 3BVXA 1GNTA 2F7PA 2OZNB 5E84A 4AZGA 4P2IA 4HYBA 3BUIA 2D4CA 3DDFA 2JNSA 3UITA 2OW6A 4IW0A 3D4ZA 2REDA 2O0I1 3ER8C 1XTNA 3HAJA 5C5BB 3DX0A 4WPEA 3ER9B 4AZBA 3BVWA 3BUQA 4UDXX 1JQKA 2CZOA 3D50A 3Q0KA 1OA0A 5FIGA 2Z8YA 1KQ6A 3SYVA 2ETTA 4IKBB 4PQOA 1WDZA 4H6IA 1E9VA 2ND1A 2Z0VA 4EZVA 4JN4A 3CZNA 1ZYLA 2YIBA 3T46A 3BUDA 3DX4A 2YL9A 4EZOA 1OAOA 1UPXA 3QNJA 3KAVA 4EZYA 3EJQA 1MJGA 3QNIA 1E1DA 4HASA 2AR5A 4AZ7A 1XTEA 4EZRA 4HY9A 2QKWA 3DPOA 3OHXM 4D8JA 4ATMA 2EFLA 4IWOA 2EWFA 2L73A 3IQ2A 4AZ6A 3T47A 1E2UA 3HPCX 2YL6A 2CSKA 1TQWA 2RAJA 4H6HA 4JLCA 2I4KA 2F1BA 4NSWA 4JWDA 3VKHA 4EZPA 4M0MA 1HXKA 3T4AG 2GF4A 3I01A 2V14A 3VEBA 2X3WA 2F18A 3Q84A 2NCZA 4DYLA 2F7OA 2YIVX 2GA9D 3DDGA 1I4DA 2DYBA 1PS3A 1QWNA 2OBLA 1TQSA 3O3MB 3D2FA 3RPMA 4KIKA 2FYVA 2YI9A 3CAZA 4R5IA 3RV0A 4EZTA 2EX3B 3M3WA 3T48A 4JL9A 3KDRA 3OWGA 3D2EA 3D4YA 3HAHA 4UDYX 1QX1A 3BUPA 1QWUA 2OO2A 3BVTA 3BUBA 4AKVA 2ELBA 4JNFA 2V0OA 2YIAA 3O3OB 3B51X 1KMDA 4DCNC 1YWMA 4PO2A 1SUFA 3T49A 3L3PA 1U00A 4NPHA 3D52A 3D51A 2F1AA 1SU8A 4R5KA 2YI8A 2YL5A 4H8SA 3B52X 3LLLA 2RAKA 3DX3A 1GNLA 3DPPA 1SU7A 2Q12A 3LVTA 2EFKA 2Z0NA 1X04A 2Z0OA 3P0CA 3ERCC 3FOGA 4BNEA 3A98A 1OCSA 4F01A 3DX1A 3I2WA 2MI7A 1ZWWA 2REAA 4EZNA 4FZPA 1O7DC 3CZSA 5C5BA 3L3OM 3SOGA
chains in the Genus database with same CATH topology
1I4DA 2DYBA 4ON3A 1O7KA 2X3VA 2CZOA 2IWLX 3Q0KA 4I1QA 3OK8A 2X3XA 3CAZA 4WPCA 1KQ6A 3SYVA 3M3WA 2ETTA 2WWEA 1WDZA 4IKBB 4IKBA 4PQOA 4P2JA 2V6VA 3HPBA 2Z0VA 1H6HA 2RAIA 3HAHA 4AZ9A 4AVMA 4AKVA 2ELBA 4BGJA 2V0OA 3LUIA 1KMDA 4FZSA 4DCNC 1GD5A 1Y2OA 4NQIA 3QNIA 2C08A 4PQPA 4HASA 1I49A 1X03A 2YPSA 2AR5A 3PLTA 3ABHA 4H8SA 1XTEA 3LLLA 1OCUA 4OXWA 2RAKA 2YKTA 1I4LA 3ACOA 2Q12A 2EFKA 4ATMA 2EFLA 2Z0NA 1X04A 2Z0OA 3QE6A 2L73A 3P0CA 3IQ2A 3G9GA 1URUA 2FICA 4PZGA 1I4TA 3HPCX 2D1LA 2CSKA 3FOGA 4IKDA 2RAJA 4BNEA 3DYTA 1OCSA 4P2IA 2D4CA 2I4KA 4NSWA 3I2WA 2REDA 1ZWWA 1XTNA 2Q13A 3HAIA 2V14A 2X3WA 2REAA 3HAJA 3Q84A 5C5BB 3QWEA 5C5BA 3SOGA 4DYLA 4WPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4D A;  2DYB A;  4ON3 A;  1O7K A;  2X3V A;  2CZO A;  2IWL X;  3Q0K A;  4I1Q A;  3OK8 A;  2X3X A;  3CAZ A;  4WPC A;  1KQ6 A;  3SYV A;  3M3W A;  2ETT A;  2WWE A;  1WDZ A;  4IKB B;  4IKB A;  4PQO A;  4P2J A;  2V6V A;  3HPB A;  2Z0V A;  1H6H A;  2RAI A;  3HAH A;  4AZ9 A;  4AVM A;  4AKV A;  2ELB A;  4BGJ A;  2V0O A;  3LUI A;  1KMD A;  4FZS A;  4DCN C;  1GD5 A;  1Y2O A;  4NQI A;  3QNI A;  2C08 A;  4PQP A;  4HAS A;  1I49 A;  1X03 A;  2YPS A;  2AR5 A;  3PLT A;  3ABH A;  4H8S A;  1XTE A;  3LLL A;  1OCU A;  4OXW A;  2RAK A;  2YKT A;  1I4L A;  3ACO A;  2Q12 A;  2EFK A;  4ATM A;  2EFL A;  2Z0N A;  1X04 A;  2Z0O A;  3QE6 A;  2L73 A;  3P0C A;  3IQ2 A;  3G9G A;  1URU A;  2FIC A;  4PZG A;  1I4T A;  3HPC X;  2D1L A;  2CSK A;  3FOG A;  4IKD A;  2RAJ A;  4BNE A;  3DYT A;  1OCS A;  4P2I A;  2D4C A;  2I4K A;  4NSW A;  3I2W A;  2RED A;  1ZWW A;  1XTN A;  2Q13 A;  3HAI A;  2V14 A;  2X3W A;  2REA A;  3HAJ A;  3Q84 A;  5C5B B;  3QWE A;  5C5B A;  3SOG A;  4DYL A;  4WPE A; 
#chains in the Genus database with same CATH topology
 4ON3 A;  2YLA A;  1R33 A;  2IWL X;  3F7W A;  2ND0 A;  2OBM A;  4FZO A;  3EJS A;  1DKX A;  2X3X A;  4FM3 A;  2WWE A;  1R34 A;  4IKB A;  3BLB A;  4AZC A;  1H6H A;  4JNE A;  4AVM A;  3DPQ A;  4EZU A;  3EJU A;  1GD5 A;  5FLE X;  1Y2O A;  4EZZ A;  4HR1 A;  2YL8 A;  4NQI A;  2OW7 A;  3FD9 A;  4IWQ A;  1TQV A;  2C08 A;  3QA8 A;  4IM3 A;  2PY6 A;  4B9Q A;  2YPS A;  2F7Q A;  4JWE A;  2PMR A;  3I04 A;  4OXW A;  2WIN M;  2YKT A;  4R5L A;  1I4L A;  3ACO A;  1R5E A;  3C7N A;  1OA1 A;  2F7R A;  4JWI A;  3G9G A;  1URU A;  2LXY A;  4IWP A;  3DX2 A;  4PZG A;  1TQT A;  2D1L A;  1DKZ A;  1HTY A;  4IKD A;  3CVR A;  3BVV A;  3DYT A;  1HWW A;  4EZQ A;  4AZH A;  4EZW A;  3GI7 A;  2ALW A;  4IM2 A;  2Q13 A;  4AZC B;  2YLL A;  3HAI A;  3ZED A;  2WYI A;  3KAW A;  3QWE A;  2X5C A;  3EJP A;  4E81 A;  4EZS A;  3B53 X;  1TQU A;  2GAF D;  1LQ7 A;  2QFF A;  3O3N B;  4HR1 B;  4F00 A;  4JWC A;  1O7K A;  2X3V A;  4I1Q A;  3OK8 A;  4KIK B;  3CV5 A;  4WPC A;  1W9M A;  2LM0 A;  2JNK A;  2V6V A;  4P2J A;  3HPB A;  2RAI A;  4G6Q A;  3I39 X;  4AZ9 A;  2N3K A;  4BGJ A;  3VEA A;  3LUI A;  2KHO A;  3CKD A;  4FZS A;  3EJR A;  4EZX A;  2ZXQ A;  2RT6 A;  4R5G A;  4PQP A;  1DKY A;  4IM0 A;  1I49 A;  1X03 A;  4AZI A;  3PLT A;  3ABH A;  4AZ5 A;  1OCU A;  1O7D B;  4R5J A;  3EJT A;  5TKY A;  3RV1 A;  5KBP A;  3QE6 A;  1SU6 A;  3BVU A;  4E3C A;  2FIC A;  3LMF A;  1I4T A;  2QXL A;  2WYH A;  1GN9 A;  3BVX A;  1GNT A;  2F7P A;  2OZN B;  5E84 A;  4AZG A;  4P2I A;  4HYB A;  3BUI A;  2D4C A;  3DDF A;  2JNS A;  3UIT A;  2OW6 A;  4IW0 A;  3D4Z A;  2RED A;  2O0I 1;  3ER8 C;  1XTN A;  3HAJ A;  5C5B B;  3DX0 A;  4WPE A;  3ER9 B;  4AZB A;  3BVW A;  3BUQ A;  4UDX X;  1JQK A;  2CZO A;  3D50 A;  3Q0K A;  1OA0 A;  5FIG A;  2Z8Y A;  1KQ6 A;  3SYV A;  2ETT A;  4IKB B;  4PQO A;  1WDZ A;  4H6I A;  1E9V A;  2ND1 A;  2Z0V A;  4EZV A;  4JN4 A;  3CZN A;  1ZYL A;  2YIB A;  3T46 A;  3BUD A;  3DX4 A;  2YL9 A;  4EZO A;  1OAO A;  1UPX A;  3QNJ A;  3KAV A;  4EZY A;  3EJQ A;  1MJG A;  3QNI A;  1E1D A;  4HAS A;  2AR5 A;  4AZ7 A;  1XTE A;  4EZR A;  4HY9 A;  2QKW A;  3DPO A;  3OHX M;  4D8J A;  4ATM A;  2EFL A;  4IWO A;  2EWF A;  2L73 A;  3IQ2 A;  4AZ6 A;  3T47 A;  1E2U A;  3HPC X;  2YL6 A;  2CSK A;  1TQW A;  2RAJ A;  4H6H A;  4JLC A;  2I4K A;  2F1B A;  4NSW A;  4JWD A;  3VKH A;  4EZP A;  4M0M A;  1HXK A;  3T4A G;  2GF4 A;  3I01 A;  2V14 A;  3VEB A;  2X3W A;  2F18 A;  3Q84 A;  2NCZ A;  4DYL A;  2F7O A;  2YIV X;  2GA9 D;  3DDG A;  1I4D A;  2DYB A;  1PS3 A;  1QWN A;  2OBL A;  1TQS A;  3O3M B;  3D2F A;  3RPM A;  4KIK A;  2FYV A;  2YI9 A;  3CAZ A;  4R5I A;  3RV0 A;  4EZT A;  2EX3 B;  3M3W A;  3T48 A;  4JL9 A;  3KDR A;  3OWG A;  3D2E A;  3D4Y A;  3HAH A;  4UDY X;  1QX1 A;  3BUP A;  1QWU A;  2OO2 A;  3BVT A;  3BUB A;  4AKV A;  2ELB A;  4JNF A;  2V0O A;  2YIA A;  3O3O B;  3B51 X;  1KMD A;  4DCN C;  1YWM A;  4PO2 A;  1SUF A;  3T49 A;  3L3P A;  1U00 A;  4NPH A;  3D52 A;  3D51 A;  2F1A A;  1SU8 A;  4R5K A;  2YI8 A;  2YL5 A;  4H8S A;  3B52 X;  3LLL A;  2RAK A;  3DX3 A;  1GNL A;  3DPP A;  1SU7 A;  2Q12 A;  3LVT A;  2EFK A;  2Z0N A;  1X04 A;  2Z0O A;  3P0C A;  3ERC C;  3FOG A;  4BNE A;  3A98 A;  1OCS A;  4F01 A;  3DX1 A;  3I2W A;  2MI7 A;  1ZWW A;  2REA A;  4EZN A;  4FZP A;  1O7D C;  3CZS A;  5C5B A;  3L3O M;  3SOG A; 
#chains in the Genus database with same CATH homology
 1I4D A;  2DYB A;  4ON3 A;  1O7K A;  2X3V A;  2CZO A;  2IWL X;  3Q0K A;  4I1Q A;  3OK8 A;  2X3X A;  3CAZ A;  4WPC A;  1KQ6 A;  3SYV A;  3M3W A;  2ETT A;  2WWE A;  1WDZ A;  4IKB B;  4IKB A;  4PQO A;  4P2J A;  2V6V A;  3HPB A;  2Z0V A;  1H6H A;  2RAI A;  3HAH A;  4AZ9 A;  4AVM A;  4AKV A;  2ELB A;  4BGJ A;  2V0O A;  3LUI A;  1KMD A;  4FZS A;  4DCN C;  1GD5 A;  1Y2O A;  4NQI A;  3QNI A;  2C08 A;  4PQP A;  4HAS A;  1I49 A;  1X03 A;  2YPS A;  2AR5 A;  3PLT A;  3ABH A;  4H8S A;  1XTE A;  3LLL A;  1OCU A;  4OXW A;  2RAK A;  2YKT A;  1I4L A;  3ACO A;  2Q12 A;  2EFK A;  4ATM A;  2EFL A;  2Z0N A;  1X04 A;  2Z0O A;  3QE6 A;  2L73 A;  3P0C A;  3IQ2 A;  3G9G A;  1URU A;  2FIC A;  4PZG A;  1I4T A;  3HPC X;  2D1L A;  2CSK A;  3FOG A;  4IKD A;  2RAJ A;  4BNE A;  3DYT A;  1OCS A;  4P2I A;  2D4C A;  2I4K A;  4NSW A;  3I2W A;  2RED A;  1ZWW A;  1XTN A;  2Q13 A;  3HAI A;  2V14 A;  2X3W A;  2REA A;  3HAJ A;  3Q84 A;  5C5B B;  3QWE A;  5C5B A;  3SOG A;  4DYL A;  4WPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...